4F15B

Molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
219
structure length
208
Chain Sequence
VKLQESGAVVQPGGSLRLSCAASGFTGSDYDMSWIRQAPGKGLEWVSGILGGSERSYYRDSVKGRSTISRDNSRKTLYLEMNSLRAEDTAVYYCARHSWGGWGQGTTVTVSSASTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSSVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of infectivity of 2009 pandemic H1N1 influenza A viruses
rcsb
molecule keywords Hemagglutinin
molecule tags Immune system
source organism Influenza a virus
total genus 32
structure length 208
sequence length 219
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2012-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f15B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f15B02
2A1WL 4TSAH 2NY4D 5F1NA 4HZLA 4M02A 2B1HH 1T0NA 4Q7DA 1IT9H 4Z77B 2Q8BH 1Y0LA 1U91A 2BNQE 3QA3A 5I1LA 4G43B 3F8UB 3MYJA 1IC5L 2XWBA 4U1MA 5DFTA 4RRPG 2FHCA 4JHBA 4ELMA 5C09D 1RVFH 3QCVL 5DD0L 1W0WA 4UT6L 5F7HA 3JBG7 5DRZA 2DQJH 1HINL 2NY5L 3WYRA 2CLRB 1L4IA 4A6YH 3JV4B 3WNOA 2Q86B 3CD4A 1MFNA 3ARRA 3DV6A 5INCA 2OSLB 2BVTA 4WW1A 2F19L 4DQOH 3B6SA 1LEIA 5FK9B 1D7FA 4XCYA 2GK0B 1U8PB 2ZCHL 5LXGH 5EO0A 3HAEG 1I85C 1TJHH 4D9LH 3HG1B 3DECA 4YHIA 2M1KA 2OR9L 1KJMA 1WWCA 3MRDA 1U2HA 4X6BA 5C0BA 2AQ1A 3BPLC 4PS4H 2AERT 4KMTH 2HH0L 4JFXB 1QQDB 2MFNA 4D0BB 1A6WL 4IRJA 1Z9LA 2QKIB 4OZ4B 5TE4H 1IGYB 4QRPA 5T1DL 3WLBA 4EIGB 4G6KL 4RMTA 4JPVH 1N3NB 5T33L 4XPAL 3VFUB 3D9AH 2DKSA 4WO4C 5I74B 1AO7B 1N4XL 1N6QH 2OMNA 2Y06L 2AXJA 3BD4A 1GOHA 4YHLL 3T0EB 3EFDL 2VN4A 4LQ1A 1P7KB 4WJ5B 1SJEB 5A2JH 1I75A 5JIPA 4JFEE 5DJ0B 5GS1C 3HCVA 4XVSL 1NSNH 3NCJL 5I1CH 5ILTL 3U30C 1OAYL 4CNIA 4JO3H 1PEZA 1FL5B 1I8KA 2NR6D 2NNAA 3MGOA 4Q0XH 2NY0B 2Q8AL 1U8KA 2E5EA 2V7HB 1S7VA 1N5AA 2J88H 3ISWA 1KJ3L 1YN7A 3UP1A 1NAKH 4U1JB 3CMGA 1HXYA 4PREB 5JQ6H 3CVHL 4Z76A 1BECA 2GUOB 2Z93B 1DUZB 1ZA6A 1LO4H 4JFQB 2DQCH 1PX3A 3TO2B 3TT3H 3RWCA 3WFEH 1FL6A 4I0PB 2J5LB 4JLRB 4MXQD 4WI2A 5JO5A 3BWAA 2DD8H 4DUVA 1FO0L 2X10A 4UV7H 5B39G 1MHCA 3VU2A 3IU4H 4BSWA 3BGMB 4ZOAA 4QHLA 4QRRB 1T22A 5HDQH 4LSUL 4ZPTB 4ODTL 4UZGA 3ZDZE 5IWLC 4AEHH 4PJIE 2YUZA 4H0GA 3I6LE 3OKLA 5JW4R 1MAMH 3BPCB 4MNHA 1UCBH 1J0ZA 1RURL 3LS5H 3CFBA 4X7SL 4Q9QL 4QRSA 5SWZD 5BO1H 2GKIA 4M00A 1KCLA 3MLYL 1TXKA 1EBPA 1JNHB 3VFNA 4WTWA 1GC1L 2VLKA 4OZHA 2NY6C 4M8QA 3QDGA 1PY9A 5DMGC 1QNZH 1AO7D 3BW9B 4JHZA 1OAKL 1EFXB 1RIUL 3U9PH 3CDGA 1ES0B 4DKEL 3RVVD 3ULVC 5BRZE 1AGBA 4IS6A 4FNLH 5IT2L 4XAWL 2NXZC 4YK4B 5E6IC 4QF1B 1KCVL 2P45B 3C87A 1L7TL 2V2WB 4XBPB 4EUPH 2HVKA 2BHZA 3HRZA 3U6RA 4EI5B 1G9EA 5KG9A 4KK9C 4GRWF 4FFZL 4OZIE 2PYEB 1ROWA 4OLXH 3QIUD 4YHNB 4GG6B 5EUOB 2NY0D 3STLA 2X5PA 2XN9E 3LSOA 4KU1A 5ALBH 2GTWA 1CR9L 4EN3B 2OMBA 4HIEB 3PGFH 2EH7H 1HHJA 4MQXC 3BYYA 4KPHL 3CSBA 3HR6A 2GI7A 1OARL 1NUNB 1U8QB 5HSFA 3C8HA 4X98A 1V5JA 1V7NL 1QP1A 3FO2A 3W5MA 3WCYA 1NCBL 2X1PA 3TLRA 5D9SB 5E24E 1YJDC 3QA3B 5I1LB 1TTFA 4L8CB 4XPHL 1UB6B 4U1MB 4UIMB 3KYNA 3C5ZC 1K9TA 4HWBA 4ZSOB 4JY5H 2CH8A 1IBGH 4PJDA 5F70A 3RQ3A 3IDYB 2BY1A 5D7IF 5DRZB 3VRLE 3QG7H 4QRRD 2PTVA 4QNPE 2VLLA 1GIGH 3KYOA 4OFYD 4XPFH 3KWWB 4NBZB 3DV6B 4KI5E 5INCB 1CGTA 1VEMA 4NUGH 4JFYB 1WV7T 4PV8B 4XPBL 1OCWH 2V9TA 5DQDL 2DI8A 5I8KH 3FQUB 4YHIB 5DEGA 3DYMA 3DX6A 5JW4Q 1KJMB 1AQKH 1CXFA 1UWEH 3MJ9H 1BF2A 4W6XB 5C0BB 4ZNEA 3K8LA 1EFXD 1R5VB 1CDBA 1WAAF 2R4RH 3LV3A 3L3IB 5IVXB 3HNVL 1EAPA 2BXYA 1Z2KA 5TF1H 4DZBA 3IFPA 2HWZH 1CFTA 4OFIA 5CFHA 1A5FH 3X13A 1NC2A 2IGFL 2XKNA 4NJAH 4QOKD 2NY1B 4DKFH 5AAWA 2EDTA 3ESUF 1AGCB 2HFEA 1IKNC 1SBSL 4AMKH 1FL3A 2CKNA 1NMAL 3F6IA 1OLLA 1R5WA 2FJGA 4WNQA 4XWOD 4LLUA 2Q3ZA 3IKCB 4OCXL 4KK5D 1W2KT 3DROA 1A9EA 4MNGB 3HCVB 5TDNA 3M17A 1OD7A 1T0PB 3STZA 3BX7C 2A0LC 3EAKA 1J1XL 5FUOL 4DCQB 3CFDA 5D96B 1V3JA 3QHFL 1UM5L 3TA3C 4F37K 1NMBH 3MGOB 1F3DJ 4Z0XA 1OWRM 5AYUH 4P4RA 2BMKB 1XF1A 1S7VB 4MWFB 4OUUB 4LPWA 1AY1H 1LNUB 5C0IB 1YN7B 2QSCL 2WBJB 1KBGL 3RNQA 2H2SC 4AIOA 3V6FA 1T83C 2O5ZH 1MSPA 1LD9B 4X9HA 4S2SB 1KJVA 2EDOA 1ZA6B 3SQOL 3DXAB 4JGMA 3ZTNH 4TUOA 5JO5B 4UNVA 3U2SB 4P5TA 3BWAB 2NTSP 4EDXA 3GMPB 2BNUA 1XF2A 2J12B 3PHQB 3KG5A 1ZLSL 4NO0D 4BSWB 1Y6KR 3DUSA 3FB6B 4X5XA 1K6QL 5FYKH 4NIKB 1BOYA 1P7QB 3QI9C 1T22B 1CBVL 4IMLB 3SGDI 3NCBB 5J12C 3MXVL 3OKLB 4U6XA 3CDYA 4Y19D 3D69A 4MNHB 5EBLB 2C7UA 15C8L 3CFBB 3U9UA 4KTEL 3S34H 4QRSB 5HHPA 4P9ML 1WTGT 2J8UE 3WIHL 5KSVA 4NBYB 3VFNB 3LEYH 2ZUUA 4L9DA 5F3HB 2NY1D 4NQEE 4WW2C 1M05A 3MCKA 5T1MA 1KCUH 5M94B 2F5AL 3HMWL 3IDGB 4ODUB 3P0YH 4PJAA 2VLRE 3CDGB 5L2KD 1X6NA 3BP4A 2VDQH 2UUDK 4PJCE 2NYYD 4IS6B 5EUKB 3TO4C 3CNKA 2IANB 2O5YH 4LASL 3QIWC 2HT4C 1IQWL 5BS0D 1DBAH 4UV4L 2EDRA 4FXGB 5GPRA 3ZKXC 1T7WA 1CIDA 3TWCL 1PSKH 3U6RB 1U3JA 5KG9B 5C7XL 5F97E 3CK0H 1LDSA 1EXUA 3GMLA 1A6AA 2P8MA 4Q2ZA 5C6TH 4NC1C 1EVUA 1FNAA 5I8OL 3BVNB 1A22B 4OB5H 2Q6WB 4YXHH 3LSOB 2DLIA 2HKHH 3LKOA 2GTWB 5D1XD 3RFZC 2Z31A 3CVHB 2XZCH 4MMXC 2EDLA 1HHJB 4YEEA 5F9WC 4NNYB 2WBJD 4R9HA 3Q6GH 4JFFE 5E2VH 4PJEB 3S37H 2Z35B 4K94L 4DFHA 4ZAKA 4XGZA 1FO0B 3MRLB 4PTUA 3U4BH 4PY7A 1U0QA 5CD3B 1DVFB 1HQ4B 3PWPD 3BQUC 4JFZH 3OKYA 4GAYB 3DXAD 4GKZB 2ILLA 