4F16A

Crystal structure of the alpha spectrin sh3 domain at ph 5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
b'KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Crystal Structure of the alpha spectrin SH3 domain at pH 5
rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2012-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4f16A00
5FWCA 2OAWA 2ABLA 3QWXX 1B3QA 1WFWA 1W70A 4LUEA 1H92A 1YNZA 2NWMA 1RI9A 1JU5C 3I5RA 1IO6A 4RTVA 3EG0A 3R6NA 1AWXA 5IHKA 2LJ1A 3H41A 2D0NA 1T3SA 1SEMA 1BB9A 2A08A 1SSHA 2AZSA 1AVZC 4HXJA 4J9EA 4JJBA 2FEIA 2DRKA 2A36A 1PRMC 4OMPA 3EG1A 1H8KA 2JMAA 1LCKA 4J9HA 1OPKA 4F16A 1G83A 1U3OA 1WXBA 2YT6A 2YSQA 1HJDA 4CC2A 1T0JA 4KRTA 4LNPA 2X3XD 4AFUC 2KT8A 2BZ8A 2EBPA 3H0IA 5IXBA 1SPKA 1V1CA 1QWEA 3M0PA 2NUZA 2FPFA 2VVKA 2A37A 1K0XA 4Z88A 4OMQA 2KRNA 1W1FA 2RQVA 2RQUA 4R0KA 2L2PA 1PKSA 4AFQC 3IQLA 1BBZA 1ABOA 4LE9A 2O31A 1B07A 5IH2A 4J9DA 1YN8A 1NEGA 2EYZA 2DBMA 4F14A 1WA7A 3KFVA 1YWPA 2CH4A 1K1ZA 2O88A 3UA6A 1G2BA 1BU1A 2RPNA 3FJ5A 5GJVB 2K7AA 2HDAA 2YDLA 2I0NA 2L3QA 1K76A 1Y57A 3C0CA 1UDLA 2KXCA 1I07A 3SHWA 1JXOA 4HVUA 3REBB 2ROTA 4J9FA 1VYTA 2V1QA 1UFFA 2DRMA 2DNUA 3GBQA 2F2WA 1U5SA 2K9GA 3VS7A 1VYUA 4HCKA 1UHFA 2JM9A 4CC4B 4J9BA 4Y92A 1I0CA 2FRYA 1AZGB 3ZL7C 1M3CA 4K11A 4Z8AA 4RTTA 2MCNA 3TVTA 1Y0MA 1UUEA 2DILA 1X2QA 2RQRA 1WXUA 1T3LA 2GNCA 2RN8A 2FPEA 4LUDA 2LMJA 2J6FA 3ULRB 2W0ZA 2H8HA 4X1VA 2CSIA 3EGUA 3M0QA 2DF6A 2HEQA 2JM8A 2EYXA 1GFCA 3LH5A 2LZ6B 4JJCA 1YWOA 1RUWA 3UF4A 5IHNA 3NHNA 3RNJA 1WI7A 2V1RA 1ARKA 3NPFA 2EW3A 3PVLA 2KR3A 3UA7A 2HCKA 2FPDA 4RTWA 2M0YA 1WYXA 4GLMA 3U23A 5L23A 1M3BA 1N5ZA 1ZUUA 2LQNA 1WLPB 2GGRA 3I35A 1ABQA 1UJYA 2CUDA 4JJDA 2JMCA 3VS2A 2AK5A 1AWJA 1J3TA 2D1XA 1HSQA 2JTEA 5FWBA 1XOVA 4OMMA 3H0FA 2DX1A 2KYMA 1JEGA 2KYBA 3QWYA 1MV0B 5I11A 3CQTA 1NG2A 2CT4A 2DBKA 1PRLC 1U06A 2ROLA 1PKTA 1CSKA 1Z9ZA 2BZYA 3I9QA 2DMOA 2SEMA 1UHCA 1VYVA 2RF0A 5IHIA 1GRIA 2DL8A 1UGVA 2CH4W 2LP5A 2HSPA 1ZX6A 2DLPA 1GFDA 4OMOA 4D8DA 2DE0X 4IIOA 2EGCA 3TSWA 3VRYA 1RLPC 3PE0A 4OMNA 1W6XA 1M30A 3M0TA 4DEXA 2JT4A 2EKHA 2KE9A 2FRWA 5ECAA 1QWFA 1TUDA 2M51A 2RQWA 2CT3A 3O5ZA 1QCFA 2PNIA 1CKAA 3JV3A 2J6KA 1UE9A 1X27A 5EC7A 4AG2C 1WX6A 2L3PA 1FMKA 1CKBA 1JXMA 2GTOA 3VS3A 4E6RA 2OJ2A 1JO8A 1K9AA 4J9GA 2G6FX 2XMFA 2K2MA 2FG0A 2EYYA 1SRLA 2EPDA 1RLQC 2CREA 2CUBA 2JS0A 3M0SA 4RTYA 3A98A 2BTTA 3VS1A 1A0NB 2EGEA 4AG1C 1NYGA 2FO0A 2L3SA 4ZNXA 1OPLA 2L0AA 1WDXA 1PNJA 5I22A 1M27C 2DVJA 1AWWA 2YUOA 1FYNA 2MOXA 1PHTA 4JPBW 1AZEA 2RQTA 4HVVA 1Z9QA 1GBRA 3EHRA 3M0UA 2J6OA 1YCSB 3I5SA 1AD5A 2RNAA 2J06A 1ZBJA 2E5KA 1NM7A 1ZSGA 2ESWA 1X43A 2D8JA 4D8KA 4M4ZA 4DEYA 3EG3A 2DYBA 2JW4A 2KGTA 2EGAA 1TUCA 2X3WD 1X2KA 1M3AA 3REAB 2CSQA 1UTIA 2KROA 1NLOC 4EIKA 4RTZA 2DL7A 1QLYA 1H3HA 2IIMA 2DA9A 2MIOA 1K4US 1UG1A 2DL3A 2A28A 4RTUA 3SEMA 2PTKA 2GTJA 1KFZA 3VS6A 2VWFA 5IXFA 2K3BA 1MV3A 2D8HA 4J9IA 2AKKA 4CC7A 2VKNA 1AOJA 1JQQA 2KRSA 2PZ1A 1YP5A 2SRCA 2P4RA 4WCIA 2C0OA 2KNBB 3UATA 4F17A 1KIKA 2LX7A 1UJ0A 3VS0A 2LQWA 2KXDA 4AFSC 2B86A 1OEBA 2O9SA 1NYFA 1HD3A 4CC3A 1SHFA 1VA7A 2EQIA 4A63B 4JZ3A 1SRMA 2EVRA 3M0RA 4HVWA 1GL5A 2ED0A 2KEAA 1GCPA 1PWTA 1ZLMA 2DL4A 4AFZC 2EYWA 3TSZA 4LN2A 2GQIA 2KRMA 4FSSA 1ZUYA 1QKWA 4ORZA 1BK2A 1GBQA 1GCQA 1WXTA 3THKA 2J7IA 2DJQA 1E6HA 1T0HA 1NLPC 4RTXA 2O9VA 1UECA 2YUNA 3NGPA 4ESRA 2K6DA 1I1JA 1E7OA 2HBWA 1M8MA 2LJ3A 1GCQC 2YUPA 4GBQA 1S1NA 4IIMA 4JZ4A 2O2OA 1X6GA 3NMZC 2CDTA 1X6BA 2ED1A 3EHQA 2AZVA 2C0IA 2YUQA 2F2VA 5GJWB 2LCSA 3H0HA 5HCKA 2W10A 1E6GA 4RUGA 5FW9A 2KT1A 1K0SA 1OV3A 3EG2A 1OOTA 2ENMA 4J9CA 4Z89A 1QKXA 2RMOA 2QDLA 1NEBA 1WIEA 3VRZA 2ECZA 2K79A 3RBBB 3VS4A 1ZUKA 1AEYA 1EFNA 4QT7A 4OMLA 2JS2A 3PVQA 2LNHB 1X69A 2GBQA 2JXBA 2LJ0A 1AWOA 2OI3A 1KSWA 2AKLA 1TG0A 1KJWA 3VS5A 1MUZA 2DM1A 1SHGA 2C0TA 2BZXA 2DL5A 2KBTA 2J05A 2F2XA
chains in the Genus database with same CATH superfamily
1Q82U 2EQJA 4LDXA 3JCMJ 2LCCA 5LJ5e 2EQMA 1HK9A 4XU1A 3FC3A 1H92A 1YNZA 1OX9A 3P8HA 3CBMA 3CCMQ 1S72A 4JS4A 1JJ2A 4RTVA 1WJSA 4F7UB 3R6NA 4M75B 2LJ1A 4FW1A 5D6YA 4XQ3A 1BB9A 1SG5A 3LGLA 1SSHA 2AIRB 1TUGB 4M77G 4LDYA 3M56A 5KH6A 4J9HA 3CXCP 1OPKA 1XTDA 1VQ8T 2CZ7B 3G6EA 2YSQA 2X3XD 4AFUC 3GNFB 3LW5E 1ACMB 4C8QD 5IXBA 4C8QF 1VQ7Q 4M78A 2WSCE 4KUIA 1C0MA 3M54A 4Z88A 4OMQA 3P8BB 4E7HA 3CXCS 3DLMA 4R0KA 4AFQC 4C0GA 3CCRA 3IQLA 4LE9A 2O31A 3ZEHA 1B07A 2VC8A 5HK3A 2DTHA 1YN8A 4OB1B 2EYZA 4E7LA 1W2BA 1I8FA 1BYMA 1YWPA 4M78C 2O01E 2CH4A 4BUGA 3R6OA 2EYQA 1BU1A 1WZOA 3G1JA 4A4KA 2K7AA 3CCLA 2I0NA 1Y57A 3S3OA 3OW2P 1K9MU 4PFZA 5CQXA 3REBB 2ROTA 3CCST 4J9FA 3V8KA 1VYTA 2E5QA 1UFFA 1YITA 2DRMA 1X6OA 5LJ3d 3G71A 2F2WA 1U5SA 2K9GA 5D7UA 3VS7A 1QVGS 4HCKA 4XU0A 1KG1A 2BKDN 1AZGB 3ZL7C 3M58A 1M3CA 3GP8A 3CCVQ 4K11A 2MCNA 4A4FA 1YI2T 2GNCA 2LT1A 2EKOA 1WHKA 2H8HA 4BI4A 2DEUA 1LVKA 4M7AE 2DF6A 2HEQA 2JM8A 3V7CA 3LH5A 2HZYA 1Q95G 4JJCA 4LDWA 2MWOA 2DXCA 3RNJA 1WI7A 1FXXA 5CKBA 2E65A 5D6XA 1VQ8Q 2FPDA 4OF1A 1OU8A 4YTLA 3X20B 1WJQA 3JB9D 1Q7YR 3E19A 3MHXA 1AWJA 2DXTA 1XNIA 2L8DA 3JCMb 1M90C 5C6SA 2DX1A 3SDZA 3QWYA 5GANj 3OA6A 1NG2A 4E7SA 4XTUA 3L2UA 1M90R 3CBOA 3MO8A 3AHUA 1PRLC 1RAGB 4R55A 1XJWB 4A53A 1PKTA 1Z9ZA 1Y96A 4A4HA 3JB9G 5GAOq 2XD0A 2QEXQ 5GAN7 2DMOA 2KI7A 1DJ7B 4RG8A 2P0KA 2CH4W 4XU3A 4BE0A 1N9SA 4M75G 2RJEA 2DIQA 1SSFA 4OMOA 4D8DA 4D6WA 2EGCA 5FU6C 3QJ6A 1Q86C 4OMNA 2R5MA 1TUDA 4PFPA 1WQWA 2FL7A 5CKDA 4Q5WA 1Q86R 1QCFA 3V7RA 1KQ2A 5GAOl 1UE9A 1X27A 1F1BB 1WX6A 1CKBA 3QYHB 3RMQA 2GTOA 4FL6A 4E6RA 4M7DE 1YI2Q 1JO8A 1NPPA 1K9AA 1VQ6A 1VQ9Q 3OW2A 4F7UE 1RLQC 2CUBA 2JS0A 3L2WA 2BTTA 3VS1A 2EGEA 1Q81C 1N8RC 1NYGA 2YRCA 1BI0A 2DTOA 3CD6A 2KSSA 1OPLA 4JS5A 2QXFA 3JCMd 5I22A 4EMKA 1D1AA 3QKJA 3CMAT 1Q81U 1N8RR 1FYNA 2FZGB 1VQOT 1AZEA 4HVVA 3TEEA 1K73R 5FU7B 3ER0A 4C92A 3V8LA 4C0ZA 1AD5A 2DEQA 2MPXC 2ESWA 2D8JA 4EMKC 4DA4A 3QZ5B 4M4ZA 3SD4A 1VQ7A 2DTIA 1G3SA 3T9NA 4X34A 4C92C 1RADB 4ZGJB 3G6ET 1ZHIA 3VJPA 4EIKA 5FRMA 3HL8A 2Y90A 1UGPB 2IIMA 1C6VX 3CCET 1MMGA 3CPWP 1K4US 6AT1B 1PCXA 1QVFA 2QG9B 2DL3A 2A28A 3M9QA 2XK0A 3A8LB 4JRIA 2CYZB 3OYLA 1KFZA 3EG9A 3JCMW 4IUQA 3CCJQ 2AKKA 1BI2A 1YP5A 