4F15B

Molecular basis of infectivity of 2009 pandemic h1n1 influenza a viruses
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
219
structure length
208
Chain Sequence
VKLQESGAVVQPGGSLRLSCAASGFTGSDYDMSWIRQAPGKGLEWVSGILGGSERSYYRDSVKGRSTISRDNSRKTLYLEMNSLRAEDTAVYYCARHSWGGWGQGTTVTVSSASTKGPSVFPLAPSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSSVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of infectivity of 2009 pandemic H1N1 influenza A viruses
rcsb
source organism Influenza a virus
molecule tags Immune system
molecule keywords Hemagglutinin
total genus 32
structure length 208
sequence length 219
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2012-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f15B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f15B02
3SGJC 3O3AB 3ALWA 3GI8H 4K71B 2O5XH 3EIFA 4XMPL 5IGXH 2JCCA 5DZNA 3HLAB 1WC7A 4U31A 4O4YL 4MAYC 2VC2H 2H8PA 5IROC 4C59B 3IDIB 1LNUB 5LAXB 5SV3A 1FVCB 2A6IA 2D3VA 1U8HA 4JGJA 4XVUC 3GNMH 1GOGA 4ZSOA 4M7KL 2HVKB 4XBGB 5JORB 3MXVL 4LK4A 2PYFB 3EBAA 3IDNA 2AK4B 3RZCD 4ZO8A 4N8CH 3P4LA 1J0JA 4JFQB 3SCMB 3LS4H 4JFYB 1UM4L 1IM9A 1JI2A 3LY6A 5FO8B 4QOKA 4HG4K 3KPQB 2FH8A 5LGHL 1MI5E 5C0AA 2ZG2A 1JV5A 1TNMA 3GSVB 1WCBA 3BDYH 1X5GA 2R0KL 5KS9E 4NSKB 1N5AB 2Y36H 3C60C 3T3MF 5CEZE 4G8GA 2X41A 1AGDA 3FRUA 1HNFA 2Y5TB 1FZMB 3X3FH 5HGAB 5FYJU 3X12A 5IFAH 2F74B 3BEWA 5BCAA 3KNBA 3ETBF 1EAPB 1W72A 1I75A 4UMGA 4F7EA 1JWMA 1VACA 3ULUE 4O00A 4WFGE 2XXMB 3QPXL 5LJYH 1PG7H 2IH3B 4BSWA 4QNPF 2DIAA 2CRYA 3G5XB 4GAYA 5E7BA 1EIBA 5EUKB 1ZLWK 5E99L 3W39A 4JJ5A 3WO4C 3EOTH 4FQPA 1C1EL 4Y19E 1R5WB 2VKWA 4XMKL 5BJTA 4KTDH 3RBSA 4U6XB 3X3GH 1UB5A 3WO3B 3LQZA 3TYGH 5J3HD 5EZOL 3WUWA 5HBBA 2ZCKL 2QBWA 5E9DB 3UYRL 2COQA 1KLUB 3BKJH 3QAZC 3L3HA 5DJXB 1TQCC 3CLFL 3OKEB 3RUGF 1G9EA 1V7ML 2V2TB 3L5XL 1A9BB 5IB4B 4W4OA 2VUYA 1JHKL 1F3DJ 2DQTH 1YEJL 2R0WL 2QHRH 4TSBH 4Q9BA 3FFDB 3DSNA 3LKOB 4L8SC 3NABL 2BC4A 2O5ZL 3DOSA 2YS4A 3N06B 4PREA 2CH8A 4LDOB 3K4ZA 5I18L 4L3AA 3EYOB 1I7TA 3HNTL 1MCPL 1ZHNB 4DKAA 2IADA 1UJ3C 4Z6AT 3PGDB 1T66C 5CZVL 1YEHH 5BXFA 4LFHD 4RAHA 1NFDF 2O93L 5TH2B 2WWKT 3I85A 4HJ0D 2AK1H 5CZXD 3STLB 5I30L 4HGKC 1GHFL 5E8DL 3E0GA 3V95A 2W0FB 1ZLVH 3VFNB 4D9LH 3IDYB 4H8WC 1Q0YH 4PRHB 4BKLA 3GUTA 3VRJA 4NZRH 1A6WH 4PJGF 1J1OL 5JIIA 5IJKA 3UDWC 5D2LF 1N26A 5L88L 1WV7T 2ITDA 4J3SA 3VFVA 4HX1A 1MCHA 1BFTA 4HLJA 3U4BH 1S5IL 3O4LD 3RA7L 2GIYA 1PYWB 1XIWA 4K2UH 1CXLA 2DL9A 1J88A 4OZHB 2CIIB 2DLFH 5CEXA 3HG1A 1A02N 1YNTA 1KTRL 5JPMA 1I9EA 1BP3B 1QLFB 1R6VA 4M4RA 3GSXA 2GJJA 3FT2B 4YDLC 5GGSA 1RU9L 3CSYA 2P5WB 4NRYB 1FSKC 4RCAA 2D4FA 2XZQL 3E8UH 4OTXL 3OJVC 3B9AA 5D7IA 3EO9H 4WCYL 4ZNCD 3L3JA 1KF9B 4JN1H 4JO1H 1IL1B 4HF5L 1RUKL 1BHGA 3IFPA 4X6CA 5IB1A 5AAWA 3PL6A 4FQ2L 3BKCL 2HLAA 4LSTH 3VXUA 1SY6L 3MR9B 4QCIA 4DGYH 2R2BB 5IQ9A 4FQIH 3L6FB 4PGCB 1CI5A 5AWNH 4Z95L 2YPLE 1HI6A 1U8KA 3RZCC 4HDIB 3S5LA 2APWA 3IU3A 4YHIB 4ZS7H 3H9HB 2ESVA 3KPLA 5J57B 3PXJA 2EDJA 4LHUD 3OB0K 4R7DB 1UFUA 5KVDL 5B39B 1KNOA 1KELL 2VN4A 4M6AA 1J1PL 4M8VA 4KV5E 1MNUL 1JPSL 1JNNH 3MROB 2M26A 1A4JB 2ADFH 4G8IA 5D7LA 3JWDC 4M3KB 1JUFA 3EYFB 4GKNB 4MCZA 4IRJA 3OB8A 1NCCH 3KDMA 2I25N 2XTLA 4G43A 4LCUA 2EC8A 4KY1L 2WIIB 3CNKA 2GFBB 4OCWL 4NQXA 4HWBL 5GIRB 3ARGD 4OCXL 4QOKE 4LHQB 5E2TH 1K3ZA 4UTBH 1RIVH 1J10A 3H0TA 2OZ4A 1MCQA 4P23C 3DRQB 3CFBA 1P2CB 2E3VA 4HD9A 4V2BA 4NQSB 3LVEA 1M1SA 1FE8L 1HDMA 4YBQC 2OL3H 1DP0A 1YMHA 4RGOH 3ARPA 2WMPA 4P2QB 4G8IB 4J3TA 1G9ML 2ZUQC 1WZLA 2R4RH 4OUUA 3S88H 5MP6L 3B43A 3EZJB 4JFFA 3WN5B 5TFSH 2DI7A 1M05A 1TZHA 5K9OB 1BD2E 5GS2H 5JHDA 4CMHB 1CFTA 1T1YA 5CIPA 1BREA 3QAZB 1IM3B 4J1UB 4ETQA 2VDLH 3PGCA 5I1LA 4IJ3C 4BUHA 4OZIB 4JGUA 3TPUA 4NC1E 1EHXA 1JZ2A 4P5TD 3ZTNH 2BHUA 5K33A 2BY2A 1MCIA 2HN7B 1JHTB 1R3JA 3SHSA 3ESVF 5KVEH 1CFVL 1NBZB 2QJDA 1U8QA 5IR1A 4PRID 2IGFH 2B0SL 3HNVL 1QLRA 3SKJH 2P5EE 5KSBE 3KGRA 3X13A 1QO3B 3ULVD 4G6JH 1UQSA 2IG2L 1A22B 2YD8A 1QFHA 2BHZA 3L95A 3MGTB 4YUEL 4D0DA 2CKBA 2EE6A 2PW1B 1N59A 4ODTL 2LV4A 1B4JL 5TGBB 3WD5L 1FGVH 1HH6B 3OAUL 1H5BA 1A1NA 1ETZB 5FHBL 1SJXA 3UPAA 1G0XA 1H15A 1G7JB 4XX1G 4M61A 4WI3A 1LE9B 1DSFL 4WWKA 3MCKB 4LSDA 4LBEB 2EE9A 4PP1D 1UJTA 4HUWA 3ARBA 1ORQB 4GLRH 3PWVB 1IKFL 3AREB 3T1WA 3ARVA 3VXOA 4HUUA 2DTMH 3D3VE 4UT6L 3VGDA 4JQVA 4ODUB 2XZCL 4K7FA 4Z7NF 4IDJL 1UKQA 3VXRE 1JTOA 1UKSA 4PJDA 3PWLB 2Q7NA 3OX8A 1RUPL 1T4KA 3QCVL 1HHJA 4YHML 1J5OL 4GKZB 3VFSB 2DN7A 1OGAB 2F58L 3HC3H 3B5TA 2Q7YA 5JMRA 4XBPA 2QSQA 3O0RH 5DUPH 4PYGA 3FO0H 2WNGA 4UB0L 1C7TA 2R0ZL 3QZWG 5EOQL 4YDJB 1WAAA 2X4NB 2JIXA 1IFHH 3OKDB 1PW3A 3WIHA 4QYOB 2YR3A 4OCRL 1MRCL 5T5FL 3OB0H 5B21A 4JFPA 4YR6A 1RIHL 5DJ2B 5KZCD 3CPLA 3NFPA 4FQHB 4YFEA 1FBIL 1KIQB 4PGEA 5D7JD 4JRYB 1I7ZA 2DKSA 3UAJD 1J8KA 4KI5C 1EBAA 2HG5A 5BRZE 3ARDA 3F58L 2NX5D 3LN4A 1G6RB 3RUGE 4JB9H 2CKBL 2XQYK 2P43B 3KR3L 3SDAC 4S1RL 3GIZL 4A6YL 4R8WL 1GVIA 2BNQA 1BQUA 1URLA 2F5BH 8FABB 1H3PL 5EBMA 1AO7D 2VAAB 1BIHA 1S7VA 3VFWB 1T04A 4GS7B 4ONHA 4XPFL 5IHUL 3ZE1F 4O2EA 1WBXB 3T08A 2C1PB 5DRWA 3CLEL 4I4WB 5ALBL 3IAGC 1KENH 2CDGB 2WQRA 5I8KL 