1KG0B 4KQ4L 4NN7C 5J1AA 1RZKC 1YYML 3I3BA 5I30H 2D7NA 3X12A 2AS5M 4BK5A 1QA9A 3GDBA 3VFRA 1ZXQA 3S96B 5C71A 1P7QD 3ZYJA 2ZG1A 5LJYH 3DGCR 5DO2D 1FNSL 1NCDH 2FECL 2IAMD 3EYFB 2A9MH 2OXGA 3UTSD 3G5XB 5FHBL 3VWJA 5DC0A 5FHAL 4W4NA 5J89A 5KS9E 3QCUL 3DX6B 3KPTA 2BVEA 4UQ2A 1G6RH 3FO1B 3MFFA 3ZT7A 1QFPA 1FAIL 1LO5B 1PKQE 1DBJH 4UQ3A 4X4ME 5CP3H 3SO3B 1NCCL 5MEPB 4YXLL 3EYSH 4U1NB 1ZT4A 4P2CG 4ODXA 1K8IB 3WHE0 3C08L 4J4PA 3RAJH 2IAND 4Q97A 1CFTB 4KTDL 2FIKA 2F15A 4XT1C 4AG4L 4BUGA 1YEKH 2XKNB 1CGSL 1KB5A 5LWYL 1W8NA 4APQB 2HFEB 1MI5A 4GBXA 3N1MC 2X05A 4QWWD 4R3SA 3VXTA 4JQXC 3H3PH 5EA0L 4LLWB 2GQHA 4OCRH 3EYQD 4LLUB 5I0ZA 2AV7A 4X6DF 2VABA 1QO3A 3UBXG 1A9EB 1SVZA 4CVWA 4V1DD 4LU5H 2J4WH 1IL1A 3LKQA 5CJXC 2R23A 5TDNB 5KBNC 1QBLL 3QUYB 1NJ9A 2HFFA 4I77L 4FFYL 2OBGA 3LB6D 5IBTL 3EFFB 5I8EB 3FQNA 3EOYG 1FC1A 1WT5A 3H7LA 5JDJA 2IFFH 1FVDA 1T5WB 4OZGE 4MQTB 5EU7C 2C3WA 4HFUH 1E6OL 4X6CB 3SE3C 3V6FB 4LF3B 1OAUL 4L8BB 5I76B 1S7QA 4RX4A 1TLKA 4HXAH 1EH9A 3WJLC 4CMMA 2WW8A 4L9LC 1S7WB 5F7YC 2BY2A 4TUOB 2DTML 2JCCF 1OTSC 2E27L 1F42A 1RPQA 2I07B 2Y6SD 1LE5B 1NAMA 1HILB 2BNUB 4HUVB 3CSYB 2IADA 4WFHD 4NRYB 2DQIL 1OP5K 4GQPH 2YOCA 3WUWA 4NCC1 1PEWA 1UKQA 2ATPB 3NFNB 3F7VB 3D69B 5C08D 3U9UB 4KH2A 2ITCB 4FQXA 1SJXA 5KSVB 4N8CL 2X4RB 3V5HB 3QXTA 4ODBD 3MA9L 3HI1A 4LAQL 4WWKA 3QIBD 4K3EH 4NNPH 1M05B 4U6VH 3MCKB 4APQD 1MIMH 2VYRE 3HE6D 2IPTH 1XT5A 4NQSA 5FXCH 4AJ0A 1J7VR 3OGCB 4LKXB 1RZJH 3QT2A 3SKOA 3ARTA 4BSVB 1V7MH 4FTVA 4BH8B 4MNQA 2NMSA 3BP4B 2WUCH 2C5DC 4N9GB 3VG0H 3FO9B 1MJUH 2R2EA 2YA1A 2DDQL 3HS0A 3LEXB 4K23L 5KZCB 1E6JH 2Z9TA 3L3GA 2P7TA 3IS1X 3QUYD 2E7BA 1KTDA 3WXVH 5FM8A 4ONHA 2DI7A 4XP4L 1EXUB 3GMLB 4O58L 2E8ZA 1TMCB 2P8MB 4W6WB 1S7TB 1LEGA 4JM2D 1EA9C 3T3MF 2SEBA 1MRCH 1YYLH 35C8H 1KLUA 3SBWC 2RIKA 4JDZA 2ERJB 3WDIA 4WY7H 1IRAY 1R3IL 4LCYB 4HS6B 4AM0A 5I1GH 4CVZB 2C3XA 2QTEA 3G5YA 4MA8H 4Z7QF 1EGJH 4ZAKB 1MCIA 3FOLB 3QEUB 4PJBB 1JIBA 1XR9B 4KRPB 4LCWA 4UINH 3A6OA 5D8JH 4YGAB 5I1HL 4J3WA 4ZOCA 1A14H 2AW2A 4OZFH 2AXGB 5I1IL 4H8WL 4ZS6D 2AJYL 2N4IA 4R0LA 4C56B 1QA9B 3QULA 5FDWA 3BKYH 3UX9B 4BZ1H 3RGHA 2CKBA 2ZNWA 2BVPA 2EIZB 1T1YB 2YBRA 4KI1A 2PXYC 2AJZB 2WUBL 3P9WB 4XPGH 2J1KA 3OF6A 3L5IA 3CCHA 3HUJB 1CDJA 2XY1A 1A6VL 1G9MH 3OZ9H 3QQ9C 4FZEL 3VWJB 4LSSH 3RGVD 2PW1B 2ITDB 3D3VD 5IMOA 4H25A 4QXTB 5E00A 3OPZH 4U1GC 1F4WL 5F6IB 1K5NB 1G7PB 3QQ4B 4UQ2B 4F7TA 1HZHL 5B8CC 1I3UA 4H1LH 5ELIA 5DXWA 1IAIM 4IMKA 3EW3B 4OM0L 1ED3A 4Y5VC 3S3JA 3EOBB 3U4AA 4QYOB 5J9PA 1MCDA 5F9JA 3MRPA 3EO9L 1KULA 3EZ8A 1LP9E 2Z92B 4E0RA 1KB5B 4JPWL 4ONGL 1ZLVK 4P0DA 1YEEH 1MI5B 2PETA 3VGHA 4MB3A 4GBXB 2GT9A 2AJVL 3ILQD 4JZNA 3LQZB 1GSMA 1BQHA 2W1NA 1YEIH 1J1OL 1DLFL 4HKXB 3H6JA 5IHZA 1AH1A 4FG6D 4N9OB 2DQGH 3C60C 1B0WA 4RDQG 2NCMA 4Y4KD 1OGTA 4R97C 1IL1B 1BD2A 3WHXA 1ZWIA 4RGNC 4LAJH 1I1AA 5DK2A 2DTSA 4KRPD 2QQLL 3THMH 5BOPA 4ZTPL 2R39A 2L4OA 5DC9B 4U3HA 5CEXB 1IEAA 3BXNA 4O2FB 1Q1JL 2B0SL 4CN1A 5DFWH 4OGXH 4K8RC 2EYTA 3JWDL 4NRXA 3E6FB 4Y4HC 2W0FA 5FYKU 4PJ7A 3EGSB 1LE9A 5KVDL 3WEXA 1PZ5A 3HNSL 1S7QB 4LSVL 3P11H 1U8OA 3UROR 5C07B 4CMMB 1FVCB 3BHBB 3BT2H 1KLGB 4CJ1A 4HQQH 3ARBD 3E8UL 1N59B 4ESKA 4G8IA 1NAMB 4RZCB 5GQBA 4GW4B 5BOZG 3RX8A 5FO7B 2P8LA 3DO7B 1NMCC 4KHTL 3G9VA 2AV1B 3L5XH 2FLBT 3H2WA 4N0CC 4Z9KB 1J5OH 1UH2A 3WUWB 3QNYB 4Y4FB 5C0CE 1VKXA 4GQ9L 5IEKA 3PNWB 1QRNB 1TITA 3LN4B 4RGMB 5A2LH 4FQXB 3QDJE 1RQ5A 1INEH 2GJ6B 1MIEH 1WBXA 4QHMB 1UZ6F 5I75C 2G60L 1LMKA 3Q48A 3VXQB 1FNGA 1S9WB 1E27A 5J13C 3RPKA 2YD5A 4TSCH 5IV2A 4I0KA 4M6NH 2YD4A 2EH8H 4MNQB 1U58B 4NQDE 3DX9A 1YECL 3QO0B 4AH2A 4QXGH 1NKOA 2AEPH 3QEGH 1I8MA 4EKXA 5JDSB 1LO2H 1UVQB 4U1KA 4PR5B 3I02A 4OLZH 3VGAB 3RVTD 1WK0A 2X70B 1GGYA 4G8GA 1OTTC 4KQ3L 5C3LD 3O2VL 1WWWX 1LEGB 3A6CL 1UA6H 3V4VH 3WO3B 1MJJA 1KLUB 2VAJA 5MERA 5D5MB 3ZHKA 4OBRA 2GIYA 4R8WH 4IJ3B 1CFSA 3VI3F 4YFEA 4QGTA 2AKRA 3ZZ1A 3ZKMD 4LVHB 3JV6A 1YPZA 4GUPB 3ABZA 4F7PA 4LLMA 4RGOH 5KVEL 1G1YA 4FQLH 1BGXH 1KPRB 3RL2B 5DVLA 2ESVB 2W9LA 3QULB 1ORQA 1QYGH 3EJYC 5E8NB 3QEQB 1TENA 2OL3A 4YDIL 2VB5A 5FGRA 3F7YB 4Y4FD 4YHOL 5I1KL 3MXWL 1U3ZA 1SY6A 2UY7A 3SCMC 1JYWA 4PG9B 1QRND 4FFWC 3WFHA 3ZKSD 1IEHA 4U1LA 2ZOKA 4PJ8B 5DD5L 4Z7UE 1KPUA 1LK3H 1WZ1H 3LKNA 4H25B 2AEWA 2WWMD 4K71C 1R3KA 2HLAB 4GKSB 5I17B 3D6GA 2C4XA 4B53A 4S11A 1VB9A 4RRPA 5HGBB 4R4BA 1PLGH 5GRJL 4EVNA 1AGEA 4FOMA 4YFDB 5JIKA 4R6UA 3GM8A 2FR4B 2XA8L 1Q94A 1YEDB 3EYVB 5JMOC 2X4QB 3CUPB 3MRPB 3ES6A 4GG6F 1OSPL 2XNAA 3ULSB 4I2XB 3NACL 1FG2B 1D6EB 3ARFC 4GXVL 1YN6A 2G5RA 4JAMB 5I6XC 4KZEL 3MA7A 2VXQL 2GT9B 3HAEA 3AREC 4OGAD 2EKSA 1MCWW 3WIFA 5IB3B 2DLFH 1EK3A 3W5NA 1MQ8A 1BQHB 3JUYA 3U0TA 4M7JH 4WI5A 5LKNA 1QTYT 4KK8C 1JZ3A 4ERSL 1IGFL 4U1IA 3I6GB 2EDDA 1TNMA 4HJJH 2FX7H 1S78D 1C5BL 4NM8L 5D70L 4WI3A 5MHSD 3WE6B 1BD2B 2FNBA 5HHQB 5EIIB 3MV7B 3CPLA 4TVPE 3PQYE 1H0DB 2JJTA 5EU4A 4PLOB 2Y5TA 4LKCA 5C2BH 3HMXL 4OIIH 5H35A 3HR5A 4PJ9A 3FT4B 3KGRA 1A4JA 1VFBA 2FEDC 4XZUB 4ACPA 5F89B 1SEQL 2JE8A 5DRNA 4P2RB 1JUFB 5GSVA 4YR6A 4OFYA 3BZ4A 2YD9A 4UTBH 4PJ7B 3S7GA 2XZZA 5MENE 3ARPA 4JG1H 3TPUA 5FYJE 3NBNA 2V5SA 3ORJA 2A1WH 