4F15B

Molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
219
structure length
208
Chain Sequence
VKLQESGAVVQPGGSLRLSCAASGFTGSDYDMSWIRQAPGKGLEWVSGILGGSERSYYRDSVKGRSTISRDNSRKTLYLEMNSLRAEDTAVYYCARHSWGGWGQGTTVTVSSASTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSSVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin
publication title Molecular basis of infectivity of 2009 pandemic H1N1 influenza A viruses
rcsb
source organism Influenza a virus
molecule tags Immune system
total genus 32
structure length 208
sequence length 219
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2012-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f15B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f15B02
3AU1B 3F12A 2F54E 2MJWA 1ZMYA 2QSCL 5CJOL 4MA8H 1ND0A 5JLZB 5FKPB 4LLWB 5SWZA 4MXWL 3QEUA 2XZQH 1UWEL 3MFGB 4G6KL 2OTPA 1ETZB 2PF6A 1H3PL 2DL9A 5HHOA 4WHCA 3ARPA 1FZJB 4PJ8A 4RISH 2C3WA 4POZD 2PUQT 5E2WH 1BOYA 5D2LA 3O8XC 5D1QC 5DJ6B 5EZJB 2OBGA 3ME0A 2YD1A 4NNPH 3UTSD 3JTTA 4Y1AD 5IJKC 1UYWH 4L8SB 4IMKC 2BOBB 4XNYL 3ARGD 5E8DL 4ZOCA 3PXHA 4WTZG 3SE4A 4OQTL 4G42B 3WLWC 4KDWA 3DV4A 4OUUB 2MNUA 2B4CH 2VE6A 5EPMA 4MA1B 2SEBB 2IFFH 4ZS7L 1HIMH 2LE9A 3LH2L 4U6TA 3BP4B 3DV6A 3IYLW 4XP1H 3S36H 5GGVY 4QHUB 1J05A 3W9DB 3NFSL 4FG6C 1LVEA 1QBMH 3DX9B 1MUJB 2P47B 4XPHH 1A6ZB 3P4NA 5FO7B 2ATKA 2GT9A 2H2PC 3PNWB 1FVDB 1J0KA 2HKHH 3UTSE 5J0BA 1D5IL 4HIJA 4Y1AE 2DWEA 3DHMA 3C09B 3SDXB 2X4QA 1U41A 4PJ7F 1YEHH 2X40A 5EU6A 3O3AA 3RRQA 3L95B 2HJLA 2IQ9L 3GSOB 1RURH 5B4MC 3MV8D 4JFEB 1LO2L 5T1MB 3U4EA 4X9BA 5SV3A 2D9CA 3NVQA 2GITA 4PJAE 5CEYA 3ZDYF 5E6YA 4KDVA 2ARJQ 2R8SL 2BVEA 4ONHB 4M48H 3Q1SH 5GQBA 4QF1B 5HXMA 2FD6H 5D2NA 3A6BH 4F7CA 2NY2B 4X6CF 1GZPA 3E6HB 1VGKB 2VLMD 3V6FA 4FFZL 2UV3A 1TIUA 1ZHBB 1E27B 1MLBA 1U8HB 3TO2B 3ARXA 2AABL 4M93C 3OZ9H 3CXHK 4XBEH 4LCCB 5GS1A 3O4OB 3FQNA 3QCUH 3IFPA 3TJHD 4C56A 2V2WB 3HC4L 5GS2H 3B83A 1EHLH 5I1CH 3MV8E 3RUGB 3CMOH 1QSEA 2BY3A 5D5MA 4JPVL 5JXEC 1A7OH 3JV0A 4MXVE 4H8WC 3SPVB 1ZTXL 5KSBA 3KXFB 4OKVB 5CSZB 3VGAC 2VLRB 4HS8L 3KHQA 3WDHA 3TO4D 5HHXL 4EBQH 1A6AA 3MLZL 1YNKH 3I50L 3ZTJG 2VLME 2CDGB 2G5BB 1OL0A 1XF5A 3HKFA 1S7UA 4PJ9D 4ZFZB 2PYEB 3UTQA 4YFDB 1OM3H 4RA3A 4Z7VA 1G0XA 3PGCB 3VXQB 2X1QA 4PJFB 1RZJC 4K9EL 2DQCL 3QEQA 3STZB 3VGHA 4KKLC 1DVFC 3BPOB 4IM8A 4XTRD 1RJYA 5H8DA 2CK2A 4K7PX 3PP4H 3WL9A 3K4AA 5D1XD 3MRRA 1IT9L 2FX9L 2QSCH 2CLZB 1ZLUH 1JBJA 4QRTB 4HIHA 5HGAA 4G8IB 4JKPH 3V6OC 1U8PA 1GGBL 1YEFL 1JWUA 1YDPA 2KQMA 1UWEH 3O3DA 1QTYT 1XF3B 5T33L 1BM3H 1YUHA 1EEZB 1H3PH 2NY4B 3WDIA 5HDBF 3WIFA 5D7KE 2FNBA 4L3EB 2APWA 2YA0A 5DHVA 3RPIB 1JF5A 5H35A 5E5UB 1TQCB 1FYTD 1VA9A 1RUPH 1PY4A 4YIQA 3VFNB 2QQNL 2O61A 1KCVL 3K1DA 1XIWD 2V5MA 1X9QA 3OBAA 4F33A 2M1KA 3DLQR 4OQTH 4LVEA 4MMZC 2AGJL 3N1GC 5SWSB 3OQ3B 3VXUA 1ZGLB 1J1PL 1JN6B 2ZCKL 3M17A 5IUSA 1NDMA 4ZS7H 3MJ9A 2YXFA 3KLSA 3WD5H 3LD8C 3D0VB 3S35X 1FG9C 3L3GB 5K9OB 2V7NB 1DR9A 1A1OA 1QPPA 4ZUWA 2Q76B 3BHBA 1X5XA 4GW5B 1QD0A 4LVOB 3BRDA 3OMZA 1C16A 2BNUA 2JKXA 2V9RA 1D5IH 2R15A 1WFNA 5CD3B 1YPZB 2W60B 3QFJD 3SO5A 4AT6B 5E9DB 4NNXA 4BK5A 1J10A 3C5SA 3EOTH 4HIEA 1IAMA 3TA3A 4UAOB 4CW1A 3OKNB 1LO2H 1HI6B 3EBAA 3OKYA 3SGJA 3GBLA 4JFQA 2DQDL 5DUPH 3S4SG 1CXKA 4HWNA 2R8SH 4JFOA 5ICZA 4FFWC 3NZ8A 1CXLA 1JHKH 3BRFA 4CVZB 3PHQA 5DJCB 1LO5A 2HLAA 2HJFA 4XRCB 3K8MA 3VGFA 3H42L 2ZG1A 4HIIB 3QQ4B 2AABH 1MCKA 2X44D 4X7SL 5DJYB 3UBXB 3QFJE 4E42A 4ZOAA 1GZQA 1XT5A 4LLUB 3JV5A 3K8KA 5DDHA 4JFPA 2J7LA 3C60D 4S2SA 4XP9L 3FB8B 4P9HC 3RZCA 1KCUL 3T65B 3OJMB 3MJGX 1LDPL 3WS6C 5ECJE 4LASH 5BXFB 2J8UB 5D1QB 4C83A 3O2DA 4GRMA 1WWCA 1G9ML 3MROB 1F2XK 2GK0A 4QOKA 3WBDA 1MI5D 2EKSB 3BKYL 5HHXH 1X5FA 1S8DB 3MLZH 2JB6A 4YHPB 4MJIA 4GRWB 2YA2A 4N9GB 3WV0A 2BY0A 4U0QB 5BCAA 3LKRB 5EZIL 4K9EH 4Y5YC 2O5ZL 3K0WA 2DQCH 1OTUC 3LQZA 3QA3B 4M7ZC 1JZ6A 4PG9B 4JKWA 4ZFFB 2HT3D 5DT1L 3BKCL 3P4MB 4I2XE 5E8PA 1NEZG 4R3SA 4MGXA 1J1XL 1IT9H 2FX9H 35C8L 5IV2B 1PVHA 4YPGB 1CLYL 3KLHD 2EDQA 2H26A 4YFLI 4ZXBD 3BP6B 5JW5B 1S7VA 1T7ZA 1GGBH 3FO0H 3KPQB 1MI5E 5JHLL 4JGMA 1IM9A 4QY8B 1AXTL 1ACZA 3TEUA 1FFNA 3SOBH 1SHMA 3QIBA 5FUOL 1E4XH 5T33H 4HEPG 3FB6B 2C3HA 3MLWL 3HZVB 4HKZA 5DQDL 5FHBH 3PIQB 2VZVA 3TGXA 4NQEA 4LLDA 1K6QL 2EO9A 5AZ2L 3RVVC 4FFVC 2JCCF 5GSVB 2C4XA 3PDOB 2QQNH 1KCVH 3C6SA 1FVEB 1K4DB 4G9FA 1MRFH 2NX5B 1YN7B 3MLTA 1FJ1B 1S9YA 2AGJH 1UJTA 4ODBD 4UT6L 3NCJL 3NCMA 1WF5A 1LD9A 1UT9A 3VMNA 5ABDE 1KTDA 3IDUA 2XWJB 1DLHA 3U6RB 2BY2A 1IJ9A 4BFEA 1CGYA 4KHXH 1ONQB 4LCWA 5EC2A 3MJ8A 1SM3H 5EO9B 4NSKA 2ADIB 4EJ1C 3QIUD 3KPOB 3HAEG 1MFAL 1DDHA 1NCTA 4L8DA 2QL1A 4OZ4A 3P0GB 4HDIB 4X6CE 1U8JB 5DFVD 1KB5B 5AZEL 5FOJA 2IBZX 2EE9A 3KLAA 5T1KB 4MSWB 5IOPA 3MGTB 1KENH 3E0GA 5FCSH 3O9WD 5FCUH 4H0IA 3PWVB 1CFSA 3O41A 4Q9RL 2A6JA 4X4XA 5LG1A 4TNWK 2HVJB 3IS0X 4PRPA 4FQHB 1S7SB 2D0FA 2DS4A 3H42H 4QRUB 2GTWB 1D5MA 4X7SH 3S6CA 2B7DT 1A6TA 4FTVB 4DOHE 5B38B 1N5YH 2HVKA 4XP9H 1RZKL 3GBNL 1KCUH 3HG1D 4YDKL 3QXWA 3TFKD 1LDPH 2DN7A 3AS2A 5F9DC 4L29A 3L3IA 4BZ2H 3MACL 1Q9OB 3GGWB 1AKJD 1G9MH 3IGAB 1HYSC 2BNQB 3JVGA 2G5RA 3MPCA 5T5FL 