4QRRE 2DQEL 1T7WA 1Q94A 1RJLB 3BP7B 2HG5B 3F7QA 3KWWA 3QDAA 4P5TB 4XC3H 4S11A 2D9CA 2FJFA 3FT3B 1FYHB 3JV6A 3G6JB 4NN7B 2F53E 4G9FB 2PXYD 3GJFB 1NJ9B 1QSEB 3QH3A 3ZDXE 4PV9A 1RZIB 3CDGB 2VLLB 5I8CB 1T20A 3D9AL 2HFFB 4HIEB 1UVQB 1IGCL 2AV1B 3GSWA 3RIFK 2IPUG 4Q6IB 2AABH 3QQ3A 5L8KB 1HSBB 1OAZH 4MAYA 3TYFA 4OFYD 4NDMA 2OR9H 4EDXA 3LDBB 4KXZI 4PP1C 4NC2B 1U8NA 4XGZA 2BSSA 4X7TB 2W59A 5SWZB 1AD0B 5H35B 3MRJA 2EYSB 4JY5L 3I75B 1R5WA 5HVHC 2F19L 4EBQH 3BUYA 1K9TA 3QUXA 3V0WH 5JLZB 3MLPA 4GXVL 2V5RA 3F62A 2XG4A 3BQUB 1XCTA 4NGHH 4OCNC 4A2LA 2NCMA 5E5RB 5HI5C 3QXVA 1SQ2N 3MV7D 1I8IB 1R3HA 4ODWA 5FM8A 5HYJA 2A6KA 4CDHA 3FQTB 3S34L 3BKYL 2E8YA 1OSPH 43C9B 5FB8B 1QACA 2ZNXA 3OKNA 1J9CT 4OZGF 4X8JB 4UQ3B 3WJLC 4WFFE 1LILA 3DROB 2E6JA 1WFOA 3ELAT 1HXMB 2IADB 1XIWC 2UWEB 4CMHC 3IRZA 3DUSA 1MI5B 4KMTL 2VDOL 2B4CC 1J0HA 1FDLL 4RFOL 2DF3A 1IGFH 3T4YB 5KS9B 5DK2A 3ARXA 2VWEE 4K3EH 1T03L 4PGZA 2BDNL 2VDQH 3U4EA 4R26H 1OGAD 5E2UL 3EOBA 4XCNB 3PE9A 1MFDH 2VH5L 4JY6A 4OZGB 1RSFA 3U1SL 2HVKA 2Q76B 1HHKA 3UXFA 4XPGL 1R0AL 5BXFB 3N85H 4NCC1 1PZ5B 5L0QC 3ZDYE 4Y19B 3STZA 2HVJB 2HJLA 2G75A 3U36A 3NCFB 5GGTH 4X9FA 4FMFA 5EC1A 4OGYL 3WBDA 1AXSB 1SYSA 1O5DT 5F70A 3W2DL 4I48A 1BLNA 4RMUA 1NEZA 3OKKA 5L8LB 4F57L 2NX5B 3H3BC 5EZLB 1S7SA 1S9WA 2VB5A 3I3DA 4JPWL 1A6TB 3FN3A 5EBLA 2OCFD 1P4LB 3TIDB 3LD8B 5IROA 1FNAA 2ITDB 4KMQA 1I8KA 1E4JA 4GG6E 1T5XA 1I1AD 1LK3H 2MTPA 2M2DA 1M6OB 1G7LB 1TETH 3GO1L 5L6YL 3DV4A 3B5HA 3O2VH 3S7GA 3L9RA 4TULL 3BAEL 4NNPH 4YWGH 4JQXC 5EU3B 4GRMA 5M7QA 4TUKH 5H37G 3T77B 4PJ5B 3WMSA 2WAHA 1UZ6F 4RAVA 4R97C 3KPSB 1EPFA 1WT5A 5EZLA 3VGGA 1B4RA 2VDNL 2EIBA 1OP5K 3MO1B 2X7LA 1OPGH 2HFGH 3WNMA 3WSQL 4OCLC 5EZIL 4G6ML 5E9DA 2FGWH 3AS3A 4PUBL 3WKMH 3P3YA 5K9QI 2Y07H 2EE3A 2NY4B 1NAKH 4QHNA 4C56E 2AJSL 3EYVB 3EJYD 1S7RA 1RUAL 1U6AH 3MLRL 4IMLB 1BFOB 2FEDC 1BFSA 5I1HL 1L9NA 1G1CA 5D9SB 4PB9L 3KPLB 4QO1A 2XA8H 3BH9B 1RUMH 3E1F1 1JNLL 1KIPB 1YQVL 5BOZG 1C12A 2IAMC 4WU5B 5FF6A 1XGUB 4DEPB 2YEZA 4ENED 1S7XB 1WVZA 2PYED 4NQEE 3QCTH 5HHOA 3K4AA 2X4PA 4I0PB 4MXWH 2ZCHH 1KFAL 4OGXH 1MHCA 1IKNA 1RVFL 4NN5C 4I77L 3B4NA 1Q1JH 3PV7A 3VG9B 4E41D 3BVNA 1A2YB 1E4WL 4ZO6A 4FABH 2I27N 4OZHE 5E95B 4Y4FB 5DJ6A 4FQLL 2IPTH 3SOBL 3VW3H 2Y6SC 1UXSA 1P7QB 3ZYOA 1UACH 3NFSL 3I02A 4YDKH 2XFXA 1S7XA 4U1SA 1QRNA 3MV8A 3MV9E 3FQXA 1K6QH 2OI9C 3Q48A 5I2IB 3EZ8A 1VCAA 2C4FU 5GRXG 3T2NL 2ILLA 1BFVL 3L1OL 5ECJE 1RK1A 4S1SL 4EZMA 4PJEE 1NUGA 1WFTA 3PWNB 3LPGA 2G5BB 3SDYH 1HQ4A 1I4FB 4WO4D 1ZANH 1GH7A 1A7OL 3RAJL 5AZ2H 4HKZA 1R5IB 5FAAA 2B39A 2FLRT 1Z2KA 3C6LA 3GHEL 3OR7B 5DTFA 4YX2H 1R5VB 4NUGH 1VHPA 1LP9E 2E9JA 2R1XB 3ZE2E 3FO1A 3T2PA 3TT3L 3INUL 4Y5XC 1RURL 4L4TE 3W81A 1NC2A 2YMXH 4B53A 4YHOL 3GRWL 2CLRB 2H32B 4Y16B 2GITA 2ADGB 3RHWF 1S9KC 5C08B 4O4YH 1U2HA 1SYVA 4HH9A 4WEUD 3U0WH 4APQA 4Y5YA 1JYNA 1I1AB 2F5AL 2QV2A 2EIDA 3RKDD 2B1HL 3BKMH 4G6KH 1TZIB 3NAAH 1Y0LB 3MXVH 3MODH 2FD6H 1QEWB 1CK0L 4QRQA 2DQJH 4POZC 1MCLA 4PJGE 5A3ID 1MHEA 4JFYA 3G6AB 4X4ME 4JN2B 3GKZA 1JN6B 3H7LA 3GBMH 1R3JB 3OGCA 4FXKA 4LDEB 5F88A 5FDYA 2DQFA 1UM6H 1UENA 3G04A 3OL2A 3QIUA 2VISB 1NGXA 3UTSB 2ZSVA 4MD0B 3VXNB 2MSPA 2GJZA 3DX6B 5JDJA 4Y5YB 1G0DA 5EB9A 2NTFB 3TN0B 4L9LA 3RWDA 1C5CH 4NFDA 5F1NB 5C0DB 2VLME 3QBTB 4PY8I 1PG7L 3TP4A 4OLEA 2X4UA 5IEKA 2JJSC 3G9AB 3LHPL 1C1EH 3BW9B 5C3TA 4Q74A 1M7DA 2UZIH 5I71C 2UZYB 4XMKH 1ZVSA 3O41B 5D96C 2PYEB 1XH3B 5T1MA 3SDXE 2A9NH 1CR9L 3NIGE 3OKMB 2ZSVB 1KG0A 3GI9H 4JKLA 4U3XA 5FA4A 3SGDI 1GZQB 1RFDL 5EZOH 3AREA 1BZ7B 1KLGB 1Q72H 5J11B 1CGXA 3Q1SH 4GG6F 4ONOA 1FG2B 2CIKA 1JFQH 2HA1A 3CFCH 4ODUA 3AB0B 2AGJH 1WICA 5CCKL 3MREA 3T2QA 4YXKL 3OAYK 2OP4H 3HZVA 2NY0B 1UZ8A 3N1MC 5C0FB 5ABDE 5ICYB 4WEBL 4WDIB 1RUQH 1YN6B 2XOTA 4R97B 4KH2A 5A2LH 2HMIC 3WKNA 1DBAH 2CKNA 2CUMA 2P8PB 2C4FT 1QFWI 2H26A 2R0KH 1FV1B 3VXSB 4MXQD 5D5MB 1FL6A 3IVKB 3UMTA 5JZ7D 2OK0L 3IXAB 4PG9B 1T0PB 1F11A 5IFAL 4KWUA 4XVUD 5A2KH 4XP4L 3TESA 5D7SL 4ACPA 3QPXH 3QWOB 1F3DH 3CVHH 4GG6B 3QUYC 5EC2B 3DX9A 1G6RA 3PDGA 3EOTL 5HHXL 4K94L 1MQKH 5J1AA 1LWRA 4L4VA 5EIIB 5BQ7B 4V1DD 2EKSB 2GY7B 1KB5H 2QADC 2EO1A 1B9ZA 3RWJA 1TQBC 2A73A 4LOUD 2VZTA 3O8XB 1MFAH 1WQVT 5EBWA 3VFWA 1A14L 4JM2F 4PJ8B 2Y6SD 3L3IB 2FL5A 5BV7C 3NGBC 3RVVD 2C1PA 4U6VH 3BKJL 2BP3A 2XY2A 2ATKB 4AEEA 4H5SB 4X5XB 3MUZ1 4OI7A 3TCXA 5GJTL 3U4BL 4CUCA 3BJLA 3VXUD 3KYOA 4LAQH 2J8UF 1RY7B 1N0XL 3LKRA 4YGAB 4CKVX 3E6FB 3EO1A 5HSFA 3H9SA 4F3FA 4OZHA 4X4YB 3NABH 5F3HB 3IU4L 4PGDA 5L0QB 1F45A 1PY4A 5IMOB 2A0LC 4JM2B 3W11D 4I5BA 1ZHBB 1P1ZB 2BSRA 3VFPA 1TVHA 4LLUB 1HSBA 3TYFB 1WUNT 3HUJE 5K9JH 2E6PA 2Z35B 4Z7UA 2YPVL 4KROD 4JHAL 4PD4J 4MB4A 3BISA 4X98B 2XWTB 2BJMH 1A0QH 4QTHA 1J8HE 5ERWB 1DBJL 4M5ZL 1MJUL 5C08E 5T1LD 4TVSa 2VRAA 1GGBH 1MCNA 1QSFD 2R1YB 1UA6H 3VRIB 2V2TA 1JPGA 3FQWA 2WV3A 4RFEA 1JGEA 4NRZA 3ULVH 4MHHI 4PRBB 2DS4A 5ESVB 4K94C 4RX4A 4FQIL 1U9KA 3I6GA 4XP1H 1L7IL 2AJUH 3LKOA 3VA6A 2XWBA 4J3UA 1CN4A 1AGEB 2YD4A 4MQTB 2OX5A 2Q1EA 4H88L 3C6SB 4MHHG 3UBXB 5HHPB 1XF4A 5IFHL 1FC1A 4LMQE 4U1HA 4LVHC 4XCCL 3ULSB 2F53B 3O2DH 1ZHKB 3AU1B 1WFNA 3BO8A 1RZKC 1D6EA 3I3EA 3HKFA 3V4VH 