2KZWA 3HE7A 2DM3A 2ZP0T 4HC1L 1BQLL 5ICXA 1J11A 3WNKA 1CDIA 2LU4A 5BXFA 3W9EA 5D2LE 1D9KD 3BUYA 4QT5B 1IC5H 3L5HA 1KN2L 3F62A 5C0AA 5DD3L 3T65A 2EC9T 1I1YA 1KCSL 3QCVH 4U7MA 5DD0H 4UT6H 5F6HJ 5IVXF 4PLKD 5I71B 5ADOL 1HINH 4NKQB 3TT1L 2NY5H 3EO1B 4Z7OF 1CI5A 3HFML 4M6ML 3VGDA 2F19H 2DQFB 4Y7MA 1VADA 2GY5A 3EDJA 5ECJE 3RWJB 3VCLA 3QJFB 3LY6A 2ZCHH 1HXMA 3ULUL 3KYKL 4MA3A 3H8NA 1RUML 2NZ9C 1QFWL 5BZWB 3O6FD 5JHDA 4Y0GA 3OKNA 3KLAA 4TUJA 2HH0H 5JXEA 3B9EA 4Q6IC 1X9QA 5FO9B 4L3EE 1YZZA 4AH2B 3PV7A 4JFHE 4MSWA 2DJUA 3O2WL 4YHML 3ZYZA 1RUKL 4G6KH 1I8MB 1FH5L 3MV7D 5T33H 2EDBA 3PHSA 1SVCP 3KPRE 4U1KB 2ICEA 4HIIA 1ZHKB 3PL6D 3WN5C 4OCYH 5IVOA 3QAZC 1N4XH 4JHAL 4YHLH 3EFDH 2JB6B 4U05A 2EE3A 1F97A 2GK2A 2NY3D 3L9RA 5C0FA 2XZAL 2N7AA 3PWLA 4MDIB 5F1SA 4ZDHA 1MJJB 1C16B 4Q9RL 5MERB 4P2RD 1FLTX 4XVSH 1CD1B 4OKVB 4JHWL 2RGSA 4Y16D 5ILTH 2APVA 1OAYH 3JV6B 4HT1L 3VXMA 3QXAB 3W0WA 4OLVL 3TM6A 4OV5A 4P2QE 4OF5A 2FX8L 3RVUC 2WWKT 3DUHA 4F15B 5D6DC 5GS0L 1BOGA 1NDMA 2IH1A 3QUZC 3WJJC 1YQVL 1ORQB 3M07A 1OP9A 1VA9A 2OM5A 3ARGD 2X2YA 12E8L 1S9YA 2HT3D 3CVHH 1V8HA 1HKFA 1ORSB 1CE1H 4P3DB 3GUTA 5E70A 1II4E 3WLWD 2MTPA 2I60L 1A6ZA 3UTPD 5IHUH 1FO0H 2QHRL 3RWDA 3LKNB 4P23C 5F7WC 5L2KA 4P2OA 2G75B 4Y5YC 1TVHA 4LSUH 4ODTH 5E7FA 9CGTA 4P46C 5KSAB 3OAUL 4R4BB 4R7NB 2YZ1A 4EVNB 4XNYH 1KGCE 1AGEB 4X7SH 1C8PA 3QSKB 1P2CA 5CBEA 5BS0A 1WZKA 3DO3A 3P9MB 5B4MD 4M4RA 3MLYH 4NFDA 4P5KA 5TQ2L 4XC3L 1EJOL 1GC1H 1T21A 3PDGA 2W0KA 5JR1H 4OQTA 3LH2H 5JXAH 1DL7L 1VFAA 3GSQA 1UJ3C 1MFBL 3MA7B 3BDBA 2VR4A 1OAKH 1RIUH 3VE0A 1AI1L 2EKSB 2GAZB 3C8KB 1Q8MA 1BFTA 3U0TB 4NCDA 4PJEF 4DKEH 3ARXA 3BZFB 5GS2D 3ZKQD 5A3IC 5IT2H 1NBZA 2MCG1 4M61A 4XAWH 5SWSE 5TF0A 1H3TA 5JORA 1R5IB 3I6LD 1JZ2A 1ZANL 4LHUB 2NW3A 5AYQA 4LGSB 3WFZA 5KAQF 3S88L 3BUTA 5HYJE 5GRZA 4P4KA 1DCLA 1BX2A 4FFZH 4S1SL 4ODWA 4LKCB 4S1DD 4PJDF 5H35B 1TZIA 2EDWA 1BWMA 1A4JB 1VFBB 3L7EA 4FQPA 2JJSA 1CR9H 1TTUA 1XZ0B 2CGRL 3FONB 3IETB 5DRNB 4YO0B 5FECA 5JA8B 2EDXA 4YR6B 1LK2A 1DQML 2CLVB 2IAMA 1JI2A 1OARH 4DN3L 4D0CB 5BRZD 4K7PL 1V7NH 5DHYB 4KDTC 1NCAL 2H2PC 3CSGA 4WIQA 4I5BA 1NCBH 2FO4B 5ICXB 2C1PB 4JO4H 3DOSA 3AM8C 4DEPB 1N5YL 3RTQB 2BERA 1QLEL 3W9EB 2KPNA 1U9KA 3O9WB 4XPHH 3BP6B 5DJDA 3V7MA 1MNUL 3L3OA 3T65B 1GJIA 4XCNB 1J0HA 4PGEA 3RZCB 3RY4A 4JB9L 2XN9D 2ZUWA 4OD2A 4LLVA 3RIFK 4N68A 3P4OA 5JPMB 3EJJX 5KSAD 1BVKB 5GIRA 1ZLUH 5DGRA 2ARJA 1I1RA 3EO0B 3KXFB 2XWTA 3AU1A 1RD6A 1XGYL 3OBAA 1U3HD 3QUXA 4IRSC 4L1HA 4OIBA 1UJTA 4YNYB 1P9MA 1MHHB 3HI5L 4XPBH 5DQDH 4LCCC 4WVRA 1U8IB 1TTGA 3OJDB 5JHDB 3OKNB 4ZNCD 2YK1L 2P1YA 4TUJB 4Y5XB 2QQNL 3EDFA 4V1DA 3HNVH 1NFDA 5MEOA 1S5HA 5D1ZB 5TJWK 4X6FB 5C9JB 2Y1VA 3I75B 4X0KA 3RVWC 1FLRL 3HHRB 4MSWB 2X9XA 3AB0C 2IGFH 4KI5D 3IDUA 3DYPA 1WAAE 1JGLL 2E9BA 2ICEB 2Z4QA 3GSXA 2ADJB 4HIIB 1OT2A 5J1TC 1G7MA 1T89A 1SBSH 3V2AR 5LGJA 1BFVL 2H32B 4PJFB 5CGTA 2AK4E 4X6CF 1T1XB 1TCRA 1NMAH 3Q1SL 3L9RB 1RZFL 2NY2C 4ZDHB 1WC7A 2ZOLA 2PYFB 4M43L 3BEVA 3VD5A 4EBQL 2MNUA 4FQHA 2MWCA 4WV1A 2D4FA 4X4YB 3PJSB 5B3JF 1FFNB 1J1XH 3E0GA 3VXMB 5HGDA 5FUOH 3OG4B 4LK4A 1IMHC 3VJ6B 3KPSE 3QHFH 1UM5H 3FKUS 3RTQD 3CFKA 5SX5K 5J7CC 3TN0A 3O9WD 1T5XA 3ULVL 3UTTB 5GGQH 4G6FD 4CUCA 5F7LB 1EVTC 3C6SB 2QSCH 4HX1A 3RVXD 3SDDC 3ZLQC 1KBGH 5C08A 4OF8A 2IFGA 3REWA 5DURD 5EPMA 4PB0L 3RU8L 5C0JA 3WV0A 4OBSA 1LDPL 4GRMA 3R4DA 3CH1A 5DUML 3C5SA 3QFJB 3SQOH 4PRBA 4JANA 1RJLA 2CRMA 3QIBA 5IQ9A 4K9EC 3HE6A 3QNXA 5DI8A 1F5WA 5IEHA 2YXFA 1ZLSH 5GGRY 1JL8A 3JVGC 3QXUA 4UB0H 1JWSA 1K6QH 3RZWA 5MEQA 1XGPA 1TVHB 1CBVH 2VNCA 5D7LE 4PRHB 4MQSB 4R2GB 5D71L 3MXVH 4XXDB 1X4YA 4H26A 15C8H 1AP2A 5EU6B 4KTEH 4PRPE 3QEHA 4YXKL 3RX5A 2OTWA 1H3UA 4P9MH 4MA7L 1YJDL 3WIHH 5HY9B 5A2IH 3DUUB 1DFBL 2CRYA 4JDTL 3IJSA 1VFAB 5CD5C 5H2BB 5C0DB 1RMFL 2F5AH 3HMWH 1QR4A 4DTGL 1MWAA 3TVMD 5GRYA 5ENWB 2HMID 1K4DB 3QHZL 1XGQB 4PJBF 1CLZL 1NBZB 4M61B 5HDOA 1T7XA 4ZPVA 3ESVF 3QDAA 4LASH 1IQWH 4UV4H 1L6ZA 1I3RB 2JB5L 3TWCH 5DJCB 2YD8A 5C7XH 1BX2B 1MCJA 5EIQA 5ICZB 3CU1A 3W39A 4Z7VE 5E6IA 5IF0A 1MCRA 3QP3A 2YPLB 2HG5A 5I8OH 4NQED 1QBML 1J87A 4JZOA 3UTTD 5FYKE 2EE9A 4X6EB 4WDIA 1NC4A 4WU7A 3HUJF 1LK2B 1PQZA 2H8PB 5D2NC 3O4LA 4L4TE 2FZ3A 1NUFA 4K94H 3MLRL 4QRTA 5IESL 4KKCC 2PCPA 4I5BB 3RGVA 5LAXA 3BZEA 1JPGB 3QFJD 2DM2A 2E7MA 1OY3B 2OI9C 4Y89A 4KQ4H 5KOVC 1KENL 4OM1H 1YYMH 1EV2E 3L3OB 3OQ3B 4PGEB 3B9KC 4HFWB 2XTJC 1VFUA 5FGCE 3F7PC 1FNSH 1MF2L 4PRHD 1IAKA 4JFDA 5GGRA 5K9OB 4L4VE 2ARJB 3C5ZA 5EU6D 2XWTB 3AU1B 4P3WA 4JFFD 3OXSA 5FHBH 3S3PA 4DVRL 3KLSA 4B7IA 5EB9A 3BN9D 2G9HB 3QCUH 3BPNC 3H9SA 1FDLL 3FTGA 2F53A 4JVUA 4MD4A 1IM9D 3GIZL 3F58L 4XTRD 4Y4KA 3OXRA 1FAIH 4M5ZL 3ARZA 3O4OC 5I2IB 1F11A 4YXLH 1NCCH 4YWGH 1NFDB 1U8NB 3C08H 4KTDH 5ERWA 3VW3L 3IAQA 3BPLB 3QFDA 4AG4H 1LILA 4OIAA 1TVBA 2O61A 1CGSH 1DQTA 2XYCA 5LWYH 2JIXB 4NZJA 1L7IH 3JWOC 1FFOA 3BP5B 1YY8A 2VO5A 2P5WA 5DRWB 2YPLD 4LOUD 5EA0H 2L7JA 4IRJC 1WC7B 4BFGA 2GJJA 3BEVB 4WO4B 2FLRT 4FQHB 3QXWA 3VXRB 4IDJH 4HPOL 3OTTA 2IQAA 4WV1B 3NGBC 2AP2A 4KGLA 5HI4C 4WI9A 1QBLH 4ODSL 4U0RB 2ORBL 4MJ2A 2A6JA 4I77H 4FFYH 3IDNB 4PUBL 5IBTH 4DKDC 4FA8A 