4M78E 5GAN2 4N0AA 2SRCA 3G7ZA 1RAEB 3M57A 4JUVA 1WHGA 1RI0A 3J81E 4O5VA 2KXDA 4L5GA 1NYFA 2HQEA 2M16A 1MHNA 1YIJT 3CCLT 2IG0A 4RCCA 4KT0E 1YJ9Q 1RAHB 3LWIA 2E12A 4N0AC 1SRMA 4XK8E 3OYNA 3CCVA 1GL5A 3E9FA 5LJ3f 2ZPFB 2KEAA 2K5IA 1ZLMA 2DL4A 3CPFA 1YITT 2EYWA 2DVEA 3TSZA 3TCJA 2GQIA 3NTKA 3EG9B 3HTRA 4LDUA 4NS5A 3CMAQ 2DJQA 3I56Q 2MK5A 4RTXA 2O9VA 4C5GA 3A8OB 1VQ8A 2RJFA 2K6DA 5KE2A 4JLGA 4GBQA 4IIMA 2VV5A 3DKMA 1X6BA 1M2OA 3EHQA 4JRKA 2KMTA 5GANh 2AZVA 2YUQA 3H0HA 5CR2A 1YJNT 3F70A 5A2QE 3EG2A 2M1HA 4Z89A 3CCEQ 2E3HA 2QDLA 4WF2A 1WIEA 1U1SA 3OYKA 3GIBA 2CKKA 3CMEQ 2ECZA 2QEXA 3VS4A 1EFNA 1IZ6A 2LNHB 4KGXB 4ZN3A 1BCMA 1AWOA 2OI3A 3OYCA 4PJOF 3CCSA 1KJWA 5LJ3g 3EH2A 1KQ1A 2DZ9A 1MUZA 4J6WA 4L6V5 1SF9A 2DL5A 2KBTA 2J05A 1TH7A 3CPWA 1K8AR 4QVDA 5CIUA 1W70A 1H641 2CS7A 2WACA 2X35A 4M7AA 2NWMA 2QGFB 2HSEB 1RI9A 2E70A 2HMAA 3UPUA 3I5RA 1IO6A 1YI2A 1VQPT 3EG0A 3HSBA 2E64A 9ATCB 1R8OB 2QQAA 4KULA 5HK0A 1SEMA 2CZ1B 3PFSA 4AMCA 3EGDA 1AVZC 2DRKA 4M7AC 2A36A 1H8KA 4PNOA 3CCQQ 4F16A 4X9CA 3OBYA 1IGUA 2O4XB 2HNIA 3CCMT 4KRTA 1MNDA 2KT8A 5KYNA 2QASA 3JCMf 8AT1B 1LNXA 4RG2A 3QHSA 1SPKA 1QWEA 3HFOA 4M7AB 5DLOA 2NUZA 2NLUA 3HFNA 2RHYA 2A37A 1K0XA 4WTOB 1YJNQ 2RQVA 1PKSA 4AT1B 4OB2B 1ABOA 2PVOB 1VQ4Q 4FYYB 5IH2A 3JAME 3EGDB 1NEGA 1M1KC 4J83A 2RHZA 2CZ6B 3PIPA 3GLXA 4N4GA 1K1ZA 2LQ8A 2XG8D 5M9OA 2RPNA 2L5QA 1M1KR 4C92E 5GJVB 2L3QA 5CK9A 1KHCA 5CVIA 3ASKA 2CP2A 3L2VA 2KXCA 2DERA 5GAMg 2DYIA 5LJ3j 3JCMc 3CCJA 1TU0B 2V1QA 1QP3A 5GANe 4J6YA 5D6WA 3S3NA 4M7DA 1OULA 1UHFA 1IXDA 4Y92A 5GAOn 3BE3A 2RHXA 4RTTA 1HYOA 1Y0MA 5KCHA 2RI3A 1VQPQ 2RN8A 3H9NA 4LUDA 4M7DC 2J6FA 4A4EA 1Q82C 1U1TA 1OI1A 1NZ9A 2D9TA 1TSFA 5IN1A 2WSFE 1IHWA 2QTXA 1BI3A 3GNGA 4IURA 3EFOA 4A54A 1RUWA 1Q82R 3J80E 1EZZB 2FB7A 4C5HA 3CMAA 3KBGA 3I56A 4M77D 2XDPA 4M77F 3CCVT 1NPRA 2Z0WA 5L23A 3BY7A 4M7DB 4TVRA 1VQOA 3PTAA 1ZUUA 2LQNA 2YRVA 2ZPHB 4DBHA 4IUUA 4IUVA 1WLPB 3I35A 3OBWA 3EAEA 4BE1A 1ABQA 1UJYA 4HKEA 2QQRA 3L42A 3JB9I 3LH0A 1QCOA 4GLKA 1IB8A 2GF7A 3OS1A 4IUPA 1HSQA 3H8ZA 5FWBA 1JEGA 3SFMA 1MV0B 5I11A 3PGGA 2V8IA 2CP5A 1D0ZA 2JVVA 2DBKA 3CC2T 2BZYA 1VOMA 2RA2A 5GMKl 4N4IA 4ZTFA 3I9QA 3CCEA 4DOWA 2XKOC 1UHCA 5GAN3 2DL8A 1UGVA 3C4SA 4ANJA 2HSPA 2DLPA 3SWNA 3CMEA 1TS9A 3TSWA 3NFCA 2VGMA 2DJZA 4EPCA 1M30A 2QA4T 5CKFA 2FRWA 5ECAA 1QWFA 2EJGA 1V29B 4IKFA 5GAOr 4JRQA 2CT3A 3O5ZA 1QVGP 1K9MC 2QEXT 2J6KA 1PG5B 2R58A 3SWNC 4HT8A 1FMKA 1YIJA 2YLCA 2Y4XA 4A4GA 2A3LA 2QQ9A 2F1LA 4LD9K 3QIIA 1K9MR 2LVMA 4J9GA 2XMFA 4Y91A 4M7AG 1M1GA 2KAFA 4NL3A 4MDWA 2ATCB 4M78B 2FVUA 4RTYA 3A98A 1N6AA 3SWNB 2K5FA 2ZPEB 1WDXA 4ELYC 1G3YA 1M27C 2DVJA 1NE8A 1PHTA 4JPBW 1D1CA 1I4K1 2RQTA 3EHRA 4XTYA 3QSUA 3BDUA 1VQ9T 3FDRA 3KXTA 2J06A 4RKUE 3OSSC 2M0OA 3NTHA 3A8HB 1QMCA 5LJ5g 1X01A 4C8QE 2BUDA 3FJPA 2DYBA 4ZGEB 2JW4A 3CC7Q 2EGAA 1XQHA 2WSEE 2X3WD 1X2KA 4HCZA 4B9WA 2CGHA 1X75C 1M3AA 3HRTA 1UTIA 2RH2A 5KYUA 1YJNA 1PD1A 1NLOC 3MCAB 3CC2Q 1QLYA 1B7TA 4FYWB 2KVQG 2E1HA 1H3HA 2DA9A 2FHDA 2HQXA 1UG1A 3QZ9B 2LC4A 3FIFA 3Q1JA 4QVCA 2PTKA 3JB9F 1MNEA 1KC8C 2AHJB 2VWFA 5LJ3h 2K3BA 1MV3A 2RD1A 4PJMA 4J9IA 2HQHA 4M75D 2RK2A 4M75F 1RAAB 2PVGB 4CC7A 2VKNA 2VB6A 1AOJA 3CXCA 2PZ1A 1KC8U 3JCMV 2QA4Q 1YCYA 2C0OA 2KNBB 4J6XA 3UATA 2A7YA 1VQKT 4ATOA 2GQVA 1KIKA 5A0GA 1Q7YU 3QG1A 4P5NA 4DOVA 3OS2A 4M7DG 3OSVA 1EX4A 1AHJB 1JB0E 5HKCA 3DB3A 5KYUB 2PUOB 1KQSP 4A63B 4F7UG 1VQMQ 2R5AA 1KHIA 4FCYA 3CCJT 2DKGA 5GAMd 3RMSA 4MDXA 4AFZC 1VQPA 2MWPA 4LN2A 1ZUYA 4ORZA 3LGFA 1BK2A 1GBQA 1GCQA 3THKA 4KH1B 3AT1B 1E6HA 1QVGA 1NLPC 3MP1A 1KQSS 1YJ9T 5I2MA 5FU6B 1BIBA 1Y96B 2DXUA 3CC4T 1RABB 2PVDB 3CCMA 1HXDA 2CZ0B 1GCQC 4JDSA 2XI9A 3NMZC 2E6NA 2ED1A 3OY9A 4PJOA 1IRXA 1PSEA 2C0IA 2F5KA 4E7KA 1Q81R 1D1BA 3I56T 2LCLA 3I55Q 2QYZA 3CEYA 4HA8A 2W10A 4RUGA 1K0SA 3MEAA 1OOTA 2RMOA 5KYXA 4EMHA 3INZA 1W4SA 1ZSZA 1NEBA 1D09B 1UGQB 3RESA 4PJOC 1M5Q1 1Y71A 1AEYA 4C5EA 3S3MA 4M78G 2JS2A 3PVQA 2IPOB 3RERA 1X69A 4FT4A 1C1AA 2JXBA 2LJ0A 2P84A 4KH0B 3G4SQ 2L89A 1ZSZC 1VQKQ 2OX7A 3VS5A 1NBEB 1SHGA 4EMKB 3C12A 3CCUQ 2OAWA 1B3QA 2GFUA 4XTWA 3JRZA 2HL3A 4C92B 3CMET 2XDDA 2H3EB 2X4JA 1JU5C 2JTFA 3JCMh 2BE9B 1OYXA 1AWXA 5LJ3e 5IHKA 3MEUA 5GAOm 3SB2A 2D0NA 4XU2A 4OGCA 2A08A 4J9EA 4FW2A 1I5LA 2OTJQ 3EG1A 3OYDA 3A5ZB 2FYKA 5KYYA 2QAZA 3CC4Q 1O9SA 4C5IA 2HKNA 1HJDA 4HT9A 3MPUB 2RI5A 2BZ8A 2QGGA 3H0IA 3UDCA 4B6MA 2JTMA 2K3XA 3M0PA 5IAYA 5GAN4 1SKUB 2FPFA 2RHUA 2VVKA 4N4HA 3LLRA 4DBQA 1VUBA 2COZA 4PJJA 1W1FA 2B8AA 2CP7A 2RQUA 3V7SA 5J39A 1BBZA 1QW1A 4F04B 2CP6A 3CCQT 4J9DA 3HP9A 2DBMA 3PMIA 4OMFB 4F14A 1WA7A 3CC2A 5J3BA 2P0QA 5KYYB 5CQYA 1H3ZA 1G2BA 1UGSB 3FJ5A 5LJ5d 5FLXE 1S72Q 3LX7A 4Y28E 1K76A 3URGA 3C0CA 1UDLA 3RKXA 2QI2A 2EJFA 3SHWA 1JXOA 3E1SA 3PMTA 3M4GA 3RIRA 2D6FA 2XHCA 1VQ4T 3QO3A 2DNUA 3GBQA 2QA4A 4LDVA 3E9GA 1VQNQ 2CP0A 2EJ9A 2HKQB 4QW2A 1IHVA 2FRYA 4Z8AA 1FX7A 1WHMA 1KD1U 2DILA 1VIFA 1WXUA 2YWWA 3VYHB 1M2VA 3LWHA 2LMJA 3ULRB 2W0ZA 4QQ6A 4X1VA 4KGVB 2YHTA 3EGUA 3M0QA 1ZA1B 1GFCA 4QVZA 4ZTJA 3X25B 3UF4A 5I21A 3CCRQ 3QDFA 2DK3A 2V1RA 4RCBA 3NPFA 2EW3A 3PVLA 2KR3A 4J8OA 3UA7A 5CCAA 1YHQQ 4E7IA 4RTWA 5GAMf 2E4HA 1N5ZA 3OYIA 4C8QA 3QDRB 1VQ9A 2KQWA 2CUDA 2JMCA 3EFSA 3MJXA 5CO7A 4IUTA 4Z02A 1D0XA 3JCMe 2MI6A 4FM4B 2PQWA 2RI2A 3OYYA 3UWNA 3QYGB 4BE2A 4C8QC 2LRQA 3OB9A 2MAMA 2CT4A 4OP0A 1NJIU 5HY6A 3OMGA 1U06A 5GAN6 2ROLA 4C92G 1CSKA 1WPYA 4PLIA 3WXMB 4JRPA 1GRIA 2QK0A 2LP5A 1ZX6A 4C8QB 1JJ2S 2COWA 5KCOA 4IIOA 1RLPC 3PE0A 1ZA2B 4PJOE 3G4SA 2EKHA 1VQKA 1MMDA 2M51A 2NUPA 2VYTA 2RQWA 2PNIA 1CKAA 3JV3A 2MF2A 3X24B 4AG2C 2L3PA 1VQLQ 1JXMA 3CCUA 1MMAA 2K57A 3PIOA 3FB9A 1G3WA 5AT1B 1W2BP 4C0DC 2EYYA 1Y7XA 2EPDA 1OZ3A 2NUTA 1TOVA 4ZN1A 3N5BB 1A0NB 2FO0A 2L3SA 3META 2L0AA 5L8RE 3DLLA 1AWWA 2YUOA 2QDYB 4V2SA 3GF5A 4C0DB 3BDLA 1Z9QA 1YJ9A 4EDUA 2CP3A 3M0UA 1W2BS 2H3JA 3V8JA 3CC4A 3JCMQ 3I5SA 1ZBJA 2E5KA 1NM7A 1ZSGA 2ZAEA 4OVAA 1FMVA 3H6ZA 4M75A 3OYFA 4DEYA 2VXFA 5FRNA 2KGTA 2DETA 1BCOA 4BDZA 2KROA 2ZGWA 1KK7A 4RTZA 4HCBA 4LD6A 2DL7A 3FRNA 5CKEA 3PNWC 4KBMB 4L59A 5A0LA 1UEBA 2RO0A 4RTUA 2EFIA 4FIBA 2RM4A 1VQ6Q 2X4XA 2X4WA 5IXFA 4EMGA 3CC7T 4LXCA 