3DXAA 4OT1H 1PKOA 5IESH 4J6RH 5KOVC 5CBEA 1D5MA 5DI8A 2DLFL 1MCCA 2W9DH 5H2BB 4WGVB 1RQ5A 2FJGA 4PJDF 1IEHA 3TBVA 1DBML 4GBXD 5D7KD 3UPRB 5FKAB 4MNQE 4YFDB 2C3VA 3I2CL 3D2UA 5SWZE 5B3JE 3U4AA 4UTBL 4FZEL 4HAGA 2NXZB 4YJZL 1DQQB 4G7YH 2R9HD 1NCAH 4QEGA 3EHBC 5KSAB 3PUCA 4LVNB 1HHHB 5MEPB 4HBCH 5D7IE 4LSTL 1A5FH 5J6HA 3FFCA 2EDBA 2E8ZA 5ETUB 5CILL 1XIWB 4H0HB 3IJHB 1OF2B 1UH3A 4V1DB 5DJ0B 5GRZA 2DQCL 3O4OC 3LEYH 2FJGB 4LNRB 2Z91B 1EEZA 1WT5C 2Y5TA 3NACL 5F1IB 4HV8A 2A6DA 1IGTB 3JZ7A 4WI5A 3U7AA 5F7EH 1EAPA 3MQIA 1JMXA 2BSSB 3G5ZB 5C6PB 3D39D 1EHLL 4Z7WA 3L7FA 3VXSE 1KCUL 2ICWA 2GAZA 4CMMB 3T3PF 3RPKA 1MAKA 2GSIB 3BGMB 1CDBA 3ZTNL 1E28B 3RDTC 3UBXI 2DD8H 3DGGB 3GMPB 3LQAH 4KFZC 3WNOA 3W9EB 2CRMA 4XWOD 5BV7H 4Y2DA 3PDDA 1F3JA 1NCCL 2HLFD 1A7RL 4F8TA 5DR5H 2QSVA 2MQCA 3RFZC 4MS8D 1IGIL 3ZYZA 3CMOL 4OV6F 3UTZB 3IXTB 4G6FD 4N0YL 1WITA 5J56B 1TLKA 3ZT6A 3SQBA 4NKQB 3HHRB 4FFVC 1EHNA 4HDIA 3SDDB 4M8QA 5LGJB 2J8UA 2O5YH 2APTA 4Z78A 3QUZB 3LS5H 2NY3B 5T1LB 3QIWD 3WD5H 1FGVL 4QOKD 4K3JL 3LKQA 5F71A 1GC1C 2FDBP 4WFHD 4CN1A 5FHBH 4XPTH 3CK0H 3RWGA 1U95B 3QI9C 4M1DH 5I76B 3BT2L 4X9HA 4QHMB 5FCUH 2YD5A 3MROA 5B38B 1S7UA 3NCJH 1FQ9C 2IH1A 5I1IL 2X4RB 2QL1A 1YJDC 5IMLA 5JW3L 3AAZA 2X4SB 1A9BA 1MFCH 1EV2E 5EC1B 3L3GA 3IKCB 1PQZA 1IAOA 4JRWA 5KJRL 4ZFZA 2JJTA 4PJXE 3KXFB 1E27B 2L0DA 1BLNB 1AY1H 4MDJA 2RR3A 2JJTC 4MQXC 2BSTB 3R0MA 5CD3B 4OQTA 4FTVA 1KV3A 4BKLB 3GUTB 4XWOC 5L9DH 2R69H 2A77L 3SDAD 1LP9F 3QUMB 4PRAB 2CLRA 4PBVC 5E1AA 5KSUA 1FZKB 1SBSL 2E7HA 3I6KA 3GSQA 3S3JA 4CW1A 3AAZB 5EA0L 5FHAH 3TH2T 1YPZE 15C8L 3BGFB 4XPAL 4YUEH 5INCA 2R29L 3MRKB 3I9GH 1YUHB 4LF3B 1RZ7L 3IKKA 4HHAA 4OCRH 4P2OA 2YUWA 3IS0X 3RNKA 1GGCL 1B4JH 5IF0A 1FBIH 3NOIA 3HC0A 4P23D 3MRCB 3IDXL 3VDCA 1ACZA 4PJ7A 5SWSB 4XNMA 2K7PA 2XYCA 3AB0C 3TBYA 2VZ3A 5F3BA 3SJVD 3G6AA 3GIVB 1MLBA 4KZDH 1G0YR 1F2QA 1BOYA 4LRNL 3VFVB 4MZ2A 4P2RE 3RI5F 1TCRB 3S3PA 1M7IB 1ZLUH 1DSFH 4MQ7A 1H3PH 3B9DA 4HWNA 4Y5VC 4APQB 4XXCA 5K9OA 5D1XB 1RK0B 4DWHA 3G5VA 3UBXG 2IQAA 1TZIA 4ONFL 3DX6A 2GJZB 3CZFB 5C6WH 1HZHH 1BGXL 3C5ZA 2GT9B 2ZG1A 2EYRB 4BQCA 3C5SB 4FXGA 2CKBB 4MNQB 1NGQL 3QCVH 4BFBD 1OTTD 3SPVB 5FOBB 2H32H 1JWSB 3O45B 4PBWD 4XC3L 2F58H 3HC3L 5IHLB 3QG7H 1IGYA 1U8LB 4KROC 3MGOB 1PFCA 2WUBH 5GISL 4LQFL 3WFHB 3VFMB 4MJ6B 5T3XH 2C5DC 3RBGA 5MERB 4H26A 4LVNC 3CDGA 2AK4E 2BNRB 4UDTB 3ARTA 3C08H 3MNZB 3GMLB 2JF1A 4OBRA 4ZSOB 1GZQA 4Q9QL 1SJEA 1OAZL 4JVWA 3EUUA 3IDNB 5GZNC 3MCLH 3MLXH 4TOYH 1C08B 2GT9A 3GM0A 2WBJC 4N8VA 5D2LA 1DL7L 3W9DB 5C0ND 1U8NB 1AKJA 1FIEA 2AI0H 1YMME 4U1SB 1H5BB 5BVJA 1WEJL 4YE4L 2OTWA 1KB5A 2IAMA 2OMBA 1MJ8L 4M7LT 2ED8A 1E4XI 5E5MB 1WCBB 3KR3H 2AAVA 2EDYA 3WFCH 4R8WH 4UOW1 1D9KB 3P77A 4KPHH 2F5BL 3OHXA 4NFCA 3HI5L 2NXZC 3S34H 5MEOB 1ORQA 3UTPD 2OJZL 1P2CA 2XZAL 5TQ2L 4GG8A 1F2XK 1XGPA 2V7NA 4U1LB 1UB6A 3GMRA 2MNUA 1A3RL 2IFFL 1DLFH 2VDOH 3P73A 3KXFD 5IV2A 2MCPL 2RJMA 2DQEH 4CVXB 4OV5A 5I1CH 2AEIT 3KPMB 3PQYB 4NQCA 5DYOB 2FYYA 4LEXH 4N1CA 2Y72A 3CDFA 5GXBB 2ADGA 2J6EA 1DQJA 2VDQL 3OF6A 5BJTB 1VFAB 1K8IA 4WHYG 5EC2A 2G2RA 2AEWA 3T1FA 4PJBF 3BN9D 2KUTA 1D9KA 2JLLA 3ARFB 3SDAB 4XMLH 2Y9RT 5FFLA 4PJHE 4YDIH 1P84J 4OCSH 1I1AA 5DLML 2DDQH 5F9WB 4XCEB 1YEIH 1J0YA 4H1LB 8FABA 1HHGB 3GSNL 3MLZH 3VXTB 3QIBC 2OR9L 2D0HA 4J4PD 1PEWA 4CVZA 3FKUS 2CUIA 4LIQH 3T0XA 5DT1L 2C1OB 5GGTL 5JW4N 4OKVB 3QWRD 2AV7A 5C07A 4GRWH 3ZKMC 1IEBA 3IDYC 2CK0L 3AUVA 5E6IC 4DOHB 1L0XA 4P2CG 5SWSD 2FO4A 2IQ9L 3ROLA 3RTQA 3RWEA 2MKWA 4CADB 4U1JA 3TZVA 1J11A 3NIDE 5D6CA 5EOCJ 5HYQA 3JWDH 1UXWA 4JPWH 4JFZL 3LIZH 2D31B 1BZ9A 3G6JA 2VO5A 5JW5B 3SKMB 5DUBA 5AZEH 2EE2A 3QFDB 3T0ED 4AIZB 3UJTH 1TETL 3BIBX 4X6FA 4KMTH 5AG9A 2EXWD 1FCGA 2LVCA 3IAPA 1IAKA 2L7JA 2EH8L 3KPQA 2GTWB 5D5ME 3BZ4A 5GZND 4KKBC 1ZT7A 2JELH 3QG6B 4G6AD 4R26L 3V6ZA 1JGUH 3FT3A 2UY7A 5F97E 4OLVH 1I1FA 4IRZL 1S7TB 2J1KA 2NY4C 1MLCB 2KKQA 1QBBA 3I50L 1MFDL 3KYMB 5B8CC 2FGWL 5JHDD 3MRMA 3U1SH 2CMRH 5ESVA 1ZHLA 4HWZB 3SN6N 1X4YA 4PV8A 5CKGA 4I18C 4NHUB 3G9VA 3CJJA 5EWIH 2AJYH 4A6YB 4K55A 3ZHLA 3UP1A 1U6AL 3MLRH 1IMHC 4LHUA 1BFOA 4B41A 1J7VR 1I1CA 1LVEA 1TZGH 3AS1A 2NQCA 2KL6A 4OGYH 1Z0NA 2YZ8A 4NNXA 1INQA 1Q9WB 3BO8B 1C12B 4GAGH 2JJWA 3S35X 1AXTH 4L8CB 1LE5B 3FT4A 4XZUA 3K0WA 1VB9A 4NZUH 4R4ND 2XQBL 3WHXA 4MXWL 2UYLB 3B6SB 4YPGA 4HXAH 5GS1A 1V05A 3GO1H 3BRGC 4PJFA 1K5NA 2X4OB 3WHE1 4FA8A 1EA9C 3BAEH 4NNPL 1D6VH 1MHPH 4N90E 3KJ4C 4TUKL 5E2WH 2X40A 2HLAB 4LDLB 1KN2H 3DVGB 1P7KB 2PO6D 5SX5K 4E5XB 1ZLSL 2AQ1A 4OKDA 4JFOA 2GJ6A 1CLOL 3QFJB 3TVMB 4DN3H 3FCTA 2DQUH 2JB5L 1PSKL 1KPRA 4G6MH 4UU9A 4O2FB 3SKOA 2Y07L 2H2PC 3OKYA 5I8OL 1WISA 4OGAD 3VFNA 1JHLL 1KIQA 4W6WB 1ZANL 3DSFH 1QA9B 4KVNH 3QNZA 3ZZ1A 1MCRA 5I1HH 3P9MB 1QLEL 3BP6B 1HHHA 4PB9H 3LKRB 5IJKC 4JFQA 4NUGL 4RGMB 3IJYB 3S37X 4UT9L 3FO2A 2ZKHL 3NTCL 3OXSB 3MLVH 1ADQL 4K7PH 4OLZL 2E27L 2GTZB 3GMNB 2VLRB 3ZO0A 5FO7A 1VGKB 2D7TL 3G5YB 4RAVB 3VRLE 1QSVA 4DUVA 3QXTA 4OGXL 4G3YH 1B90A 4QXTA 1SY6A 1X9QA 1EUTA 4NDMB 2CGRH 4OF8A 4WVRA 2PTVA 3LAFA 1AR1C 3IF1A 1WF5A 4IOFC 5E08L 1F4XH 4DKEL 5I17A 1TPXB 4QXUL 4G6KL 2A0LD 3A6BH 1X6NA 1OAUH 1VPOL 1IQWL 