2QR0A 3OAYK 2ADGA 5JHDD 3UC0L 1FRGH 2OSLB 4X7FC 4JPIA 3T4AB 2JJSC 4FQXB 1NL0H 5EZIH 5B39G 3FRUB 5F1NB 4DVRH 1LEGA 3FCTB 1DN0A 3VCLB 1KTLA 5JO5B 4C4KO 3DO7A 3LD8B 3QUML 3U7YL 1KTKE 3LB6C 1GOFA 2VLJD 1K5NA 3HG1E 5DT1H 3BKCH 4S1DC 1MQKL 5FYLD 2IAMD 1RJLB 3C6LC 1TMCB 4L4TD 4R8WL 2WWMC 3GIZL 4MQ7B 1J1XH 2AEIT 1JNNL 3ARZA 3SE3C 3TT3H 4CBPA 3GMMA 35C8H 3ROOB 3LQAC 1SYSB 3HAEH 3O8XA 5HDBE 4O58L 1ZHKB 3B2VL 4U1LB 3A6CH 4NN5C 3D85A 4F9LA 5JHLH 4YLQT 5JHDE 1OW0C 3RNKB 1F6FB 1XGTB 3TJEL 4IMKA 5FUOH 1FAIL 3KDMB 3MLWH 4PRHD 3I02B 5DQDH 1CK0L 3QDMB 4KWUA 1SY6A 2VLJE 3KYOB 4U1KA 4PY7B 4F7TB 3SO3C 2NXYD 5T1DH 3KPSB 3W2DL 5FYLE 3GSNA 3M1BA 3LKSA 4UB0L 3ZSSA 4OGAC 4L4TE 3JTSB 5AZ2H 3ARTA 4YHZL 5C8JA 1WJ3A 3MRLB 2GSGB 1UXSA 1IKNA 5CHNA 3X13B 5EC1A 1JPSH 4OBRA 4CN4A 4U3HA 5INDA 4UT6H 5FOBB 4X6DB 3NCJH 1KCRL 1MCOH 1F97A 3FB5B 5KVFL 4MS8D 3WIIH 3BN3B 4PRHE 3TNMA 4MZ2A 1PG7L 5DZNA 3QISA 4JVWA 4XC1L 2NY6C 3CXHJ 1MJUL 2Z91A 4H1LB 3TESA 8CGTA 4MDJB 4IJ3C 3OKDB 3IAPA 4YDVA 4ENED 5HY9B 4UV4L 2PNDA 3U4BL 1RUML 1XGYL 3FFDA 4P2RB 43CAA 4LMQI 1QFHA 3K80A 1WFTA 5F89B 3NPZB 1MFAH 2ARJA 4TTDD 5JORA 3ZHLA 4YHYC 2X1OA 3MBXH 1HQ4A 4Y5YB 4MB4A 1MY7A 4FQ2H 2YC1B 3DSFL 3FB7B 1JYNA 3O2WH 4M7ZB 5HYFA 3H0TB 3OB8A 1CXEA 3QB7C 1DQDL 2HN7A 1CXFA 5C0JA 2NQCA 3SCMD 2H8PA 3BSZH 4LKCA 1RUAL 4MNQA 4X4MA 4CADA 4Q9RH 3T2PA 4X5XA 1FP5A 2FL5B 2W92A 1FZOB 4I0PC 5KANI 3TZVD 4M8QB 1NUGA 4HZAA 4NQTA 4EUPB 3ULVL 2FBJL 2P4AB 3ECBA 4WI8A 2IPKB 2FDBP 2ZUUA 2V7HB 3BT2L 3MOQA 4JRYA 4DKDC 5FA4A 4P2CG 5I9QC 4WI6A 2VLKB 4YDKH 4NYLB 5F3HB 1JFQL 5FB8B 1EH9A 5MP6L 4N0YL 2QHRL 2GEEA 3SDXF 1UZ6F 3GK8L 4HPOH 5T1LA 3S3JA 3SQOH 1DVFA 1JF6A 2JTDA 5JPMB 3QWOA 4QRQB 5T5FH 4Q2ZA 4BH7A 3KS0J 2RHEA 4RFNC 5ICYA 4PJXB 3UC0H 3BZEA 1XGUA 3EFDH 4Y4FA 1IGYB 4NZDA 3CCHA 1T0NB 2I25N 3MUJA 4WTWA 2FJFA 4M6OL 3ZHDA 3PJSB 1MIEL 4P4RA 5IHLB 5EFIB 5IB2B 3U7YH 4YQXH 3WN5C 2MOVA 4IS6B 4MB5A 1MQKH 5ITBL 3Q3GA 5IWLC 2ZJSL 3AB0C 4MJ5B 4NM8H 4AM0A 4R8WH 4LPYA 3BN9D 2E9JA 4WWID 1JNNH 4IRSD 4IRZH 1T7VA 3IJSA 4YHKL 4FXKB 1MCQA 1OSZB 1JI1A 4O58H 4PV8B 4HG4K 5C6PB 1M6OA 3RUGF 5CGYD 4X7DC 3D87B 2BHZA 4MX7A 2XWTA 2DKUA 4V2BA 4WEUD 3HN3A 5D7LD 5FHAL 2JCCE 3VDCA 1I1AD 3B9KC 1M7IA 2GYSA 4OV5A 4IOSD 1O7SA 3UTTB 3HA0A 4PJFF 4Z7UB 3MTRA 1MCLA 3BEVB 5IVZA 5DQ9A 3O11B 3GMPB 5AYQA 4OD1L 1WZKA 4F7PA 4LVHC 4KMTL 2DLEA 1JWSA 2XPGB 5C86A 5KVFH 4WUKH 4G7YH 1PG7H 5D7LE 1VERA 5F7HA 4PUBL 1MJUH 2HFEB 3E3QE 1H8SA 2GJ6B 5FO8A 2A77L 2C3VB 1OGAD 1GOHA 3GMOA 1FN4B 3QFDA 4UV4H 1ZT4B 2C7UB 1RUMH 3U4BH 5ESQA 3IF1A 3MUGA 1JZ5A 1VHPA 4P57A 3GUTA 5LCVL 2BVOA 3CIQA 4WGVB 4UTAH 3QHZL 4P5TC 5IBTH 1CFNB 3PP3K 5E95B 3DSFH 3P77A 2E6QA 5D8JL 4Y89A 1P5UA 3S98A 1BVZA 4ODXB 1DQDH 1CD1A 4MZ3A 4XCFH 1RY7B 2NPLX 4GQ9H 4UV7H 5HPMB 3C6LB 4JVUA 1O7VA 2VXQH 1RIUL 1KNOB 4RNRB 1OGAE 1HHIA 3OX8A 4JE4B 4F9PA 1S78C 2QADD 3DECA 4FXGA 3EOYG 5IVXA 3CVHL 3ULVH 2FBJH 4NN5B 1AO7D 4PRIB 5EU5A 3HNTH 1IQDB 3TIDB 1KPUA 1O0VA 4HULB 3RVUC 32C2A 5DURB 2HFGL 5C71A 3EHBC 1EVUA 3GMNB 4D2NA 2RGSA 4NC1E 2UWEB 1QLFA 4DWHA 2PO6C 1YPZF 5EA0L 3MREA 5MP6H 2QQLH 4NQDA 2Q8BL 2Q86B 3SO3B 5AD0B 3BFOA 2BCKB 2J6EA 4K3JH 5IW1B 1MJJA 1WCQA 5E6IC 1LGVA 3PWLA 1DQJA 2JB5L 1KLFA 3MV7B 1II4E 1AO7E 1NJ9A 3PABB 3MA9H 1UM5H 4HUUA 4N68A 4JKLA 4LLYB 5TE6L 4Y19D 3LN4B 2NY6B 2NY0D 3BP7B 1QLRA 1JGLL 1QEWB 4IJ3B 3DARA 3RKPA 3KPPA 4AEEA 3KPLA 4BM7A 5JNYB 5JPNB 1Y18A 1NLDH 2CLRB 3UMTA 2J4WL 2VZ1A 4NQSB 3RWFB 1S9KC 4QHMA 1A3QA 1LWRA 4WU5A 4KZDL 4JDTL 4LLQB 3CXDL 4YHYB 5IF0A 2YD5A 2J8UF 2N4IA 4XVSL 4DKEL 4OM1L 3QYCA 1G7QB 5FHAH 3QPQC 4BSWA 3NAAL 4WO4A 4KRPC 1P6FA 4Y19E 4R7DA 4GRWF 1C5DB 4PGDA 4PGZA 1OLLA 2AJXL 4ONGL 4Q9CA 4NT6A 1INDL 1VSCA 2R2EA 1KELL 2VR9A 2ZZUT 1GC1H 3UPAA 4LSRH 1CFVL 2PXYC 1X3DA 2A9NL 2WWKO 4OD1H 4O2CA 2X4OA 1G7PB 2DAVA 3LKOA 4K7PL 3CJJA 3K4ZA 2ZOLB 2NR6C 4KMTH 5I9QB 1KSRA 4LIQE 5LGJB 2H1PL 1RUKH 1UACL 3ET9F 4ZFOB 4OZFH 1IM3A 4PUBH 4PJCB 2A77H 1M7DB 2X1PA 4D9LL 1G6RL 3MGOB 1NCCL 5C9JA 4Z7WB 3QUKB 1OGTB 4RFNB 7CGTA 1B3JA 2YWYA 4JZNB 1B0GA 4RQQB 3VD3A 1KYOJ 3RGVC 2J5LB 1CZ8L 3QHZH 4DJMA 3QDGA 3LOWA 4ODUA 3T0ED 4XXDA 4JFED 1UKTA 4ZPVB 5GS0C 4U1JA 5D8JH 1SVZA 1LEKB 1DQML 3BDBA 5F7EL 3WN5B 2CUHA 1V7ML 3DTXB 2FEEI 4HWZA 3BEWB 1WAAF 3AB0B 3H9HB 2XG4A 3EYVA 4OFKA 5I8OL 4HUKB 3I6LD 1I7UB 1RIUH 4ZSOB 2MCG1 1SYVB 2NY2D 5D7JA 4RSVA 4QXGH 3BJ91 4A6YB 1A1MA 2AQ1A 2CIKB 4DGIL 4R4ND 5IHZA 3I6GB 2MQ3A 4Z7NF 3SDXE 1TTUA 4PRDB 2CR6A 2YPLA 1UZ6E 4NQCA 2EIBA 5HVGB 2HFGH 3E8UL 3H6JA 2GUOA 4MWFB 5IMKB 3T0EE 1BPVA 1JF1B 2NZIA 4JFEE 3QQ9C 3OAZK 3ZMRA 1AP2A 3B9KB 2EYSA 3L5WB 1LE9B 5DYOA 1K85A 5CZXC 3KXFD 3S5LB 4IMLA 2VLRD 3OF6A 4KROC 4HIJB 2ICWI 3VRJA 2FATL 1TVHB 4WCYL 5INCA 5EIVA 2XRAL 3SE3A 4HIXL 2EIZB 2XXCB 4LVHB 5DS8B 2UUDK 3T1FA 1HHJB 2AV1A 1IGMH 3STBA 3R1GL 5BQ7B 5I18H 3GHEL 1ITCA 2P7TB 3RUGE 1HOCA 1JGLH 4AENA 5ADOL 2O5YL 3RNQA 4EI5C 3EDJA 5F6IB 1RZ8A 2YXMA 4G6FB 2ATPA 3WXWL 3KXFE 1KC5H 2VLRE 1WIOA 4Y4KC 4U31A 3BO8B 4NPYA 3AS0A 5I19H 1MCWM 5FV2A 5IEKA 4JDTH 4KRLB 5F7YC 3WXVL 1EK3A 1U3HB 1A9EB 5FK9B 4J1UA 1IC4L 4P5TB 1I7ZA 4XVSH 3OKEA 1Q38A 4DKEH 4OM1H 