4N1CA 4X6DE 5GS1B 2ZKHL 5E8OA 3CFKB 4NQXA 3GBML 3ZSSA 3O8XA 3TN0B 1EEUA 4HS8L 3U30B 5IIEA 5GSRA 2EYRA 3VXPB 3MUGB 3LPGA 4KJQC 1I8IA 4UMGA 1CL7H 2OXHA 4Z78B 5T1LA 4NKDB 3G6AA 2EDKA 1S9KC 4HGWB 1EO7A 1OAUH 2FD6L 1XMWA 2EDEA 3REWB 4E5XB 4GRMB 3T2NL 4HK0A 3WNNA 2DTMH 4RAVA 3X11A 4JANB 1RJLB 5TDOB 2E27H 5IQ9B 3GIVA 4OF3A 1PG7L 2JLLA 3D39D 4HGKC 4JRYA 2FB4L 3BDXA 2DQIH 2XG4A 1KCRH 1AP2B 1H15B 3T3PF 1JTOA 4AENB 2OTWB 3O3BA 2ZUTA 1EZVX 3EHBC 4PY8J 4N8CH 4RQQA 2EXWC 1RZKL 2V2XA 3ZSTA 2FRGP 3MA9H 4RMUA 4LAQH 2R8SL 3TESA 3DVNB 3IJSB 2JIXD 5D5MF 2VR9A 1PVHA 4K7PX 1X5AA 2MMXA 5L7XH 3BKML 1K4CB 5EBWA 5E8PB 2NY6B 1HSAA 4BQ9A 1AJ7L 2APFA 2C4FU 3SDXB 2DDQH 3TYGL 1WITA 1JPFB 1RULL 3VXRD 3PGCB 4K23H 4ZFFA 5GISL 1X3DA 4KZDL 3VFSA 2WMPA 4YDVA 3OAYH 5J4MA 2D9QB 3WIIL 3W39B 4XP4H 1D5MA 2BSSA 2NXZB 4O58H 5E6IB 5SV4A 2F74A 4JO1L 4LSQL 1CG9A 3Q3GB 1RSFA 2V17H 4P5MA 5E2UH 1T4KA 2Y7QA 2W60A 2YRPA 3X3GL 1U92B 3N1GC 5D1QD 2FO1A 1PYWB 4WDIB 3V6OA 1NC4B 2WP3O 1CE6A 4WU7B 1R3IH 4ORGB 1TQCC 4NDMA 4HULB 1WZLA 3OL2A 3T3ME 2VDPL 5KSBE 2G2RA 2X1QA 3BZEB 5DR5L 5I1HH 3FQWB 1UCTA 4NZUL 1RAMA 3HZMA 2VKWA 5FGSA 1X5LA 4Z7QE 5I1IH 1VSCA 3JV5A 1CXLA 3O2DA 2XKSA 3NZHH 3UYPA 3WNPA 1D5BB 3KR3L 1FYTE 1UXSA 3EYUH 4POZC 5C09E 2A83A 4D8PB 5D93B 2IMMA 3B2VL 4J12A 5GZNC 3X3FH 2WUBH 3C6LA 2F9BT 2F8VA 3D87B 3C5ZB 4HCRL 2V2TB 1UXWA 4M3JA 3B8SA 1A6VH 2X4OB 4FZEH 3VXSA 4R7DA 2O5XL 3TBWA 3HI6L 3DX8A 1FZMB 1F4WH 2F53B 1D5XA 1KXVC 4PJHB 3MRQB 2ZPKL 1HZHH 5SX4H 3REVA 2MKLC 2NY6D 3QG6A 4OM0H 4PJ5A 4ZMAT 3BISA 1X7QA 2ADGB 3ZE1F 3OR7A 2ICWJ 3EO9H 4CVXA 4HMDA 2O61B 4UTAL 4JPWH 3CLEL 4ONGH 5F7DA 4HH9A 4H5SA 3G6DL 4KUZL 1NCWL 1RHHA 5DFVD 1OAQL 2ZSVA 3MRHA 4NQVA 4PGJA 2AJVH 3RRQA 2WM0A 5EC1B 1Z5LA 2P5WB 4PJ7F 2F54B 1J1OH 1DLFH 5I1AA 5AG9A 1IM3A 1YEGL 4S1RL 1EEYA 4KK9D 4G7YL 1XF5A 2KBGA 2OS7A 3SGKA 3O3UN 4E9LA 3WDHA 2P5EB 1K2DA 2JF1A 2FJFB 4CMHB 5ACZA 2H3NA 5IBLC 3GJEB 1D9KA 1AGDA 2QQLH 1BVLB 4LPTA 3L3DB 4ZTPH 2G5BB 4NQXB 2Y4SA 3OGOE 5E9DA 1Q1JH 2B0SH 1OPGL 2VIRA 5GSRB 1CYGA 3EYOB 1GXEA 2NW2A 3JWDH 4OQ1A 1R24A 1XIWA 3U4EA 5KVDH 5GS2H 3HNSH 4KJWC 5F21B 3MV01 3BMVA 4LSVH 5EFIA 4AT6A 1G1CA 4TNVK 3MRKA 4YAQB 2FIRT 1F3JB 4RAVB 5TE6L 5DVOA 1QVOA 2UYLB 3E8UH 2BNQA 3GMMA 3OAZK 3HG1E 2NY7L 4JRYB 4KHTH 1CDYA 3I2CL 4U0QB 2ZCKL 3V5DB 3RPIB 1M1SA 1KACB 3SQBA 4GQ9H 4OKDA 5GS3A 4NQCD 3ALPA 5IOPA 2DI9A 3O3BB 3CFEA 1DEEA 4P5TC 2R1XA 3OB0K 1OP3K 1KIUA 3QI9B 2V2XB 1RFDL 1YMMB 4BFEA 5IJVB 3KPMB 3LS4L 2WLZA 5J12B 1YNKL 3GSWA 1SEBB 5E2TL 2G60H 5LCVL 2DWDB 3FJTA 2C3VA 1AO7E 2F54D 1T1WA 3C5JA 3D0LA 3T0EE 1UZ6E 4WW2B 2BVQB 1WBYA 1YECH 4R96B 3IJYA 5HYIA 5CEYB 1NGXA 3S4SG 3GMRA 3QWQB 4G9FB 4ZFFB 4Y1AB 3VFSB 2IG2L 3U0WH 1VGKB 2ICWB 3FFDA 1ZA3A 5TE7L 1S7RA 4HV8A 4LPCA 2EEAA 3TO4B 1BLNA 1D5MB 3GSNL 5IR1A 2F74B 4KQ3H 4O2CB 3O2VH 3A6CH 4P5MB 3U79A 4I18A 1T4KB 5L6YL 1CD9B 1FNLA 1KELH 2Q7YA 2W60B 4UBDD 1FGVL 1IZKA 1VENA 4TVSa 3VD9A 4ONOA 3PWVA 1CE6B 4JFEA 4TUKL 1Q0XL 3TA3D 1INQA 1BHGA 3R0NA 5EBMA 3TH3T 2VDLL 3GBNH 2GCYB 5HGHB 4ZXBD 1HIML 5HHMB 4W4OC 2G2RB 3GHBL 2NXYC 3P4MB 3MV11 5CIPB 5F9WB 5KVEH 3VI3E 1PG7W 4GAJL 2X9WA 1UACL 3E2HC 3OJMB 2Z31C 1JGEA 3U1SL 3KYMB 2W65B 4OLYH 2H1PL 5DJAB 4PP1C 4DKAA 1OTUC 2A83B 1HHHB 3GRWH 4X7TA 4YDIH 1BIIB 2BC4A 4QRRE 3C6LB 4YHOH 5I1KH 2DIJA 2F5BL 3MXWH 3DX7A 3NCCB 3VFWA 1UXWB 2YC1A 2Q20A 4OCWL 3NAAL 3O11A 4OT1H 2GEEA 4R7DB 3QI9D 5DD5H 1YMMD 1HHIA 2PXYA 3ETBF 4YBHA 5T5NF 3VA6A 2OP4L 4K8RL 1BBJA 4DUXA 3W9DB 1MELA 2OJZL 5LGHL 3O45A 4AIZB 3O3EB 1KJ2A 4MDJA 3V8CA 5GGTH 4GS7B 1U8HB 5GRJH 2B4CH 1C12B 1MHEB 2HVJB 4PJ5B 5HD8C 5IG7A 1WBZA 1NBYB 1X7QB 2XA8H 2BVOB 3VWJC 4OFPA 2VUOA 4YDJA 1AC6A 1BAFL 3MYZA 1ADQL 1OSPH 4Y1AD 1U8LB 5CZXC 3ZE2F 3NACH 1EO8L 2X89A 2NLJA 4GXVH 4QOKE 3V52L 3N85L 4KZEH 2WV3A 2VXQH 32C2A 3G5VA 5A16A 4NQVB 2PYEE 3QIWD 2HT4D 1HSBB 1J8HB 2VL5A 5EUOE 4GG6E 1AGFA 5EO9A 1Q9KA 4ERSH 1IGFH 5F8QC 1DQLL 1ZS8A 1VFOA 5CWSA 4J4PC 5BRZA 4IOSD 5IVZB 5GGVH 1NGWA 5ESQB 1C5BH 5TFSH 4NM8H 5D70H 5DHXB 4D0DA 1XCTA 2GJZA 3FFCB 5ACZB 1F90L 5J1SC 4E41D 3NCYP 3HMXH 4YPGB 1D6VL 4OZIA 4P9HC 1KOAA 3ARYA 3CXDL 4M9OA 2Q87A 1I4FB 4Z5RB 1GYAA 3GMOB 5E9DB 3IAGC 2XN9A 4FMFA 1GHFL 5E8EB 4J1UA 5T5FL 1SEQH 2H32H 2IALB 4KJYB 4WUUB 4X9GA 4ZSOE 3BQUD 3OKEA 1W72L 4U6HA 4AT6B 4YBLC 5EFIB 3LDBC 3WBDA 4JDVA 1FCGA 1JHKL 2XICA 1IJ9A 4HC1H 1BQLH 2DL9A 4PRIA 3RBGA 5GGVY 3OR6B 2DB8A 1WT5C 2VITB 3CSPA 3LRSB 4MHHI 5C0GB 1G7HA 1QVOB 2D7MA 1HKLL 2BNQB 5JPNA 1KN2H 3GMMB 1KCSH 1KYOJ 3HZKA 1CICD 2R9HC 1BFSA 5ADOH 3BI9X 2DM4A 3TT1H 5C0BE 3EJZC 3HFMH 3R0MA 2BY0A 4KJPC 4BJLA 3ME0A 4LEXL 3DVGA 1M6OB 4M6MH 4WEBL 5IOPB 5IP4A 1YEHL 3CFEB 2APXA 5IVXE 5MEND 4U3XA 4MLIA 2WIIA 5FYJD 3KYKH 1MOEA 4Z7OE 4F33B 1RUMH 1R3HA 3AS1A 3M8OL 3T04D 2X7LA 1WZMA 3TBYA 2WSKA 1P84J 4RISL 1J8HD 1U2CA 3MROA 4RGMC 3FAXA 3QYCA 4FQXC 5BJTB 1MAKA 1X5YA 3O2WH 4YHMH 5DD1L 4MNGE 4CKVX 1RUKH 3UTZA 1A1NA 3V7AE 4WHTA 3JTSA 2HFTA 1FH5H 4NO3A 4WWKC 1ZA3B 4LL9A 3WS3B 4E42B 2A6IA 1PW3A 1CD0A 1G7LA 4JHAH 5GGTA 1R3LB 4U31A 1ZT1A 5IMKA 5T3XL 3V4PL 3CFCL 4F9PA 4BKLA 3M1BA 1HE7A 2AQ2A 2XZAH 4D9QE 3ULUF 3LKPA 