1JWMB 4LCIL 1CK0H 3IS1X 2IPTL 4XRCB 3SOBH 2KZWA 5JHLL 1LO0H 4IIQA 4WU7A 4Z5RA 2H6PB 1N5YH 4X9GA 1IAII 2J12B 1IBGL 1MHEB 1FYTE 5A1AA 4KQ3H 3SQOL 1VSCA 5D9SA 4GKSB 1RIUH 3M07A 3H6JA 5HVWA 1FIGL 4BZYA 2XIDA 4NQUA 2FNBA 2OL3B 4DN4L 3FQTA 3EHBD 3U48A 4TNVF 3LQZB 7FABH 2HTKC 3MFFA 4U49A 1YNTB 3V2AR 4OZIE 2X4RA 1GZPA 3VXNA 4OD3L 5DSCB 2OJEB 4PJHF 3C60A 5GGQL 4HCRL 1KOAA 3M17A 4LRIA 5D7JB 4GAYB 1NMCB 4D0DB 4IDLA 1TITA 3TPUB 2XTJE 2X1OA 1YNKL 3SE4C 1IM9D 2DBJA 4ZTOH 5HGDB 4BQBA 2QTEA 4YHOH 3TBVB 5JQ6L 2R56H 4UIKL 5IJVB 1W72H 5IK3B 4P59L 1UYWH 1JRHI 3FL7A 4F7PB 2HAZA 3MA9H 1FNEA 3HMWH 4U7MA 4FQXC 1RFDH 1MY7A 2JIXD 5J3HC 1CQYA 2AQ3A 2KZ1B 1AE6H 3W0WB 1FL5B 4PLKD 4WEMB 1JVKA 3V4UH 4WV1B 4HQQH 1C5BH 1E27A 4FQXA 4ALAH 3K8MA 3BKML 5DC0A 3DUUA 4ORGB 4YXKH 4TYUA 2FD6L 1ED3A 4KJWD 4YHKL 5DJ8A 4OZFH 4PGBB 4Z77A 4UTAH 4OD1H 5KANG 4U3CA 2CQVA 3OBAA 4MCYB 2NX5A 4MLSA 1A6ZA 4UQ2A 5GGUA 4ZO9A 3GSOB 2B20A 4R6UA 5C3LD 1GOFA 5IGXL 4HIHA 4PRPB 4OGZA 4AEFA 2DQIH 2VDKH 4F7TB 2G75B 4Q9CA 5D5MA 6FABL 4LCUB 5D1QC 4JY4A 1I7UB 4LSRL 5ELIA 1BVKA 4JDZB 5CEYA 4ZOCA 3GMOB 1X3DA 5D1ZA 1L7TH 5CJQH 5EN2B 3GMMA 4MXVF 1CGVA 3CFBB 1OM3L 1RZ8A 3TBTA 1QP1A 4JFPB 2AJZB 4EEEA 3DECA 4UT7H 2ORBH 3LHPH 1VKXB 1A3LH 1NGPH 4Y5XA 5EO0A 4PJ8C 2NTSP 4K8RC 3CC5B 1D7FA 2CRZA 2X5PA 1KB5L 2VLMD 3RGHA 1OWRM 2IF7A 2B2XH 2A9NL 4YAQB 3R4DA 1NAMA 3RVWD 5DGQA 1NPUA 2D0GA 4MJ2A 4B5EA 1XF2A 3UTTB 3EAKA 1H9VA 4L9DA 4G8GD 1G7IB 3BDBA 2JCCB 4DK6A 3LSOB 4L4TB 4OZHF 1JFQL 3U30B 2DTSA 5TDNA 2DIBA 3VFOA 4WENB 4R4BA 1RPQA 4MJIB 2NNAB 4ZUVB 4DK3A 4RZCA 4M62H 1KT2B 2ICES 2NTFA 2R1WB 2YWZA 1P4BH 2HRPH 3GGWB 3MYJB 4WEBH 2A2QT 5CEXB 4C4KT 1S7UB 1DQLH 1MRDL 2WBKA 4JPKL 5EU7C 5JW4R 3MBED 3ZTJH 1CCZA 1L9MA 5JUEH 3ES6B 3QDGA 4P5KA 4OSUH 8CGTA 4XPBH 4EI5C 4OJFL 3WXVL 3FB7B 3P4NB 3RL2A 2YPKA 4JPVH 3MRLA 4MGXA 4ZOAA 3HE6C 4PJAA 5BMFH 3FHAA 1T83C 1S7WB 1PX4A 4JHAH 1U93A 5EH1A 4I4WA 4WI7A 3CLFH 5ISZE 1AGCA 1G9NL 3QEGH 3TBSB 4U7KA 5DZOA 3WFDL 3CVHL 4GW5A 3UTSE 3JXAA 5FDWA 1KB5B 4YHYB 3BZFA 1ZLUK 4LLDA 3HN3A 4BK5A 1ZWIA 4YHYC 2QQKH 2IBZY 3RX7A 4NZJA 3OGOE 4FTVD 2NY1C 1K4CB 5DVOA 4YHPB 2J4WH 4WI6A 4XP1L 1L7IH 2AJUL 4XAWL 4R7NB 1G7PB 4GQ9L 1U91B 5BVPL 4YZFE 1V3JA 4K7FB 4Y1AD 1KNOB 2OBGA 4MMZC 3GBNL 4DW2H 4ELMB 1U93B 3ZDZF 2BVUA 3UJIL 4OQTL 3MOBH 4F9LC 3VXOB 3W5NA 3TFKD 1LHZA 1V3MA 3QHFL 4NJ9L 2FECI 3O2DL 4XNMB 3S3SA 3EKCA 1YEGL 3LRSA 2OSLA 3KPSD 5I30H 1J0IA 2L7UA 3UC0L 2HJFA 2X9WA 1DE4B 2BNRE 3VGFA 1I1YB 5DMYA 3VRJB 2WIIA 1JCKA 3IU4H 5C71A 2UWEE 1LGVA 1XGRA 2G9HB 3DURA 3CH8A 3VXSA 4JFFB 4DUWA 3PHQB 1TQBB 3O9WB 1NFDE 2BC4B 1KJMB 4LGRB 4PS4H 5DJCA 4PJFF 1ND0A 2ZUSA 3CVIL 4M00A 4XB7A 2BJML 4O5LH 2FL5B 3NIFE 3PWPA 1MJUH 1FCCA 4K2UL 3D87B 3IDGA 3LKNA 3RHWK 3GSRB 3CSBA 4JRYA 4BK4A 4Z7QE 3LKPA 3EOYG 3V52H 2NY2C 4OZFG 5EIIA 1HWHB 2BOCB 3QIUB 5E0QA 1S9XA 1BIIA 3ORJA 3K74B 3LEYL 3CH1A 4E41B 4MA1B 4NQDA 3UAJC 1FFOB 2Z8VC 4P5TA 4LLQA 5DUBB 3REWB 4ZFOB 5HHQB 3PGCB 2J2ZA 1A1MA 2XKSA 5HGHA 1ZTXH 2VXVL 4ONHB 1MWAH 3C6LD 4OTXH 4EUPB 2YD7A 1ROWA 3HPLA 4YGVA 4PRPE 5BO1L 4XCCH 2C7UB 4M6OL 1T6WA 1A1OB 1RUKH 2ICWJ 4X6CF 3Q6GH 4Z8FL 5HHMD 1IQDB 3BKCH 1OSZB 2P8MB 5D7IF 5J12B 5DD0H 1P6AB 5IESL 2DKUA 1Q9KB 3D3VB 4FFYL 1U3ZA 3MBEB 3TEUA 4DGYL 3NA9L 3RWIA 3U82B 2ZUUA 3O81A 5E6IA 4OZFA 5DR5L 4CVUA 1ERNA 1A6PA 3OKLA 4D3CL 4YNYA 4PV8B 2IMNA 2AKRB 5J8OA 4B7LA 3TWCL 1UVQA 4HUUB 4EUPA 2VR4A 4JAMB 4LLWA 4X6BA 3V6FB 2JE8A 2WBJA 3PJSB 3G6JF 1NLBL 4QF1B 5HHPA 1HNGA 4S2SB 4HBCL 5C0CD 1I8LC 1MNUH 3TA3A 5T1MB 4EI6B 1A5FL 1CGTA 5FV1L 4HZAA 1JPGB 4ZPVB 3V6OC 5DJAB 3STBA 4LQ1A 1F58H 3MRNA 1KN4H 2CIIA 4XI5C 2OQJA 3JV0A 4P46C 4X9BA 2DM4A 2QKIB 1KXTB 1I9IL 3DUHA 1T1ZA 1AHWA 1Y18B 3NACH 3VXTA 4QT5B 4HWBH 4HKXA 1T0MB 3PWUA 35C8H 4D9QE 4DEPC 1WIUA 1S9YB 5GJSL 3QZWA 3FT2A 2H2SD 3MUHL 2ID5A 2NXYB 2P8LB 2FHCA 3O4OB 4HGWA 4KZEL 1LEGB 2IBBA 2NLJB 1PQZB 3MZTA 1ACYH 4FQ1L 4PLKC 2OL3L 4UI2A 3VFSA 4MX7A 1PZUB 5F9OL 4Y4KB 4I9WE 4JKPH 2EDXA 1T7XA 2C26A 6CGTA 5I1KH 1NQBA 2NY6C 3ARDB 4KI5F 5DJAA 3MR9A 4PFEA 5DD6B 1MHHB 5CBEB 4IEFB 5FK9A 5JOPD 4OIIL 4O2FA 2N7AA 1JUFB 5EBMB 5HGGS 4JFFD 3N9GL 4NCC2 4QYOA 1JWUB 4N0YH 5GGTA 3H7BA 3O9WD 3QWOA 4RGNC 5EA0H 4YK4C 1PEZA 5FHAL 4AZ8A 1KXVC 3B3IA 3NH7L 2VABB 4XPAH 2Z91A 1KPVB 3FOMB 4YK4B 4LP4A 3HZYA 3I9GL 2VDLL 4U33A 4YXLH 4IRJD 4H25B 3LS5L 1UXSB 3EDDA 2IFGA 5HDQL 1XGTB 4K3JH 3F7VB 5JXED 4DVRL 3QXUA 5ETUA 2P5EA 5KSBA 4KJQC 4M1DL 1GL4B 1CFVH 4N0FB 1E6JH 2GUOA 1CGWA 2B0SH 3HNVH 5HD8C 5EU4B 4GKOA 5HYSB 3VFRA 4WFHE 4JFHE 1OD9A 3EDFA 4AY0A 3ZYJA 5E4IA 3PIQB 1P7HL 2XKNA 3U7YH 1OARH 4Z7VF 1MCJA 3FMGL 3HPJA 4G42B 4ONFH 1ITBB 3QXDA 4XNQA 3G5ZA 3C6LB 1AQDB 4KRMB 2H6PA 3D0LA 3VRIA 4X7TA 1U8MB 4P46B 3DRTB 1ZT4A 4NRXA 4W70A 5HHMB 5M95B 3SPVA 1U8IA 4HKJA 1JV5B 4S0SD 1CL7H 4U05A 5FGCE 3C2AH 4YDVB 1RZIA 2VLLA 2GITB 3HG1B 1TVBB 1K2DB 1NCBL 3D3VD 2WUBL 4N0UB 5GISH 3TJHD 4LU5H 4ODWB 5T3XL 3K3QA 3QEUA 3B9KA 1WWAX 3C6SA 5BRZD 2BNRA 1M05B 4LHJB 2P5WA 2AXGB 4KJQD 5FYJE 1PYWA 3U7WL 4WUKL 4LPWA 4U6HA 4XNZC 1QLFA 5H94B 5H35A 2VDML 1NC4B 3MRHB 2Q86B 4F9PA 4E0RB 3QUXB 5ESQA 4Z7OF 3IKCA 3IDXH 2V9QA 3DRTA 