3D0LB 2NY4D 4PJFE 5CIPH 2VL5A 2WINB 4X0KA 4L3ED 1F00I 5ISZB 4R96A 3PG2A 3F7RA 1F4YH 1WLHA 4DGVH 5BVPL 1RHHA 1U0QA 1YQ2A 1NBVL 4MHHI 4ONGH 3V8CA 4Q7DA 4KKAD 1A47A 2A6DA 2V9TA 4LU5H 3UYRL 4YNYA 1A6AB 5J3HC 1KELH 4CGTA 1HWGB 2APFA 2X4RA 1FNEB 2XTJB 3P40A 2A9NH 1CDBA 3KHOA 4HH9A 4OCYH 4F15C 5KOVC 5SWSD 1ZS8B 2VAAB 3VU2A 4KRNA 2AP2A 5L2JB 1IC7H 3WIHL 4WEBL 2H1PH 2ZUYA 1UACH 2DQHL 2HT2D 1MELA 2FJGA 1RZIA 1FSKC 4OLXH 5F7KC 3ZKMD 2PO6B 4L3EE 4WHTB 3TPUA 4PY8I 2X4TA 3IDNB 4P99A 3JV4A 4D9LH 4POUB 1FIEA 1JVKA 5IW6A 4M5YL 1N8ZA 5DVLA 3SEPA 4JDVB 8FABA 3I3DA 4TPRH 5E6IB 5E7BA 1JWUB 3MBEC 4JGJA 1MCPL 1TDQA 3NABL 5E9DD 4EIGB 3LS5L 2CO7B 4HJGB 4I0PA 1CZ8H 2C1OA 1GCFA 4YHOL 3OKOB 5DRWA 5SWSE 4XI5C 3RBSA 1QNZL 4HFUL 3B5HA 4N1HB 1DQMH 1V7MH 2QHLA 1IEBB 3P30L 5D4QA 1WBZA 4ZG1A 5I8OH 1FLTX 4YIQB 3SKNA 4CVWA 1WSST 3DX7A 1I3GL 4X6DF 4QCIA 3S35H 4U0RC 1LK3L 1BJ1H 3NOIA 4DGIH 1ZA3A 1GGYA 4XB7A 5FV1L 1LO3H 1AGDA 1YPZE 4JGUA 5HGBA 4M3JA 5E9DE 1J1OL 4ZDHA 3KPRE 3DURA 3EKCA 4F37F 2ARWA 2I5YL 4HCRL 1HQRB 4OLEA 4PJBB 3E8UH 1FFPB 3RWHA 1M05B 3V6BR 4Z0XA 2RFXB 5HI3C 3MNWA 4HG4J 1I8KB 4KRPB 4PREA 5D1QD 5GRJH 4ZOEA 1FCGA 2EXWC 4ODHL 4GXVH 4HBCH 2FATH 3DMMC 3RBGA 1IZKA 4L9DA 2PXYB 3NFPA 5I1IL 1MCIA 3WLWD 3CSPA 4HPYL 4HIXH 1JPGB 3VWJC 3NA4A 3IDGA 1B2WL 5KG9A 4P3CH 3EO9L 4N8VA 2ZUWA 3IKCA 1TCRA 4ALAL 4NO0A 3R1GH 4MA7L 4NOBA 3W39B 4OI8A 1MEXL 5C0NC 5GRYA 3GHEH 3IDMA 1A1NA 1S7RB 4QKXB 5CGTA 2H2PD 2J8UE 5CWSA 4GMSL 3RGHA 2Z31A 1BIIA 2XYCA 3WXWH 3BDYL 1FO0A 1CGSL 3ZYIA 4F80A 4J23A 2XY2A 4FFYL 2G75B 1NDGB 1JZ2A 1L6ZA 2ZSVB 3QCTH 4JJHA 1RAMA 1B0WA 4GRWE 1IC4H 3RGVB 3MYJB 5DD6B 3H7BA 4NZUH 1FNFA 1NCBL 1AR2A 3QG6B 3H8NA 2YPKA 3CFDB 5L2KA 3UJIH 1Z2KA 1UJ3A 2XWBA 4PJXF 2MSPA 4RFOL 5IHBA 2ZCLL 3QEHB 4EI6B 5GGSA 2P8LA 2DQUL 3ISWA 4U6YB 2OR7A 3UYRH 4P59L 2P42B 2GAZA 4JM2A 4J4PC 3GNML 1YEEH 2NX5D 1CDCA 3FQXB 3MRDA 5ESVB 4JN1H 5E08H 1K3ZA 2ICWJ 1P7QB 4JB9L 4N0UB 3WIHH 4WEBH 1R24B 2DQHH 4OT1L 1QRNB 1F4XL 1UM6L 1VFBA 2VITA 2HMIC 5FKAA 3GSWA 4KROB 4M5YH 4C55A 2BERA 25C8L 2XFXB 2ZUVA 5DMJB 2NZ9D 1JP5A 2IANE 2I24N 4NIKB 1YYMH 5D96C 3BKML 1MCPH 4NQXA 1KT2A 3NABH 3LS5H 4OZGA 4OZIB 2YBRB 3RL1B 1WAAE 5E7FA 2NX5E 1DBAH 4G80B 2UZYB 1QNZH 2H41A 1RMFL 4PR5A 1QOKA 5HYQB 4D0BA 4Z7UF 3IJHA 2B39A 4KKLD 2VR5A 5ALCH 4YHLH 3BWAB 5H2BB 5T1KD 4IOIB 3GKZA 5ENWA 4CJ1A 1JWMA 4GJTB 3P30H 4JM4L 5KS9B 4EI5B 1Q9LA 4Z7NE 2X09A 2UYLB 2AJZA 7FABL 2R56L 3CFKA 1U36A 1U8MB 2DQFB 1QPXA 4FABH 1D5BA 4Z8FL 3OGCB 1CE1L 5KSVA 3C8HA 4L9LA 1OP3K 1LK3H 5I1AB 1WZ1L 3QNZA 2K1MA 5GZNC 4QRRA 5CP3A 2JIXB 2IH1A 4M61B 1J1OH 1DSFH 4V1DB 4FTVD 2I5YH 4HCRH 4RX4D 1MCDA 5F3BB 4JO3L 1YMHB 1U8NB 4JN2A 3G5YB 4OCMC 3KNBB 4NO5A 3K74B 3RX7A 2K3TA 4ELMB 5DK0B 4ZUVB 2W65B 3CFEA 1U8IA 4JFXA 2BNQD 2R2CA 2CJUL 3CDGA 5BZWA 5I1IH 3V6OE 4P2QB 4PY8J 4F15B 3VFRA 3ROLA 2FR4A 1X7QB 3NIDE 4FQXD 1YJDC 1P84K 3MRPA 5F7FA 5C0CA 2AK4B 3BMWA 4FTVE 2PW2B 2VABB 1DEDA 4MA7H 1FSKB 3V4VL 3WO3B 4PTTA 4DN4L 2RAMA 1S7WA 4XCNB 2IALB 3FT4A 4PRPB 5HYJA 4JHAH 5F88A 5DEZA 5KSAA 3BDYH 4OLZH 1CGSH 3A0OA 5IW3A 4WFED 1NFDB 4K71C 3KYAA 4K3GA 4WWKB 2BNQE 3PWNB 3UZVB 1OAXH 5FDWA 1UA6L 2UWEF 1IRAY 2I26N 2IQAB 4R90H 3VFMB 1A4KB 2CIIA 2ZUTA 2I9TA 1NCBH 4XX1E 3NTCL 1D9KA 2FJHA 1MCRA 3RKDC 5EN2A 3C5ZC 4L29B 3Q6FA 3VFSA 2Z92B 4G9DA 4OD2A 1MHHA 2Z8WC 3N1QC 4NO2B 2EDXA 3L3HA 4YC2B 3L7FB 4FFWD 1LP9A 1CT8B 4Y16C 3KPSD 2VXUL 4WTZA 1FHGA 1CFQB 1D5ZB 2X9WA 4LGSB 4ODWA 4WFEE 3GNMH 4YJZL 1XZ0B 3G6AA 5CJQH 4WJ5A 4ZPTA 2LV4A 4Q6IC 4Y5XA 2E7MA 5GGQH 3QO1A 5CBAB 5T3ZL 1UVQB 2OL3B 3WJJC 2AJSL 1H3XA 3KR3L 1UM6H 3H9SA 2HLFC 4AY0A 3OKMA 2CSPA 2FLBT 1A6VL 3WNKA 25C8H 3KPSE 4P2RD 1S5IH 4KQ4L 5BV7L 5C3LD 1FL5A 4CVXB 5GGRY 3FTGB 5IFHH 1TTFA 4MJ6A 4GW4B 3VWJB 2BXZA 1XFPA 5F9WC 1KTRL 4WV1C 4NBZB 3MODL 1RMFH 2FECI 1XGRB 4X6DE 3VXSA 5GZOD 1WUNT 5F9OH 2AQ2A 1R3IH 5DMIL 1ZOXA 2LTQB 2VDLL 2QSTA 3HR5A 3ARDB 4TNVF 7FABH 2R56H 3L3KA 4W6XB 4Z8FH 5CGMA 4P2RE 1ZT1A 4OIAA 5JOFA 4OQTA 4ZO9A 2YN3A 4JR9L 5D7IB 1EJOL 5DGQA 1SEQH 2BC4B 4X8JA 2Z35B 2JK5A 1KIPA 3D18A 3PWPB 4TVPL 2WIIB 4RBPK 2YSSB 5DD1H 1U6AL 5FYLH 5M7QA 1NGQH 4GAJL 3RWEA 4Z7WF 1N0LA 3IRZA 4G8EA 1NBYB 3RDTA 1QSVA 1HH9A 3DX6B 1CCZA 1FDLL 4PJHB 3LKQA 3RVVD 1MVUB 1F4WL 2CJUH 2VWEE 4D0CA 1BVLA 1U93A 4U3XA 2YRLA 1ZKAA 4G6ML 4J3SA 4Y4KA 3ARQA 2I9LA 3UDWA 3UYOD 4L1HA 3QQ3B 5I17A 4JQIH 3VMOA 4P23C 1Q72L 3DUUA 3V0WH 4APQC 2H32H 4DN4H 1H8NA 4ETQA 5ID1B 3LKNB 3QUZD 3SDAC 1JV5A 3IETB 3QUYD 1CIDA 3OKLA 1UM4H 4NNYB 1A21A 3H3PH 5CEZD 3I84A 5D96B 5IB1A 4JJ5B 3ARUA 3HTLX 2WQRA 3KWWB 4PJXE 1JHTB 1KFAH 1NH6A 1T5WB 1RJZB 5E8EA 2GTZB 3RWGA 4PGBB 1XR9B 3U30B 1UWXH 4FN0A 1VEMA 4ODTH 3H9YA 3LAFA 3CFJA 4D9QD 2PETA 2BVQB 3UTTD 3MOAH 1FNSL 5CFHA 1W8OA 2P8MA 4X6FA 2I60L 5CEZE 2PTTB 5I1JL 4OI7A 2ZNWA 2FIKA 2ZKHL 4Z95L 5C6TL 4J6RL 4OGXL 3S34L 3MBEA 1KBGH 4Z0BH 2JELL 4KXZH 2Y6SC 3BD5A 4JRXB 2AJSH 5ACZA 5GJSL 3N9GH 3KR3H 1EJ6A 1MH5A 1A7NL 5DQJB 4M6ML 4U05A 2GJ6D 1QKZH 1YEDA 3LY6A 1HYSD 2BNRB 4MAYC 1A6VH 3V6ZA 4D9QE 5E5MA 2VQ1B 4JY4A 3GI8L 5BV7H 3AM8C 4M1CC 3UTTE 4Z7UE 3RY6C 4H0HB 1NMCC 2YUXA 3GJFH 3ULUC 3IFNL 4JANA 