1B3JA 1GGBH 4Q9RH 3CXHK 1UQSA 4HK3N 2D0FA 4WUUD 3VRJA 2CUIA 1PX4A 3EUUA 4JHWH 2DQEL 1INQB 5EBMB 4J3XA 4FABL 4HT1H 5C9KA 5F1IA 1MFDL 4OLVH 5AG8A 3MRRB 5JHLL 2FX8H 5JTWA 4OI7A 1P4BL 5GZOC 3L6FA 4MAYD 3DXAE 4RFOL 4F7MA 3KPRD 1TIUA 5LGKA 2AJ3A 1SQ2N 1FVEB 5L9DL 12E8H 5DD6B 2NTFA 2VWEC 4EUPG 1OTSD 2MCPL 3QQ3A 3FMGL 3VGGA 4BQ8A 1X5ZA 1BEYL 3DX7B 3QJHA 1LWRA 1T3FA 4UDUA 5DK0A 2BOBA 2NX5B 1WSST 4NPYB 4NC2B 4HKBB 5I9QB 1CVSC 2I60H 2D9CA 2PXYB 2R2HB 4P2QD 2QHRH 4R0LC 2HT2D 5DJ6A 3TNMA 4RIRB 1G84A 1AR1D 1HH6A 3ARDA 4A2MA 2A6KB 5IW6B 2XOTA 5E03A 3DJ9A 1KJ2B 3OAUH 3GEWB 1MVFA 4GRWB 2VC2L 3VFMA 2W9DL 4XBEL 1A1OA 3QB7C 4U1GB 1WBZB 5TQ2H 1ODAA 2J8UA 3I85A 4XC3H 3UJJL 2IANE 1EJOH 3GSNB 4U1HA 1QPXA 3MRJA 5B8CB 2NLJB 4NQEA 4QGYA 4Y5VB 1JGDA 1DL7H 4YDKL 1MFBH 5JW4M 1CF8L 4HDIA 1AI1H 1B88A 5DYOB 3SGEI 4W70A 2ZWLT 1OL0A 2VL5B 4LSTL 5CP7B 2VLRA 3FB8A 4IMKC 1O7SA 1ZS8B 3ARFA 1R3JA 3PDDA 4PJCA 1NGWB 1MRDL 4QCIA 1ZANH 3S88H 4LVEA 1XCTB 3NCFB 3UEZA 4F3FA 1MFCL 4PJEE 4S1SH 2E7HA 3L5WA 1P4LA 4R97B 1JV5B 4LPYA 1I7TB 4DN4L 1HYSC 3K1KC 4ZTOL 3KLHC 1BM3L 1CCZA 1BMGA 2CGRH 4LP5A 4GKNB 1E4XI 2A2QT 3RWHB 2NY4C 1G9NC 1DQMH 4DGYL 4DN3H 4K7PH 1HQRA 4U6HB 1I1AC 1NCAH 1A7PL 2Q7NA 5D6CA 3V6ZB 1S3KL 4FQJL 2XIDA 2NX5D 4PRIB 1N5YH 1U6AL 3RNKB 1FIEA 1HCVA 5HYJD 1QLEH 4HLZG 3SGDH 1B0GA 1FSKC 5JPNB 3S8WA 3SDCA 1MNUH 4LCUA 1IM9A 2UWEA 1NFDF 4JB9H 3O3AB 2H26A 3VXOA 2RB8A 1DN2A 1NGYB 4WFHE 4WU5B 4EZMA 3KPOA 1EZVY 4HSQA 3B5HA 4YZFF 8FABA 3GB7B 2JELL 4LLAA 2P42B 1XGYH 1NMCB 1MUJA 4KXZI 4Z0BL 1OB1A 2W0PA 2OZ4L 4PRAA 1KT2A 4RA3A 5KS9A 1I9JH 1OP3H 3MRFB 4NUJB 2W07A 2X7LB 5DA4A 1Q9OB 2YK1H 3TBYB 4HJGA 2QQNH 5FAAA 5I75B 4Z95L 1PKQA 1IARB 2X1WL 4L29B 3ILPA 4X4MA 3IDJB 5J13B 3HN3A 4TNVF 1FLRH 4M48L 5AZ2L 1A1NB 4G6AC 2QADC 5BZDA 1N7ML 4WENB 1JGLH 3R06A 4F7EA 3UPRA 4ZS7L 3C60D 3UTQA 2A6IB 1BFVH 4GRLD 1F58L 3QRFM 1W72B 3Q1SH 4LMQI 1DZBA 2OJEA 5IMKB 1MPAL 1RZFH 4RGND 5B38A 1G9MC 4M43H 2WAHA 1QLRB 1UQSB 3G6JB 4EBQH 3U0PA 2P47B 2KL6A 4RFNB 5HVGB 1CIUA 2NR6C 1A3LL 4X6CE 3GZKA 3SKMB 3C2SA 3FT2A 3MO1B 5DK3A 4U7KA 3MRIB 3PXHA 1JYNA 2AJSH 4K8RD 4Y4HD 1BZ9A 1J1PL 3CX2A 3EOTL 4F7MB 4YHYC 4IHOB 3ULVH 1X5IA 5B3JE 5CSGA 1ZGLB 4K3JH 2OQJB 1P6FA 1OF2B 3QWRD 1LHZA 4LSDA 4LHQB 1KNOA 2NTFB 1JE6A 3GMQB 5KJRL 4MXQC 4HIJB 2EDNA 3RU8H 1A3RL 3ZTJG 2M2DA 1LDPH 1TETL 3QJHB 1JWUB 1M7DA 4X7DC 1U8MB 3TJHD 3VFTA 2X4NA 3H0TA 3T2QA 5A1AA 4N0CD 3HPLA 4XRCA 5LG1A 4I9WD 3KPSD 3UPAA 1RY7B 1WCBB 3QWOA 1VGEL 3K3QA 3SCMB 1CFNA 3DGGA 1OAZL 4K3DL 3SDXF 3MOQA 1NEZG 1IAOA 5D71H 4PJXA 5IW1B 3F7RA 3VXNB 3IDMA 3DLQR 4RAUB 4YXKH 1A21A 3ULVF 1QHPA 5F7KC 1QSFB 4MA7H 1YJDH 3B2UC 4Y2DD 5GGSA 4JGUA 2QV2A 2P43B 1W0VB 5EU5B 1J86A 3MRJB 1DFBH 4JDTH 2AJXL 4MZ2A 2K7PA 4KKAC 3QUKB 1RMFH 3PV6B 1EFQA 3ZYIA 1KYOK 4DTGH 1OGAB 1I3VA 4UDTA 5D1QA 2VE6A 1XEDA 3T0VA 3ROLA 3IGAA 3QHZH 4GMTL 3SO5A 3LRGA 3CC5A 3ARFB 1CLZH 1R3JB 4JY4A 5I6XB 5D7LD 1KB9K 5I15L 4QCIB 4QY8A 1MREL 1OTTD 1T80A 3QIUC 4DJMA 5DQJA 2JB5H 1M71B 4PRPD 1QEWA 1HEZB 2VZVA 5K59F 1IGCL 4PJBE 2BRRL 2I26N 4JPIB 4X9IA 3MZTA 1JP5A 1QBMH 4JCMA 3PIQA 1K85A 4CW1A 4TQEL 1XGRB 3B83A 4GO6B 3RX7A 3QUML 4C56E 4XI5C 1ACZA 2GW5A 5B21A 2XRAL 4Y2OA 3LKSA 2HJLB 2A6DA 3DRTA 1QSEB 2LU3A 3RWFB 3MLRH 5IESH 2JJTC 1EIBA 3KS0J 3PDOA 5HDBF 3QNZB 3EJYD 3JXAA 5T1KB 5L2JA 4PJ9C 2BX5A 3HUJE 1CXIA 1KENH 3QZWG 4FQCL 3L3JA 4PJHF 4R90L 4G8EA 4LCUB 2I9TA 2UWEB 4RMSA 5ALCH 4JO2L 2VLJB 3BH8B 4RMWA 1TZGH 4BQCA 1GZPA 1MF2H 3KPLA 2FYYB 3MRBB 3GMNB 3KPOB 1FFPA 8FABB 3HE7C 1XAUA 5E1AB 5I66A 5DHVA 4ZUVA 3DIFA 3SDAA 3RHWK 1OLZA 1OHQA 4DVRH 1CFBA 1YMHB 5HHNA 2BSRA 1V3MA 4ODVL 3MRNA 4YUEL 4PLJD 2VLME 4PRAB 3NZ8A 1FDLH 4HUXB 3H3KA 5T3XD 2FSEA 1MFEL 1HWHB 4I4WA 2AI0L 4GW5A 5FF6B 1ZHNB 4MQ7A 5I0DA 2ENSA 1CT8A 4RBPK 1OGAD 3GSOB 5TQ0L 3GIZH 3F58H 1CFQB 4HJGB 4M7KL 4M5ZH 2HLFD 1G0DA 4LNRA 4OLEA 3MV9B 1I8LC 3S3SA 3AFLA 3K2UL 4XNUL 4K9EL 2COQA 4DK3A 2Q76B 3VW3H 4O51B 4L4VD 2CJUL 3ARED 2E6PA 1NDGB 3VWKA 3MLSL 5TDPB 3GSVB 1ONQB 1DN0A 1NCNA 4Q6IB 1B4JH 1LP9A 4KK8D 3BE1L 4F7EB 1X44A 2PO6D 2CDEB 2IPKA 3DNKA 4HF5L 2L0DA 3IDXL 3LQAC 3IFLL 2P44B 4MMZC 2B8OT 4KK5C 5I18L 5JXEC 3MOBL 2V7NB 4O2EA 2Y25A 3IXAB 1FZKA 2YUXA 5B38B 2J8HA 3U0PB 3S97C 3QAZB 1YDPA 2YD3A 2A9NL 2FEDD 2AABL 5JNYA 2ORBH 3W82A 1QSED 5CEZL 2DMBA 4PUBH 3MBEA 4L8SA 1MVUB 2Z91B 1BZ9B 5C07E 2ZKHH 4JFOB 3OKKB 5ID0B 5IB1B 1EPFA 3GBMH 3UZEA 1E4WL 3UCRA 4HS8H 2P4AB 5SX4I 5E94B 1B0RA 4N0UB 2DQTH 2CRIA 1AXTH 5FGBA 2VLJD 3L3KA 5KW9L 2MJWA 3PHOB 3RBSA 2XT1B 5HDLA 3QUZB 4MVBD 4XBGA 1ZTXL 1WFNA 1CQKA 3BIAX 3T2NH 2CK0L 2FJHA 3AXLA 3MGTA 1JPSL 3TYFB 1QRNE 3VFTB 4G5ZL 1Q72L 1HN1A 3DARA 1I7ZB 2VDRL 4QHUA 1G7QB 2GJ6E 2IPUG 3QWOB 2H41A 4WW2F 5CIPH 5DS8A 4LLDA 2FB4H 1A7QL 3FRUA 3UAJC 3FOMB 4ODHL 4PJXB 4C83B 1ETZB 4M1GL 5FOBA 5C0CA 2EEBA 3T4AA 2J6EL 4P23B 4MNQE 3MV9D 4ZFOA 4X7EC 4Y5YB 1NGZA 2ZG3A 1RZKH 3QDJA 2LAGB 4P46B 2OLDA 2R56L 4NBXB 2VISB 2R8SH 1YNLH 2P8PB 4P2OC 3T3PE 4Y8DC 4JN2A 3NTCL 2NYYC 3UO1L 1QLFB 2E7LC 3BKMH 1T2XA 3TF7C 2JTDA 3ET9F 4ZUUB 2BCKB 4LQFL 3VFGH 4LLQB 3X14B 3P3YA 3IGAB 4KRMB 3AY4A 2QEJA 1AJ7H 1DLHA 4NQDA 