4HJGB 1WIPA 1K85A 1RUPH 1RZFH 4L29A 1KTKE 4NO2A 3EJZC 4PJ7E 5ITFA 4LSQH 5FF6B 3ILQC 3F12A 4PJ8D 4ZXBD 4PJ7F 3BX7C 1SMOA 2VYRE 1PKQB 2F8XC 4ZUTB 4U1HB 2PO6C 3HI5H 5HVFB 3CVHA 3SBWA 1U8JB 5DJXA 5DJ6B 4I3RH 5EU6B 1ZS8A 3C87A 1MRCH 5CEYB 2EIZB 2DQHH 5BZWB 5L2KA 4E0RA 1FPTL 4LCWB 1FRGH 5DYOA 1QR1A 2NY5C 1F90L 3OZ9H 3QG7L 1G1YA 3S98A 2ADIB 1NH6A 4GMSH 1KACB 3GIZH 3LD8C 4IRSC 1MFBH 3FRPA 4A6YH 4ZQKA 1KEGL 4YDIL 3D48R 4UUJB 1PX3A 3OAZK 5DLMH 5DJYB 2H3NA 1QBLL 5DHVA 4IOIA 5I8EB 2IANB 2NY7H 3MREB 3MLZL 1GIGH 4HUXB 3TBTB 3ULUH 3QUZC 3RNQA 5DURD 4WIQA 1HSAA 3K8LA 4IRJB 2GSIA 3K80A 5DMGC 1LO5B 4D0BA 4YC2B 2CK0H 5KTEL 1MJ8H 1FGNH 5IMMA 1ZSDB 3K4DA 3FO1B 3MYJA 2R2EA 4OCYH 2AEPL 4Z7UE 2VQTA 3JWDL 2ED7A 3WNPA 3QDJE 2DQDL 1F11B 5AZEL 5A2IH 5TQ2H 4WW2A 1OGAE 3LQMA 5FKPB 3KPNA 5C0JA 1CFBA 4LARH 3PABA 2ENYA 4PJAB 5DK0B 3QJFB 4NBZB 1HSAB 1WFUA 4I0PC 1LNUA 5LAXA 4C83A 1CLCA 2EH8H 5I1CL 3AMLA 1WBXA 3C8DA 1LO5A 1OTSD 5F9DC 1FZOB 5FDWB 2X44D 4D94A 4LFHG 4GXVH 1IT9H 3RWJB 1KBGH 4WY7H 4YQXL 1X5KA 1ORSB 4TUOA 1X5IA 4MJ6A 4R96B 3D25A 5D8JH 3MC0A 4QTIH 3MV7A 3O2DA 5FO8A 4FG6D 5IW3A 3TN0A 4HWEL 3ARFC 3RIAK 2FR4A 3D39A 4XVJL 5I1AA 1P1ZA 4PJCB 5K93A 5KSAD 4LIQL 4WTWA 1A4KB 1AR1D 3MX0A 3CGTA 1X5AA 1HH6A 1WK0A 5JNYA 1REIA 1MY5A 3JVGC 3P4OA 3BW9A 4BQ8A 2FBJL 1RJZA 5F6HI 1XIWD 4QRSA 1FNLA 3LRSB 3KHQA 4DKFH 1X4ZA 2IQ9H 4UINL 3I02B 1G7JA 2AJVL 4NZUL 2K1MA 3I75A 3V5KA 3QRGL 5E2JA 1AC6A 4R96A 4JFZH 4HWUA 1W0WA 4NQVA 3WS6C 1G7PA 5I19L 5GHWL 1H3XA 1LP9B 1NMBH 5SWSE 2HFFA 2WW8A 4HIEA 4TNVK 4RGNE 5TGBA 3GMMB 1FO0L 3N85L 2R2CA 1N6QH 5ADPH 3IFOB 3K2UH 4M7JH 3GB7B 3MMEB 2BSED 3WS3A 5C1MB 2VUOA 4Y5XB 5EO0B 1NUFA 3KPRD 3W2DH 4P4RA 2VXQL 5BZDB 4KJPD 1BQSA 3MCKA 1HQRA 5E00B 2ARJB 1CLOH 4DN3L 3GSRA 2Z93A 3W11C 4GOSA 1XCTB 3HCVB 5DFWH 4JZJC 4N9GB 3B8SA 1CGYA 3LEVH 1B2WH 1I8IA 4P2QE 5SX4H 2CMRL 2MHAB 3RIAF 3VDAA 4XWGL 4HH9B 4ZYKA 2Y23A 4BZ2H 2ZWLT 5GSVB 1B6UA 1R3KA 3CZFA 4RMVA 5KBNC 1BQHG 3RVWC 2FIKB 4AIZA 1NC2B 3Q5TA 1T3FB 2WIMA 2C7UA 1BD2B 3GJEA 5C09D 2EDHA 3CPLB 2ZKHH 3NTCH 1INEL 4YHZL 4OLZH 2E27H 4Q2ZA 2DQFB 4C54A 2XQBH 3REWA 5CEZH 1NBZA 4Z0XB 1VFBA 1EMTH 3K1DA 3HTLX 1BAFL 4LLYB 3LB6C 1FFRA 4M48H 1CXKA 5JR1H 4NPYB 1YC8A 3MRQB 1FH5H 4QXUH 1MHPL 4NHUA 2PYEE 1EUUA 1TVDA 4IRSD 3HZKA 5IVXE 2P8MA 1KN2L 3HI6L 3O6KH 1WTLA 5IEKB 4YBLC 1I3UA 1MCBA 1IAIL 1FIGH 2DQUL 2JB5H 5EZJB 4BFEA 3RJDA 4YNYB 1DBKH 1QO3A 3T0DA 4MA1C 3F65A 2XWJA 5AD0B 3MJ8B 4HPOL 5I8OH 4U0RB 2GCYA 3O4LA 1JHLH 4CGTA 3C9NB 2DMKA 1UADC 3C5ZD 2ZUVA 2XXCB 4FABL 4KKLD 3MJ7B 2HJFB 1B88A 1QFUH 1KSRA 4OLYL 3PP4L 4IS6B 3MACL 4K71C 1A1NB 1ETZA 3QYCA 1NUNB 3O41A 4ZTOL 5DD5L 1NDGB 4PR5A 1H15B 3EYSH 3MLVL 2YOCA 1KLFA 1AQKL 5F9JA 5BW7A 3L3JB 4YHLH 3OKMA 4ZPTA 2R56L 4QHUB 1UYWL 2DJSA 4MYWB 4G3YL 4NKDB 5KW9L 1W72B 3SDYL 1I3GH 3O2WL 5HI4D 3PWPB 3DTXB 3UTOA 5LXGH 1OAKH 2X2YA 3GMQA 4XCFH 1PG7W 2G60L 5C9KA 4P2OD 4DKEH 1EDQA 3LKNB 3TH4T 3CSYB 4NRYA 4H20L 3O6FD 3QPQC 4JDTH 4WRLA 1BBDL 5ANMB 4TSCL 4GG6A 3C09B 4OD1L 3MUGB 2MJWA 5F7DA 5F21B 2E7BA 3SQOH 1GGIL 3KPRB 1YEKL 3FZUD 5L2JA 5CBAA 5J1AB 4XCYA 2HT3C 3EOBB 2VWEC 4NQDB 4WTZA 5D2NE 5BS0E 5HYQB 2V9RA 5D1QB 1UWEL 5IMLB 4QRTA 3EFFB 4PJXB 7FABL 4YHNB 1RZJL 3U79A 1KTDB 3RZWA 1MCEA 3OKOA 5I75C 3RY4A 3L7EB 2VMFA 3VE0B 1GGTA 3HRZA 4LSRH 1KCRL 2AV7B 3U0WL 5FEBA 1T04B 1NDMA 4BSVA 5FXCH 4KKBD 5E8NB 4K07A 1UM5H 4RISL 1L7TL 5CJQL 1KJ2B 1DR9A 2CD0A 1OM3H 2DQJL 1A6AA 4XCNA 2NW2A 4RSVA 3OF6D 1NEZB 3OKKB 5F7DB 4KRNA 3QG6A 4IOSD 3VH8G 1DANT 4U1MB 1RV6X 1D9KD 5JOEA 1NGPL 2RB8A 5JQ6H 5H37H 4N0FA 5F1IA 4X6DB 1W72L 5FOJA 3WV0A 2HTKD 3B9EA 1NLDH 1IVLA 1E28A 3D18B 3MA9L 4LCCC 1TVHB 5T3ZD 1FFNA 3QXAB 3V4UL 1SJVA 2P1YA 4L8SB 4S2SA 1FP5A 1C5CL 4MAYB 4C57C 5IHBA 3I3BA 4F7CB 3JTSB 3X17A 2D7OA 4RRPA 1A6AB 3EO1B 4KHXL 4XRCA 4P2RB 5JXAL 2YPLA 5HVHB 3HE6B 3QUKA 2HRPL 1KCSL 1T7VA 5KG9A 3MRRB 4JFED 3ARFD 5TF1L 4M1GH 1LO2L 3LKQB 5FYKE 5ITFB 2DWDA 2HKHL 4XPBL 1DQML 3GI9L 1N8ZB 4FMKA 1KXQE 3IGAB 1RK0A 3EYVA 1Q72L 3SKNA 4DQOH 3NIFF 4R0LB 4Z78B 5C8JA 4OF6A 4O9HL 4ZFFB 4ZUSB 2H9GB 2AGJL 1HXMA 5CCKH 2R2HA 4WHCA 5DRXB 3KYAA 2E7CA 1ZHKA 1LEKB 1NGZA 3WFDH 2XICA 1Z0MA 2FATL 3QQ9C 3DUUB 3DBXA 3ZHKA 1A3LL 2MFNA 3I6LD 1NAML 4D9QD 3V9FA 1QR1B 4X6CE 1DBAL 3VXMA 1DCLA 4M9OA 4X7FC 3VXUE 2VZSA 1CS6A 4Z7VA 2YD2A 4OM0L 5CJXC 1KPVA 1HH9B 2N4IA 4PTTB 2OK0H 3N1PC 5T33H 3IYLW 5BVPH 1YMMB 2ZUWA 4I0PA 1KC5L 2YC1A 3DYMA 3PWPD 4NKMA 2E6QA 3IFPB 4YBHA 4PJIB 3WEXA 4OQTH 5T1DL 1P5VA 5DHVB 2V7HA 5GRVK 1T6VN 2CDFA 3MLYL 3BWAB 3MOQA 3O6FB 1QSFA 3BIAX 5I73C 1P4BL 3QO1A 3D2UD 5JOPE 5D1ZB 2QQLH 3DBXB 1AXSA 5HHXH 2RFXB 4K94H 3QUMA 4PRAA 3PGFL 3DPBA 4JPIB 5DVMA 3MJGX 4S1QL 1F8TL 1H8SA 1P5UA 1XGRB 3FQUB 4LKXB 1HHJB 5M94B 4TPRH 4LLMB 3QWQB 2ICEB 4ZNEE 1A14H 4R4NC 4MLIA 5FO9B 3BPNB 4Y4FC 1RHHA 3CSPA 2EDRA 3KLSA 1RZKH 1P9MA 3CVIH 2V7HB 3SDDC 4QRUA 3L7FB 4O5LL 3MRKA 4NN5B 3H9SE 3N1QC 1IARB 4O02L 2DRUA 4OCMC 4PJBA 5IT2L 3V52L 1EEZB 5DO2C 5F7KC 1S9VB 3L3KA 1S9XB 1A6TA 5EBLB 3T0AA 5E5UB 1NFIA 4KUZL 4ENEC 2J4WL 1LQSR 2Q6WA 2PTTB 4U6YA 1S5HA 3CXHJ 4HIXL 4XXDA 1HHGA 4JQXA 4KDWA 5K9JL 3KS0H 4KRPB 5D7JA 