2DXBA 4KGZB 2BIVA 1JQQA 1B34A 5CAIA 3CD6Q 4X9DA 3EFOB 4FU6A 2LX7A 4E47A 1UJ0A 4E7ZA 3FLGA 4AFSC 2B86A 5LJ5f 2O9SA 1WJRA 2HL5C 4CC3A 1VQ5T 3OYMA 1VQNA 2EQIA 4B9XA 5GAMj 2EVRA 2EWNA 4HVWA 5GAN8 1PSFA 2VXEA 1PWTA 4M7AD 3GOXA 1V76A 2ZPIB 4C0FA 4M7AF 1RACB 3JCMP 2YXYA 1IGQA 2HBPA 4DBRA 1QKWA 3JSCA 1WXTA 2J7IA 2XDBA 2OTLT 1B34B 1T0HA 1RAFB 1YFNA 2XIDA 1UECA 3NGPA 1VQMT 2X51A 2BE7D 4M77E 3ZFJA 2OAUA 5GANg 1MGQA 3EGXA 1YHQA 4JLIA 4C8QG 2HBWA 2YUPA 2LJ3A 1S1NA 1X6GA 3MP8A 3VUZA 3OYEA 4GY5A 2F2VA 3HRSA 2NYSA 2LCSA 5C0MA 3RDVA 5HCKA 1WHJA 4CI0C 3GPLA 4QKUA 4J9CA 3CCQA 1FWZA 1QKXA 3TQ7P 4CRIA 2K5LA 3VRZA 5DM7R 5LL6S 4OB3B 3EGXB 4QT7A 4OMLA 1BKBA 3OW2S 5CKHA 3FEOA 2ZPGB 2GBQA 1N9RA 3I55T 2E6ZA 2GCXA 2AKLA 3OS0A 5GMKm 3VUBA 3HPWA 3QJYA 2LQKA 2DZCA 2DM1A 1VQ4A 2RB6A 2BZXA 3QXEB 5FWCA 3ZBDA 1VQ5Q 1YBYA 2ABLA 2C06A 3TREA 3QWXX 4PKCC 4M7DD 1WFWA 4M7DF 3BFMA 2XU8A 4LUEA 1VQLA 2COYA 2V8KA 3MEWA 2VUBA 4F7UF 1Q7YC 4UC4A 2JOYA 1KC8R 2DFUA 3G4ST 2PU9B 1QVFP 2X9HA 3H41A 1T3SA 2K3YA 2OTLQ 2AZSA 4HXJA 4JJBA 2FEIA 3CCUT 1PRMC 4OMPA 4J7IA 1U8RA 2F5TX 4ZGDB 2JMAA 1RAIB 1LCKA 3M55A 4O6JA 3RUXA 4J7FA 1G83A 1U3OA 2EAYA 1WXBA 2YT6A 1M90U 1YJWT 2MMPA 3HHTB 4CC2A 1T0JA 4LNPA 1QVFS 2DO3A 2EBPA 4XTXA 5GAOp 1V1CA 5GMKj 3UT1A 3QUIA 2KRNA 2QQBA 3CCSQ 2OTJT 2L2PA 3OYAA 1TXQA 3EFRA 1MMNA 5KE3A 2RJCA 4MZMA 3KFVA 3RKYA 4E7JA 4VUBA 1Q86U 4KUDK 3A8GB 5LJ5j 2O88A 4RMOA 3UA6A 2E3IA 2HDAA 2YDLA 3QPHA 1I07A 4M78D 4HVUA 2IVWA 4M78F 5AYFA 2EIFA 4M75E 5FU7C 4ELZC 1G5VA 4PK4A 5KYWA 4MZTA 2JNGA 1LJOA 2JZ2A 1VYUA 2FZCB 1Y07A 2JM9A 4CC4B 1RL2A 1WHLA 5GAMh 1K73C 4J9BA 1I0CA 3BW1A 1N8RU 3L2RA 4PJLA 3TVTA 1S72T 2DIGA 1UUEA 1X2QA 2RQRA 1K73U 4BY6C 1T3LA 2E10A 2M02A 2FPEA 4ME7A 4QQGA 3MKDA 4OB0B 2E41A 1PM3A 1TTHB 1OZ2A 2CSIA 2EYXA 4PJOB 2KK4A 2LZ6B 1M1FA 4QQDA 5FROA 1YWOA 2JUFA 3MP6A 1VQNT 1WNLA 5IHNA 3L2QA 4XTVA 3NHNA 1ARKA 3M4YA 5GAN5 5KYWB 4BY6B 2HCKA 3QBYA 5KYXB 2M0YA 1WYXA 4GLMA 1YJWQ 1ZSZB 3U23A 1M3BA 1GXIE 2PUKB 2GGRA 1FMWA 3D7SB 4JJDA 5DLQE 2VGNA 3VS2A 2AK5A 1P92A 1J3TA 2D1XA 4DQ2A 2JTEA 1OQKA 3OYGA 1XOVA 3CCRT 4OMMA 3H0FA 4FYXB 2KYMA 2KYBA 1KQSA 3CQTA 2KDSA 1YHQT 4XTZA 3HRUA 2JN0A 4BDYA 5GANd 3M59A 3CPWS 2DD5A 5A0DA 2DAQA 2SEMA 1I5OB 3O8VA 3X28B 1WQ7A 1VYVA 2RF0A 3EH1A 5IHIA 4PFOA 2LTOA 1M4ZA 4FSXA 2V26A 1GFDA 2M9UA 1PD0A 2DE0X 3CC7A 3VRYA 3JCMX 4II1A 4BB7A 2QQSA 3E2UA 1EIFA 1W6XA 4NL2A 3G71T 3M0TA 4DEXA 2JT4A 2KE9A 3VYGA 3JB9J 1G8XA 2A0FB 3OYJA 1WGSA 3VKIA 3NTIA 5EC7A 3MEVA 4FT2A 2LNVA 2DPPB 1VQOQ 1D3BA 2EQKA 1VQ5A 3OQ5A 1UB4A 3VS3A 3CBPA 2OJ2A 1QQJA 2G6FX 2V8JA 3M53A 2F69A 2K2MA 2FG0A 1LOJA 1SRLA 2RHIA 2Y4YA 2QTVA 2CREA 1VIEA 2P4TA 3M0SA 3OMCA 4AG1C 4ZNXA 1ZQ1A 2LX9A 2YRDA 3VU3C 4BACA 1KD1C 1PNJA 3RR6A 4M77A 3OYHA 2MOXA 2OTLA 3KUFA 3G6EQ 2ZPBB 1VQLT 1OU9A 1KD1R 1GBRA 4MMLA 5DY9A 2J6OA 1VQMA 1N27A 1YCSB 1IREB 3M5AA 5GAMe 5GMKh 3X26B 4NOYA 2RNAA 2D0QB 4M77C 1D3BB 1X43A 1JBMA 4D8KA 3JB9H 3EG3A 2HAXA 1TUCA 3L1AA 4MMKA 3REAB 2CSQA 1M9SA 4PJOD 4BI3A 1BIAA 1R77A 2HD0A 1K8AC 5LJ5h 3C95A 4M77B 2FZKB 1LPLA 2MIOA 2AT1B 5I2SA 2O4XA 1YIJQ 4C92D 3CCLQ 4C92F 1K8AU 3SEMA 4J5YA 2GTJA 3J7AF 4PL6A 3VS6A 1M2VB 1NJIC 1JRIA 2D8HA 2K4YA 4PJOG 1JJ2P 4JJNK 1QVPA 3C94A 1YITQ 8ATCB 4HCCA 2KRSA 3G71Q 3I55A 2EQUA 2P4RA 1NJIR 4WCIA 4F17A 2L3RA 1TWBA 3VS0A 7AT1B 1UGRB 2LQWA 3OS5A 1OEBA 2LT4A 5J26A 1HD3A 1SHFA 5IT9E 1R0BG 1VA7A 3A8MB 4JZ3A 1VQ6T 3LYIA 4OGEA 3M0RA 4XAXB 3P8DA 2ED0A 3OYBA 1GCPA 2MYSA 2DD4A 3L2ZA 3CD6T 2KRMA 4BI8B 4FSSA 1ZBXA 4FYVB 2RJDA 1OX8A 4PLLA 5EG2A 3DB4A 1O75A 2YUNA 2GFAA 4E2FB 2K2VA 2JJ9A 3HKSA 4ESRA 1I1JA 1YJWA 1E7OA 1WHHA 4DBFA 1M8MA 1PC0A 4JZ4A 2O2OA 1M8VA 1G3TA 2CDTA 1M1KU 3TU4K 1VQ7T 2KY9A 3WVEB 2LDMA 5GJWB 2VASA 1D0YA 4PJNA 1BI1A 1E6GA 5FW9A 2OTJA 2NUPB 2KT1A 1OV3A 2ENMA 3VV0A 1I81A 3RKWA 1R0CB 5GMKi 4BD3A 4F7UA 3ME9A 2K79A 3S6WA 3RBBB 1ZUKA 5GMKe 2ZZDA 2NUTB 2P0PA 4MZPA 5GANf 3PT9A 2XICA 4R56A 1KSWA 1QCNA 3WVDB 1TG0A 2G3RA 1AT1B 2ZCFB 2I2LA 3A1PA 1QP2A 2C0TA 2RK1A 3JCMg 4M75C 2X4YA 2YLBA 2F2XA 2R57A
chains in the Genus database with same CATH topology
5FWCA 2OAWA 2ABLA 3QWXX 1B3QA 1WFWA 1W70A 4LUEA 1H92A 1YNZA 2NWMA 1RI9A 1JU5C 3I5RA 1IO6A 4RTVA 3EG0A 3R6NA 1AWXA 5IHKA 2LJ1A 3H41A 2D0NA 1T3SA 1SEMA 1BB9A 2A08A 1SSHA 2AZSA 1AVZC 4HXJA 4J9EA 4JJBA 2FEIA 2DRKA 2A36A 1PRMC 4OMPA 3EG1A 1H8KA 2JMAA 1LCKA 4J9HA 1OPKA 4F16A 1G83A 1U3OA 1WXBA 2YT6A 2YSQA 1HJDA 4CC2A 1T0JA 4KRTA 4LNPA 2X3XD 4AFUC 2KT8A 2BZ8A 2EBPA 3H0IA 5IXBA 1SPKA 1V1CA 1QWEA 3M0PA 2NUZA 2FPFA 2VVKA 2A37A 1K0XA 4Z88A 4OMQA 2KRNA 1W1FA 2RQVA 2RQUA 4R0KA 2L2PA 1PKSA 4AFQC 3IQLA 1BBZA 1ABOA 4LE9A 2O31A 1B07A 5IH2A 4J9DA 1YN8A 1NEGA 2EYZA 2DBMA 4F14A 1WA7A 3KFVA 1YWPA 2CH4A 1K1ZA 2O88A 3UA6A 1G2BA 1BU1A 2RPNA 3FJ5A 5GJVB 2K7AA 2HDAA 2YDLA 2I0NA 2L3QA 1K76A 1Y57A 3C0CA 1UDLA 2KXCA 1I07A 3SHWA 1JXOA 4HVUA 3REBB 2ROTA 4J9FA 1VYTA 2V1QA 1UFFA 2DRMA 2DNUA 3GBQA 2F2WA 1U5SA 2K9GA 3VS7A 1VYUA 4HCKA 1UHFA 2JM9A 4CC4B 4J9BA 4Y92A 1I0CA 2FRYA 1AZGB 3ZL7C 1M3CA 4K11A 4Z8AA 4RTTA 2MCNA 3TVTA 1Y0MA 1UUEA 2DILA 1X2QA 2RQRA 1WXUA 1T3LA 2GNCA 2RN8A 2FPEA 4LUDA 2LMJA 2J6FA 3ULRB 2W0ZA 2H8HA 4X1VA 2CSIA 3EGUA 3M0QA 2DF6A 2HEQA 2JM8A 2EYXA 1GFCA 3LH5A 2LZ6B 4JJCA 1YWOA 1RUWA 3UF4A 5IHNA 3NHNA 3RNJA 1WI7A 2V1RA 1ARKA 3NPFA 2EW3A 3PVLA 2KR3A 3UA7A 2HCKA 2FPDA 4RTWA 2M0YA 1WYXA 4GLMA 3U23A 5L23A 1M3BA 1N5ZA 1ZUUA 2LQNA 1WLPB 2GGRA 3I35A 1ABQA 1UJYA 2CUDA 4JJDA 2JMCA 3VS2A 2AK5A 1AWJA 1J3TA 2D1XA 1HSQA 2JTEA 5FWBA 1XOVA 4OMMA 3H0FA 2DX1A 2KYMA 1JEGA 2KYBA 3QWYA 1MV0B 5I11A 3CQTA 1NG2A 2CT4A 2DBKA 1PRLC 1U06A 2ROLA 1PKTA 1CSKA 1Z9ZA 2BZYA 3I9QA 2DMOA 2SEMA 1UHCA 1VYVA 2RF0A 5IHIA 1GRIA 2DL8A 1UGVA 2CH4W 2LP5A 2HSPA 1ZX6A 2DLPA 1GFDA 4OMOA 4D8DA 2DE0X 4IIOA 2EGCA 3TSWA 3VRYA 1RLPC 3PE0A 4OMNA 1W6XA 1M30A 3M0TA 4DEXA 2JT4A 2EKHA 2KE9A 2FRWA 5ECAA 1QWFA 1TUDA 2M51A 2RQWA 2CT3A 3O5ZA 1QCFA 2PNIA 1CKAA 3JV3A 2J6KA 1UE9A 1X27A 5EC7A 4AG2C 1WX6A 2L3PA 1FMKA 1CKBA 1JXMA 2GTOA 3VS3A 4E6RA 2OJ2A 1JO8A 1K9AA 4J9GA 2G6FX 2XMFA 2K2MA 2FG0A 2EYYA 1SRLA 2EPDA 1RLQC 2CREA 2CUBA 2JS0A 3M0SA 4RTYA 3A98A 2BTTA 3VS1A 1A0NB 2EGEA 