2AK1H 5EDXA 2IH3A 3PQYB 4TSCL 4A2MA 3VFGL 3MODH 4KK9C 1S9VA 1U95B 3S4SA 4HKXB 2J1KA 2XACC 2ZP0T 3HC3L 4PV9A 2OQJB 2YUVA 3DRQA 3HI1B 5H94B 4S1DD 3EJJX 5DMIH 3TIEA 1J0JA 3K46A 1MWAB 3BPLC 3C6LD 3U2SA 1AGCB 5B39B 3G5XA 2GJ6E 4GKSA 1I4FB 4P2OA 4NWUL 4PP2B 1D6VL 3D9AL 4OUOA 4K71B 1BD2B 4M03A 1MCJA 4LPXA 1JGEA 3QNXA 5IEHA 2F8VA 3LCYA 5FIEA 4JR9H 3TV3L 1EJOH 5DD3H 1T83A 3UPRA 3BDXA 3DMMA 4TVPH 4U1NA 4CMMA 1HHKA 4HV8A 5DURD 4U1SB 1U6AH 4NCC2 2IEPA 3ZKSD 2B1HL 4GAJH 3QIWA 1GC1C 1ZT7A 1DEEA 3GMOB 1HINL 1M71B 1J5OH 2CQVA 4Y16B 4H5SB 1FDLH 4CNIB 2ZOKA 3MUGB 4Z5RA 1NPUA 5D6CB 5GSRB 5D1ZA 3BQUC 1EO8L 4G6AC 4EN3C 4G6MH 2DBLL 3AVEA 1GH7A 4Q6IB 3ZKXC 4JHBA 4LCIL 3ZTNL 3N1MC 3VI4F 1EUUA 1KJ2B 4OLYH 3QHFH 3MRQA 1Q72H 1NEZA 4DFHA 2NY6D 1TZGH 3BI9X 1EBAA 2D4DA 2UWEE 4KHTL 3GRWL 3LIZH 4QEGA 1HHHA 4J3XA 3GB7A 1BVKB 4QTIL 4PJBF 4KUZL 4I48B 4L8BB 4O02L 3G6DL 5A2IH 5FYKD 4PRBA 3FT2A 3LEVH 4Y5VC 5F9WB 4WV1B 1X5KA 3C9NB 1R3JA 1Z3GL 2VERN 3F58L 3QXDA 2VDMH 1FQ9C 1UB6A 1K2DA 4M1DL 3TLRA 4JFDB 1ED3A 3OPZL 1A4JA 1HXMB 5C09A 5C70A 3RJDA 4UILL 1FNSH 2FEDD 3ZL4L 4DZBB 1JGDB 1TZHA 1EFXB 2X1WL 4GG8B 2DB8A 5I1JH 5I1LB 5IMOA 3O6MH 5J1AA 5FYKE 1RK1A 4Z95H 4OGXH 3S34H 1KV3A 4KDTC 4XVTL 2HTLD 3UX9B 3Q6GL 1W8NA 4FP8L 4JQXA 2BVUA 1PX4A 4NZTL 4OLVL 4YK4C 1FH5L 4M6MH 3VWKA 4K94H 3VXRB 3IDJB 2DWDA 2B8OT 3HAEA 3GI8H 1I1FB 4HK0B 4JPKL 5GGRB 4HWBH 3BIKA 3WFCL 2IGFH 1CL7I 1BFVL 4XGZA 3IFNH 1F6AA 2NY5L 4TSCH 1I8IB 5J8OA 5CMAB 1JCKA 3NZHL 4R6UA 3HCVA 3B8SA 1VKXB 3HC3H 1BQHA 3RHWF 1Q94A 4LPVA 4APQB 5IB3A 4XCYA 1U92A 3PV6B 3JWDC 3KVQA 3SDAB 4JFZL 1H3UA 4FNLL 4FQ1L 4PJIB 5DJ8A 4PJCE 1P84J 5EUOA 1QA9B 4NWUH 3D9AH 3OXRB 5ETUA 3O4LB 5KTEL 3AREA 4UUJA 2XG5A 4X5WA 4GAGL 5MEQB 3RWIA 4UT7L 4Z7WE 4JCMA 4B53A 1BBDL 3TV3H 2VDRH 1HCFX 3LKPA 4HKJA 3P73A 3V4UL 3DJ9A 3TYFA 5CSBA 5K93A 5TGBB 2WK2A 1T4KB 2QKIA 4X99A 5JW4R 3GSRB 5DVOA 1TXKA 3MRGA 3B9KD 4JO1L 3ZDXF 5E24E 1HINH 4KKNA 3X3GL 4OZIF 5ESAB 5I8CA 2HWZL 3QI9B 3NGBC 4H26B 1J8HB 1CXHA 1NLBL 2UZIH 3NCFB 4LBEB 1CF8H 4NJ9L 4LNVA 2DM4A 1CD8A 4LIQH 1T5XA 3RPKA 4DTGL 1EO8H 4MYWB 3EDEA 1I8MA 1BQLL 2NLJB 1SBBA 4P4KA 2V2XB 5KS9F 1F11B 2YD2A 4LCIH 2QLVB 3MLUL 4KJQC 3ZTNH 3O6FC 2XKNB 2D7MA 4IOFC 3TJHC 5J9PA 4LLMB 3MRIA 1IARB 4KHTH 2WUCL 3GRWH 3C5ZA 3IDIB 1CICA 4MAYB 1V8HA 3FKUS 1P2CB 3MOBH 3C8DA 5ERWA 5ACMA 4KK8C 3DGCR 1MSPA 4QTIH 1NBZB 1NMCB 4HUWA 1A6UH 4O02H 1FNHA 1Y0LA 4MLSA 3QZWB 1U3HD 5C0EA 3RX8A 3FO1A 4P5TD 4LF3A 1NCDH 4EDXA 5HDOA 4ELMF 3RAJL 2GUOB 3OAUH 1AXSB 1BOGA 5DJZA 3TWCL 4O9HH 2VSCA 4Y4HB 3HZKB 2Q6WB 3RTQA 5ISZD 3CK0L 5DYOB 2A6IB 2DQTL 4TUOB 3BPLB 4M1DH 5I1EH 2CLVB 3KS0H 2X41A 5DEFA 3OPZH 3MXVL 5DHXB 5JW4Q 1QFWI 3WJJA 4UILH 2EIEA 4LCYA 5BMFL 1S78D 3SQBA 4NC2B 2XTJD 3ZL4H 1PBYA 4GRLB 3T2NL 1VADA 3DVGB 2W9DL 3RVUD 1UZ8B 4M1GL 4XVTH 2R39A 3QUMA 4PJ5A 5MENB 3KPNB 4FP8H 3CUPB 1NFDF 3CH1B 4H25B 1BGXH 4NOFA 5I16B 4NUGL 2PO6D 5ISZE 2N1KA 1FH5H 3OV6A 5D9SB 1RIHL 3SDCA 3HI5L 5KSBE 5L7XH 2HFFB 4HKBB 4JG1L 2DTML 4FQPA 3U82B 3QH3B 3V52H 4DEPC 1OF2A 5E6ID 3BQUB 1BFOB 4JVPA 3WNMA 5JOPD 1BFVH 3ULSA 2XTJE 3BVNA 4EN3B 5D71L 4YZFF 5GIRB 1YMMA 1U3JA 1X5AA 5IR1B 5EO0A 4YHIA 2BSSA 3U1SL 3QUXB 4FHBD 5CBEA 2R69L 4U6XA 2XNAA 2D4FA 3HZYB 1X4XA 4G3YH 3T0VA 2B0SL 2H3NA 4FQ1H 1EHAA 4B41A 3CVIL 1W72L 4X5LA 1CG9B 1PG7W 3SE9L 5KTEH 3SDDC 3CPLA 3LQMA 2R4SL 4LQFH 5ITFB 3B3IB 5EBWB 1QFPA 1SY6L 5GRVK 2YK1L 2ESVB 5C0DA 2PW1B 2G60H 5JOPE 1BBDH 1KLGA 4RAUB 4Y5VB 3STLA 2H9GB 3GSNL 1ZA6A 3EGSA 4ZUSA 5J06A 4MNHA 1SJVA 1OP5H 1HXYB 3HNSL 3DVIA 3O45A 3G04B 2X4TB 3Q5YA 4S11A 1RPQA 5ID0A 4KRPD 3QG7L 4JO1H 3MRBA 3MJ6A 4KGJA 4UNVA 2HWZH 4P23A 1GPOL 2Q8AH 5HD8C 1NLBH 3QJHB 3PL6A 4NJ9H 3VRIB 2ED8A 1Z5LB 1YEGL 3VI4E 2D31A 2PXYD 4DTGH 3H2WA 3B5TA 1FV1A 1JRHI 1BQLH 3Q2CA 4IDLA 3FQUA 5FM8A 2NR6D 5C1MB 1OP9A 2Q20A 4A2LA 1EEQA 1MRDL 3WFDL 4P3DB 1ROWA 1H5BA 3MLUH 3KPMB 1REIA 4ZQKB 2BZDA 4LAJH 4PJBE 1NGZB 3CH8A 2F5BH 5JOEA 4YK4B 3PV7A 1C08A 4YAQA 5EO1A 3P11L 1N64L 5C07A 5F8QC 5D7IF 3I3BA 2WUCH 4JZOA 1N0XH 3ZE1F 3CSYA 1KPVB 4QT5B 2IJ0C 3MRNB 4AEIL 1D6EB 4W4OA 1ZVYA 4OF7A 4EQ2A 1CGUA 2Y5TB 3P0VH 3UTSB 1FLRL 3RGVD 2XN9A 4BZ1L 3O2VL 3RAJH 1V3JA 4PJHF 4ZFGH 1RU9L 1I8LC 1JUFA 3VE0A 4H8WL 5AYUH 2CGRL 4Z77A 4P46C 3CK0H 4FQQB 2R23B 5TFSH 3QDHA 3WUWA 2DQTH 1DBML 1JGUL 3BZFA 1OCWL 2DF3A 4LSSH 1QG3A 5DLMH 1UXWB 3FRPG 4KJWC 3BP5B 2X4PB 3LMJH 1RZJL 2A74B 3C87A 3T2NH 1KB5L 1P9MA 1NC2A 5DJDB 4M1GH 1P7QD 1EHNA 4D94A 3RX5A 1QRND 3QQ9D 4NO3B 4NFDA 1T04B 3MRFB 4NUGH 1IGJB 4YWGL 4FZ8L 3FN0H 2R1XA 4U1GB 2D7QA 1RIHH 2HP4A 3G9AB 2A73B 4QRSB 5CZXD 4LARL 1LEIB 1S7XA 3MV8B 3WKML 3C8KA 3NGBB 4KROD 4L3CB 2Y4SA 1XR8A 2DTMH 3SJVA 5IKCA 5I8EB 1Q9WB 2R2BB 4ZAKC 3F8UB 3EDKA 3MRHB 3T1WA 5KSUB 1U91A 4KJYB 1ZSDB 2I07A 1WZMA 4X98B 5D71H 4GG6B 3TNNA 2W0FB 1DQTA 5L8JB 1F2QA 4JFFB 1KEGL 4IHOB 3U1SH 3MMEA 3DUSA 4DFIA 2R69H 3O6FB 4HX1B 1U58B 3NBNA 4YO0A 2APTA 1QRNE 3U0PB 4EI5D 2B0SH 1KUMA 1JTOA 3RQ3A 3V5HA 4N0FB 4NRZA 4GRWH 4LL9A 5ILTL 3SE9H 4F7EB 4GW1A 1I9JL 2MPAL 2R4SH 4E5XA 2RBLA 4QHNB 3LHPL 2YK1H 4LEOB 3LPWA 1IEAB 2JIXD 4PJGA 4YEFA 4V1DD 5IHUH 4OZIE 4AIZA 