3BESR 1Q38A 3UJIH 2BY3A 1FG9C 4QRQB 1JGVL 3QHFH 4LSVH 1FLRH 4HJ0C 4OFYA 1CF8H 1HE7A 1GGBL 2WZPD 1JN6A 4M93B 3FONA 3UC0H 3F5WB 2CO7B 2HT2C 5JXEC 5DD0L 4TSAH 5IVNA 3CFJA 1CFNB 3DHJA 3Q5OA 3BEVA 3QO0B 1HCFX 4D3CH 3WFZA 4AM0A 3X13B 3I6LE 4HEME 4H88H 5I1LB 2AJXH 4GLRI 3V7MA 4YIQA 3W9DA 2XZZA 2KBGA 4NQEB 4KGJA 5CHNA 1S3KL 4JN2A 5F7FA 3WO4B 4X6DE 3F7PC 3RZCA 4X8XA 1FAIH 2AQ2A 2W60B 3E3QE 4LLWB 3V6FA 3S5LG 3OWEA 4XNXH 3LQAC 1Z9OA 4KVCH 4LPCA 1AJ7L 1NLBH 3BZ4B 4LSPH 1MWAB 4JCMA 4XBGA 1JHTA 2GW5A 3V6ZB 5ACMA 3MRGA 3NA4A 4OT1L 4QXGH 5BZDA 3U6RB 3AXLA 4WFGD 2PR4L 1JIBA 4X4YA 2H1PL 4JZNB 3DX7A 5SWZA 3RKPA 3WXWH 3ARUA 4R2GC 35C8L 2J5LB 3K2MC 5C0DA 3I2CH 2ATPA 1E6OH 1S9YA 3RWFB 4NSKA 4FZEH 3WN5C 1RZGA 4HS8L 2X4UB 3BPOB 2JB6B 2AV1A 1QNZH 3G6JE 1FZMA 3UROR 1QPPA 4GAFB 4NNYB 3PWLA 2WQ8A 2G2RB 1CYGA 4OIBA 4EI5B 1A7NL 1LE9A 3PL6D 4MCZB 4XP5L 4M02A 3DX7B 1E4XL 1CDYA 5C07B 2H2PD 4MXVE 3SE8H 2P4AB 1ES0B 1KPRB 5C0JB 3N9GH 3BGAA 3VGAC 3KYKL 1ZA3A 2EIEA 3G6DH 2X4NA 1QKZL 4PG2A 4OIAA 2V6HA 2GQHA 2PKDA 4OKVA 1XF4B 1IKNC 2FIKA 2DM7A 4Q9RL 2BRRL 1EHLH 4L8DA 4OZGA 1QBMH 2IWGA 1O7VA 2DI8A 3Q5YA 4P3CH 1A1MB 4YXLL 5IIEA 4ODXA 3RVXD 5DS8B 25C8L 4TNWK 5D6DA 5EUOF 1CLZL 1MQ8A 1UZ6E 5TE6H 3BPCA 4ZSOE 4RMRA 1F58L 5CWSA 4YBQD 4UDUB 3OSKA 5C0BB 1IQDA 2A73B 3QEQB 1PLGL 5D7LD 5C08A 2KQMA 3T3PE 5JW5A 1GXEA 1I9IH 4ZFGL 1IGIH 5FYKU 5K59E 4ZD3L 2XTJC 1JZ5A 1INDH 3CFKB 5GJSH 4P3DA 3HR6A 3MNZA 4JFDD 5DEZA 1CFTB 1T1YB 5C0AE 2R8SL 3MRQA 3MZGB 1CBVL 4YEEA 3FMGH 3F6IA 5IB3B 1U3JA 2HFEB 1H5BC 5DMIH 1GPOL 1MFEL 4FQ1H 2VLRE 3FB6B 2AXHA 5F9OH 2FRGP 2WBWB 3ZMRA 2UUDH 5DVKA 3TO4D 3E6FA 1C5DB 4PJFE 1MELA 4WGWB 4ELME 3JUZA 5ALCL 4XPTL 5F3HA 4PLOB 3OPZH 4XC1L 5K9KB 5EG6C 1K4CA 12E8L 1NCBH 4X0KA 4OIIH 2NY6B 3ARDC 3B8YA 2XN9E 5L2KE 4QHUA 5I1IH 3ZKND 2UY6A 4Y4KC 5ENWA 2YN3A 2DIJA 3WIFB 3LN5B 2PN5A 4NM4L 3AMKA 4WWKC 1CG9B 4WUKH 4FQXD 1T0MA 2NX5E 3PWUB 4HKXB 5FM5M 3VFPB 3WDIA 4F7MB 1QPXA 1FAKT 5DC9B 1Q9WA 5AG8A 2VDMH 4LHUB 2A83A 4JKMA 3RRQA 4CVXA 4X5LA 1N64L 4U1IB 1RZFL 4NO2B 1T1XB 4AMKL 2OL3A 4MX7B 3QDGD 4KMLB 4GRLC 5FA3A 2V9TA 4JHZA 5L2JB 4YH6A 3ECBA 2JJUA 3PP3H 1IGJA 5F9WC 5B4MD 2OYPA 2BVPA 1SBSH 5T1KA 3H9ZA 4CBPA 1JZ8A 3NN8B 5CMAB 2FEEL 3NMEA 5FUOL 5MEQA 1ND0B 4R90H 2EEAA 1OARL 5HYJE 2R29H 4KQ4H 1VACB 3DX8B 4WO4A 4AT6A 4BFGA 3ZLQC 1Z6JT 2DQHL 3E6HA 2Z31B 4HC1L 3HB3D 3IFLH 1D6EB 1KEMH 1LO4H 1MCOH 1VFAA 2R0LL 5DZLA 1J86A 4M03A 2MQ0A 3OZ9L 4H25A 3C2AL 4J4PA 2B5IC 4GMSL 3DIFB 1MPAH 1VFBB 3MLWL 4XP9H 4F58L 1WZ1L 1YN7A 4LU5L 1VGEH 3IJYA 1NL0L 5C07D 3BE1H 3QUYB 2IH1B 1DFBL 3C8KB 1U2CA 3LN9A 1JWUA 1FL5A 3QI9D 5CKAA 2BVQA 3HC4H 3MLSH 2F9BT 4WWKD 1CGSH 4Y7MA 2Q3ZA 2NY7L 3FQNB 1K8DA 2OTPA 5DK2B 2YD9A 4HW6A 5TF0A 1IJ9A 1P53A 4OD2A 4ZUUB 3NVQA 1OSZA 2Z4QB 3TA3C 3LB6D 5CUSL 1ZV5A 3MV7E 1W2KT 1KCKA 4U6TA 4AYFA 4FTVB 4X6DA 1PJ9A 4WFFD 2J8UE 3RI5K 1XCQB 1XF3B 4OCYL 1ZT4B 4NRXB 2AEPH 3LEXB 4KRLB 1RHFA 4F33A 1VFMA 2GTZA 2W0LA 4NJAL 2VLKB 5GRUL 1GGYA 4NKIL 1CICB 4OAWB 2CDEB 2UUDK 1YYMH 4J8RA 4PB0L 4JFDB 1HHIB 4I3RL 4BA8A 3RPIA 5I1GL 1A6UH 1H3TA 4NZDA 4S0TD 1R5IA 3O3EA 5IF0B 2NW3B 4K9EH 1OD7A 1WEJH 2HH0H 1J1XH 4Z7WB 3L5JA 4QHLB 3TO4B 1F90H 4WTXA 1ZXQA 4HS6A 4KKLC 5IMKB 2ZCLH 3VA2C 1IT9L 1A7PL 3AS2A 3WFCL 5HJ3A 2J7LA 1I8KB 4NRZB 1JP5A 2XRAL 4WNQA 1JWSA 3QNXB 4KPHL 3EJYC 4MA8L 4J23A 3MYZA 1CICA 5EIQA 4OFKA 1XFPA 4Z7VB 4TRPH 1Q8MA 1CTOA 1ZOXA 3P30L 1J18A 1MCWW 3ULUL 2PW2B 1DLFL 3KYNB 3MUY1 4HG4J 2ZJSL 4YFLI 1INQB 2QEJA 5J7CC 1YEEL 3VJ6B 1J0ZA 1JNHB 2UZXB 5IM7B 5IVZB 2APFA 1XMWA 2DB8A 5JIHA 4Y5VB 4JO4H 3QIUD 4TUJB 1WLHA 4G80B 2E5EA 3QO1B 5JIKA 3VH8A 3WHXB 4IMKC 4PRIA 4YHNA 4WW2F 3QDGB 3AFLA 4JPIA 1JTTA 3DMMB 2DMCA 4XMLL 1BM3L 4KI5D 1WBZB 4UV4L 3CUPA 1XR9B 1VDGA 1AGEA 4H26B 2PO6A 3S6CA 5I19H 1YMMA 5GHWH 4P9HL 1BBJB 2VN7A 4MD5A 4JO2L 5F72S 3GKWH 2RCSL 4PJIA 1MVUB 3FO9B 3QDJA 3CU1A 5EU6A 3P0VL 4N0CD 3ZSTA 1ODAA 5GRWA 3HMXL 2UVEA 3GB7A 3MMEA 4JZJB 3ME0A 4NHCH 5J06A 5KZCB 4EVNB 4HUXA 2BSTA 2QADB 3B9KC 2VXUH 3T4AA 1CL7I 4KK9D 2VXQH 3T0VA 1DEDA 1OHQA 4Y16C 5FM4A 1KGCE 2I9LA 5TQ0L 3PWJA 1CDCA 5TE7H 3G5YA 3L3GB 4V1DA 4LPXA 4HAFA 4XNUL 5F7MC 2X05A 2OXGA 1T66D 1QHPA 4L8SA 4F37F 3WE6A 2GFBA 3BWUC 3DNKA 3NPSC 3PHQA 1MH5B 4PP2B 1HYSD 4WWKB 1ZAGA 4MAUL 5HYIA 1YJDL 3RWHA 2FJHB 4Z0BH 2XNAA 5B4MC 2UWEF 4HUKB 1U8IB 2YK1H 4HKJB 1YYLL 3KJ6H 3MRBA 5JHDE 4GKNA 3O6MH 1UZ8B 5LQBL 4GKSA 2VZVA 4UINH 3H9YA 4QRPE 2K9UA 4JEGB 3PP3K 3QHZH 4IRZH 3WFBL 3QRGH 4RA3A 4G9FD 2R23B 4L4TA 1MUJB 1QSED 3KVQA 4OF5A 4YFLF 2E7MA 3RJQB 5J1TC 1CICD 1EBPA 3D0LB 3QO0A 1CQKA 1BAFH 3IB4A 1LEIB 4M1CC 1F6FB 2ZUXA 2IPUK 3KPNB 5SWSA 4CVZB 3QJFA 3GIVA 2EO9A 4PRHE 5I1AB 1RAMA 4PPTA 1BMGA 3ARDD 1P9MC 2BMKA 4GRLB 5LVEA 5DO2D 5FYKD 1A1OA 2BNQE 4HWBA 4XP6H 4X5XA 2VTFA 1AXTL 1MCDA 1F3JB 1IAIH 5MHSE 5EORL 4PJGA 3QB7C 1F97A 4RDQF 2NZIA 4AM0B 1X5FA 4NOFA 3LEVL 3LN4B 1U8QB 2AEQH 1EO8H 1X44A 4HXAL 3ZT5A 3BP4A 1Y0LA 4BZ2L 4DOHE 2BOBA 4DFIA 4BM7A 5MENE 2J8OA 4PJ8A 5BZWA 4KI5E 3QUZA 5IBTH 3BIKB 5IQ7L 1U8OB 5E2WL 3TO2B 3VWKD 3VFMA 4JG0H 1J05B 2EDFA 2VISA 1INEH 4YHZH 4LLMA 5C9JB 4YHLL 1PSKH 3DMMC 3HA0A 5CEZL 3DVNB 