4AG1C 1NYGA 2FO0A 2L3SA 4ZNXA 1OPLA 2L0AA 1WDXA 1PNJA 5I22A 1M27C 2DVJA 1AWWA 2YUOA 1FYNA 2MOXA 1PHTA 4JPBW 1AZEA 2RQTA 4HVVA 1Z9QA 1GBRA 3EHRA 3M0UA 2J6OA 1YCSB 3I5SA 1AD5A 2RNAA 2J06A 1ZBJA 2E5KA 1NM7A 1ZSGA 2ESWA 1X43A 2D8JA 4D8KA 4M4ZA 4DEYA 3EG3A 2DYBA 2JW4A 2KGTA 2EGAA 1TUCA 2X3WD 1X2KA 1M3AA 3REAB 2CSQA 1UTIA 2KROA 1NLOC 4EIKA 4RTZA 2DL7A 1QLYA 1H3HA 2IIMA 2DA9A 2MIOA 1K4US 1UG1A 2DL3A 2A28A 4RTUA 3SEMA 2PTKA 2GTJA 1KFZA 3VS6A 2VWFA 5IXFA 2K3BA 1MV3A 2D8HA 4J9IA 2AKKA 4CC7A 2VKNA 1AOJA 1JQQA 2KRSA 2PZ1A 1YP5A 2SRCA 2P4RA 4WCIA 2C0OA 2KNBB 3UATA 4F17A 1KIKA 2LX7A 1UJ0A 3VS0A 2LQWA 2KXDA 4AFSC 2B86A 1OEBA 2O9SA 1NYFA 1HD3A 4CC3A 1SHFA 1VA7A 2EQIA 4A63B 4JZ3A 1SRMA 2EVRA 3M0RA 4HVWA 1GL5A 2ED0A 2KEAA 1GCPA 1PWTA 1ZLMA 2DL4A 4AFZC 2EYWA 3TSZA 4LN2A 2GQIA 2KRMA 4FSSA 1ZUYA 1QKWA 4ORZA 1BK2A 1GBQA 1GCQA 1WXTA 3THKA 2J7IA 2DJQA 1E6HA 1T0HA 1NLPC 4RTXA 2O9VA 1UECA 2YUNA 3NGPA 4ESRA 2K6DA 1I1JA 1E7OA 2HBWA 1M8MA 2LJ3A 1GCQC 2YUPA 4GBQA 1S1NA 4IIMA 4JZ4A 2O2OA 1X6GA 3NMZC 2CDTA 1X6BA 2ED1A 3EHQA 2AZVA 2C0IA 2YUQA 2F2VA 5GJWB 2LCSA 3H0HA 5HCKA 2W10A 1E6GA 4RUGA 5FW9A 2KT1A 1K0SA 1OV3A 3EG2A 1OOTA 2ENMA 4J9CA 4Z89A 1QKXA 2RMOA 2QDLA 1NEBA 1WIEA 3VRZA 2ECZA 2K79A 3RBBB 3VS4A 1ZUKA 1AEYA 1EFNA 4QT7A 4OMLA 2JS2A 3PVQA 2LNHB 1X69A 2GBQA 2JXBA 2LJ0A 1AWOA 2OI3A 1KSWA 2AKLA 1TG0A 1KJWA 3VS5A 1MUZA 2DM1A 1SHGA 2C0TA 2BZXA 2DL5A 2KBTA 2J05A 2F2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FWC A;  2OAW A;  2ABL A;  3QWX X;  1B3Q A;  1WFW A;  1W70 A;  4LUE A;  1H92 A;  1YNZ A;  2NWM A;  1RI9 A;  1JU5 C;  3I5R A;  1IO6 A;  4RTV A;  3EG0 A;  3R6N A;  1AWX A;  5IHK A;  2LJ1 A;  3H41 A;  2D0N A;  1T3S A;  1SEM A;  1BB9 A;  2A08 A;  1SSH A;  2AZS A;  1AVZ C;  4HXJ A;  4J9E A;  4JJB A;  2FEI A;  2DRK A;  2A36 A;  1PRM C;  4OMP A;  3EG1 A;  1H8K A;  2JMA A;  1LCK A;  4J9H A;  1OPK A;  4F16 A;  1G83 A;  1U3O A;  1WXB A;  2YT6 A;  2YSQ A;  1HJD A;  4CC2 A;  1T0J A;  4KRT A;  4LNP A;  2X3X D;  4AFU C;  2KT8 A;  2BZ8 A;  2EBP A;  3H0I A;  5IXB A;  1SPK A;  1V1C A;  1QWE A;  3M0P A;  2NUZ A;  2FPF A;  2VVK A;  2A37 A;  1K0X A;  4Z88 A;  4OMQ A;  2KRN A;  1W1F A;  2RQV A;  2RQU A;  4R0K A;  2L2P A;  1PKS A;  4AFQ C;  3IQL A;  1BBZ A;  1ABO A;  4LE9 A;  2O31 A;  1B07 A;  5IH2 A;  4J9D A;  1YN8 A;  1NEG A;  2EYZ A;  2DBM A;  4F14 A;  1WA7 A;  3KFV A;  1YWP A;  2CH4 A;  1K1Z A;  2O88 A;  3UA6 A;  1G2B A;  1BU1 A;  2RPN A;  3FJ5 A;  5GJV B;  2K7A A;  2HDA A;  2YDL A;  2I0N A;  2L3Q A;  1K76 A;  1Y57 A;  3C0C A;  1UDL A;  2KXC A;  1I07 A;  3SHW A;  1JXO A;  4HVU A;  3REB B;  2ROT A;  4J9F A;  1VYT A;  2V1Q A;  1UFF A;  2DRM A;  2DNU A;  3GBQ A;  2F2W A;  1U5S A;  2K9G A;  3VS7 A;  1VYU A;  4HCK A;  1UHF A;  2JM9 A;  4CC4 B;  4J9B A;  4Y92 A;  1I0C A;  2FRY A;  1AZG B;  3ZL7 C;  1M3C A;  4K11 A;  4Z8A A;  4RTT A;  2MCN A;  3TVT A;  1Y0M A;  1UUE A;  2DIL A;  1X2Q A;  2RQR A;  1WXU A;  1T3L A;  2GNC A;  2RN8 A;  2FPE A;  4LUD A;  2LMJ A;  2J6F A;  3ULR B;  2W0Z A;  2H8H A;  4X1V A;  2CSI A;  3EGU A;  3M0Q A;  2DF6 A;  2HEQ A;  2JM8 A;  2EYX A;  1GFC A;  3LH5 A;  2LZ6 B;  4JJC A;  1YWO A;  1RUW A;  3UF4 A;  5IHN A;  3NHN A;  3RNJ A;  1WI7 A;  2V1R A;  1ARK A;  3NPF A;  2EW3 A;  3PVL A;  2KR3 A;  3UA7 A;  2HCK A;  2FPD A;  4RTW A;  2M0Y A;  1WYX A;  4GLM A;  3U23 A;  5L23 A;  1M3B A;  1N5Z A;  1ZUU A;  2LQN A;  1WLP B;  2GGR A;  3I35 A;  1ABQ A;  1UJY A;  2CUD A;  4JJD A;  2JMC A;  3VS2 A;  2AK5 A;  1AWJ A;  1J3T A;  2D1X A;  1HSQ A;  2JTE A;  5FWB A;  1XOV A;  4OMM A;  3H0F A;  2DX1 A;  2KYM A;  1JEG A;  2KYB A;  3QWY A;  1MV0 B;  5I11 A;  3CQT A;  1NG2 A;  2CT4 A;  2DBK A;  1PRL C;  1U06 A;  2ROL A;  1PKT A;  1CSK A;  1Z9Z A;  2BZY A;  3I9Q A;  2DMO A;  2SEM A;  1UHC A;  1VYV A;  2RF0 A;  5IHI A;  1GRI A;  2DL8 A;  1UGV A;  2CH4 W;  2LP5 A;  2HSP A;  1ZX6 A;  2DLP A;  1GFD A;  4OMO A;  4D8D A;  2DE0 X;  4IIO A;  2EGC A;  3TSW A;  3VRY A;  1RLP C;  3PE0 A;  4OMN A;  1W6X A;  1M30 A;  3M0T A;  4DEX A;  2JT4 A;  2EKH A;  2KE9 A;  2FRW A;  5ECA A;  1QWF A;  1TUD A;  2M51 A;  2RQW A;  2CT3 A;  3O5Z A;  1QCF A;  2PNI A;  1CKA A;  3JV3 A;  2J6K A;  1UE9 A;  1X27 A;  5EC7 A;  4AG2 C;  1WX6 A;  2L3P A;  1FMK A;  1CKB A;  1JXM A;  2GTO A;  3VS3 A;  4E6R A;  2OJ2 A;  1JO8 A;  1K9A A;  4J9G A;  2G6F X;  2XMF A;  2K2M A;  2FG0 A;  2EYY A;  1SRL A;  2EPD A;  1RLQ C;  2CRE A;  2CUB A;  2JS0 A;  3M0S A;  4RTY A;  3A98 A;  2BTT A;  3VS1 A;  1A0N B;  2EGE A;  4AG1 C;  1NYG A;  2FO0 A;  2L3S A;  4ZNX A;  1OPL A;  2L0A A;  1WDX A;  1PNJ A;  5I22 A;  1M27 C;  2DVJ A;  1AWW A;  2YUO A;  1FYN A;  2MOX A;  1PHT A;  4JPB W;  1AZE A;  2RQT A;  4HVV A;  1Z9Q A;  1GBR A;  3EHR A;  3M0U A;  2J6O A;  1YCS B;  3I5S A;  1AD5 A;  2RNA A;  2J06 A;  1ZBJ A;  2E5K A;  1NM7 A;  1ZSG A;  2ESW A;  1X43 A;  2D8J A;  4D8K A;  4M4Z A;  4DEY A;  3EG3 A;  2DYB A;  2JW4 A;  2KGT A;  2EGA A;  1TUC A;  2X3W D;  1X2K A;  1M3A A;  3REA B;  2CSQ A;  1UTI A;  2KRO A;  1NLO C;  4EIK A;  4RTZ A;  2DL7 A;  1QLY A;  1H3H A;  2IIM A;  2DA9 A;  2MIO A;  1K4U S;  1UG1 A;  2DL3 A;  2A28 A;  4RTU A;  3SEM A;  2PTK A;  2GTJ A;  1KFZ A;  3VS6 A;  2VWF A;  5IXF A;  2K3B A;  1MV3 A;  2D8H A;  4J9I A;  2AKK A;  4CC7 A;  2VKN A;  1AOJ A;  1JQQ A;  2KRS A;  2PZ1 A;  1YP5 A;  2SRC A;  2P4R A;  4WCI A;  2C0O A;  2KNB B;  3UAT A;  4F17 A;  1KIK A;  2LX7 A;  1UJ0 A;  3VS0 A;  2LQW A;  2KXD A;  4AFS C;  2B86 A;  1OEB A;  2O9S A;  1NYF A;  1HD3 A;  4CC3 A;  1SHF A;  1VA7 A;  2EQI A;  4A63 B;  4JZ3 A;  1SRM A;  2EVR A;  3M0R A;  4HVW A;  1GL5 A;  2ED0 A;  2KEA A;  1GCP A;  1PWT A;  1ZLM A;  2DL4 A;  4AFZ C;  2EYW A;  3TSZ A;  4LN2 A;  2GQI A;  2KRM A;  4FSS A;  1ZUY A;  1QKW A;  4ORZ A;  1BK2 A;  1GBQ A;  1GCQ A;  1WXT A;  3THK A;  2J7I A;  2DJQ A;  1E6H A;  1T0H A;  1NLP C;  4RTX A;  2O9V A;  1UEC A;  2YUN A;  3NGP A;  4ESR A;  2K6D A;  1I1J A;  1E7O A;  2HBW A;  1M8M A;  2LJ3 A;  1GCQ C;  2YUP A;  4GBQ A;  1S1N A;  4IIM A;  4JZ4 A;  2O2O A;  1X6G A;  3NMZ C;  2CDT A;  1X6B A;  2ED1 A;  3EHQ A;  2AZV A;  2C0I A;  2YUQ A;  2F2V A;  5GJW B;  2LCS A;  3H0H A;  5HCK A;  2W10 A;  1E6G A;  4RUG A;  5FW9 A;  2KT1 A;  1K0S A;  1OV3 A;  3EG2 A;  1OOT A;  2ENM A;  4J9C A;  4Z89 A;  1QKX A;  2RMO A;  2QDL A;  1NEB A;  1WIE A;  3VRZ A;  2ECZ A;  2K79 A;  3RBB B;  3VS4 A;  1ZUK A;  1AEY A;  1EFN A;  4QT7 A;  4OML A;  2JS2 A;  3PVQ A;  2LNH B;  1X69 A;  2GBQ A;  2JXB A;  2LJ0 A;  1AWO A;  2OI3 A;  1KSW A;  2AKL A;  1TG0 A;  1KJW A;  3VS5 A;  1MUZ A;  2DM1 A;  1SHG A;  2C0T A;  2BZX A;  2DL5 A;  2KBT A;  2J05 A;  2F2X A; 
