4F16A

Crystal structure of the alpha spectrin sh3 domain at ph 5
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
b'KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
molecule tags Structural protein
source organism Gallus gallus
publication title Crystal Structure of the alpha spectrin SH3 domain at pH 5
rcsb
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2012-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4f16A00
2DL5A 1CKBA 3ZL7C 4RTVA 1NG2A 1RI9A 1NM7A 2RN8A 2OAWA 3UATA 5IHKA 4AG2C 1Z9QA 2EPDA 4ESRA 2LX7A 1GCQC 2J7IA 3EG3A 3I9QA 1WXBA 3PVLA 1PRMC 2EYYA 5IXBA 1NYGA 1ABOA 2KGTA 2L3PA 4HCKA 3CQTA 1K0SA 1NEBA 3VS3A 4DEXA 2RQVA 4M4ZA 2I0NA 1RLQC 2F2VA 3TSWA 5IHNA 1BK2A 1AWWA 2CREA 4Z8AA 5FWBA 2J05A 4JZ3A 3FJ5A 1Y0MA 1WXUA 2DYBA 1AEYA 1IO6A 1PWTA 1KFZA 1QKWA 2LJ3A 2M0YA 3NPFA 4RTZA 1E6HA 1AWOA 1QKXA 2D8JA 3REAB 2DBKA 1MV0B 1FYNA 1B07A 3EG2A 2ROLA 2DMOA 1W70A 2OJ2A 2JS2A 1JXOA 5IXFA 2D0NA 1GCQA 1ZLMA 3PE0A 3QWXX 1M3BA 4FSSA 4IIMA 1T3LA 2C0OA 1A0NB 2O9SA 1ZBJA 1E6GA 2ABLA 4D8DA 1WIEA 1PKSA 1HJDA 1EFNA 2SEMA 3JV3A 1I07A 4RTTA 2JMCA 2KE9A 1GL5A 4AG1C 2O2OA 2BZ8A 1ZUKA 1GBRA 1BBZA 2RQRA 2VWFA 2C0IA 2FRWA 2F2WA 4AFZC 2DILA 1UECA 3C0CA 2KYBA 1V1CA 2YUQA 3SHWA 2K79A 1CKAA 2EVRA 1G83A 1UHCA 1YNZA 2GQIA 2EGCA 2DL3A 3EHRA 1M8MA 2LZ6B 4Z88A 1Y57A 1VA7A 2DL4A 3UA7A 4HVWA 4CC7A 2RQTA 2CT3A 2J6OA 1OV3A 2LNHB 4HVVA 4J9HA 2AZSA 2BZXA 2CUBA 2YDLA 2MOXA 1G2BA 1UJ0A 2DX1A 3VS1A 1RUWA 1NYFA 4OMNA 1UG1A 2DJQA 3VS0A 5IHIA 1QCFA 3VS7A 2HCKA 5IH2A 3SEMA 1N5ZA 2A36A 5L23A 4QT7A 2NWMA 1SHGA 2CH4A 2CSIA 2B86A 2IIMA 2DA9A 3M0UA 1T3SA 2AK5A 4F14A 4GLMA 2DRKA 4OMPA 2GTJA 1VYUA 1U3OA 1X2KA 2MIOA 4CC3A 2JT4A 2KXCA 2FPDA 3LH5A 1OPLA 4HVUA 2EYXA 2D8HA 1NLPC 4RTWA 3M0PA 1SPKA 2O31A 2ENMA 4LUDA 1ABQA 3I5RA 4OMQA 2KBTA 3TSZA 2HEQA 3H41A 1UUEA 4ORZA 2HDAA 1PRLC 5FW9A 3I5SA 3UA6A 2A37A 1BU1A 1H3HA 2GTOA 1WI7A 1WYXA 4J9BA 1SRLA 4CC4B 4JJCA 4R0KA 