5FYLL 2I26N 3S4SG 2EDDA 3QNYA 5KOMC 4LPUA 5CSGA 5I75B 1S7QB 4L8BA 4ORGA 3D1MC 1KYOK 4QT5A 3BVNB 3O2WH 4KK8D 5HHNB 4M48L 4XBEL 3DSFL 4LCWA 1T83A 1CD0A 3L3OA 1HKLH 4Y19D 4WW1B 1NCDH 4OZ4B 1MJJA 3F6LA 4HIJB 1UC6A 1YEDB 4TSCH 1YPZB 3C2SA 1DQJB 5EOTA 1NGWB 1HQRB 4XAKE 5JQHC 4ZXBA 5DEGA 1AGBA 4M61B 2DL2A 2O5XL 4XMPH 1FZKA 2XTJD 4E5XA 4LBEA 4OB5L 4NN6C 3PHOA 2VE6B 4XX1E 3SE3A 1M7IA 1YEFH 3WLBB 1GCFA 5CP7B 3I6GB 5IV2B 1G7IA 1T0NA 5F8RC 3RUGA 2X09A 1JRHL 1A47A 5E08H 1F4XL 4U4BA 3CX5K 3FONB 3ZE0E 3UBXA 1OAUL 1MJ7L 4LEOA 1VPOH 4LCIH 4X6EA 5DS8A 3HC0B 4RNRB 1YN6A 2I24N 4N8CL 1T3FA 5JPNB 1IBGH 2VLJD 4HBQA 3SCMA 3DWTA 2P8PA 1IC7H 5DD5H 1DBBH 5GGSY 1RIUL 1T2QH 4ZXBB 2XI9A 2P5WE 4XB8A 2G5RA 1D5ZA 1MRFH 1VEMA 4N0CC 1SMAA 1UH4A 2FX7H 4D0CA 3PABB 1NLDL 5BRZA 1NCWL 2E7LA 1XR8B 5MHSD 3VFGH 4OD3H 4HFWB 2C9AA 1OAKL 4P48A 4XCFL 5GGQH 1JZ7A 4HCRH 1T89A 2A1WH 2DAVA 2XKNB 5HGHB 1G84A 1BECA 3S35H 5L8JB 3MOAL 3VFUB 4K8RH 2FB4L 5B22A 2RQ8A 4Z7VE 1YNKH 2YPLB 5MEND 4WWID 1GGIH 4GRLD 1YECH 5HDBE 3IDMB 3WFHA 2IAMB 4M1GL 1I9RL 2JCCF 4DGVL 4UIKH 2YPKB 4EQ3A 4XT1C 1OAXL 4KTDL 4WI4A 5D6DC 5DRZB 5IVOA 3ZE0F 5IMOA 4GO6B 3JVGA 2HKHH 1RZJH 1TTUA 3FOLA 4I0PD 2IAND 3TYGL 3HAEA 2GJ6E 3MRNB 1CG9A 3S8WA 3SKNB 4PRDB 1DZBA 4ELMF 5CGYC 4M6ML 1OP9A 1UM5L 4RISH 3T65A 4D9RE 2EH7H 4P9HC 3B2UC 5GGVY 3GMRB 4KU1A 4EI6A 4V1DE 4EDWL 1DEEA 5K9QG 2QSCL 2RBLA 4A6YA 4NNXB 1QFPA 4C56D 1KJVB 4JREC 3LS4L 3VWKB 4Y1AA 4AENA 1L0QA 4L8CA 2C4XA 1KULA 2ZOLB 4WJ5A 3SY0B 3T0EC 5LGHH 5LG1A 1FC2D 2VXTH 2DI9A 1YNLH 3HRPA 5K59F 1FNFA 2O5ZH 3KPSA 5J4MA 3K7UA 2IEPA 1S78C 4X5WA 4GSDH 1QUNA 5HPMB 1JYVA 1KG0B 4OM0H 5FA4B 3MLTB 3CXDH 4TTDD 1NEUA 4NQTA 1CFQA 5T33L 4U1NA 2CLVA 4MDIB 4PJFB 1G9MC 4X8JA 3DVIA 2BVQB 4WO4B 4Y4KA 3RVTD 1YEHL 3E6HB 3ABZA 3T04D 2RAMA 1ZA6A 3GJEB 2D7PA 1QFWL 4RFEB 2AK1L 4R9HA 5C0FA 1CXEA 3WLWD 3TJHC 5E8DH 3PGFH 4P23A 5TF1H 4S1QH 4HULB 5GSVA 1Q0YL 1OY3B 2P24A 2B2XL 4L3EE 4Y16D 1Y6KR 4PJXA 4FRWA 2C3GA 1DQMH 1P4IL 4HIHB 4JFEE 3DYOA 4DQOL 1QHOA 3VE0A 2A74B 3MV9D 4F2MA 3CFDA 3UYRH 1AO7B 4GS7C 1PDKA 5D2NB 5BS0B 3HPLB 4YGVB 4FTVE 4QY8A 4FQJH 1X5YA 5T3XD 5B38G 4Q97A 1ED3B 1IEBB 1MAJA 2YXFA 4Q2ZB 1W8OA 2FATH 1G7MB 3EDJA 5ACLA 3S96B 5D7LE 3IETB 1X5ZA 3KPOB 1NBVL 2VLJB 2DQTL 5EZJA 1DQLL 1MRDH 4JPKH 4NFBA 1FO0B 4NCDA 1T2XA 5C0AD 3KS0J 1VENA 5E6IB 5ISZD 5KG9B 3VGAB 4KUZH 3FFCE 3QNZB 5JA8B 2VSCA 3HNTH 1UKTA 1H0DB 1MSPA 4J3WA 2IANA 1EEQA 5BMFL 4AJ0A 3ZE1E 3QXWA 4YEFA 4MSWA 3T0WA 4JAMA 4XNYL 1CVRA 1Z5LA 3JV4B 2LAGB 3MCG1 5C09A 3SGKA 1I7RB 4JO1L 4P2RA 3MXWL 4PR5B 2J8HA 3VJ6A 1K2DA 2D0FA 2NPLX 3N1FC 4I2XE 3V5HA 2KQNA 5F7NC 3MRCA 2R2EB 4LP5A 1QG3A 5KVMC 5SWZD 4AEHH 2EYTA 5I16A 4D9LL 2IAMD 4Y2OA 3DETD 4FXGB 1A7QL 4JG1H 1A6WL 4ODHL 2CPCA 5JW4M 3BI9X 3OR6A 4NN6B 4XAWH 5I0ZA 4QRRB 3TZVC 3D25B 4BH7A 5GS1B 5C70A 2EXWC 1OLZA 2P44B 3CXHK 5BW7C 2ESVB 3SGEI 2J8UB 5IWLC 3QDGE 5I1JH 4KVCL 5DA4A 3GMLA 4TUJA 4DZBB 2A6JB 2YKLL 1U58A 5F89A 3SBWC 3GSNA 3P2TA 1JPSH 3TO4C 2QKIA 5INDB 1RJZB 4LL9A 3V5DB 1U95A 3AXLB 4Z7WF 2EDEA 3H9SD 3WXWL 2X6MA 3PWJB 5CINH 3VXSD 4Z7NE 3PF2A 5HHOB 4L1DA 5IHZB 2BX5A 4HIXH 2EIZA 1E6OL 4NKOA 1RU9H 4JVUA 3WL9A 2R4SL 2VABA 4I3GA 1XF5A 4NBYB 4GUPB 4NKMB 1JJUA 4BFIA 2P48B 4NT6A 2DYPA 3ALPA 1QFOA 4LKCA 1U91A 4LSVL 4RBPK 5MEOA 4JN1L 1JI1A 1EVTC 3SDCC 3T4AB 5DQDL 4L9LB 1DTUA 5FK9B 4RRPG 1I1RA 4OFIA 3UJJL 4R4FL 3P9LB 5E8EA 1D5MB 4XP5H 4F7TA 3SKOB 1U3HA 3RTQD 3SE8L 3ARRA 4JFDA 1HWGB 2V17H 3EYQD 5EUOE 5HHME 5IWLA 3S5LB 3MV9B 5B8CB 4MB3A 5DQJA 1MWAL 3RY6A 4NQCD 5D2NC 5IG7A 4K3GA 1G6VK 4P5MB 1I8LA 5HI3C 5EO1B 1CT8A 4P3CL 1DUYB 5KVDH 4XNXL 4LASL 3SGJA 5IMMB 4M6NH 2EKJA 3OR7A 3O8XC 1S78D 4POYA 4XVTH 2DWEA 3BPCB 4OLXL 5KSUB 4OM1H 3O4LE 3IJHA 4OI9A 3L3KB 4RMTA 3MRIB 4WDIA 3DXAD 2Z9TA 4OQ1A 5E70A 4KY1H 2WWMC 4OCWH 4HT1L 2I07A 4N8VG 4JM2D 3RGVD 5FECB 3HR5A 1JTPA 3JTSA 4OCXH 5BV7B 4I3SH 1UGNA 2ZUYA 2IG2H 4S1DD 3GFUA 5E2TL 5E4EB 1OL0A 4CADA 4X4XA 5DMKB 4LLQB 3L95B 4KK6C 5IKCB 4ORZC 2NY4D 1LD9A 4X99A 4QLRA 4KK8C 4Y4HC 1UWXK 4JFFE 4RGOL 4NZTL 1PBYA 4L4VD 3TH3T 4NQDD 5C0CA 4NYLA 5D1QD 4ZG1A 1AO7E 3DGGA 4Q6YA 4HPYH 1MREL 4CNIA 3OPZL 3W9EA 3ES6A 3JBG7 2GSGB 3MTRA 3PDOA 2AXGA 5MP6H 1ZLVK 2Y7QB 2R2HB 1HKFA 1F6AA 4Z7UF 5A40E 1ORSA 1FJ1B 3V79C 4PJ5E 1KT2A 4PJ9D 4XI5D 4QRRD 5IVXB 1IKFH 5C7XH 1EGJH 3V4PL 5CHNB 3RZCB 4KZEH 3SDDA 4FP8H 4X80H 2YD1A 4TQEL 5D2LB 3UX9B 4H8WL 2F53D 1RZGB 2W0PA 3MRDA 5ILTL 4JFEA 5AYUL 3UO1H 5FUZL 4JKPL 4U1IA 1WBYA 2IALA 2IPKB 4OF7A 2QQQA 2Y5EA 4AMKH 3MRGB 2ADIA 2BCKB 2NY0C 2Q8BL 2DLHA 3FQUA 5CSBA 1PLGH 1JYXA 5DUPL 5MI0C 4KUCD 2GK0A 4HMCA 4ZFGH 1I1FB 3QNYB 4P4RB 3RVUD 1IRAY 3FO0L 3H9SB 4F3FB 3B9KD 1DDHB 3FHQA 1BJMA 4TN9A 4DVBB 2X4SA 4MAYD 3V0VB 2V7NB 4MXQC 4U1LA 5E56A 2VOTA 4CL7A 4JDVB 5HY9B 3QZWB 2X4TB 4K3DL 1RIHH 4JCLA 4HC1H 3VI3E 1KEML 4JFEB 1RZ8B 4P2YA 4Z76A 3PQYA 1F4WL 2M8XA 4JJHA 5FYJD 1XF1A 2FHFA 4YXHL 4JFHD 1JL8A 2MWCA 1OCWL 4PRPA 3CMGA 4KDVA 4GAJH 5F1SA 1ITCA 5DD3H 2V2XB 2X89D 1YY9D 1E6JL 2Z93B 3AY4C 2PCPA 5D1ZC 4I2XA 1N6UA 1OQOA 1MCSA 3HC4L 3MLSL 3U7YL 5IHUH 2V5MA 1CGSL 2DTML 1Z9SA 2X1WL 4UT6H 4EN3B 1BD2A 1NSNL 3KPMA 3LH2L 