#chains in the Genus database with same CATH topology
 1Q82 U;  2EQJ A;  4LDX A;  3JCM J;  2LCC A;  5LJ5 e;  2EQM A;  1HK9 A;  4XU1 A;  3FC3 A;  1H92 A;  1YNZ A;  1OX9 A;  3P8H A;  3CBM A;  3CCM Q;  1S72 A;  4JS4 A;  1JJ2 A;  4RTV A;  1WJS A;  4F7U B;  3R6N A;  4M75 B;  2LJ1 A;  4FW1 A;  5D6Y A;  4XQ3 A;  1BB9 A;  1SG5 A;  3LGL A;  1SSH A;  2AIR B;  1TUG B;  4M77 G;  4LDY A;  3M56 A;  5KH6 A;  4J9H A;  3CXC P;  1OPK A;  1XTD A;  1VQ8 T;  2CZ7 B;  3G6E A;  2YSQ A;  2X3X D;  4AFU C;  3GNF B;  3LW5 E;  1ACM B;  4C8Q D;  5IXB A;  4C8Q F;  1VQ7 Q;  4M78 A;  2WSC E;  4KUI A;  1C0M A;  3M54 A;  4Z88 A;  4OMQ A;  3P8B B;  4E7H A;  3CXC S;  3DLM A;  4R0K A;  4AFQ C;  4C0G A;  3CCR A;  3IQL A;  4LE9 A;  2O31 A;  3ZEH A;  1B07 A;  2VC8 A;  5HK3 A;  2DTH A;  1YN8 A;  4OB1 B;  2EYZ A;  4E7L A;  1W2B A;  1I8F A;  1BYM A;  1YWP A;  4M78 C;  2O01 E;  2CH4 A;  4BUG A;  3R6O A;  2EYQ A;  1BU1 A;  1WZO A;  3G1J A;  4A4K A;  2K7A A;  3CCL A;  2I0N A;  1Y57 A;  3S3O A;  3OW2 P;  1K9M U;  4PFZ A;  5CQX A;  3REB B;  2ROT A;  3CCS T;  4J9F A;  3V8K A;  1VYT A;  2E5Q A;  1UFF A;  1YIT A;  2DRM A;  1X6O A;  5LJ3 d;  3G71 A;  2F2W A;  1U5S A;  2K9G A;  5D7U A;  3VS7 A;  1QVG S;  4HCK A;  4XU0 A;  1KG1 A;  2BKD N;  1AZG B;  3ZL7 C;  3M58 A;  1M3C A;  3GP8 A;  3CCV Q;  4K11 A;  2MCN A;  4A4F A;  1YI2 T;  2GNC A;  2LT1 A;  2EKO A;  1WHK A;  2H8H A;  4BI4 A;  2DEU A;  1LVK A;  4M7A E;  2DF6 A;  2HEQ A;  2JM8 A;  3V7C A;  3LH5 A;  2HZY A;  1Q95 G;  4JJC A;  4LDW A;  2MWO A;  2DXC A;  3RNJ A;  1WI7 A;  1FXX A;  5CKB A;  2E65 A;  5D6X A;  1VQ8 Q;  2FPD A;  4OF1 A;  1OU8 A;  4YTL A;  3X20 B;  1WJQ A;  3JB9 D;  1Q7Y R;  3E19 A;  3MHX A;  1AWJ A;  2DXT A;  1XNI A;  2L8D A;  3JCM b;  1M90 C;  5C6S A;  2DX1 A;  3SDZ A;  3QWY A;  5GAN j;  3OA6 A;  1NG2 A;  4E7S A;  4XTU A;  3L2U A;  1M90 R;  3CBO A;  3MO8 A;  3AHU A;  1PRL C;  1RAG B;  4R55 A;  1XJW B;  4A53 A;  1PKT A;  1Z9Z A;  1Y96 A;  4A4H A;  3JB9 G;  5GAO q;  2XD0 A;  2QEX Q;  5GAN 7;  2DMO A;  2KI7 A;  1DJ7 B;  4RG8 A;  2P0K A;  2CH4 W;  4XU3 A;  4BE0 A;  1N9S A;  4M75 G;  2RJE A;  2DIQ A;  1SSF A;  4OMO A;  4D8D A;  4D6W A;  2EGC A;  5FU6 C;  3QJ6 A;  1Q86 C;  4OMN A;  2R5M A;  1TUD A;  4PFP A;  1WQW A;  2FL7 A;  5CKD A;  4Q5W A;  1Q86 R;  1QCF A;  3V7R A;  1KQ2 A;  5GAO l;  1UE9 A;  1X27 A;  1F1B B;  1WX6 A;  1CKB A;  3QYH B;  3RMQ A;  2GTO A;  4FL6 A;  4E6R A;  4M7D E;  1YI2 Q;  1JO8 A;  1NPP A;  1K9A A;  1VQ6 A;  1VQ9 Q;  3OW2 A;  4F7U E;  1RLQ C;  2CUB A;  2JS0 A;  3L2W A;  2BTT A;  3VS1 A;  2EGE A;  1Q81 C;  1N8R C;  1NYG A;  2YRC A;  1BI0 A;  2DTO A;  3CD6 A;  2KSS A;  1OPL A;  4JS5 A;  2QXF A;  3JCM d;  5I22 A;  4EMK A;  1D1A A;  3QKJ A;  3CMA T;  1Q81 U;  1N8R R;  1FYN A;  2FZG B;  1VQO T;  1AZE A;  4HVV A;  3TEE A;  1K73 R;  5FU7 B;  3ER0 A;  4C92 A;  3V8L A;  4C0Z A;  1AD5 A;  2DEQ A;  2MPX C;  2ESW A;  2D8J A;  4EMK C;  4DA4 A;  3QZ5 B;  4M4Z A;  3SD4 A;  1VQ7 A;  2DTI A;  1G3S A;  3T9N A;  4X34 A;  4C92 C;  1RAD B;  4ZGJ B;  3G6E T;  1ZHI A;  3VJP A;  4EIK A;  5FRM A;  3HL8 A;  2Y90 A;  1UGP B;  2IIM A;  1C6V X;  3CCE T;  1MMG A;  3CPW P;  1K4U S;  6AT1 B;  1PCX A;  1QVF A;  2QG9 B;  2DL3 A;  2A28 A;  3M9Q A;  2XK0 A;  3A8L B;  4JRI A;  2CYZ B;  3OYL A;  1KFZ A;  3EG9 A;  3JCM W;  4IUQ A;  3CCJ Q;  2AKK A;  1BI2 A;  1YP5 A;  4M78 E;  5GAN 2;  4N0A A;  2SRC A;  3G7Z A;  1RAE B;  3M57 A;  4JUV A;  1WHG A;  1RI0 A;  3J81 E;  4O5V A;  2KXD A;  4L5G A;  1NYF A;  2HQE A;  2M16 A;  1MHN A;  1YIJ T;  3CCL T;  2IG0 A;  4RCC A;  4KT0 E;  1YJ9 Q;  1RAH B;  3LWI A;  2E12 A;  4N0A C;  1SRM A;  4XK8 E;  3OYN A;  3CCV A;  1GL5 A;  3E9F A;  5LJ3 f;  2ZPF B;  2KEA A;  2K5I A;  1ZLM A;  2DL4 A;  3CPF A;  1YIT T;  2EYW A;  2DVE A;  3TSZ A;  3TCJ A;  2GQI A;  3NTK A;  3EG9 B;  3HTR A;  4LDU A;  4NS5 A;  3CMA Q;  2DJQ A;  3I56 Q;  2MK5 A;  4RTX A;  2O9V A;  4C5G A;  3A8O B;  1VQ8 A;  2RJF A;  2K6D A;  5KE2 A;  4JLG A;  4GBQ A;  4IIM A;  2VV5 A;  3DKM A;  1X6B A;  1M2O A;  3EHQ A;  4JRK A;  2KMT A;  5GAN h;  2AZV A;  2YUQ A;  3H0H A;  5CR2 A;  1YJN T;  3F70 A;  5A2Q E;  3EG2 A;  2M1H A;  4Z89 A;  3CCE Q;  2E3H A;  2QDL A;  4WF2 A;  1WIE A;  1U1S A;  3OYK A;  3GIB A;  2CKK A;  3CME Q;  2ECZ A;  2QEX A;  3VS4 A;  1EFN A;  1IZ6 A;  2LNH B;  4KGX B;  4ZN3 A;  1BCM A;  1AWO A;  2OI3 A;  3OYC A;  4PJO F;  3CCS A;  1KJW A;  5LJ3 g;  3EH2 A;  1KQ1 A;  2DZ9 A;  1MUZ A;  4J6W A;  4L6V 5;  1SF9 A;  2DL5 A;  2KBT A;  2J05 A;  1TH7 A;  3CPW A;  1K8A R;  4QVD A;  5CIU A;  1W70 A;  1H64 1;  2CS7 A;  2WAC A;  2X35 A;  4M7A A;  2NWM A;  2QGF B;  2HSE B;  1RI9 A;  2E70 A;  2HMA A;  3UPU A;  3I5R A;  1IO6 A;  1YI2 A;  1VQP T;  3EG0 A;  3HSB A;  2E64 A;  9ATC B;  1R8O B;  2QQA A;  4KUL A;  5HK0 A;  1SEM A;  2CZ1 B;  3PFS A;  4AMC A;  3EGD A;  1AVZ C;  2DRK A;  4M7A C;  2A36 A;  1H8K A;  4PNO A;  3CCQ Q;  4F16 A;  4X9C A;  3OBY A;  1IGU A;  2O4X B;  2HNI A;  3CCM T;  4KRT A;  1MND A;  2KT8 A;  5KYN A;  2QAS A;  3JCM f;  8AT1 B;  1LNX A;  4RG2 A;  3QHS A;  1SPK A;  1QWE A;  3HFO A;  4M7A B;  5DLO A;  2NUZ A;  2NLU A;  3HFN A;  2RHY A;  2A37 A;  1K0X A;  4WTO B;  1YJN Q;  2RQV A;  1PKS A;  4AT1 B;  4OB2 B;  1ABO A;  2PVO B;  1VQ4 Q;  4FYY B;  5IH2 A;  3JAM E;  3EGD B;  1NEG A;  1M1K C;  4J83 A;  2RHZ A;  2CZ6 B;  3PIP A;  3GLX A;  4N4G A;  1K1Z A;  2LQ8 A;  2XG8 D;  5M9O A;  2RPN A;  2L5Q A;  1M1K R;  4C92 E;  5GJV B;  2L3Q A;  5CK9 A;  1KHC A;  5CVI A;  3ASK A;  2CP2 A;  3L2V A;  