3HNSH 3ARBA 1T22A 4OZFA 1NAML 3QG7H 1ZLWH 1U42A 1QBAA 3L9RA 4XBGB 1S5HA 5E8NA 4I18C 4DKAA 3HE6A 2MCPL 5KS9E 2DDQL 1GPOH 3I85A 5DFVC 4PB0L 2GCYA 2IPUG 5J3HD 1G7HA 2X4SB 4I1NB 3O9WC 1OB1A 4P2QD 1GGCH 5B38G 2OMNA 5F1IA 3EYQC 1MRDH 1NGPL 2AK4D 1J18A 4V1DE 4PTUA 1JZ3A 1W0WA 2F54A 2P1YA 4OCSL 3S96A 5IMLB 2G9HA 4XHJD 5TDNB 3LDBC 3B9AA 3P11H 3VXPB 4D0DA 4LCUB 4PRPD 3WO4C 5DMYA 2BVTA 3MRKA 4ELME 1ZWIA 1PAMA 4I4WA 5F70A 4DEPB 1JPST 5LAXA 5KVMC 1G7LB 2VIRA 3TFKC 4XP6H 4WWKD 4M9OA 3DYOA 2H45A 4AEIH 1A3LH 2GFBB 3VFVA 4XX1G 5DSCA 4UQ2B 1FLRH 3FOLB 2CMRL 1T1XB 2QSVA 4P2QE 3N85L 3SGDH 4BZ1H 3O2VH 5GGVH 5IFJB 2FZ3A 5JQ6L 5BW7C 4H8WH 1S7TB 3DBXA 3MR9B 2DQEL 2HA1A 2R2HA 5GGTL 1DBMH 1JGUH 4XH2B 5MERB 5LBSL 1PQZB 1OCWH 3GSVB 4PRPE 4ETYA 4C54A 4TVSa 4BUHA 3SDDB 3DGGA 1L4IA 1NFDE 3WEXB 1BF8A 5IIEA 3WUZA 3IFLL 1KB5H 5C0CB 1A7RH 3P4OB 5E4EC 4OCWL 1A8JH 3MXWL 1IL1A 4NKMA 4TUKL 5HI3D 3PWJB 2R9HC 2FBOJ 3ZKNC 2GW5A 1QACA 4Y1AA 4YWGH 4FZ8H 2R1YB 4LLVA 1QUNA 5EZOH 1OAQL 3UTPD 4YZFE 5HTSA 3ARGA 2EXWD 3WKMH 3GIVA 1K8IB 5GISL 4GKNA 2V5RA 3HHRB 5H37G 2DOCA 4BH8A 4PLJC 2O93L 4OLWL 5DK3A 2DLTA 3VWJD 1FZMA 4PJAA 3F5WB 3QEGL 4XZUA 2FYYB 1KEGH 1U3ZA 3KJ6L 3ES6B 3RWDA 4DZ8A 5CIPA 3CC5A 4JO4L 3UAJC 2FO4A 1P7KA 4IEFB 3WFEH 1U8OB 2HRLA 3REWB 3ARDD 3W5NA 4NQUA 3FQTB 3MLYH 4IIQC 2HH0L 3UTPE 4MS8C 1RZ7L 1MLCB 4U1MA 5EU4B 5ILTH 5IK3B 1I9JH 1MCCA 5DEGB 5DJXA 3G6AB 5KAQF 3LHPH 2P43B 5D6DA 1N59A 1ZEAL 1H0DB 3PWPD 3U0TA 3V8OA 5FECA 5C0FA 3JV6B 9CGTA 2DQGL 4XC3H 3VFOB 6FABL 4P46B 1JK8B 4Y8AA 4TTDC 5FO9B 5CEZL 2YR3A 4RZCA 3VXTA 4ODVL 4PB0H 4HC1L 2R0WL 5EIIB 5SV4A 3AS1A 2CPCA 4J4PD 3MZTA 5LWYL 1ZANL 2N7AA 5DRNA 2D7OA 5KN5B 5J13C 1FAKT 1QHPA 2CRYA 1IILE 5D7IE 1JPFB 3LS4H 2UVEA 4PJIF 3PWPE 1CDIA 3RVTC 5DJ0A 1KIQB 4LVNC 1PZ5B 4OCSH 1YEKL 1LO0H 2C4FT 1G7JA 1YC7A 1SVCP 1FGNL 3GBMH 5B3NA 2HMID 3TO4A 2YD3A 3IXTB 1QR1B 3BH9B 5IT2L 4ORGA 5DHYB 1WCBA 5H37H 5DUBB 4PJ9A 4PJHE 5ICXA 5DRZB 1KLUB 4ZAKB 3VFPA 4X8XA 3VG9C 2OP4H 4OAWB 4TUJA 5TDPB 2YUZA 4P9HH 2CMRH 5E2UH 4LDLB 1P1ZA 2AV7A 5JQ6H 3E6FA 3MO1B 1L7IH 1DUYB 4H1LH 3K3QA 1E6OL 2VQUA 5D1XA 3R4DA 5GGTH 2FO1A 3EJZC 3KYNA 5T1LD 1A5FL 5LBSH 3MCLH 4DN3H 3G5VA 5FA3A 2R0ZL 1NUFA 1TVBA 3P9LB 2X7LA 4LSPH 3WE6A 5EB9A 4G8FB 4X6BB 4G7VH 5GZND 5I17B 4IRSC 3LRSB 4LHQB 3UTOA 1UQSA 5L8LB 4JY6B 5IBLC 2V2TA 4HXAH 1N5AB 1V05A 3VJ6B 5JIHA 1FYTA 4TUKH 1EERB 3DI3B 4JRXD 1CE6B 2VUYA 5GPRA 3P9MA 1G7IA 1MCNA 3ULUF 3AS3A 3LQAL 4ELKB 1XGQA 1FZKA 4HF5L 4HMDA 4PRNA 1XIWA 4E0RB 2BNRD 3ARFA 5GISH 4N0CD 2ITCB 3LPGA 3E3QC 2CUIA 4HS3A 3EOAA 2DJUA 3BESR 5HHNA 1BZ9B 1A0QH 4KK5C 4KTDL 5HJ3A 1I1AC 1WGOA 4JG0L 4NHUA 3FQRA 4MHHG 4OLWH 4O2FA 2BOCA 3FAWA 3PQYD 1F3JB 4J8RA 3QEGH 4LP5A 1EFQA 3G5ZB 1ZLUK 4UIKL 3D3VB 1XCQB 2VDKL 4JO4H 4WI5A 3U7WL 3OR7B 1WC7A 3PP3H 3OJDA 3LDBB 2C1PA 3MQIA 2ADFL 4KRMB 3TBWA 3C5JA 3MRJB 4RAHA 4I8DA 2DI8A 2P46B 3QFJA 5J57B 1RZ7H 2BNRE 1BD2D 5BOPA 1RD6A 3GSQB 2HJKB 5FM5O 1C5BL 4PJDB 4GUPA 1TENA 4XPBL 1AKJB 1ZEAH 4G43A 1XH3B 3T4YA 3DSNA 3SKMB 1AGEB 3WIHA 3PQYE 1XCTB 1NSNH 5A2LH 5IBUB 2DQGH 1SMOA 2PKDA 2EH8L 5DO2C 4R7NA 3FT3B 5IB5A 1I75A 2W91A 4YGVA 4MAUH 5CEZH 1INQA 4Y16D 4YE4L 1RULL 5F9AC 1X5IA 1NGYB 5C0AB 3REVA 4HC1H 2R0WH 5FYKL 4UMGA 2ERJC 5I66B 5LWYH 1BD2E 2P24B 3C60A 5I8KH 5HHVL 2N7BA 2P5WB 1E4WL 1NKOA 1S9VB 4I2XA 1P4BH 4K94C 2FLRT 3CSBA 5HYIA 5BJTB 2C26A 3BW9B 4M00A 5B8CA 3ALXA 2VDQL 3SKJH 4X4YA 1LNUB 1T1YA 1MFEH 3MCG1 2KDGA 1FGNH 4TQEH 1MI5A 2HLFD 1ZVSB 3C2AL 5IT2H 4N90E 2ICEA 1MHCA 5EU3B 1UB5A 1JGEB 1FFOA 2PCPB 5CUSL 5EIQA 2VXSL 1KPRA 2EDEA 3VFUA 1B88A 4QGTA 4HCRA 4ZFOL 4CRPA 3BZ4B 1E6OH 1TETL 2Y72A 4RFEA 5K9JH 2BVPA 1PDKA 2BHUA 4NQDD 1WT5C 3BPCA 3IJYB 1AD9B 3GMQB 3PHOA 4JFDD 1A5FH 4ZXBA 5E2VL 4MCZB 4XXCC 1IFHL 4IIQB 5CZKA 1KCKA 4QHLB 5K9QI 1EXUB 2CKBB 3W81A 1TZIB 1F45A 5ANMB 5IG7B 2NY0C 5IVXE 3QDJB 3VFWA 1EFXD 3TPKA 1PKQB 3L3OA 4K23H 3V4PH 3KYKL 1I7TB 3VH8B 3VXOB 3B5GA 2X89D 5HHMB 3OWEA 4PJ7A 1MCEA 2X6MA 4X7TB 3P2TA 3WLBB 2F8OA 4CDHA 4MD4A 2DLFH 5IQ9B 4H88H 3LQAH 4JAMB 4NQDE 3VXRD 5CKGA 4NKDA 1Y6KR 5CS7A 4JFDE 2DKSA 4NN7C 1CYGA 4XWOC 3EZJB 3VG0L 5D72L 3LSOB 3OTTA 4KTDH 4JG0H 2OXHA 3CFBB 3SE8L 5J13B 4DK3A 4QLRA 1OARH 2BRRH 4WHYG 1CDHA 1BWWA 4UIKH 2VDKH 2VSDA 1HH6A 1ORSA 1UB6B 5DC4B 5JMOC 4LVNB 4QXTB 3D25A 4APQD 2YRZA 5EOQH 5I76B 2FCBA 4GH7B 4WDIB 5IESH 2GI7A 3D6GA 4MA1C 1NAKL 3MRMA 3QIUA 1WBYA 1X5YA 4NRYB 4DVBA 3RIFF 1CLOL 3VG9B 1BWMA 1HILB 4B7LA 4I18A 1C5BH 4XPBH 1T3FB 1W0VA 1DQQB 3U9UA 1EHXA 4WNQA 4O51A 3I75B 3OR6A 4GMTL 1T1ZA 2K9UA 2Z4QB 3O9WA 3C09C 5EORH 3EO1A 5TH2B 1QYGL 1IGTB 2L4OA 4MXVF 4JHWL 1V7NL 3VWKB 2VISB 3FQWB 4G8GB 1N6QH 5IM7A 5FYJL 5TDOA 4GG6F 3OJVC 3QI9D 4Y7MA 2MKLC 3T0EC 4QWWD 1J8HD 4I3SH 4F7MA 4PJIE 5KVGH 4OD3L 5FYKH 2DL2A 5EULV 1K8DA 1SJHA 1UCTA 4IRJC 1TJIL 4HHAB 3HG1A 2MHAA 4IRSB 4BYHA 1E4WH 1ZXQA 1BQHB 4F58L 5LQBL 1T1WB 4U1HB 4LCCC 2KPNA 5JIPA 3GJEA 5C92A 5DC0A 4FZEH 1WTGT 1I3RA 3S5LG 1G6VK 5BW7A 4P5KA 5J6HB 2DBJA 1IE5A 4MAYD 3C2AH 1BX2B 4M1CD 1J8HE 2Q3ZA 3ILQD 5CUSH 5E2WL 4M5ZL 4NUJB 4XNQA 3ULUD 3AAZA 5A2JH 4LSQH 4HZLA 4WHYH 3B2UD 5I30L 4NNPL 1IKFH 