4NQCB 3D69B 4RNRA 3SKUD 5L2KD 1PD6A 5ALBH 4IDJH 4C83B 1BJ8A 4GXUM 2ZG3A 1N64H 2EXYD 2Z4QA 3EO0B 4YHMH 1J5OH 2Q6WB 1CL7L 2HYMA 1UCBL 3LKSA 1ZE3C 2V5TA 3BYYA 1NCUA 3RVXC 3WNLA 4PJCE 1LO3L 1RJYB 1FN4B 3MBXH 3VD4A 3RVUC 5C0EB 1UXWB 3DXAB 4JM2C 2H45A 2Y1VA 4LMQI 4I2XB 4XHJC 1CLYL 3LSOA 4F9LA 4P2OC 3RGVB 4G6FB 5EOQH 1T5WB 5H2BA 4ZAKA 3U7WH 1IGCH 4NN7C 3AC0A 3G5VB 4N68A 2ZSWB 3JTTA 4HKBA 3L3IA 4X6FB 3HZKB 4MJIA 5F7UA 2P5ED 5D1ZD 4XH2A 4L1HA 2BOCA 5ITBH 4TNWF 2V2WB 1CFNA 2NW3A 5T3ZH 4OGAC 4CU8A 2BZDA 4QOKB 2HH0L 3EO0A 5MI0B 4L4VB 1K4DB 4RGNB 2Z8WC 3FB5A 3VWKA 5GS2D 3W39B 5KN5B 3MLWH 4XP9L 4F58H 4IS6A 3SY0A 4NGHL 2HTLD 5CP3H 1VGKA 1Q0XL 4MA8H 1C16B 3V8CA 1DFBH 2A6KB 2OXHA 2VAAA 3BKYH 2VR9A 1OSPL 2FZ3B 3HI1B 5J1SC 1ZVHA 4Z7OE 1YZZA 2BXYA 2RHEA 4AL8H 4XPFH 4PJ9B 3TGXA 2QR0B 3NFNA 2QLVB 3QUMH 4O2EB 2Q87A 2FIRT 2ZJSH 4X98A 4NKDA 1OWWA 3KPPB 1FDLH 4KKCC 1U8PA 2BY0A 1DLHB 1IGFL 1NC4A 2NY0D 5F96H 4IOFD 5HVGB 1CE1L 1NDGA 4XZUB 1ES0A 3GJFA 5DJZB 1IGJB 4XHQA 3OHXB 3V6BR 1UWGH 3KPRA 4CDGC 1ZA3B 4ZMAT 4KRPD 5CBAB 3B9KB 3SCMC 3QIBA 2EECA 2P42B 1KLUA 3UYPA 4ZFFA 4HGWB 1QQDB 4Q7DA 4JLRB 4EI5A 5I1GH 1GIGL 2AJ3A 3QIWA 1VEOA 3P0VH 1BQHA 1KTDA 1I8MA 1KCVL 3GM8A 4XGZB 2IBZX 3MRHA 1DLHA 4NHCL 4WFED 3W0WA 1D3CA 2VXUL 4JY5H 4P23B 1FGNL 2W65A 3FFDA 4ZUUA 5AEAA 2EDKA 1NMAL 2UYLA 3B6SA 3GSUA 3M8OL 1U41A 4RMWA 5GS0H 3UCRA 3TJEH 4PGBA 4C58B 3F7RA 3RL1B 4UU9B 1KJMA 4ZUTA 5D96B 3THML 5C0RL 1XCQA 1XF3A 2DQDH 1OAYH 2F54E 3C09C 2YC1B 4TRPL 3TV3L 1KJ2A 2Y25A 5D1XD 4YO0B 1K8DB 4NPYA 3C5JA 3FB6A 3DVGA 4EN3D 3D18A 5CWSB 3HAEH 3NCMA 1MHHA 1EFXA 2MKLC 4NWTH 3HUJF 1HHIA 2P47B 1W0VA 4NUJB 4TVPL 1IAOB 3LKPB 4JO4L 2NR6D 3O6ML 4Y5YC 5I0DA 3P0YL 4P3DB 4WY7L 4YQXH 3TIEB 3VD3A 3LEXA 4GFTB 3WFBH 5HYSA 4Q58C 3ARGB 4PJEA 1OPGL 3OJ2C 4ZQKB 2VH5H 3QIUC 3LV3B 4K3HA 5ICZA 4QTIL 2VLKA 2FBOJ 4DZ8B 4I0CC 4N9OB 3T65B 1ZGLB 5F7YC 3K81A 4XPGH 3BP6A 2RCSH 4XVJH 4JY4B 1T2JA 4BSJA 4ZDHB 3HMXH 3T8XB 5KVGL 3EGSB 4P2QD 4PYHA 3UTTA 3D0VA 2XA8L 4KHTL 5A2FA 2MQ3A 2WBJB 2NY2D 2ICWB 1MEXL 1IL1A 4RA0C 2AJZA 4DKFL 5I16B 3QWRA 4RGND 5SX4I 4F57H 4GW1A 5F9JB 4FZ8H 3CIQA 2Z8RA 4N8PA 5TE7L 4KDTA 4HGMA 5T1KB 2OR8A 2H41A 1AI1H 4CJ1A 1JPFA 2ZCHL 4LSSL 2XACC 3ROOB 5IUSA 5E2VH 4R0LC 1AHWB 1Y18A 1FO0H 4MAUH 4P5KB 1N6QL 5ADPL 3DV4B 4R0LA 2ITCA 2AK4D 5F93C 3U2SB 3F7YB 4NT6B 5ID1B 2IQAB 1L6ZA 1CE6A 2YK1L 4HIIB 5H94A 4ZUVA 5C0BD 2R1WA 3A6CH 2OR7A 3ET9F 3DYPA 4PRIB 4YDKL 1QFWM 5I71B 2VQ1A 3QHZL 1AH1A 4FQCL 2Z0BA 3QR2A 5ID0B 1K6QL 2AXJA 4OF0A 1GZPB 3EYQC 4R2GB 1J8HB 3T2NH 1XR9A 1OGTB 5FYLH 2P45B 1JZ6A 1U3HB 4HXBH 5E94B 3TBWA 1B0GB 5TJWK 5ESQB 4MA7H 2AJSH 2QHLA 4GBXB 4RFNC 3MRLB 1I4FA 4P3WA 4WV1A 1A7OH 1RUAH 3BPNC 5TE4H 4G9FE 4L5FL 1HXYB 1HKLL 1XT5A 1QSEE 2F54D 5DQ9B 3Q2CA 3Q3GA 2PXYC 1ZS8B 1A4JA 4L3ED 5KSAC 5IK3A 1XGTA 3QUYA 3B5GA 1IZKA 4UQ2B 5GGUB 3QFJA 1A6VH 4J12A 4UNUA 1UJ3B 3KXFE 5EORH 5IBLD 4NO3A 5FO9A 4Z7QF 4OB5H 4ODSL 5CLWA 3MRIA 2BERA 3ARED 5IP4A 1EEYA 4FQXB 2OMNA 4H0IA 2P7TB 5I8EA 4YHPA 2EDTA 4P4KD 5E8OB 1E4WH 3A0OA 1ZT1A 5EO1A 2WP3O 1KJ3L 1HDMB 5TDOB 1HXYA 4XPHL 2EDQA 3HPJB 4G42A 3NAAL 3HNSH 5IFJA 1XGPB 3PHSA 4GG8B 3MJ6A 3P4MB 4KTEH 4MJ4A 4PJBB 1JGLL 2NY5H 1FVEB 4LVOC 3J8F7 5C6TL 2X4QA 2FSEA 4HK0B 5I2IA 4D0BB 1WWWX 1MLBB 1XGYH 1M71A 3MNVA 3E3QC 3L3DB 4UDUA 2I9TB 4N0UA 3HR5B 1BVKB 3L1OH 4IHOB 4WHYH 1FLTX 1N7MH 1SJHB 1N8ZA 4HPOH 2H8PB 2VZUA 2PF6A 3WIHL 5D4QA 3BZEA 3QXDB 4XNQB 1R3KB 1L4IA 3A6OA 2YRPA 1YY8A 2Z31D 4JRXB 4WHTA 3KHOA 4JANA 4JRYD 3NIGF 4M5YH 3MRRA 4MNGB 4OLYH 3SDXF 4ZFOA 2FWOA 4UBDD 3BP5B 5CZXC 2WBJD 1MIMH 3VWJC 1RD6A 4KKAD 3INUH 3T0BA 5TDPB 4L29B 4Q0XL 3GRWH 1JYWA 1OTUC 5IHZA 2HMID 1KCLA 3VWJA 1OAXH 5I9QC 2PYEA 2X1XR 3QI9B 2PW2A 4YIQB 3MFFB 5DK0A 5CJXA 3ZE2F 4X4MA 1AP2B 1JRHH 5HGBB 5HYEA 5LXGL 3JWOH 5I1EH 1U0QA 4M6MH 2F5AH 4OZFB 3SKMA 1MJ7H 2GCYB 3O4LB 3BFOA 2FR4B 4JDTL 3A67L 2QSCH 3BWAA 3LPWA 3O6FA 1BBDH 2W60A 1NGYA 3RWFA 3DI2B 1SM3L 3E2HB 4WW1A 2LU7A 1DBBL 1NMCC 4RQQB 4NM8H 2PO6B 2PXYB 5D7JC 2V5SA 5HHVH 5KSVB 3F12B 4M7LH 5A16A 3D85A 1V7NH 1YEDA 3QFJD 1T1XA 2VXTL 4PTTA 1UM6L 4R3SA 1MRFL 1MVUA 3FO9A 3UYOD 2FX7L 5JW4Q 4LKXA 4X7DC 1QRNE 3MV9A 3MV8E 4D8PB 3QQ4A 1J8HD 1HEZA 3FRPG 2ICEA 3HUJA 4GSDL 2HT3D 1MH5A 1KUMA 1U3HD 1CFQB 3VFGL 4JKWA 1KCRH 2P5WD 3P40A 3WLWC 5CP7A 4XP4H 4EIZC 2HJKB 3C8HA 3MOAH 4AEIH 4HJJH 4HEPG 3SO3C 2F54B 5D7SH 3IDUA 2VR5A 1FNGB 3SDCA 1CXFA 2J5LC 3DVFA 1NFDB 1YECL 3S37L 4PTUA 5DDHA 5HXMA 4ZXBC 2E9BA 1S9VA 2I07B 3P77B 2LTQC 2WUCL 4P99A 5FCSH 3SJVB 5JA9A 5DK3A 2VL5B 4PREB 2OQJB 2IJ0C 3OAYH 1P4IH 1S8DB 3VCLB 1MI5D 3Q1SL 1D5XB 4U6VL 1RZJC 1T5WA 32C2B 2EH7L 5D2NA 5BS0A 1B3JA 4ZYKB 5KAQG 2HJKA 4EDWH 2P8LA 5GJTH 4RGMC 3FTGB 2GJ6D 3DXAE 3LDBC 1TJHL 1U92B 2V2WA 3PV6B 3VG0H 1RUQL 3B2UD 1JK8B 1QD0A 2DOCA 4MNQD 4V2CB 3QISA 1C7SA 1KJ2L 1Q9OB 1YNLL 1XEDA 4XXDB 3NZ8B 1LO2H 3F7VA 1AXIB 3VWJD 1WC7B 1FL6B 3IVKA 3CXDL 2ZPKH 4TTGA 1XR8A 2EDWA 4NQDE 3O3DA 3BPOC 5TDNB 3VFOB 1Y6MR 3LZFH 3TPKA 1FL3B 3X12B 5AUMA 1QFWH 2V5YA 5ADOL 2AXFA 2DMBA 4OFVA 1IM9B 3WYRA 4YBLB 2GK0B 2SEBB 5GSRB 5I1DB 2EYTB 3TN0C 2A83B 3RWIB 3U9UB 1IEAB 3VXMD 4CU7A 1A7QH