2KXC A;  2DER A;  5GAM g;  2DYI A;  5LJ3 j;  3JCM c;  3CCJ A;  1TU0 B;  2V1Q A;  1QP3 A;  5GAN e;  4J6Y A;  5D6W A;  3S3N A;  4M7D A;  1OUL A;  1UHF A;  1IXD A;  4Y92 A;  5GAO n;  3BE3 A;  2RHX A;  4RTT A;  1HYO A;  1Y0M A;  5KCH A;  2RI3 A;  1VQP Q;  2RN8 A;  3H9N A;  4LUD A;  4M7D C;  2J6F A;  4A4E A;  1Q82 C;  1U1T A;  1OI1 A;  1NZ9 A;  2D9T A;  1TSF A;  5IN1 A;  2WSF E;  1IHW A;  2QTX A;  1BI3 A;  3GNG A;  4IUR A;  3EFO A;  4A54 A;  1RUW A;  1Q82 R;  3J80 E;  1EZZ B;  2FB7 A;  4C5H A;  3CMA A;  3KBG A;  3I56 A;  4M77 D;  2XDP A;  4M77 F;  3CCV T;  1NPR A;  2Z0W A;  5L23 A;  3BY7 A;  4M7D B;  4TVR A;  1VQO A;  3PTA A;  1ZUU A;  2LQN A;  2YRV A;  2ZPH B;  4DBH A;  4IUU A;  4IUV A;  1WLP B;  3I35 A;  3OBW A;  3EAE A;  4BE1 A;  1ABQ A;  1UJY A;  4HKE A;  2QQR A;  3L42 A;  3JB9 I;  3LH0 A;  1QCO A;  4GLK A;  1IB8 A;  2GF7 A;  3OS1 A;  4IUP A;  1HSQ A;  3H8Z A;  5FWB A;  1JEG A;  3SFM A;  1MV0 B;  5I11 A;  3PGG A;  2V8I A;  2CP5 A;  1D0Z A;  2JVV A;  2DBK A;  3CC2 T;  2BZY A;  1VOM A;  2RA2 A;  5GMK l;  4N4I A;  4ZTF A;  3I9Q A;  3CCE A;  4DOW A;  2XKO C;  1UHC A;  5GAN 3;  2DL8 A;  1UGV A;  3C4S A;  4ANJ A;  2HSP A;  2DLP A;  3SWN A;  3CME A;  1TS9 A;  3TSW A;  3NFC A;  2VGM A;  2DJZ A;  4EPC A;  1M30 A;  2QA4 T;  5CKF A;  2FRW A;  5ECA A;  1QWF A;  2EJG A;  1V29 B;  4IKF A;  5GAO r;  4JRQ A;  2CT3 A;  3O5Z A;  1QVG P;  1K9M C;  2QEX T;  2J6K A;  1PG5 B;  2R58 A;  3SWN C;  4HT8 A;  1FMK A;  1YIJ A;  2YLC A;  2Y4X A;  4A4G A;  2A3L A;  2QQ9 A;  2F1L A;  4LD9 K;  3QII A;  1K9M R;  2LVM A;  4J9G A;  2XMF A;  4Y91 A;  4M7A G;  1M1G A;  2KAF A;  4NL3 A;  4MDW A;  2ATC B;  4M78 B;  2FVU A;  4RTY A;  3A98 A;  1N6A A;  3SWN B;  2K5F A;  2ZPE B;  1WDX A;  4ELY C;  1G3Y A;  1M27 C;  2DVJ A;  1NE8 A;  1PHT A;  4JPB W;  1D1C A;  1I4K 1;  2RQT A;  3EHR A;  4XTY A;  3QSU A;  3BDU A;  1VQ9 T;  3FDR A;  3KXT A;  2J06 A;  4RKU E;  3OSS C;  2M0O A;  3NTH A;  3A8H B;  1QMC A;  5LJ5 g;  1X01 A;  4C8Q E;  2BUD A;  3FJP A;  2DYB A;  4ZGE B;  2JW4 A;  3CC7 Q;  2EGA A;  1XQH A;  2WSE E;  2X3W D;  1X2K A;  4HCZ A;  4B9W A;  2CGH A;  1X75 C;  1M3A A;  3HRT A;  1UTI A;  2RH2 A;  5KYU A;  1YJN A;  1PD1 A;  1NLO C;  3MCA B;  3CC2 Q;  1QLY A;  1B7T A;  4FYW B;  2KVQ G;  2E1H A;  1H3H A;  2DA9 A;  2FHD A;  2HQX A;  1UG1 A;  3QZ9 B;  2LC4 A;  3FIF A;  3Q1J A;  4QVC A;  2PTK A;  3JB9 F;  1MNE A;  1KC8 C;  2AHJ B;  2VWF A;  5LJ3 h;  2K3B A;  1MV3 A;  2RD1 A;  4PJM A;  4J9I A;  2HQH A;  4M75 D;  2RK2 A;  4M75 F;  1RAA B;  2PVG B;  4CC7 A;  2VKN A;  2VB6 A;  1AOJ A;  3CXC A;  2PZ1 A;  1KC8 U;  3JCM V;  2QA4 Q;  1YCY A;  2C0O A;  2KNB B;  4J6X A;  3UAT A;  2A7Y A;  1VQK T;  4ATO A;  2GQV A;  1KIK A;  5A0G A;  1Q7Y U;  3QG1 A;  4P5N A;  4DOV A;  3OS2 A;  4M7D G;  3OSV A;  1EX4 A;  1AHJ B;  1JB0 E;  5HKC A;  3DB3 A;  5KYU B;  2PUO B;  1KQS P;  4A63 B;  4F7U G;  1VQM Q;  2R5A A;  1KHI A;  4FCY A;  3CCJ T;  2DKG A;  5GAM d;  3RMS A;  4MDX A;  4AFZ C;  1VQP A;  2MWP A;  4LN2 A;  1ZUY A;  4ORZ A;  3LGF A;  1BK2 A;  1GBQ A;  1GCQ A;  3THK A;  4KH1 B;  3AT1 B;  1E6H A;  1QVG A;  1NLP C;  3MP1 A;  1KQS S;  1YJ9 T;  5I2M A;  5FU6 B;  1BIB A;  1Y96 B;  2DXU A;  3CC4 T;  1RAB B;  2PVD B;  3CCM A;  1HXD A;  2CZ0 B;  1GCQ C;  4JDS A;  2XI9 A;  3NMZ C;  2E6N A;  2ED1 A;  3OY9 A;  4PJO A;  1IRX A;  1PSE A;  2C0I A;  2F5K A;  4E7K A;  1Q81 R;  1D1B A;  3I56 T;  2LCL A;  3I55 Q;  2QYZ A;  3CEY A;  4HA8 A;  2W10 A;  4RUG A;  1K0S A;  3MEA A;  1OOT A;  2RMO A;  5KYX A;  4EMH A;  3INZ A;  1W4S A;  1ZSZ A;  1NEB A;  1D09 B;  1UGQ B;  3RES A;  4PJO C;  1M5Q 1;  1Y71 A;  1AEY A;  4C5E A;  3S3M A;  4M78 G;  2JS2 A;  3PVQ A;  2IPO B;  3RER A;  1X69 A;  4FT4 A;  1C1A A;  2JXB A;  2LJ0 A;  2P84 A;  4KH0 B;  3G4S Q;  2L89 A;  1ZSZ C;  1VQK Q;  2OX7 A;  3VS5 A;  1NBE B;  1SHG A;  4EMK B;  3C12 A;  3CCU Q;  2OAW A;  1B3Q A;  2GFU A;  4XTW A;  3JRZ A;  2HL3 A;  4C92 B;  3CME T;  2XDD A;  2H3E B;  2X4J A;  1JU5 C;  2JTF A;  3JCM h;  2BE9 B;  1OYX A;  1AWX A;  5LJ3 e;  5IHK A;  3MEU A;  5GAO m;  3SB2 A;  2D0N A;  4XU2 A;  4OGC A;  2A08 A;  4J9E A;  4FW2 A;  1I5L A;  2OTJ Q;  3EG1 A;  3OYD A;  3A5Z B;  2FYK A;  5KYY A;  2QAZ A;  3CC4 Q;  1O9S A;  4C5I A;  2HKN A;  1HJD A;  4HT9 A;  3MPU B;  2RI5 A;  2BZ8 A;  2QGG A;  3H0I A;  3UDC A;  4B6M A;  2JTM A;  2K3X A;  3M0P A;  5IAY A;  5GAN 4;  1SKU B;  2FPF A;  2RHU A;  2VVK A;  4N4H A;  3LLR A;  4DBQ A;  1VUB A;  2COZ A;  4PJJ A;  1W1F A;  2B8A A;  2CP7 A;  2RQU A;  3V7S A;  5J39 A;  1BBZ A;  1QW1 A;  4F04 B;  2CP6 A;  3CCQ T;  4J9D A;  3HP9 A;  2DBM A;  3PMI A;  4OMF B;  4F14 A;  1WA7 A;  3CC2 A;  5J3B A;  2P0Q A;  5KYY B;  5CQY A;  1H3Z A;  1G2B A;  1UGS B;  3FJ5 A;  5LJ5 d;  5FLX E;  1S72 Q;  3LX7 A;  4Y28 E;  1K76 A;  3URG A;  3C0C A;  1UDL A;  3RKX A;  2QI2 A;  2EJF A;  3SHW A;  1JXO A;  3E1S A;  3PMT A;  3M4G A;  3RIR A;  2D6F A;  2XHC A;  1VQ4 T;  3QO3 A;  2DNU A;  3GBQ A;  2QA4 A;  4LDV A;  3E9G A;  1VQN Q;  2CP0 A;  2EJ9 A;  2HKQ B;  4QW2 A;  1IHV A;  2FRY A;  4Z8A A;  1FX7 A;  1WHM A;  1KD1 U;  2DIL A;  1VIF A;  1WXU A;  2YWW A;  3VYH B;  1M2V A;  3LWH A;  2LMJ A;  3ULR B;  2W0Z A;  4QQ6 A;  4X1V A;  4KGV B;  2YHT A;  3EGU A;  3M0Q A;  1ZA1 B;  1GFC A;  4QVZ A;  4ZTJ A;  3X25 B;  3UF4 A;  5I21 A;  3CCR Q;  3QDF A;  2DK3 A;  2V1R A;  4RCB A;  3NPF A;  2EW3 A;  3PVL A;  2KR3 A;  4J8O A;  3UA7 A;  5CCA A;  1YHQ Q;  4E7I A;  4RTW A;  5GAM f;  2E4H A;  1N5Z A;  3OYI A;  4C8Q A;  3QDR B;  1VQ9 A;  2KQW A;  2CUD A;  2JMC A;  3EFS A;  3MJX A;  5CO7 A;  4IUT A;  4Z02 A;  1D0X A;  3JCM e;  2MI6 A;  4FM4 B;  2PQW A;  2RI2 A;  3OYY A;  3UWN A;  3QYG B;  4BE2 A;  4C8Q C;  2LRQ A;  3OB9 A;  2MAM A;  2CT4 A;  4OP0 A;  1NJI U;  5HY6 A;  3OMG A;  1U06 A;  5GAN 6;  2ROL A;  4C92 G;  1CSK A;  1WPY A;  4PLI A;  3WXM B;  4JRP A;  1GRI A;  2QK0 A;  2LP5 A;  1ZX6 A;  4C8Q B;  1JJ2 S;  2COW A;  5KCO A;  4IIO A;  1RLP C;  3PE0 A;  1ZA2 B;  4PJO E;  3G4S A;  2EKH A;  1VQK A;  1MMD A;  2M51 A;  2NUP A;  2VYT A;  2RQW A;  2PNI A;  