1XOVA 2EW3A 2O88A 2YSQA 2JM9A 3H0FA 1GRIA 4LUEA 1BB9A 1ZUUA 2EBPA 2KROA 2RNAA 1OPKA 1I1JA 1WXTA 1X6GA 2E5KA 1X27A 2OI3A 4E6RA 1SHFA 2EGAA 2KT8A 2FPFA 2DL8A 2H8HA 1OEBA 1SEMA 1X2QA 3IQLA 2DNUA 4X1VA 2F2XA 1T0HA 1S1NA 2RF0A 2GNCA 2K7AA 3EGUA 5ECAA 1H8KA 2FEIA 2LJ1A 3ULRB 2LQWA 2K3BA 3THKA 2PTKA 2X3WD 4EIKA 1KIKA 1NEGA 2J6FA 4J9DA 1YWPA 2EKHA 1HD3A 1H92A 1MV3A 2L3QA 2LMJA 2DLPA 1M3CA 1GCPA 1Z9ZA 1WLPB 4K11A 4JJDA 2GGRA 1W6XA 2VKNA 2CH4W 1PNJA 2PNIA 5I22A 2K2MA 2V1QA 2KNBB 1X69A 5HCKA 3NMZC 2CUDA 1I0CA 1UJYA 2DF6A 5GJWB 2AKKA 2GBQA 1K0XA 2CDTA 2M51A 4A63B 2A28A 2DM1A 2FO0A 3O5ZA 2JXBA 1MUZA 2DL7A 1J3TA 1UDLA 1GBQA 2J06A 3REBB 3M0RA 2KXDA 1AVZC 4ZNXA 2J6KA 4OMOA 1K9AA 5I11A 1CSKA 4JPBW 4Z89A 4J9FA 2KEAA 2W0ZA 1AOJA 2KYMA 1JQQA 4LE9A 2ROTA 1QLYA 1SRMA 1JU5C 1KJWA 4JZ4A 2HSPA 4F17A 1NLOC 1ZSGA 2ECZA 2X3XD 3RBBB 2LJ0A 3VRZA 3VS2A 2KT1A 2ED1A 2RQWA 3R6NA 1AZEA 4IIOA 1B3QA 2NUZA 2PZ1A 2RPNA 4RTYA 4CC2A 1E7OA 2YUPA 1M3AA 4J9IA 1ARKA 4GBQA 3NGPA 3U23A 1TUCA 3M0SA 2EQIA 2EGEA 5FWCA 3A98A 1U06A 1WA7A 4LNPA 3EHQA 3QWYA 2JW4A 2KRNA 1YWOA 2D1XA 2YUNA 4AFQC 1AZGB 2BTTA 1FMKA 2JTEA 2FPEA 2CT4A 1WX6A 1UE9A 1WFWA 1ZX6A 1UGVA 2RMOA 1T0JA 3TVTA 2CSQA 1GFDA 2L2PA 1GFCA 2AZVA 2W10A 3RNJA 1VYTA 2MCNA 2HBWA 2ED0A 3H0IA 1QWFA 1YP5A 1VYVA 1JEGA 3GBQA 4J9GA 2DVJA 2SRCA 2O9VA 4LN2A 2V1RA 2DRMA 1YN8A 4RTXA 3PVQA 3VS6A 1M27C 2RQUA 1M30A 4OMMA 3H0HA 1W1FA 3KFVA 2LQNA 4J9EA 3VRYA 4KRTA 4RTUA 4RUGA 1OOTA 2ESWA 1X6BA 2DE0X 1PHTA 2KRMA 2L3SA 5EC7A 4J9CA 4WCIA 1SSHA 1QWEA 2A08A 2KR3A 3VS5A 3EG0A 3M0QA 1K4US 2QDLA 2K6DA 4D8KA 1HSQA 1JO8A 3M0TA 1K76A 3I35A 1AWJA 2EYZA 2P4RA 2C0TA 2JS0A 1KSWA 3VS4A 4DEYA 2FRYA 2YT6A 2LCSA 2EYWA 1AWXA 2YUOA 2FG0A 1TUDA 1LCKA 2L0AA 1U5SA 4JJBA 2KRSA 2K9GA 1K1ZA 1UTIA 1WDXA 1YCSB 4HXJA 1PKTA 3NHNA 1UFFA 4AFUC 1TG0A 1ZUYA 4OMLA 2G6FX 1AD5A 3UF4A 2AKLA 1JXMA 4AFSC 1X43A 2JM8A 3EG1A 4F16A 4Y92A 2DBMA 5GJVB 2XMFA 2BZYA 2LP5A 1RLPC 2JMAA 1UHFA 2VVKA