4TPRL 4O5LL 1UJ3B 4L4JA 3TYGH 5F96H 1RULH 4PGCB 5D5ME 1FZOA 3HZVA 4ZXBA 2GSIA 3CAFA 5GISH 2DYPA 4KZDH 2WQRA 1XGTA 1KTLA 4DZ8A 3IVKB 1UM6L 5C70A 3I6KA 5F72S 3TBTB 1L0QA 4HMEA 5D1XC 5FYJH 3WIIH 1JF1B 2VKXA 2GTZA 4JO1H 4LSQH 5DUPL 4NJ9L 1XGUB 3L95B 5EZIL 3A6BL 2BSTA 3QDMB 5E4EC 3FB5A 3X3GH 1VHPA 4PD4K 2ESVE 5LQBH 3VH8A 4EQ3A 1AQDB 1N2RA 3RVUD 3QBTB 1FN4A 3O41A 3QEQE 1NFIB 3JV0A 3LKSB 4P4KC 4BZ2L 2QLVB 1NUGA 2VDPH 1JCKA 3JWOL 5BVJB 4QEGA 5DR5H 3E1F1 3GSRB 2JJSC 3L3JB 3CFJA 2FH8A 3MV8B 2ZZUT 5F6HI 2YN3A 3KR3H 4KRLB 2IAMC 4ELKA 3B2VH 4KAQL 1GZPB 2J3SA 3KPLB 4MXWL 2ZJSL 4HCRH 4JFPA 4NN6B 4P23D 1NQBA 4F9LA 4HIHA 3DURB 1VERA 4WTZA 5L8LB 2O5XH 5CINL 5HHNB 3SOBH 3HI6H 5J06A 3V0VA 3MRNB 4Z7UA 3UZVB 5HPMB 3BJ91 3DMMD 4I2XE 5HGAA 2VH5H 3TPKA 4GW5B 5I1DA 4XP5L 1SJHA 4MQ7B 1HH9B 4NNXB 4IRSB 2X40A 4DVBB 2ZPKH 4HS3B 1FYTD 3GJFH 5GXBB 3UPCA 1B9ZA 4LCCB 4AEIH 3JTTB 1XF4A 3QUXC 3NA9L 5C92A 1P9MC 1X5HA 5EDXA 2RHEA 5BMFL 4UTAH 1DN0B 1HHGB 3CLEH 1BD2E 2WQ8A 3G6DH 1NCWH 4KUZH 1I9RL 3VDCA 3MV7E 5A3ID 2FL5B 3EYQC 2H6PB 3DVIA 4XPTL 3ZE1E 3QUMB 1MHPL 3AB0B 2ZNXA 3B3IA 4N8VB 4JKPL 1FZKB 1YEGH 2XFXA 3QDMD 4S1RH 5ISZD 4X7CC 4G7YH 1E4KA 1W8OA 4G6ML 1YDPB 1ERNA 4P2RE 1KEGL 4NHUA 2VXVL 1FYHB 5ESVA 1YY9D 2CD0A 4FQQB 5AD0B 2FWOA 2NY2B 1OAXL 5ETUA 4HUUB 4N0YL 3PQYA 3S4SA 5JLZA 1T89C 2R1WA 4ORZC 3F5WB 3P4LA 4JQIL 3PWUA 4TOYL 1CZ8L 3E3QE 4XAKD 1CICA 1TZHA 1AHWA 5FYLL 3BAEL 1OPGH 4U6YB 2H2PD 3MV8D 5DJ8B 3L3HA 4F2MB 4R4FL 5DSCA 4WV1C 2OTUA 3S5LB 1RVFL 4U0RC 4MX7A 3RDTA 4Z8FL 3B9DA 4XCEA 4NO5A 3WMSA 1M7IA 2FJHB 3AXLB 3VD4A 5TE6H 3SDDB 4WFFD 2CMRL 3TN0C 5E2JA 1J0IA 3GNML 3MNVA 5D2LA 2XKUA 4GW1A 3MLVL 3UTPE 1DE4A 1HI6B 2R0ZL 2NY7H 3H7BA 5ICYA 3I2CH 2ZCKH 1MH5A 4IRSD 4NO2B 5A43C 3B4NA 3KHOA 3HPJA 1OSZB 2Y72A 5C0CB 1JWMA 1QR1A 4CN6A 4PS4L 1A4KA 3L7FB 1KLFA 3QIBC 1NGZB 4XVJL 3HE6C 1RFDH 3VXUB 5EO1B 3QDJB 1RZ7L 1YNKH 5E2TH 5LCVH 2XXCB 1J9CT 2CIKB 1RJYB 4WWID 3RVWD 1KIRA 3HG1D 3QO1A 2DLHA 5EU3B 4ETQB 3TNNB 4L3EA 1DLHB 4UOJA 1KPVB 3H42L 4NQDB 4GRWH 2GSIB 3DRQB 2DYPB 2ZCLL 3F12A 4HKJB 4Z7WA 5TH2A 4HWBL 2IG2H 2EIBA 1OVZA 2EZ0C 1T20A 5TE7H 4XMPL 2NY2D 4MAYA 4G7VH 3I6KB 4X8JA 3KPRA 3MLUL 4HBCL 2BFVL 2R1YA 1AXSA 3GSNH 4JREC 5FB8B 2VDNL 3T4YA 4I3GA 2YUVA 2BSTB 2I9LB 4LIQL 4QO1A 1WEJL 1X5GA 1FGVH 1BJMA 2YS4A 1IEBA 2VZ1A 1AE6L 3BP7A 4G3YL 3VH8B 1UWXH 4A6YA 4QRQB 4TUKH 3T0ED 5CJOL 1GGIL 2VDLH 5GRXG 4RNRA 4M7LL 3UYRL 1JYVA 5HXMA 1UKTA 5HJ3A 1Z3GL 1HIMH 3D85A 1GPOL 5FA4B 3QH3A 5DJZA 1QFWI 3GHBH 5J0BA 4ZS6C 3KPNA 2D0HA 4X99A 5FKPA 5D2NB 4GAJH 5DEFA 1UACH 2JJUA 2X4PA 3U1SH 1AKJB 2H1PH 2HN7A 4PG2A 4YGVA 3D1MC 4Q58C 2DL2A 4X4XA 4N1EA 5E0QA 2XQYG 2OI9B 5EZLB 1UC6A 3DBXB 1FQ9C 2F5BH 2YEZA 4LSRL 4JFPB 4MJ6A 4OCWH 3RGVC 2AVGA 2MHAB 3B9KB 3BD5A 3NAAH 2XTJB 3IF1A 1ZAGA 4N90E 3WFBL 5CHNA 4JKMA 2XY2A 3SJVB 3VXUD 3KPQA 5I1JL 3B5GA 5F8RC 2OP4H 1I1FA 3QDHA 4K8RH 5F1NB 2PW2A 4HZLB 1T0NB 2OJZH 1I7RA 5I1DB 5D93C 4QHNA 4K7FA 5D7SL 4I0PD 5LGHH 1S7UA 1Y0LB 1U91B 4DOHB 5IK3A 1YQ2A 3MYJB 2XWBB 2IMNA 3BPNB 1H3WM 4ELMB 1MJ7L 2BDNL 1W0WB 3V7AG 2EICA 1G6VK 2E8YA 5CEZD 4XCFL 1XF4B 1BAFH 1T7YA 1ADQH 3ZDYF 3ZYOA 1IE5A 4LDOB 3ILQC 3O4OB 1EO8H 1F6AA 3N0PB 3S36L 3V52H 4WW1B 1MCOL 4NFBA 3N85H 3B6SB 4NGHL 1LEIB 3T0BA 4FG6C 2VAAA 4XCYB 4V2CB 1BP3B 4Y4KC 5EO0B 4BFIA 1S9VA 3B3IB 4OLXL 4QXUL 2W0LA 4RFEA 3U36A 3ZE2E 2XFXB 2HA1A 1DQLH 5DTFA 1I7UA 1URLA 4IOIA 3MRDB 4X6BB 4HWNA 5FOJA 5SWSA 3RUGE 1VDGA 1WWBX 4UUJA 1A47A 5KSUA 1KN4L 4IIQA 1CDHA 3ARSA 4IRJB 2R1WB 2K3TA 1D6VH 4QRPB 3T0DA 1SHMA 3CXDH 3WLBB 3NGBB 1TZHB 3UMTA 2FGZA 1GZQA 3B5TA 4M5YL 1AHWB 4EI5D 5FCSH 3L1OH 1GHFH 3OMZA 5F9OL 1IGIL 3LKRA 1NGQH 4KKCD 2PYED 5IUSA 1YNTA 1JYXA 5DSCB 4XP1L 1W72H 4HLZH 1G7JA 4CMHC 4MX7B 3RDTB 5DC4B 5HHXL 4EN3D 1RUQL 3RWEA 3MLTA 1JHKH 2IBZX 3BWUC 5DRXA 3B9KD 3KXFE 1M7IB 2XTJD 4G8FA 5ANMA 3O8XC 1HKLH 3MNVB 3SJVD 4GW1B 3PGDA 4CNIB 2VXTL 1DE4B 2UZXB 1UKSA 1I8KB 4AEFA 2NNAB 4ZYKA 1BQUA 3F6LA 4I13B 3DYOA 2PNDA 3FQXA 1U8KB 5JHDE 1N5AB 4LEXH 2ED7A 3VDBA 3QXVA 4J8RA 5AEAA 4EUPA 2MPAL 1G7IA 1K8DA 3BESR 1HXYB 4GRLA 4Z76B 3S35L 2H9GA 2F8XC 2EDHA 4WHCA 2ZUVA 5FYJU 3M8OH 2P48B 3RWCB 1X5JA 1FL6B 3G6JF 2VZUA 4LVOB 4PJFE 4RISH 3TBSA 1MHCB 3VRIA 4D9RE 4FMKA 3B43A 1RUPL 1DBKL 4QHLB 5C0BD 25C8L 4A2LA 5DD1H 3RVTC 2V9QA 1CLOL 1IILE 3F12B 3O6ML 2FBOJ 4Z7WB 1RK1A 1H3XA 1ZEAL 1T20B 1WAAA 4K55A 1E4XL 5KAQG 4ZQKA 3VXME 5KVGL 2R1YB 4QRPD 4OD3L 1RJZA 2AK4A 2EO9A 2VLKB 3BEWA 4OZHB 5T3XH 3CFCH 3V4PH 4DGVH 4N0RA 3QWRA 4M8QB 5DJ2A 4GKOA 3Q5OA 5HI3D 3QDGB 1S7XA 3UTTE 3MUJA 1XH3A 4NP4L 2D31A 3HNTL 4O02L 1P1ZA 1SYSA 3R8BB 4MD5A 4FABH 4NWUL 1MFDH 2VQ1A 3FAWA 1AGBB 3D85B 3ULUE 2QSTA 5DJZB 3P77A 5FUCE 3HLAA 4KJQD 3RJDA 5HYEA 5JHLH 2ZUYA 3KPSA 3KPNB 1P4BH 4MHHG 4X99B 1TQCB 3QFJE 4RFOH 2HVKB 3HRZB 3LZFL 3LVEA 3ZTJH 3MJ9A 2WIMA 2X4UA 4I48A 3V6OC 4W4OA 1L9MA 1S7SA 5L9DH 4JZJA 4M7ZC 4MJ5A 1FV1A 3FQRA 5K9KA 3STLB 4D9QD 1KB5L 5ITFA 2MCPH 4GSDH 3FMGH 4Y2DA 4PRHE 1ZLWK 4MJ6B 2YPKA 1NFKA 4P9HL 5EU6E 1IFHL 5HYSA 5DUBA 5EORH 3TC9A 4X98B 3TJEH 2D7TL 3FO2B 5KVFL 3LEYL 2F8OA 1CGVA 3RWGA 5E5RB 4FFVD 4K7FB 1DUYA 2DMCA 1S7UB 