1CKA A;  3JV3 A;  2MF2 A;  3X24 B;  4AG2 C;  2L3P A;  1VQL Q;  1JXM A;  3CCU A;  1MMA A;  2K57 A;  3PIO A;  3FB9 A;  1G3W A;  5AT1 B;  1W2B P;  4C0D C;  2EYY A;  1Y7X A;  2EPD A;  1OZ3 A;  2NUT A;  1TOV A;  4ZN1 A;  3N5B B;  1A0N B;  2FO0 A;  2L3S A;  3MET A;  2L0A A;  5L8R E;  3DLL A;  1AWW A;  2YUO A;  2QDY B;  4V2S A;  3GF5 A;  4C0D B;  3BDL A;  1Z9Q A;  1YJ9 A;  4EDU A;  2CP3 A;  3M0U A;  1W2B S;  2H3J A;  3V8J A;  3CC4 A;  3JCM Q;  3I5S A;  1ZBJ A;  2E5K A;  1NM7 A;  1ZSG A;  2ZAE A;  4OVA A;  1FMV A;  3H6Z A;  4M75 A;  3OYF A;  4DEY A;  2VXF A;  5FRN A;  2KGT A;  2DET A;  1BCO A;  4BDZ A;  2KRO A;  2ZGW A;  1KK7 A;  4RTZ A;  4HCB A;  4LD6 A;  2DL7 A;  3FRN A;  5CKE A;  3PNW C;  4KBM B;  4L59 A;  5A0L A;  1UEB A;  2RO0 A;  4RTU A;  2EFI A;  4FIB A;  2RM4 A;  1VQ6 Q;  2X4X A;  2X4W A;  5IXF A;  4EMG A;  3CC7 T;  4LXC A;  2DXB A;  4KGZ B;  2BIV A;  1JQQ A;  1B34 A;  5CAI A;  3CD6 Q;  4X9D A;  3EFO B;  4FU6 A;  2LX7 A;  4E47 A;  1UJ0 A;  4E7Z A;  3FLG A;  4AFS C;  2B86 A;  5LJ5 f;  2O9S A;  1WJR A;  2HL5 C;  4CC3 A;  1VQ5 T;  3OYM A;  1VQN A;  2EQI A;  4B9X A;  5GAM j;  2EVR A;  2EWN A;  4HVW A;  5GAN 8;  1PSF A;  2VXE A;  1PWT A;  4M7A D;  3GOX A;  1V76 A;  2ZPI B;  4C0F A;  4M7A F;  1RAC B;  3JCM P;  2YXY A;  1IGQ A;  2HBP A;  4DBR A;  1QKW A;  3JSC A;  1WXT A;  2J7I A;  2XDB A;  2OTL T;  1B34 B;  1T0H A;  1RAF B;  1YFN A;  2XID A;  1UEC A;  3NGP A;  1VQM T;  2X51 A;  2BE7 D;  4M77 E;  3ZFJ A;  2OAU A;  5GAN g;  1MGQ A;  3EGX A;  1YHQ A;  4JLI A;  4C8Q G;  2HBW A;  2YUP A;  2LJ3 A;  1S1N A;  1X6G A;  3MP8 A;  3VUZ A;  3OYE A;  4GY5 A;  2F2V A;  3HRS A;  2NYS A;  2LCS A;  5C0M A;  3RDV A;  5HCK A;  1WHJ A;  4CI0 C;  3GPL A;  4QKU A;  4J9C A;  3CCQ A;  1FWZ A;  1QKX A;  3TQ7 P;  4CRI A;  2K5L A;  3VRZ A;  5DM7 R;  5LL6 S;  4OB3 B;  3EGX B;  4QT7 A;  4OML A;  1BKB A;  3OW2 S;  5CKH A;  3FEO A;  2ZPG B;  2GBQ A;  1N9R A;  3I55 T;  2E6Z A;  2GCX A;  2AKL A;  3OS0 A;  5GMK m;  3VUB A;  3HPW A;  3QJY A;  2LQK A;  2DZC A;  2DM1 A;  1VQ4 A;  2RB6 A;  2BZX A;  3QXE B;  5FWC A;  3ZBD A;  1VQ5 Q;  1YBY A;  2ABL A;  2C06 A;  3TRE A;  3QWX X;  4PKC C;  4M7D D;  1WFW A;  4M7D F;  3BFM A;  2XU8 A;  4LUE A;  1VQL A;  2COY A;  2V8K A;  3MEW A;  2VUB A;  4F7U F;  1Q7Y C;  4UC4 A;  2JOY A;  1KC8 R;  2DFU A;  3G4S T;  2PU9 B;  1QVF P;  2X9H A;  3H41 A;  1T3S A;  2K3Y A;  2OTL Q;  2AZS A;  4HXJ A;  4JJB A;  2FEI A;  3CCU T;  1PRM C;  4OMP A;  4J7I A;  1U8R A;  2F5T X;  4ZGD B;  2JMA A;  1RAI B;  1LCK A;  3M55 A;  4O6J A;  3RUX A;  4J7F A;  1G83 A;  1U3O A;  2EAY A;  1WXB A;  2YT6 A;  1M90 U;  1YJW T;  2MMP A;  3HHT B;  4CC2 A;  1T0J A;  4LNP A;  1QVF S;  2DO3 A;  2EBP A;  4XTX A;  5GAO p;  1V1C A;  5GMK j;  3UT1 A;  3QUI A;  2KRN A;  2QQB A;  3CCS Q;  2OTJ T;  2L2P A;  3OYA A;  1TXQ A;  3EFR A;  1MMN A;  5KE3 A;  2RJC A;  4MZM A;  3KFV A;  3RKY A;  4E7J A;  4VUB A;  1Q86 U;  4KUD K;  3A8G B;  5LJ5 j;  2O88 A;  4RMO A;  3UA6 A;  2E3I A;  2HDA A;  2YDL A;  3QPH A;  1I07 A;  4M78 D;  4HVU A;  2IVW A;  4M78 F;  5AYF A;  2EIF A;  4M75 E;  5FU7 C;  4ELZ C;  1G5V A;  4PK4 A;  5KYW A;  4MZT A;  2JNG A;  1LJO A;  2JZ2 A;  1VYU A;  2FZC B;  1Y07 A;  2JM9 A;  4CC4 B;  1RL2 A;  1WHL A;  5GAM h;  1K73 C;  4J9B A;  1I0C A;  3BW1 A;  1N8R U;  3L2R A;  4PJL A;  3TVT A;  1S72 T;  2DIG A;  1UUE A;  1X2Q A;  2RQR A;  1K73 U;  4BY6 C;  1T3L A;  2E10 A;  2M02 A;  2FPE A;  4ME7 A;  4QQG A;  3MKD A;  4OB0 B;  2E41 A;  1PM3 A;  1TTH B;  1OZ2 A;  2CSI A;  2EYX A;  4PJO B;  2KK4 A;  2LZ6 B;  1M1F A;  4QQD A;  5FRO A;  1YWO A;  2JUF A;  3MP6 A;  1VQN T;  1WNL A;  5IHN A;  3L2Q A;  4XTV A;  3NHN A;  1ARK A;  3M4Y A;  5GAN 5;  5KYW B;  4BY6 B;  2HCK A;  3QBY A;  5KYX B;  2M0Y A;  1WYX A;  4GLM A;  1YJW Q;  1ZSZ B;  3U23 A;  1M3B A;  1GXI E;  2PUK B;  2GGR A;  1FMW A;  3D7S B;  4JJD A;  5DLQ E;  2VGN A;  3VS2 A;  2AK5 A;  1P92 A;  1J3T A;  2D1X A;  4DQ2 A;  2JTE A;  1OQK A;  3OYG A;  1XOV A;  3CCR T;  4OMM A;  3H0F A;  4FYX B;  2KYM A;  2KYB A;  1KQS A;  3CQT A;  2KDS A;  1YHQ T;  4XTZ A;  3HRU A;  2JN0 A;  4BDY A;  5GAN d;  3M59 A;  3CPW S;  2DD5 A;  5A0D A;  2DAQ A;  2SEM A;  1I5O B;  3O8V A;  3X28 B;  1WQ7 A;  1VYV A;  2RF0 A;  3EH1 A;  5IHI A;  4PFO A;  2LTO A;  1M4Z A;  4FSX A;  2V26 A;  1GFD A;  2M9U A;  1PD0 A;  2DE0 X;  3CC7 A;  3VRY A;  3JCM X;  4II1 A;  4BB7 A;  2QQS A;  3E2U A;  1EIF A;  1W6X A;  4NL2 A;  3G71 T;  3M0T A;  4DEX A;  2JT4 A;  2KE9 A;  3VYG A;  3JB9 J;  1G8X A;  2A0F B;  3OYJ A;  1WGS A;  3VKI A;  3NTI A;  5EC7 A;  3MEV A;  4FT2 A;  2LNV A;  2DPP B;  1VQO Q;  1D3B A;  2EQK A;  1VQ5 A;  3OQ5 A;  1UB4 A;  3VS3 A;  3CBP A;  2OJ2 A;  1QQJ A;  2G6F X;  2V8J A;  3M53 A;  2F69 A;  2K2M A;  2FG0 A;  1LOJ A;  1SRL A;  2RHI A;  2Y4Y A;  2QTV A;  2CRE A;  1VIE A;  2P4T A;  3M0S A;  3OMC A;  4AG1 C;  4ZNX A;  1ZQ1 A;  2LX9 A;  2YRD A;  3VU3 C;  4BAC A;  1KD1 C;  1PNJ A;  3RR6 A;  4M77 A;  3OYH A;  2MOX A;  2OTL A;  3KUF A;  3G6E Q;  2ZPB B;  1VQL T;  1OU9 A;  1KD1 R;  1GBR A;  4MML A;  5DY9 A;  2J6O A;  1VQM A;  1N27 A;  1YCS B;  1IRE B;  3M5A A;  5GAM e;  5GMK h;  3X26 B;  4NOY A;  2RNA A;  2D0Q B;  4M77 C;  1D3B B;  1X43 A;  1JBM A;  4D8K A;  3JB9 H;  3EG3 A;  2HAX A;  1TUC A;  3L1A A;  4MMK A;  3REA B;  2CSQ A;  1M9S A;  4PJO D;  4BI3 A;  1BIA A;  1R77 A;  2HD0 A;  1K8A C;  5LJ5 h;  3C95 A;  4M77 B;  2FZK B;  1LPL A;  2MIO A;  2AT1 B;  5I2S A;  2O4X A;  1YIJ Q;  4C92 D;  3CCL Q;  4C92 F;  1K8A U;  3SEM A;  4J5Y A;  2GTJ A;  3J7A F;  4PL6 A;  3VS6 A;  1M2V B;  1NJI C;  1JRI A;  2D8H A;  2K4Y A;  4PJO G;  1JJ2 P;  4JJN K;  1QVP A;  3C94 A;  1YIT Q;  8ATC B;  4HCC A;  2KRS A;  3G71 Q;  3I55 A;  2EQU A;  2P4R A;  1NJI R;  4WCI A;  4F17 A;  2L3R A;  1TWB A;  3VS0 A;  7AT1 B;  1UGR B;  2LQW A;  3OS5 A;  1OEB A;  2LT4 A;  5J26 A;  1HD3 A;  1SHF A;  5IT9 E;  1R0B G;  1VA7 A;  3A8M B;  4JZ3 A;  1VQ6 T;  3LYI A;  4OGE A;  3M0R A;  4XAX B;  3P8D A;  2ED0 A;  3OYB A;  1GCP A;  2MYS A;  2DD4 A;  3L2Z A;  3CD6 T;  2KRM A;  4BI8 B;  4FSS A;  1ZBX A;  4FYV B;  2RJD A;  1OX8 A;  4PLL A;  5EG2 A;  3DB4 A;  1O75 A;  2YUN A;  2GFA A;  4E2F B;  2K2V A;  2JJ9 A;  3HKS A;  4ESR A;  1I1J A;  1YJW A;  1E7O A;  1WHH A;  4DBF A;  1M8M A;  1PC0 A;  4JZ4 A;  2O2O A;  1M8V A;  1G3T A;  2CDT A;  1M1K U;  3TU4 K;  1VQ7 T;  2KY9 A;  3WVE B;  2LDM A;  5GJW B;  2VAS A;  1D0Y A;  4PJN A;  1BI1 A;  1E6G A;  5FW9 A;  2OTJ A;  2NUP B;  2KT1 A;  1OV3 A;  2ENM A;  3VV0 A;  1I81 A;  3RKW A;  1R0C B;  5GMK i;  4BD3 A;  4F7U A;  3ME9 A;  2K79 A;  3S6W A;  3RBB B;  1ZUK A;  5GMK e;  2ZZD A;  2NUT B;  2P0P A;  4MZP A;  5GAN f;  3PT9 A;  2XIC A;  4R56 A;  1KSW A;  1QCN A;  3WVD B;  1TG0 A;  2G3R A;  1AT1 B;  2ZCF B;  2I2L A;  3A1P A;  1QP2 A;  2C0T A;  2RK1 A;  3JCM g;  4M75 C;  2X4Y A;  2YLB A;  2F2X A;  2R57 A; 