2ZPKH 3V5DA 1EGJL 1FNAA 43C9B 1UYWL 2VLJA 1KJ3L 2AJ3B 4KK9D 3R06B 3BIBX 2IAMA 4Y4HD 1TETH 5D7SL 3FO9A 4L4TA 1GSMA 3E2HC 3GO1L 3NN8A 1HYRC 5C0GA 4X80L 1S9XB 3ZE2E 1IFHH 2D0HA 1RZGB 2BSTA 4YBHA 2OJEB 1NGXB 1BBJA 1EAPA 1QSFB 1X44A 5I74C 3SGEH 1QBML 1VFAA 3EO0A 2FGZA 2X4UA 4GRLD 4XPHL 3G08A 1FVCB 1JMXA 2VLLB 4PRHA 1G84A 3KYKH 1R6VA 3ULUE 4GKZA 1ZHLB 2YPLE 1R3HA 3BRGC 1QLEL 1R5WA 1L7TL 4BJLA 2H32A 2WUBH 4WFHE 1AD0A 1A7QL 3TH4T 2YUWA 1MIMH 4J12A 3BGMA 1GYAA 3HE7B 4HGWA 1QQDA 4I5BA 4A6YH 1RURL 2W9LA 3AXLA 1E28A 4EEEA 3BQUD 1OLZA 2ERJB 4MNGB 2BRQA 4G6AD 3FONA 1XAUA 5HI4D 3BWUC 4OBSA 4M48L 3UYPA 1Z9SA 2GJZA 1R5VB 3GSXB 3VXMB 4UQ3B 3OKKB 1D5XB 3Q5OA 4HSQA 4J2XA 3WHXB 2VUOA 3QUXD 5C08B 3OZ9L 4UIMA 1VACA 4OIBA 3GMRA 5EOTB 1T20B 2DRUA 1AGFB 3IRPX 2CRIA 3NCYP 2P8PB 4UDTB 5DEFB 4JZJC 5J6GA 1NAKH 1Q0YL 1H3WM 2NNAA 3BXNB 4WU7B 1BLNA 5I1CL 1BHGA 2HT2C 1CLOH 1I85C 3HNVL 5AAWA 2ZSWA 1GVIA 4PIRF 4PRAA 1WITA 4HFWA 1VADB 1AHWB 2ESVD 2P45B 4LDOB 2W07A 3MFFB 2UY6A 1N2RB 4GMTH 4EBQL 3T8XB 1YNKL 3SCMA 3VA2C 4JHWH 1YN6A 3FN3A 1V7NH 5L6YL 4OKDA 3S3PA 1KIRB 1GL4B 3TZVA 1OF2B 4WFFD 4ORZC 4NRXB 3L7EA 3TBTA 2E8YA 4UOW0 3GJFA 3SY0A 1A7PL 5GS0L 2ESVE 2ICES 3CDFA 1FG2B 2EDFA 4AG4H 2FSEA 5J89A 4JKPL 3ZZ1A 4F58H 3ILPA 4P48A 5LQBH 1QBLH 1MHEB 2G2RB 1G7MB 3U79A 2CDFA 5IB4A 1DN2A 1BM3L 3PGFL 2R0KH 2YEZA 4KI1A 5CILH 3QXAA 1KG0A 4NN7B 5DI8A 5IMMA 2EYRA 4WW1A 1S7QB 3L3JB 4WFFE 4ZS6C 4UOJA 4M5ZH 4BSVB 3PGDB 3HB3C 2WIMA 2DM3A 5I2IB 2JCCA 1RUPL 5I30H 3AY4C 3X11B 1Z9OA 4D8PB 1EGJH 1CLCA 3TH2T 1KJ3H 4QXWA 5TF1H 2AXFA 5D7SH 5SX4H 1LK2B 3GO1H 5A3ID 4HXBL 3OXSB 4YBLC 1KCLA 1UADC 1IGIH 4X80H 3TBSA 4ZTOL 4PP1C 1LE5B 2F53B 1Y6MR 3WD5L 4Z76A 4R26L 2DD8L 5I6XB 1Q9KA 3W0WB 1UH3A 3FFCB 1C12B 2L0DA 1NCUA 3MRCA 4EXKA 3TF7C 3RL2A 5L88H 4Z78B 1NGWA 5AUMA 3NIGF 1QLEH 3BH8A 1I1AA 1KJVA 1L7TH 2X4NA 4WGWB 5BVJB 5LGKA 1HN1A 2YWZA 1A7QH 5EBLA 5HGDA 4R4BB 4EQ3A 5IJVB 3EOTL 3EIFA 2A6KB 3BYYA 5FUCC 1L9MA 1KXQE 3T0EB 2IPTH 3CZFA 5DUPL 3NPSC 3O0RH 1MF2L 1EAJA 4IRJB 3RU8L 4JRWA 2RCSL 1JHKL 3X17A 5FFLA 5CP7B 5HPOA 4JFFD 4RAVB 1HSBB 4HEME 1WBXB 1N3NB 1QZ1A 2AXGA 4MQXC 1KJMA 4KJQD 3DVNB 5DMKA 1OGAA 4L8CB 3O6FD 1CFTA 4RWYH 1P4LB 3AC0A 4IOFD 2BSRB 2VNCA 4PG2A 1G9EA 1Q0YH 1DTUA 5DRXB 5HHQB 3CMGA 4OLUL 4KK8D 4LFHD 3DXAB 4NDMA 1AI1L 3HNVH 4LASL 3D39B 4MD0B 2YKLL 1OP3H 4UU9A 2KH2B 4GG6E 3TBVA 2NZ9C 4HJJH 4HS6B 4JFFE 4PD4J 1QFWM 3E2HB 3CFIC 3MUHL 5L6YH 5HGHB 5DFWH 4GQPH 5D7KD 4GAYA 1R5IB 1AO7A 1NC4B 2IADB 1CU4L 5C0IA 5I74B 4HWBA 4OIIH 5GHWL 1A7PH 5GS0H 3IVKA 3RWJB 1NFIB 2F74B 2HG5B 3O2DH 4RIRA 3FO0L 2VQTA 4U6HA 3LEXA 5GGUA 2Q3AA 1OD9A 1RZFL 3SOBL 1PD6A 4PJDF 3MA7B 5F7DA 1E4XL 1VENA 3PGFH 4GBXC 1Q1JL 5FHBL 5EBMB 3THML 2DQJL 5CZVH 1WT5A 3GSUA 1HHGA 2YZ8A 3MLVH 4KC3B 2EO1A 4O2EB 5E00B 4OZGE 4YHNB 4Y19A 1AGBB 5DVMA 2GSIB 3EYOA 2D7TL 2VDPL 4Q97A 4F57H 1JNHA 2LU3A 3O6LL 1MRFL 4HXBH 3RIAF 3F7VB 4AH2B 3AU1A 3BGFB 1FCCA 5DK2B 4FQXC 5CSGA 4JZJB 4WW2C 4ZTOH 3LRGA 4LRNL 1ORQB 5E1AB 5JLZA 2A2QT 4LKXB 5FKPA 3O3EB 4MCYB 2CK0L 3SDDD 1VESA 3VXNB 4R26H 2DD8H 5I75C 1ETZA 1UKQA 3C08L 1UEMA 5I71C 3TN0C 5F1IB 1WWAX 2ILLA 5C0CD 1FZJA 4KHXL 3ZTJH 2E5EA 1SM3L 1EEYB 1RJCA 5DJ6A 5EZJA 5GRWA 1B0RB 3EUUA 2GKIA 4F3FB 5FF6B 3KPRB 3L6FB 4L8SA 2BOBA 3GRWA 2Y7QB 5HD8D 3CVHB 3VDAA 1U9KA 4G42A 4OUUA 1KENL 5BRZB 1MF2H 1A2YB 5FCUL 2SEBA 1E6JH 3I3EA 2IMMA 3GKWL 3RU8H 2RCSH 3BP4A 5EH1A 5F93C 5K59F 1OAUH 3ZE0E 3BOVA 4FMKA 4QHUA 4BQ9A 3W9DA 3RI5K 5C0CE 5HSFA 3DX9A 3WCYA 1MUJA 5FO7A 3DRTB 3PNWA 1FVDA 4MA3B 2K7PA 1KN4L 1N5YL 2F58L 3KYMB 5DUMH 2XKSA 5HYJE 2NW3B 4UTBL 2XV6B 4OLUH 1XF2B 3SDXA 3MX0A 3HPLB 1AI1H 2ITDB 2A1WL 3MNVA 3OHXB 2NTFB 3L95A 3G6JB 3GSOA 4BZ2L 1DL7L 4RMTA 4JFEA 5T1MA 4XNMB 5JDSB 4TSBH 4TULL 2YKLH 2FRGP 2WLYA 2KZ1B 2AKRB 4WI7A 5CLWA 2A38A 4LEXH 4R97B 1FRGL 4ONHA 4P46D 4QF1A 2CXGA 4YBLB 5CEXB 3DROA 4X9GA 5CJXC 1NL0L 1U2CA 1VGKA 4HAFA 1LP9E 4YDIL 4DVRL 1ZHBA 1E27A 1U8HA 5F71A 3TO2A 4Z9KB 3QO0B 4LCCA 4QYOB 4KJWD 2ZG2A 1CU4H 5GZOC 5I1KL 4EDWL 2Q7YB 3LZFL 1SEBB 5GHWH 1BZ7B 2V2WA 3RWDB 3TT3L 2VWEC 3RUGA 1G0DA 1I7RB 3D69B 3L1OH 1ZHNB 4S0TD 3BYTA 3VXSD 1RK0B 3FO2B 3SKOB 3SPVA 4EIZC 3A6CL 1XMWA 3DWTA 3KXFA 4OKVA 5CSZA 4HJ0C 2VLRA 1RZFH 2AEWA 3H9SE 4PJEB 2YHGA 3T04D 2OTWB 2CDGA 2G5BA 1Q1JH 4ZFZA 3THMH 2DQJH 2PYEA 1SJEB 3O3BB 4ZAKD 3BAEL 4YR6B 3NPSB 3PGCA 3VXQA 4PJFA 2IG2L 5T1DL 4GKOA 3STZA 2IANB 5EBGA 2WBJB 2OL3H 2D7TH 2VDPH 3EOBB 2FH8A 2BXYA 3CFCH 3VXSE 3LV3B 3O6LH 1JPSL 3D48R 2VRAA 3VXTB 2CLZA 1G6RB 4GSDL 4QRTA 4U3CA 1V5JA 4G8IA 1DQLL 2X10A 3QULB 4LRNH 5JDJA 1U8KB 2K7QA 1MCOL 1R3LB 3WIIL 5C0BA 3NIGE 2CK0H 3ZT6A 1T6WA 1HEZB 3HC0B 4POYA 4X6EB 2E7HA 1YJDL 1XF3A 3C08H 3QUZC 3IXAB 1EEZA 3QUYC 3F7YB 1JYVA 1MCSA 2VXVH 4L3EA 2UY7A 1CL7H 4MD5B 3D1MC 3H3KA 1FL3B 3RPIA 1MWAL 4Y2OA 2Z8VC 1DCLA 3D2UB 3MBXL 3VFNA 4FQ2L 1JZ8A 3O2WL 4JFYB 1MVFA 1YNTB 3I9GL 3MYZA 2NW2B 1IAIM 2ADJB 5SWSA 1ES0B 2O26U 1EMTH 4ZNCD 4YDJB 1ZGLA 1JN6A 1T21B 3BSZL 2Y07L 3GKWH 4ZTPH 3FOMB 2EH7H 1MCFA 3EYQD 1I85A 3L3GA 5K9OA 2V7NA 3D3VD 1MPAH 2Q76A 4GW5A 1I1YB 4ZYKB 2PR4L 1KN4H 3W5MA 2F58H 1FL6B 4GBXB 2ZWLT 