chains in the Genus database with same CATH superfamily
2O4XB 3G71A 2X35A 4EPCA 4DBQA 4MZTA 1M1GA 2RN8A 2DETA 3EFRA 5IHKA 1Z9QA 2CYZB 2EQMA 2LCCA 1GCQC 2J7IA 2JOYA 4QKUA 3I9QA 1WHJA 1WXBA 4PFPA 4PFOA 4MDWA 2QQSA 2QQRA 2IPOB 2KGTA 3CQTA 3EGXB 4M78E 2K4YA 2X9HA 4GY5A 4PLIA 1C6VX 1VQKQ 2L8DA 1HYOA 4IUVA 3MEAA 5KCHA 4HCZA 5FWBA 2J05A 3CD6T 1WXUA 2DYBA 1IO6A 1KFZA 5GAN3 3CCJT 1WHMA 1KK7A 4RTZA 2QTXA 1G3YA 1YIJA 1M1KR 3CMEQ 2DBKA 5GAOq 1Q82U 1DJ7B 2ROLA 1OX8A 3SWNC 2OJ2A 4EMKB 1JXOA 2OX7A 4J83A 4E7JA 3QWXX 4IIMA 1I5LA 4J7FA 5KE3A 4C5GA 2O9SA 4N4IA 1VQ8T 2E65A 4D8DA 1WJSA 4M7DG 2JMCA 2KQWA 3SDZA 1GL5A 2BZ8A 3I56A 2VWFA 1BI2A 2QXFA 3E1SA 2F2WA 1QCNA 4WTOB 3I56T 3S6WA 3RKXA 1CKAA 3E9FA 3MP6A 1YJWT 1VQNQ 3PIPA 3MCAB 4EMKA 3E19A 4QQ6A 5CKHA 1Y57A 2GCXA 1VA7A 4HVWA 2RQTA 3RESA 1WHHA 1D0XA 2GFUA 2LNHB 1KQSP 4DOWA 3ZFJA 4OF1A 1G2BA 2YWWA 3QUIA 2RH2A 5IHIA 1QCFA 3VS7A 3ASKA 3DKMA 3X26B 3SEMA 3V8LA 2JVVA 4C8QC 1N8RR 4QT7A 4KT0E 2NWMA 3CMAA 3UWNA 1BI1A 2M02A 2V8IA 1M4ZA 1T3SA 4N4HA 4Y28E 3LX7A 4L5GA 4OMPA 4JS5A 3X24B 1VQKA 3D7SB 1YIJT 2NYSA 2FPDA 3M4GA 2CZ6B 2EYXA 1OU8A 2X4XA 4FYYB 2D8HA 3OW2P 2DIQA 2KBTA 4QW2A 3OYAA 4ORZA 4E7LA 1OQKA 2X51A 2DJZA 2WSFE 5DY9A 1VQ6Q 5LJ3d 3I5SA 5GANh 2HAXA 1LJOA 1WYXA 4JJCA 4QVZA 4FYXB 1M90U 2LNVA 1ZUUA 2EQJA 1WXTA 4M7AG 2MYSA 3OQ5A 2EGAA 4EMHA 3MEWA 1X2QA 1VQOQ 3NTIA 4X1VA 5I2MA 4R56A 2RF0A 1JJ2P 3SB2A 2MAMA 3CCVA 2DXBA 2LJ1A 2XDPA 2XD0A 2K3BA 2PTKA 3CCMA 3A8HB 1KIKA 1YWPA 3WVDB 4C0DC 5D6XA 2CP3A 1M3CA 3O8VA 2RHUA 2MF2A 4DBFA 1WLPB 1VQ4Q 3E2UA 2OTJT 3JCMW 4JRQA 4RG8A 2CUDA 4J6WA 2AKKA 1K0XA 3E9GA 2E10A 4M7DA 2JZ2A 1QMCA 2DL7A 1UDLA 5KCOA 1GBQA 4EMGA 1AVZC 2MK5A 4ZNXA 3GP8A 2J6KA 4OMOA 1WHLA 2RJFA 4C0GA 2KEAA 2W0ZA 3BE3A 2BUDA 2JTMA 1JQQA 4LE9A 5LJ3f 3PGGA 4CI0C 1QLYA 4OGEA 2QASA 2RHXA 4II1A 1KD1U 4IUUA 3M54A 4JZ4A 2HSPA 4JDSA 1VQ5A 2X3XD 3META 4L59A 3RBBB 1BCOA 2ED1A 1Y71A 2F5TX 1BIAA 3R6NA 1RAAB 3INZA 