#chains in the Genus database with same CATH homology
 5FWC A;  2OAW A;  2ABL A;  3QWX X;  1B3Q A;  1WFW A;  1W70 A;  4LUE A;  1H92 A;  1YNZ A;  2NWM A;  1RI9 A;  1JU5 C;  3I5R A;  1IO6 A;  4RTV A;  3EG0 A;  3R6N A;  1AWX A;  5IHK A;  2LJ1 A;  3H41 A;  2D0N A;  1T3S A;  1SEM A;  1BB9 A;  2A08 A;  1SSH A;  2AZS A;  1AVZ C;  4HXJ A;  4J9E A;  4JJB A;  2FEI A;  2DRK A;  2A36 A;  1PRM C;  4OMP A;  3EG1 A;  1H8K A;  2JMA A;  1LCK A;  4J9H A;  1OPK A;  4F16 A;  1G83 A;  1U3O A;  1WXB A;  2YT6 A;  2YSQ A;  1HJD A;  4CC2 A;  1T0J A;  4KRT A;  4LNP A;  2X3X D;  4AFU C;  2KT8 A;  2BZ8 A;  2EBP A;  3H0I A;  5IXB A;  1SPK A;  1V1C A;  1QWE A;  3M0P A;  2NUZ A;  2FPF A;  2VVK A;  2A37 A;  1K0X A;  4Z88 A;  4OMQ A;  2KRN A;  1W1F A;  2RQV A;  2RQU A;  4R0K A;  2L2P A;  1PKS A;  4AFQ C;  3IQL A;  1BBZ A;  1ABO A;  4LE9 A;  2O31 A;  1B07 A;  5IH2 A;  4J9D A;  1YN8 A;  1NEG A;  2EYZ A;  2DBM A;  4F14 A;  1WA7 A;  3KFV A;  1YWP A;  2CH4 A;  1K1Z A;  2O88 A;  3UA6 A;  1G2B A;  1BU1 A;  2RPN A;  3FJ5 A;  5GJV B;  2K7A A;  2HDA A;  2YDL A;  2I0N A;  2L3Q A;  1K76 A;  1Y57 A;  3C0C A;  1UDL A;  2KXC A;  1I07 A;  3SHW A;  1JXO A;  4HVU A;  3REB B;  2ROT A;  4J9F A;  1VYT A;  2V1Q A;  1UFF A;  2DRM A;  2DNU A;  3GBQ A;  2F2W A;  1U5S A;  2K9G A;  3VS7 A;  1VYU A;  4HCK A;  1UHF A;  2JM9 A;  4CC4 B;  4J9B A;  4Y92 A;  1I0C A;  2FRY A;  1AZG B;  3ZL7 C;  1M3C A;  4K11 A;  4Z8A A;  4RTT A;  2MCN A;  3TVT A;  1Y0M A;  1UUE A;  2DIL A;  1X2Q A;  2RQR A;  1WXU A;  1T3L A;  2GNC A;  2RN8 A;  2FPE A;  4LUD A;  2LMJ A;  2J6F A;  3ULR B;  2W0Z A;  2H8H A;  4X1V A;  2CSI A;  3EGU A;  3M0Q A;  2DF6 A;  2HEQ A;  2JM8 A;  2EYX A;  1GFC A;  3LH5 A;  2LZ6 B;  4JJC A;  1YWO A;  1RUW A;  3UF4 A;  5IHN A;  3NHN A;  3RNJ A;  1WI7 A;  2V1R A;  1ARK A;  3NPF A;  2EW3 A;  3PVL A;  2KR3 A;  3UA7 A;  2HCK A;  2FPD A;  4RTW A;  2M0Y A;  1WYX A;  4GLM A;  3U23 A;  5L23 A;  1M3B A;  1N5Z A;  1ZUU A;  2LQN A;  1WLP B;  2GGR A;  3I35 A;  1ABQ A;  1UJY A;  2CUD A;  4JJD A;  2JMC A;  3VS2 A;  2AK5 A;  1AWJ A;  1J3T A;  2D1X A;  1HSQ A;  2JTE A;  5FWB A;  1XOV A;  4OMM A;  3H0F A;  2DX1 A;  2KYM A;  1JEG A;  2KYB A;  3QWY A;  1MV0 B;  5I11 A;  3CQT A;  1NG2 A;  2CT4 A;  2DBK A;  1PRL C;  1U06 A;  2ROL A;  1PKT A;  1CSK A;  1Z9Z A;  2BZY A;  3I9Q A;  2DMO A;  2SEM A;  1UHC A;  1VYV A;  2RF0 A;  5IHI A;  1GRI A;  2DL8 A;  1UGV A;  2CH4 W;  2LP5 A;  2HSP A;  1ZX6 A;  2DLP A;  1GFD A;  4OMO A;  4D8D A;  2DE0 X;  4IIO A;  2EGC A;  3TSW A;  3VRY A;  1RLP C;  3PE0 A;  4OMN A;  1W6X A;  1M30 A;  3M0T A;  4DEX A;  2JT4 A;  2EKH A;  2KE9 A;  2FRW A;  5ECA A;  1QWF A;  1TUD A;  2M51 A;  2RQW A;  2CT3 A;  3O5Z A;  1QCF A;  2PNI A;  1CKA A;  3JV3 A;  2J6K A;  1UE9 A;  1X27 A;  5EC7 A;  4AG2 C;  1WX6 A;  2L3P A;  1FMK A;  1CKB A;  1JXM A;  2GTO A;  3VS3 A;  4E6R A;  2OJ2 A;  1JO8 A;  1K9A A;  4J9G A;  2G6F X;  2XMF A;  2K2M A;  2FG0 A;  2EYY A;  1SRL A;  2EPD A;  1RLQ C;  2CRE A;  2CUB A;  2JS0 A;  3M0S A;  4RTY A;  3A98 A;  2BTT A;  3VS1 A;  1A0N B;  2EGE A;  4AG1 C;  1NYG A;  2FO0 A;  2L3S A;  4ZNX A;  1OPL A;  2L0A A;  1WDX A;  1PNJ A;  5I22 A;  1M27 C;  2DVJ A;  1AWW A;  2YUO A;  1FYN A;  2MOX A;  1PHT A;  4JPB W;  1AZE A;  2RQT A;  4HVV A;  1Z9Q A;  1GBR A;  3EHR A;  3M0U A;  2J6O A;  1YCS B;  3I5S A;  1AD5 A;  2RNA A;  2J06 A;  1ZBJ A;  2E5K A;  1NM7 A;  1ZSG A;  2ESW A;  1X43 A;  2D8J A;  4D8K A;  4M4Z A;  4DEY A;  3EG3 A;  2DYB A;  2JW4 A;  2KGT A;  2EGA A;  1TUC A;  2X3W D;  1X2K A;  1M3A A;  3REA B;  2CSQ A;  1UTI A;  2KRO A;  1NLO C;  4EIK A;  4RTZ A;  2DL7 A;  1QLY A;  1H3H A;  2IIM A;  2DA9 A;  2MIO A;  1K4U S;  1UG1 A;  2DL3 A;  2A28 A;  4RTU A;  3SEM A;  2PTK A;  2GTJ A;  1KFZ A;  3VS6 A;  2VWF A;  5IXF A;  2K3B A;  1MV3 A;  2D8H A;  4J9I A;  2AKK A;  4CC7 A;  2VKN A;  1AOJ A;  1JQQ A;  2KRS A;  2PZ1 A;  1YP5 A;  2SRC A;  2P4R A;  4WCI A;  2C0O A;  2KNB B;  3UAT A;  4F17 A;  1KIK A;  2LX7 A;  1UJ0 A;  3VS0 A;  2LQW A;  2KXD A;  4AFS C;  2B86 A;  1OEB A;  2O9S A;  1NYF A;  1HD3 A;  4CC3 A;  1SHF A;  1VA7 A;  2EQI A;  4A63 B;  4JZ3 A;  1SRM A;  2EVR A;  3M0R A;  4HVW A;  1GL5 A;  2ED0 A;  2KEA A;  1GCP A;  1PWT A;  1ZLM A;  2DL4 A;  4AFZ C;  2EYW A;  3TSZ A;  4LN2 A;  2GQI A;  2KRM A;  4FSS A;  1ZUY A;  1QKW A;  4ORZ A;  1BK2 A;  1GBQ A;  1GCQ A;  1WXT A;  3THK A;  2J7I A;  2DJQ A;  1E6H A;  1T0H A;  1NLP C;  4RTX A;  2O9V A;  1UEC A;  2YUN A;  3NGP A;  4ESR A;  2K6D A;  1I1J A;  1E7O A;  2HBW A;  1M8M A;  2LJ3 A;  1GCQ C;  2YUP A;  4GBQ A;  1S1N A;  4IIM A;  4JZ4 A;  2O2O A;  1X6G A;  3NMZ C;  2CDT A;  1X6B A;  2ED1 A;  3EHQ A;  2AZV A;  2C0I A;  2YUQ A;  2F2V A;  5GJW B;  2LCS A;  3H0H A;  5HCK A;  2W10 A;  1E6G A;  4RUG A;  5FW9 A;  2KT1 A;  1K0S A;  1OV3 A;  3EG2 A;  1OOT A;  2ENM A;  4J9C A;  4Z89 A;  1QKX A;  2RMO A;  2QDL A;  1NEB A;  1WIE A;  3VRZ A;  2ECZ A;  2K79 A;  3RBB B;  3VS4 A;  1ZUK A;  1AEY A;  1EFN A;  4QT7 A;  4OML A;  2JS2 A;  3PVQ A;  2LNH B;  1X69 A;  2GBQ A;  2JXB A;  2LJ0 A;  1AWO A;  2OI3 A;  1KSW A;  2AKL A;  1TG0 A;  1KJW A;  3VS5 A;  1MUZ A;  2DM1 A;  1SHG A;  2C0T A;  2BZX A;  2DL5 A;  2KBT A;  2J05 A;  2F2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...