5CD3A 1YPZA 2W60A 4UTBH 4AT6A 1PEWA 5DR5L 5IQ7H 1CD0A 5E9DA 3P9WB 2DJ4A 1B6DA 1CTOA 2A1WH 4L4VB 1DL7H 2H6PB 3GMLB 3OKNA 3NFNB 1O5DT 1HI6A 1YZZA 4HPOL 2WNGA 3SQOL 3ZDZF 4TULH 2RR3A 3MSPA 3CDYA 2E7LA 5MEOB 3U36B 3D3VE 1Q0XH 4MVBC 3EFDL 4JDZB 3MLPA 3NA9H 5DJCA 5KVDH 4PRNB 2JJTC 4XRCA 4WW2B 1T7WA 4YDIH 4HIIA 2NYYD 1T7YA 3QQ4A 5DJYA 2Z93B 4G5ZL 5C0AD 4OFYD 2Q1EA 3GM8A 3UBXA 4YQXL 5I1KH 3EFFB 3QNYB 4EDWH 1X4ZA 5I75B 4LLUA 3LZFH 4LPWA 4NM8L 5I71B 3TN0B 15C8H 3FB8A 4LOUD 4PJDE 3T65A 2P5WD 3HS0B 4IRZL 4XP5L 3TCLB 5TE7L 5BXFA 2J8UA 1S3KH 5D1QA 4LNRB 1WC7B 2RJMA 5MEPB 4WI3A 3AMKA 3MV9B 3MROA 2R9HD 3ZKND 5L8KB 1A9BB 2WM0A 5IJKA 3Q0HA 3U46B 2EKSA 1M1SA 4N8PA 1S8DA 1W72A 4K7FB 4YHPA 1INEH 3BISA 3HLAB 2V5SA 3BAEH 3LKRA 5C0AE 4EVNA 3N06B 2AI0H 4PLJD 3RWCB 2IG2H 3QA3A 1IZJA 1OTSC 3FMGL 4PG9A 5F1OB 4ZFFA 2P5WE 1DBKH 5BZDB 5JR1L 2E9BA 3P4MA 3UAJD 3QIWD 1PYWB 3EJYD 5DTFB 4LRIC 5IV2A 4YPGA 2YPVH 3FRPA 4GSDH 4IDJH 2C3XA 3BP6A 1DQLH 3BKJH 5JW5A 3KPQA 4YUEH 4QY8A 4WUKL 5BS0B 5TJWK 4G7YL 3QDJD 1YJDH 5E0QA 3FB6A 3HZVA 1JIBA 4X7CC 1WFOA 3PIQA 5HBBA 4R0LC 1U8QB 5HHMD 4HUVB 4YFLF 1A02N 4HUXB 2BFVL 1MWAH 3MC0A 4TTGA 3VGGA 4M43L 4UTAL 4OGZA 5IBTL 1A22B 5GSVA 3PDOA 5K59E 1FVEA 4LHUB 2IBGA 4NGHH 1K4DA 2APBA 1WAAA 2NX5A 1YN7A 3I9GH 1FJ1A 3OJ2C 1CI5A 3OB0H 3TBYB 3GHBL 3UROR 5I1DB 5EOCL 3B9EA 4XCFL 4GQ9L 3OL2A 4UV7L 5ANME 2BMKB 2Y07H 3JUYA 3QDJE 2VXQL 4Z7OF 1PKQE 5JXEA 1AQDB 2FEDC 1UH4A 2XWJA 4LAQL 3TVMB 3MLXH 5HHME 3RVTD 3U6RA 2LU7A 5KAQG 3HNTL 3UZQA 4BFBD 5HYSB 2PR4H 2XZZA 1H15B 1DE4B 1ONQA 5HHPB 3V79C 5EO9A 1R3KB 4ZNEE 2ADIA 2HTLC 3KPOA 5DR5H 5F9JB 1WIUA 4OJFH 3WJLC 1QO3B 1QVOB 2QQLL 4HDIA 5DJ2B 1U8JA 1KB5A 3MCKB 4K3JL 1KJ2H 5T1KA 5E94B 4RMSA 4MSWA 1VEPA 1J87A 3MGTA 4E41B 1TTGA 3PWVA 3WKNA 3VWKD 4K8RC 2F9BT 2HVJA 5E8OB 4G8GD 4FQHA 4PS4L 1S7SA 2ICWB 2J5LC 3EJZD 3UTZB 4UNUA 3V6OA 3MA9L 4QRUA 4GAFB 2AXHA 1NMAL 1DUZB 1UM5L 2GTWA 4PJ8C 4G5ZH 4NQVB 2VZOA 4PGEA 3ULUL 1F02I 3V5KB 5K9KB 1A6WL 5B38A 3QUZB 1WVZA 4RX4A 4ZUTB 3QUYB 1NLDL 1S9WB 1YY8B 3CLFH 4XP5H 3LN5B 2IBBA 5TE7H 3SE4C 3W9EB 5IBLD 3EW3B 4WHDA 3HUJB 1Q9OA 3GGWA 3IGAA 3MV01 2BNQA 4YPJA 4KTYA 1RVFL 4PLKD 3V0VB 4G8GE 5I1HL 3HRZB 2OSLA 3T4AA 1AIFB 4FQXA 4KK5D 2VN7A 3FRUA 1FGVH 5A2KH 1GRWA 3FCTA 4WI2A 3VCLA 3U9UB 3CX2A 5JO5A 4UBDD 4WEMB 4XWGL 2W1NA 3FMGH 4BFIB 5AG9A 3DX8B 1GC1L 4LSRL 5JR1H 1RJLA 2DYPB 1OAZL 1NAMA 4MQ7A 4BK4A 3WS3B 3ROOA 3H7LA 1SYSA 1URLA 1DJSA 1ZHKA 4U1LA 1RUKL 2CDEB 2EDYA 1QSFD 4WUUB 3RNKA 1XGTA 1X5LA 1IAKB 5FGSA 3KDMA 5D2NC 3QZWG 4P4KD 5ACLA 5F6IC 3I02A 4JHZA 5F7WC 3QDMA 4Q9QL 5GS1C 2BFVH 3KYOA 1L6XA 1IAOB 1V3KA 4PY7A 4F7TA 4F2MB 3KPSA 1T0MB 5DO2D 2OTUB 1U3HC 3JTSA 4M43H 3I6KB 3HE7D 1MREH 2XY1A 1CR9H 3MRLA 1GHFH 2GSGA 3HZMA 5DJAB 3FHQA 3X13A 3BUTA 1N26A 2YRPA 3GHBH 5EOCH 1QSFE 4NZRH 5FOBA 4X6DA 3FB5A 3W82A 3VXMD 3WS6A 3X3FL 4QXGL 4H1LA 2XTJC 4LAQH 4MDJA 5C08D 1GOGA 2FWOB 3OKDA 5E03A 2E7BA 5A16B 5HY9A 4MDIB 1MY5A 5GGTA 3ZKQD 4P2RA 3N1PC 3L3DB 3ZDZE 4K3EL 3IFOB 1UWGL 5F89A 1FNGB 4N0RA 5LGHL 2R1WB 4PGCB 3T2QA 4Y5YA 4XPFH 4RMRA 1X6NA 1F42A 4B0MM 3BUYB 1RFDL 4MNGE 2YC1A 3FB7A 4ZUUB 3H0TA 4CJ0A 5J11B 3RA7H 4PYGA 3ALWA 3VXME 4OZHB 5CCKH 3UEZA 2EC9U 2EC9T 5C08E 2X70B 1DANT 3B6SB 5C7XH 2FL5A 4PS4H 1FZOA 2P5EB 2EYTB 5BO1L 4M8QA 1NMAH 4EUPA 5L0QC 1IGML 2IPKA 4JLRB 2V7HA 3ULUH 3RVXD 1A3RL 3FONB 5I18L 1A6WH 5E2JA 3VGEA 5D70L 2PYFB 4RGNC 3SHSA 1NANI 3ZYOA 4NP4H 3PDGA 2VLKA 4NYLA 5F3HA 1KC5L 5EZLB 4R0LB 5AG8A 5FB8A 3JWDL 5I19L 3WFHB 1HDMB 3T77B 3X12B 4JREC 3MJ7B 5JPMA 2FB4L 3G6JF 1RVFH 4QRQA 3QJFB 5EUKB 1GGIL 4PJXA 5I1HH 4QRPB 1IGYA 3KGRA 1JZ7A 4XWOD 3TH3T 4NWTH 1F4YL 1I3UA 4AL8H 1T0NA 1OOAA 4DGVL 3PJSA 3FZUD 5EFIA 5IB2A 1QRKA 2D2OA 4TNWF 1HSAB 4LU5L 4OCXH 2ORBL 4XWGH 5SWQB 5KVEH 4IS6A 4Y2DB 4MJ5A 2EDHA 4UDUB 5J56B 1OAZH 1K4CA 2IMNA 4OCYL 3VFTB 3TA3C 4KPHH 1ADQL 2P44B 1OSZA 3PWUB 4NKOB 3SGJC 4PV8A 1IC7L 2H2SD 2F53D 4HC1A 1XGPB 5FAAA 1AR1C 4OLXL 1Z6JT 4QXUH 3W0WD 3FFCD 3F12B 1DFBL 1TITA 1TFHA 4Q9QH 2VC2H 2V17L 1ND0B 2VJXA 4PJEF 4NCDA 2FHCA 4TPRL 3TP4A 2AJVH 3VRLF 5SWZB 2EICA 3QEUB 2X1XR 3JZ7A 1HNGA 4WENB 1OHQA 2Z9TA 4Z7UA 1JNLH 3UTTA 5CINL 3BEVA 5HHOB 4PJ8B 1PSKL 4Z7OE 2EIDA 2LABA 3O11A 3GMPA 2Z0BA 5D2LB 3ULVD 2F53E 2X2YA 4EOWL 2XPGA 3JTTB 4IRJD 5FGRA 5CJBA 3U4AA 3CZJA 3FFCE 3W0WE 4KU1A 3LN9A 4JO2L 3X3FH 2BDNL 2OI9C 1ODAA 2HFEA 3S35L 1TVDA 2GJ6A 2C3VA 4W70A 3DV4B 1MAJA 1LO3L 2VE6B 1FN4A 5EPMB 1SBSL 1ZT4A 1GJIA 3T0WA 2C7UA 3DV6B 4K55A 4K3EH 1UWGH 1X6LA 1J05B 1QP1A 1ACYL 2FHFA 4OM0L 3DXAD 5LGHH 4AIXA 2JJSA 3P4NB 3ULVE 2ATKB 2GT9B 1UWXK 5GRJL 1CFNA 1RFDH 3D39D 5DZOA 1BFSA 4GXVL 2DWEB 4HBCL 1EEUA 3B43A 3UO1H 5HPMA 3NACL 2X4QB 1I9RL 3C6LA 3QIBC 5EU6B 3O3AB 1KNOA 4RNRA 2HJLB 1VCAA 5BO1H 4P3CL 3U4EB 4YXHH 5I1GL 1NC4D 4PRIA 4LFHG 2GITB 5CEYB 1A3RH 1IQDA 4OGYH 1OW0A 2UZXB 3TIDA 1BJ1J 3DXAE 5D2NB 3NIDF 4F7CB 5HDQL 5D70H 1GZPB 2KZWA 2Z8RA 4KH2A 3V6FB 3GMNA 1MLBB 4QNPE 2UWEA 2A0LC 3D39E 1NFKA 3JWDH 2AQ3A 5GS1B 1Z9MA 3JBG7 3FQNB 5A43C 3GJFK 2Q86A 3IFPB 3U7AA 5AD0A 3QCTL 1WZLA 2BCKA 4C56B 2W9EL 4WTXA 5IW1A 2FB4H 4NZUL 3VA6A 4OSUH 1WISA 2VZTA 1GGIH 