2EKJA 5DVNA 4ZG1A 1C08A 3C6LC 5D7LA 3KYNB 2NQCA 1KIQA 2WBWB 2VC2H 2W9DH 5IROA 4PJDB 4XBEH 4JGJA 5I1EL 4PRPA 1RV6X 1WQVT 4M3KB 5JW4N 5DJXA 2VDQL 3UJJH 3V79C 2VLLB 3KYOB 3NABL 4OGAC 1CWVA 3PP3K 1JN6A 4YDKH 4LNVA 4W81A 4NWTL 1CF8H 4RWYL 1FHGA 5GJTL 4XP6L 4GS7C 3BOVA 4UILL 4WFGD 2VLKD 3DV4A 4LSTH 2YPLE 4KDVA 2P49B 1T04A 3U36B 5DEGB 1MCPL 5DTFB 4CADA 2ZSWA 1QOKA 4G6JL 5HHOA 4KFZC 2HKHL 1JK8A 3OHXA 2YA2A 1NEUA 1MRDH 2O93L 1NAML 3LV3B 4UUJB 5IB4A 1MFCH 4NHCL 5C86A 5KSUB 5C2UB 1EAPB 2E6JA 3VMPA 1V3LA 3S37L 3T8XA 2UWEF 4DZBB 3IFPB 4Z7VA 1MLCA 2D03H 3X13B 1NC2B 4DN4H 4ZTOH 1BM3H 1D5ZA 5E2WL 4ZFGH 1E28A 3SKNA 4EXPX 4RWHA 2CIIA 4H88L 3SGKC 2EXYD 1FL3B 4DGYH 3SN6N 1R5WB 3G5ZA 4ALAL 1J12A 2X6MA 2FJGB 4PRNA 4L4TA 4WNQB 1JHTA 2VSDA 1D9KC 3MCLL 1S3KH 1XR8A 3RWIA 4FQJH 3DROB 5FV2A 3MFGB 1FJ1A 1Q9LA 1U6AH 4G8FB 5GJSL 5ANMB 4EQ2A 3M17B 3STZB 4AL8L 3LMJL 1C5DA 1DVFD 3BGFC 3CFDB 3F65A 1NANI 3D39E 1XIWC 5F7UA 4Z0XB 4P4RB 3FQXB 2JELH 4MJIA 1A7OL 1G0XA 1RHFA 3UYOD 4PY8I 1NFDE 3RNQB 4U1SA 4Z0BH 2ICCA 2PO6A 3O6FC 4GAFB 2OZ4H 3RAJL 2H9GB 5L8KB 4YZFE 4ZFZA 1KJVB 2YRLA 3KS0H 3GI8H 4P5TB 1ZT7A 3C09C 4PV9A 4EDXB 3NOIA 1XF2B 3WS6A 2ZUXA 4PPTA 4B0MM 3NPSB 1AD9A 4TSBL 2J8OA 3BN3B 3DUSB 4X5XB 1NEZA 4ZOEA 5ACLA 5AZ2H 2R0LL 3SKJL 3VXRE 1GAFL 1QFUL 5HVHC 4U6XB 1DQJA 1N7MH 2C7UB 2CKBL 1T66D 4ZS7H 5HHPB 2NY3C 3V0AC 5DA0B 2OYPA 1F58H 1U42A 3MRCA 1NC2D 1WFTA 3NCYS 4OTXH 1MPAH 3WFCL 5DF0A 1F4AA 3MBXL 3T1FA 5T1MB 5FFLA 1S7XB 5IBLD 3MCG1 2XTLA 5AUMA 1SYSB 1SYVA 1A3LH 4CL7A 4PJAB 4GFTB 5DVKA 3FT3A 5J3HC 3ZE0F 1CS6A 1A1MA 1SBBA 1HOCA 1J1PH 4QXWA 4X6DA 5IFAL 3EOTH 4YX2L 4I18C 3ZT5A 3ARGC 4PJXF 1JNNL 3P0GB 5CGMA 2HT3C 4I48B 2X42A 1G6RA 2NXYB 5H94A 1A6AB 1S7SB 4Q2ZB 4JZJB 2E6QA 4MJ5B 1FV1B 3T2OA 5CP3A 3S36X 5CCKL 5C0RL 5KJRH 3W11D 3LKOB 3E2HB 1A3RH 3PABA 1OWWA 3IXTA 2Z31B 1TETH 1S9XA 2A73A 4YHPA 5F1KC 3TFKC 4WI7A 5IBUB 5HYSB 1TPXC 4JRXA 5CJ8A 4XGZB 4PTUB 4PY7B 1VGEH 1ZHLA 4ONFL 4MD0A 1G9NL 2DN7A 1OAZH 4K3DH 1H8OA 1UZ8A 1FGNL 2HRPL 3QZWA 4AQOA 4NNPL 5J1AB 1C08B 2Y5EA 1BFOA 3WNMA 3X12B 3NFSL 1KIQB 1Q9WA 1RZIA 3DSFH 3VFRB 3P4NA 4PGDA 2MSPA 2HFGL 4OGYL 3I3DA 5I9QC 4KUCF 4NKIL 2ICWI 5DJXB 3SDXE 1I1CA 4FQIL 3TZVA 3ECBA 2DS4A 3IT8D 2AJXH 1JN6B 5D7JA 1JPTL 2DBJA 4NZTL 1WIPA 5TPWL 3ULVE 3WXVL 5HHVH 3ARWA 2XWJA 3DV4B 3MJGX 1MCBA 1T04B 4J3OC 4GMTH 4LDEB 5DGQA 3D2UA 4XMKL 4BH7A 4CADB 1ZGLP 4NKOA 5HHOB 5AAMA 1AIFA 3OHXB 5I15H 1MREH 3MFFB 1QFHA 3BJLA 4L3CA 3KJ4C 1GCFA 3U83A 4UQ3B 5IB4B 2EYSA 1ZT4B 4ODXB 3MJ6A 4LLYA 3VMOA 1IGCH 3H9ZA 2BRRH 4HW6A 2VRAA 5KZCD 2FIKB 2VJXA 5AWNL 5D8JL 5KN5A 4TQEH 4CJ0A 3QUMH 3WUWG 5K59E 4R3SB 3VXTB 3LPFA 2XRAH 5EULV 3S35X 1QFWM 5JA9A 1B4RA 4PRNB 4EOWL 4C4KT 2AV7B 2BNRA 3BO8A 3RWIB 2LABA 2VABB 5E5MA 1QO3B 5DZNA 5KSBA 4PP1D 1FAKT 1OTUD 2BRQA 3DMMA 2V6HA 3LKQB 2R23B 1EAJA 3WKNA 4FQCH 4XX1G 3KNBA 4O4YL 4OI9A 4R90H 1G9ML 4ZAKD 4YBLB 1NJ9B 3LDBB 5I16A 2GITA 2HFFB 2C1OA 3D0VA 4JO2H 1LEKA 5HDBE 2C3HA 3FQNB 5LBSL 5C09A 1FVDB 4M03A 3TIEA 4PJHE 4C56D 6CGTA 1QD0A 5E95B 4MJIB 1LP9F 5CSZA 1B6UA 4NQCE 3S9DB 4U1SB 1QHOA 3NIFF 4QTHA 4WEUD 3RIAK 2KUTA 4ODVH 4YUEH 1VPOL 3OJVC 2R69H 1YUHA 2YMXH 1MFEH 3MJ8A 5E99L 2AI0H 1MQKH 4XHJC 3GGWA 5HD8D 1U3YA 3VWJD 5TQ0H 3BSZL 4M7KH 1ZVYA 4NQUA 2FGWL 4YHZL 4L8DA 2VXUH 3CVIL 2F54E 1JGVL 2HTLC 4KI5C 4JQVA 2IADB 3TCXA 5K9QG 1U95A 3U82B 3K2UH 4MCZA 4K9EH 4XNUH 3J8F7 1EGJA 2DQGL 2DQUL 2CJUH 4BQBA 3MLSH 3FB7A 2PR4L 2AEQL 1DQJB 5HYQA 1EMTL 3O81A 2P5EE 2WWKO 3BE1H 2OL3L 4J4PD 3IDXH 4NSKA 3IFLH 4F37F 5I18H 4OZFA 2VLMD 4NZDA 3MOBH 1SY6L 4HAGA 1FP5A 5FKAA 3HI1B 4WWKB 5F7NC 4J3UA 1MI5D 3KJ6L 4GBXD 2EIEA 4NQSB 4IOFC 3LAFA 4OAWA 5AUMB 4WHDA 2A9NH 3SKOB 5JOPD 3T2PA 1DBBL 4FTVB 1I9IL 2AABH 4XHQA 5CEZH 4KK6D 3GSUA 4UU9A 3MNZA 3QISA 4LEOA 2R2EB 3HS0B 4BSJA 2B4CC 1FC2D 2UUDH 1E4WH 2P7TB 3L3GB 4KMLB 4LCIL 4F9PC 1KTDB 1A02N 1P69B 4ONHB 1G6RB 3PG2A 1DQDL 5H94B 4RFNC 5KW9H 1IC7H 4JRYE 2VZTA 4H1LA 4JKWA 3G08A 3MC0A 2SEBB 3PABB 1ZTXH 3DVFA 4JDZB 3P73A 3JV4A 2A73B 4X5LA 2CK0H 4YHPB 2Q86A 1JPSH 4U3CA 4AM0B 3G5YB 4R26L 2ADFL 3OSKA 4G5ZH 4JRXB 1Q72H 4RX4D 2BP3A 3EJZD 2VDRH 4KJPD 1YMME 2GK0A 2VXSL 1U8PA 5C07D 4LCWB 4MD0B 1T7VA 1BQHG 1QSZA 3HG1A 4G9DA 2GSGA 3NIDF 1A7QH 1CXHA 1OW0A 1DANT 4ODHH 4PYGA 4DW2L 4M1GH 4R0LB 5FIEA 5FDWB 2J6EH 2OK0L 4M6NL 4PGDB 2CKBB 1QQDA 2BVPB 1A3QA 2YBRB 5SWZA 1P4IL 4D0BA 1FZJA 3G9AB 1GOFA 4OZ4A 2QKIA 4G9FE 3EOAA 2R56H 1IGYA 3DI3B 3TVMC 3ECBB 4Y1AE 3QEGL 3CCHB 3ARDC 1N3NA 3NTCH 1LO2L 4FQXD 2PTTA 4M4PA 2GJ6D 1AO7A 4OLZL 3PP3H 4LQFH 1BJ8A 2XWJB 5IMOB 5E00B 3T0EA 4GXUM 1FNFA 5EWIL 4TPRH 3GM0A 4O5LH 2BVYA 1AIFB 5CAYB 4HZAA 1P7KA 4WJ5A 4BM7A 4WCYL 5DLML 2CRZA 4F7TB 1BBDL 4L3CB 2QL1A 5DJ0A 4GLRI 4NC1E 1INDL 4MNQD 1UM6H 3PP4L 5J8OA 1ED3B 4QHKJ 5J9PB 2LVEA 5HHME 5DUPH 4E41E 4NJ9H 5F9JB 5IMMA 3GBLA 4OLWL 5EZIH 4KKLC 3QIUA 2DF3A 3A6BH 4K2UL 4E0RB 2ATKA 1CK0L 2V7HA 4C58B 5BV7C 4JZNB 4KVCL 5FM5O 1WIOA 3WXWL 4BZ2H 4WHYG 1I9EA 5IHZB 5HI5D 3CMOL 4U1JA 1L9NA 3Q5YA 3VG9B 4PREA 2BNRB 3JWOH 3LQAL 1OGTB 4GOSA 5KSBB 3FRPG 5L0QB 3QHTC 2Z93A 2NY4B 3L5JA 4C54A 4PJGE 3U7YL 3WHXB 2N7BA 1ZWIB 