1QSEB 3UJIL 5D5MB 4RGMB 3MV7A 4LRIA 4HW6A 4U33A 3PABA 5KSBB 5DA4A 4D9RD 5L9DH 1P53A 2R0LH 4LLYA 2ORBH 3LN4A 4WW2F 1CN4A 3ARWA 3BP7A 1XF5B 3ARBD 1S7UB 1YYLL 1QEWA 3UTQB 5JNYA 1YEEL 3UP1A 5TPWH 5JPNA 1ZAGA 4Z7VB 4XMPL 2CLRA 4OTXH 4K07A 3GM0A 3QEQB 4GAYB 1ADQH 1PW3A 4JN1L 4NQSA 3RWFA 5E08L 1OAKH 2DLGA 4LLQA 1RJYB 2KQNA 4F8TA 2ZUXA 4XHJC 3WL9B 1DBBH 3MRRB 5C2BL 1MHPL 1DFBH 4D9RE 1G7QA 4HIHB 5HGAB 4XBPA 1MJ7L 2V17H 1U8PB 1B4RA 5GRZA 1PY9A 4BA8A 4WWKC 1YDPB 1AQKH 1NBQA 1YYML 5F7LB 3O3DB 1VFUA 1T89C 3KPRD 5IFAL 5CJ8A 1YUHB 5CINH 4R2GC 2XQBL 1DBAL 4ZO7A 3WIFB 5AAMA 1PSKH 5L0QB 1F90H 2DIJA 1G7PA 3F62A 5ALCL 5DHVB 4YHLL 5H35B 4EOWH 2ZOLA 5BRZD 2EDTA 4YC2C 5LGJA 4RGNB 1CGTA 3JVGC 1EV2E 2YN5A 2O61B 4FABL 4JO2H 4HUMB 1CDJA 2BDNH 4ZFOA 4F33B 5GXBB 1M7DA 3N50A 3VXUB 5KW9L 3IDYC 4JREB 1OSPL 2CRZA 3MGOA 2Y5EA 1TQBC 1SBSH 3M17B 1NDMB 1DSFL 4Z7WA 3QUKA 1OGTA 1HKLL 4JZNA 1ACYH 4RQQA 4OM0H 4LMQE 1A1OB 4ZS6D 4ZUWB 3TM6A 1P4IH 3BHBB 4LPCA 3HB3D 4CU8A 3ZT5A 2KL6A 2VKXA 5BRZE 2CRMA 4ZPVA 1C16B 2BNUB 2MKWA 3E1F1 1LEKA 3ARYA 2DIBA 3WN5A 5C9KA 2XQYG 3DTXA 3V0AC 5IGXH 1I1RA 4F9LC 3BEWA 4NNXB 3NACH 5SX5H 5IWLA 2PTUA 1I9RH 3H9HA 4M4PA 4XAWH 4LGRB 2D9QB 3C5SB 1I7UA 4HIEB 3T3MF 4ZSOA 1SYVA 4NBYB 3TA3B 4CW1B 1FC2D 4A6YA 4PP1D 4JFQB 2CIKA 5I1GH 5CP3H 1F5WA 3I6GA 4JFOB 5ICZB 2DIAA 4PRDA 5KJRL 4KV5F 3NZ8B 2LTQC 5HDQH 3PHQB 1LO5B 1EZVY 2HLAB 5DWUL 2HJFB 1BP3B 3ARDC 1F58H 4JHAL 5T3XD 3G6JE 2GIYA 4MWFA 5IMKA 1JF1A 4OLZL 1IKNC 3B9KA 3L5WA 4I13B 1LE9A 1OAXL 3VI3E 4XMLL 3S5LA 4E42B 4W81A 1GZQB 4R90L 1WFUA 2W9EH 5DDHB 4JFPB 4S2SB 1TVHA 4UINL 3RZCB 4XPAL 3MNVB 4KXZI 1JGVL 4C83B 2EIZA 3ESUF 3O6KL 4GRMB 5DS8A 3VMPA 1HHJA 4KUCF 2GK0B 4QOKB 2IAND 2WBJD 1B9ZA 5BQ7A 5T3XE 5F1SA 2OI9B 2JB6B 4MJIB 2P7TA 4MQXD 3WHE1 1YYLH 5FM5M 3DROB 4XMPH 4M7LL 5CJQL 3LQZB 3BO8A 1KACB 2B2XH 5GGQL 4KVCH 5FUCE 4PJEE 4S1QH 3VRLE 1U3HA 1A9EA 2JF1A 2ICCA 4GLRH 5E8PB 5FK9A 4P5TA 4XP4H 4R3SB 2OJZL 3HUJF 5C2BH 3ELAT 1MHPH 4CU7A 3D0LA 2F8XC 3BJLA 2H26B 5JTWA 2WINA 1MJ7H 5ISZA 1S7VB 1G0YR 1S5IL 4KTEL 2EEAA 1IM9B 5IFHL 1FFNB 2DLHA 3QIBB 3L5HA 5DD0L 5IFAH 3D2UD 4O5LL 2XQBH 1OT2A 4XNZC 4HKZB 1MAKA 1FNEA 4Z6AT 1IVLA 5GS3A 2MQCA 5F9OL 4NQEB 1ZS8A 2VAAA 3Q48A 4LLDB 1R3IL 3U30C 4Q74A 5L2JA 4DK6A 2WSKA 1LO4H 1EGJA 4BKLA 4C4KT 2DJSA 3C6SB 2PO6A 3V7AE 4G9FB 4WHTA 3QSKB 3IDNA 4Y4FC 3MLTB 1S9YB 5KW9H 5CJOH 1OSPH 2XZCL 1SEQL 3ARRA 4JDVA 5E6IA 3S88L 4JPWL 1LD9B 4GBXD 4FXLA 1CLZL 1HKLH 2VTFA 4MXWH 5DD1L 5C0BB 1KTDB 5FYLL 1NGQL 4G6KH 2Q87A 1DLHB 4HJGA 3ARSA 3OKOA 4L4VD 4LCWB 5FM4A 5EC2B 3KJ4C 3MJ8B 3W11D 2LVCA 4NSKB 4N0CC 1DDHB 1IEBA 2WANA 4L8DB 5IROC 2F5AL 4OZ4B 1HK6A 4XNYH 5E8DH 3ARFD 3KLAB 4JQIL 4U49A 5IOPB 3V0WL 4CMHC 1CFSB 3O41B 3LH2H 2A6JB 5KJRH 4X4XB 3QXVA 3PE9A 3TN0D 1HQRA 4PJBA 5DWUH 1FFPA 2YD6A 4L4VE 1M05A 3NFSH 1UM4L 4WI4A 2RFXA 3H3PL 4AYFA 1D5MB 1I8KA 1CFBA 5T5NF 5IBUG 4XMLH 1FYTE 3MV9D 1A6TB 1KFAL 4R2GB 2CKBL 2HVKB 2B5IC 4UINH 2PXYA 5E6ZA 4XPAH 3L3IB 2DLIA 1JGVH 1JPGA 2IQ9H 4OZHF 3O6KH 1IMHC 4ODTL 1Y6NR 2QR0B 3W39A 2XXMB 2ADGB 3MOAL 4JPIB 1S7RA 4U2ZA 2QBWA 1VFOA 3IDYB 4FFZH 4M7LH 1ITBB 1TQBB 1LEGB 3K2MC 1DN0B 3MV9E 1KTLB 1SMAA 3DO7B 1T6VN 1KBGL 1OP5K 4Z0BL 2G75A 1K5NB 5BS0D 1NDGA 3WNLA 2ZSVA 3HC4H 4KMLB 3RGVA 3N9GL 3MYJA 5DD6A 4GS7C 2OJZH 1DZBA 3QG6A 2GY7B 2E9WA 1QKZL 2WV3A 4ZOBA 3GMMB 3CFDA 1YEIL 4JPVH 3O8XB 4F9PC 4Y0GA 3CGTA 4KTEH 1ZTXH 1WV7T 2EEDA 3D85B 1EO7A 3QEHA 1G9NC 5ADPL 4EI6A 4HS8H 2AK1L 4KKBC 4U6YA 5DD0H 1Z9LA 4O5LH 1BEYL 1W72B 3I50H 4LHUD 5JW3L 3FQXA 4EVNB 1ZLVH 5ESVA 5BS0E 4U1KB 1EVTC 3GSNB 1P7QA 3LKSB 3M1BB 4N0UA 3VH8G 1R24A 5C8JB 1QRNA 3CLEL 1UXSB 5CHNB 1CDGA 1PJ9A 1A7BA 2AW2A 2GQHA 3TVMD 5EC1B 3FHAA 4HJ0D 3P3YA 5DD3L 5FYKU 2ID5A 2XZCH 5INDB 2D0GA 2OK0L 4PJCF 2XFXA 4CN1A 3S88H 1YEFH 4JPWH 1CLZH 3TNMB 4N8CL 1D3CA 4JFHD 4OZIA 2YBRA 2Z91B 2J12B 3RL1A 4AJ0A 2VXTL 4J3WA 4YDVB 3QWRD 4G80A 3T3ME 3V95A 1J5OL 2EECA 5HYQA 4M6NL 1AFVL 4TN9A 2XIDA 3FFDB 43CAB 1TJGL 2N56A 3JWOC 3BWAA 5H2BA 1J9CT 3HPJA 4FS0A 4IOIA 3VD5A 3M45A 2ARJB 5KS9A 2QTEA 4EI5A 5D2LF 4E41D 5JORB 2F5AH 4KUCD 2UYLA 1HQ4B 4KV5E 2DQFA 1U8MA 4ZODA 3PHSA 4M93B 3OGCA 1C7TA 5I1AA 4OLYL 4WO4C 3QHFL 2HN7B 1J1PH 2ZCKH 5C0JB 2JIXA 1TZGL 2H8PB 4LKCB 4M61A 4JFHE 4MNQB 4V1DA 4CADB 4X5XB 1RUQL 5F3BA 1L9NA 1EO5A 4PGJA 3LIZL 1YMHA 5FGBC 1U8NA 2C9AA 4CU6A 3G5YA 4PJ7E 3ECBB 3KNBA 4HWEL 4X9FA 5HGGS 3VGAB 1J8KA 3A67L 4JRYB 4ELMA 5JW4N 5DK0A 5FA4B 4ZUVA 2W65A 4E41E 2QEJA 3LEVL 2CKBH 1J12A 4XNZB 1BF2A 2EEBA 3ZDYE 5KOMC 4P2QA 2VDML 1X7QA 4TYUA 4DQOL 3ABZA 5T1LB 2AK4A 2FGWL 1PZUB 1DVFB 2DQDH 2PW2A 2VABA 3QWOB 3QI9C 4QWWC 4Q2ZB 4BH7B 1BQHG 5ICYB 4LHJB 1U8LA 3ZYJA 3BZEB 1XGUB 4XCNA 4Y4FB 2IALA 3CD4A 1OY3B 1LDSA 2DYPD 5B3JF 4RCAA 3CCHB 2FJFB 1ZLSL 3O6ML 3HUJE 4P4RB 4NJAL 5CKAA 1NFDA 4WWKA 4PGEB 3PWNA 5HVFB 1MOEA 1T89A 2IQAA 3Q3GB 4WUUD 4AM0B 3VFMA 1A4KA 1ZLWK 4K94L 5D7JC 3IJSB 1YEIH 3KJ4B 2DM2A 4RDQG 3SBWC 2Z92A 4FMFA 1KYOK 1M6OB 3OG6B 4NO2A 3ILQC 4HWBL 5D5MF 5ADPH 3L7FA 2IGFL 2JJVA 2VH5L 1YY9D 1CT8A 4MVBD 4MX7B 2XWTB 3B2UC 3BKYH 5KSBF 2OXGA 1BEYH 4M6AA 4E9LA 1CFQA 5MI0C 1D5ZA 4R4FL