3TO2A 5JOFA 4I0PA 1I1AB 4M93B 5DK2B 3QPQC 4ELMF 4TTGA 4KAQH 1FSKB 4MXWH 4ZO7A 3BGMA 1IEAB 1LQSR 2D2OA 3BXNB 5H37G 2ESVD 2ZJSH 4QRRA 1DP0A 3BN9C 4ZPTA 3VD7A 2EYTB 2AJUL 4NRXB 2W0FB 1GOGA 3BPCA 3QEQD 2EC9U 1LE9B 1FNHA 5CINH 3WEXB 4QTHB 1PZ5B 1TNNA 3SDCC 1U8OB 2DIBA 4JCLA 3OF6D 1JNHA 1J88A 1YUHB 4NRZA 2B7DT 5HBBA 1F4XL 2PN5A 4XP5H 2AXFA 1CGUA 4PJ8D 1YA5A 4PIRF 3V95A 1X5KA 3BW9A 4G8IB 2XPGA 1EFXA 2P8LB 1J8HE 3WL9A 1MCHA 2DLFL 5CKGA 1ES0A 5J11C 4TN9A 3NA9H 2FX7L 5BMFH 1VKXB 2UZYB 3WFDL 5HYQB 3FFCE 1OP5H 5IB2A 5IEKB 2V2WA 5JOEA 2FHBA 1I9RH 2O26U 1I8LA 4QOKA 4EI5A 4MCYA 4XPTH 1MHPH 4OZFB 3FN0L 1CVRA 1WBXB 1NCTA 2WINA 4JKPH 3CLFL 4HWUA 5EBGA 4OIIL 2QADB 5FKAB 4ZUTA 5EUOA 4GG6A 2HJFA 2OR9H 1FNGB 5E9DE 1E27B 4G6MH 2YD7A 4EN3A 1DQQA 5IV2B 2V5RA 3VI4F 1F2XK 4WUUE 2VXVH 4HIEA 5B39A 1HYSD 3KLHD 4K3GA 1A7NL 4X4ZA 4JPKL 5C3TA 1A6WH 1OAXH 3OG6B 1CFVL 4N0YH 3DX9B 4UU9B 1U8QA 4JQIH 4LEOB 5EU7E 4TOYH 1CZ8H 5T1DH 4JJ5A 1UYWL 1BD2D 5FYLH 3BAEH 3CFIC 5D9SA 5EIVA 4XPAH 1I1AD 3MRGA 3I02B 4L8CA 1UB6A 2VQTA 4UIMA 2Y06H 4G8GB 4R4FH 1QKZL 4ZSOA 1U41A 4H1LB 1EDQA 4YHYB 4OQTL 3G08B 4Z8FH 3ZO0A 1JNLL 2RCSL 1UH3A 3P73B 3MUY1 1CFSB 3KWWA 1FPTL 1H8NA 2CMRH 3DSNA 3NCJH 2LV4A 2AKRB 3GNMH 4X5WA 3MLVH 4JFYA 1J05A 5GHWL 1YPZB 1QZ1A 2R0ZH 5IQ7L 4F7PB 2XV6B 4PV8A 4LLMB 5T5NG 4G9DB 3FQUA 1NLBL 2GSGB 3GKWL 2Q8AH 4WRLA 4NO0A 1FBIL 2BHYA 2LFGA 4Z7WF 3VFPA 4URTB 1R5VA 1Q38A 4G42A 1KJ3H 4LHUG 4HHAA 4Y19A 4HJ0D 1JZ6A 3L3IA 5IVXA 4XVJH 2OL3B 5SWZB 1FZJB 1RZ7H 1GGCL 3EOAB 4OZHF 2N1KA 5J6HA 4KY1L 3BFOA 3WFHB 4U1LB 2ZOKB 1AGCA 4Z6AT 2PTTB 4OCYL 3QR2A 4D3CL 1KPUB 4G6AD 2QADD 4QLRA 2QQQA 4LGPB 2A77L 3WHE1 3MTRA 3B8YA 3H42H 4YPJA 1R3KB 4LARL 4XH2A 1F3DH 3IKCA 2ZCLH 3UXFA 2E7LA 5KANI 4HWBH 4MNGA 2FHFA 1RURH 4Q9QH 4XMPH 4LFHG 3MLUH 1JHLL 4HBCH 1Q94B 5CSBA 2BFVH 5D1QC 3SKUD 2VDNH 5IMMB 3ES6B 4DCQA 2X44D 1FE8L 2XNAB 3QIUB 4P59L 4KKBC 4LIQH 1WEJH 4R4ND 2ATKB 4LRIA 5IJKA 1YN6B 2BMKA 5BCAA 4NT6A 5D1XA 1AE6H 4G3YH 2XZQL 4MWFA 4G8GD 3HAEB 4OUUA 3WIFB 1LNUA 1ZLVH 5CJOH 1GGIH 5C0IA 2WBJA 4M7LH 4K07A 3UYRH 1KUMA 4U1IB 1Z3GH 4B50A 1GPOH 1LD9A 4S2SA 1KCVH 4CU7A 1L7TH 4J3VA 1LO0L 2NX5E 1CE1L 2FH6A 3PWPA 4P99A 2BJML 3DXAA 5JOFB 3CPLB 3U2SA 1IKFL 1JFQL 5EU4B 3GMPA 2Y5TB 5IHUL 1F02I 4KTYA 3PHQA 1J10A 3HR5B 4PJ9B 5FA3A 3RI5K 3MSPA 3FB6A 3GKZA 4LSRH 3BRDA 1P7QA 4RCAA 4IMLA 1WISA 4GRWE 5GSVB 4KPHH 3BZ4B 3WFBH 5EBLA 4XNYL 4ENEC 3WDJA 3UTSA 4V2BA 3D25A 3TPUB 5I1JH 5JW3L 1ACYL 1IAII 3HE7B 4AK1A 4NRZB 5F3HA 5D7SH 2AXFB 3B2UD 5BXFB 3LEVL 5JR1L 1FORL 3BUYB 3LH2L 5JXAL 5F1OB 5C0AB 4GMSL 1RIHL 2XPGB 3IDGA 4NN6C 4ODUA 1I1YB 1MJ7H 2BDNH 3WL9B 3SDAC 5F9AC 3HC4L 4XCFH 4KKAD 5DFVC 5EUKA 4JR9L 2YUWA 2IANA 4N90D 3S36H 1MCOH 5IB2B 1VADB 4FXGA 4NGHH 1DBML 4QOKB 3VCLB 4XXCA 4FZ8L 5D7IE 4MB4A 4MCYB 1HXMB 4QXUH 5FUZL 3ZDYE 3P2TA 2WINB 4MA3B 3WSQL 2IPUK 4ZUTB 3BVNA 2HJFB 4RGNE 2Q6WA 5HGGS 4ZODA 1JZ4A 1DQQB 3CVHA 3V0WL 1KV3A 1C7TA 3KLAB 3VFVA 3VWKC 4U49A 4J6RL 5B39B 4OD1L 3RIAF 1EJ6A 3U7AA 4NNYA 1KN4H 3AROA 4PJEA 2Z35A 1OQXA 4WFEE 1FO0A 2F58L 3I9GL 3MRLA 4XI5D 4JJ5B 5CD3A 2DBLL 4LHUD 1DVFA 1HQ4A 2AK1L 4U6TA 4PRIE 2W38A 4M5YH 1S5IL 4GKZA 4GAYA 4JO4L 4D2NA 3B9AA 5F9OH 1IGIH 1KG0A 5D7KE 3MRGB 3R1GL 4JG0L 5CJBA 4XP1H 1V3KA 2IWGA 4PJ9D 3IRPX 2OR8A 3Q0HA 3RY5A 1JPST 1M4KA 3S96A 4MJ4A 5HHXH 3OKDA 1RUQH 3VGEA 5C0FB 3PWLB 4OCXH 3MBEC 1CLYL 4L8SC 1J8KA 1MWAL 2FX9L 2P24A 3EYFA 3U7WL 2X41A 4HIXL 3G5XA 3TV3L 4X5WB 1A6PA 3W0WB 1J05B 2VXTH 4OV5B 3HE7D 4I9WE 2QSVA 4MAUL 5FGBC 3ARVA 4LFHD 1BOGB 4NO0B 1NDMB 1CD8A 2IH1B 5C0AD 3FO1A 3VFPB 1F13A 4PBVC 4G42B 3RZCD 1LO5A 4HHAB 4G80A 4Y19B 3MGAA 2MPAH 3EDKA 5MEPA 4U1NA 3SGEH 3UZQA 1K8IA 1S9YB 3VGBA 4BZYA 3AS0A 3S35H 3KXFD 1QFOA 5J6HB 1UG9A 4MS8C 3GUTB 1A7RL 5AZEL 2DLTA 2WANA 2B5IC 4APQA 1A6ZB 2UZIL 1P7HL 4PJAF 2CSPA 3RWDB 1T1ZA 5L2KB 4LLWA 1P6AB 4P2OB 1RUPH 1DBKH 25C8H 5JHDD 1NBVL 4XH2B 4O9HL 3G6JE 1CLOH 3O6MH 5JXED 1IC4L 5FM4A 1GRWA 1ZEAH 3V4UL 1P2CB 1ZSDA 5CBEB 5BS0B 5D1ZD 1E4XH 5KVGH 3QUYA 4P5KB 4UBDC 3PXJA 5EZOL 4H0IA 4OD3H 1T21B 3EFFA 5I8EA 3V5KA 3AY4C 4ZD3L 4I0CC 1RU9L 4JM2A 1CTOA 3GSQB 3P40A 1T5WA 4NT6B 1Q0YL 4TTDC 4NP4H 5D1XB 1EHLL 1T6VN 3HNTH 2Z8VC 4O02H 4ZXBC 3VE0B 4XVTL 5GGQL 2DOCA 3GO1L 1ZKAA 1PDKA 5JZ7D 4YHKL 4D9RD 4NWUH 4X6CA 5JUEL 4POYA 2PTUA 4KROC 1RZGA 3AMKA 4LF3A 5E4EB 3P9LA 2CQVA 4L8BA 5I76A 5JORB 3T09A 2MOVA 2NW3B 3ZHLA 1F00I 3PWPB 1S7WA 4P4KB 3LZFH 3SE4A 3VXMD 1KIPA 3W0WD 2Y36L 4ODWB 2I07A 1LE5A 4LSPL 4YBQC 1HILA 4KXZH 4NZRL 1TZIB 3ZKNC 4HUVA 3CSYA 5FA3B 1KB5H 3L7EB 4UB0L 3SHSA 4NRYA 4GAGL 4LBEA 3GI9L 5FECB 4WI4A 1TJIL 4P9HH 2ATPA 3UDWA 3NFNA 2QQKL 3F7VA 1IFHH 2IAMB 1NL0L 1QSFE 2IBBA 3UTSB 5EOQL 1SM3L 3UAJD 3D25B 3ULUD 2ITCA 4YDLC 2D7TH 5KVFH 3UBXA 2X4RA 3V5HA 1OT1A 5T3XE 4CN4A 3QRGL 2R29L 3D3VA 3CX5J 2J2ZA 5DJDB 1OGAE 2FEEI 3OGCA 4LKXA 4BSVA 5I1EH 3V6BR 1CXEA 1L6XA 4F9LC 4M6AA 4P2OD 4BH8A 4OD2B 1Z6JT 4LLVB 4N9GA 4Z7VF 3P4OB 3O6KL 3FO9A 4R2GD 1F6FB 5GIRB 3NABH 3LEXA 4HUMB 4NWTH 3EBAA 3AVEA 1J0JA 4XMLL 4RWYH 1FFQA 2AQ3A 5C1MB 3QUXB 5GJTH 4XP6H 5FHAH 4UILH 1UH4A 5IB5A 1X6LA 3TH2T 1MCPH 1S7TA 4G6JH