1WGSA 2L3RA 1N8RU 4XU1A 5GAOm 4CC2A 2CZ1B 1ARKA 1VQ7A 1RAGB 4GBQA 4C92B 1D0YA 3MKDA 4C92E 2LC4A 3LLRA 2EGEA 4M77E 2E6ZA 1ZSZB 3R6OA 3CCST 1WA7A 5GMKj 4FSXA 3OY9A 3OYDA 3A8LB 4XTWA 4FL6A 3EGDB 1TUGB 2H3EB 4AFQC 1YJ9A 1FMKA 4E7HA 5FU6B 1WFWA 3KUFA 1D3BA 1UGVA 2COYA 1Q7YR 5GAMd 4RKUE 4HT8A 1N8RC 3AT1B 2MCNA 3OW2S 4XTUA 4N0AC 2DXUA 1QWFA 1YP5A 1UGRB 1JJ2S 3LGFA 4M77G 1U8RA 2M16A 5A0GA 2XICA 4PJOG 5CVIA 3PVQA 3VS6A 3OMCA 1Q86C 3H0HA 5GAOn 2K3XA 2CP2A 4KRTA 4E7IA 3Q1JA 3SD4A 4RUGA 4FT4A 5GANe 4PJNA 2WACA 2RHZA 3SWNB 1X6BA 2L89A 2EQUA 2QA4Q 1HK9A 1SF9A 1M1KU 1SSHA 3C12A 4M7DF 3EG0A 4FM4B 2K6DA 3OS5A 4D8KA 2QI2A 4CRIA 5KYXB 4M75G 1Q81U 1JO8A 1RAEB 2QEXT 3I35A 2P4RA 5IT9E 2E41A 2NLUA 2ZPFB 2JS0A 1TXQA 4MZPA 3CPWS 3T9NA 3I55A 2QEXA 2EYWA 4B9XA 2HQEA 3RKYA 3G4SA 2VGMA 1LCKA 4PL6A 2K9GA 1WDXA 5M9OA 4AT1B 1PKTA 3NHNA 1UGQB 1B34A 2XKOC 2VGNA 1VQNT 1JXMA 2JM8A 1YI2A 2YRCA 2K3YA 3OYGA 5GJVB 2VASA 2F5KA 3EH2A 2RD1A 4M78B 1VQ5T 4C8QD 3GNGA 1PM3A 3EGDA 3RMSA 4M77C 3FLGA 4J6YA 2EWNA 1WJRA 1CKBA 1VQ9A 3PMIA 3ZL7C 3A8OB 4RTVA 1NG2A 1Q81R 1VQPT 2HD0A 2QEXQ 2BIVA 1R0BG 4FT2A 3UATA 1BIBA 4AG2C 4E47A 2DO3A 4ESRA 1YI2T 3CCRQ 4PJOF 3J81E 3JB9G 2RJCA 2E64A 3CCEQ 5LJ5f 2MMPA 1MMGA 3L42A 5IXBA 1NYGA 4M77D 2D0QB 1K0SA 5KYUA 1NEBA 5GANf 2PVOB 3VS3A 3OYLA 3MEUA 2RQVA 2YRDA 2L5QA 5GAMh 2I0NA 3OYIA 1RLQC 1AWWA 3EGXA 1C1AA 4F7UA 3X28B 3CMET 5GMKl 1VQ8A 1KG1A 3FJ5A 4X34A 5D6YA 1Y0MA 3CCSQ 2DTHA 1AEYA 2LJ3A 2M0YA 1E6HA 1M2VA 1AWOA 3RR6A 2D8JA 1G3WA 4PK4A 1FXXA 5CK9A 1Q7YU 4BI3A 1YCYA 2DMOA 2OAUA 5FROA 4C92C 5IXFA 3SFMA 4FSSA 1M3BA 4BI4A 4BB7A 3S3NA 1A0NB 4M75B 4Q5WA 1M8VA 3DB3A 3EG9B 3V7CA 3JCMJ 3HHTB 1VQ4A 2P0QA 2SEMA 1I07A 4RTTA 2JTFA 4A4FA 2O2OA 3OB9A 2HQXA 1BBZA 1U1SA 2Y4YA 2C0IA 4PJMA 3OYEA 4DOVA 4LDUA 3URGA 1XJWB 4AFZC 8AT1B 3L2QA 2E3IA 4C92D 1V1CA 6AT1B 1Q86U 3VKIA 1NE8A 1IB8A 3OA6A 1YJNT 1K9MC 1EZZB 1NBEB 1AHJB 1UHCA 4BE1A 1FMVA 2DL3A 4E7SA 3G71T 4PJLA 1VOMA 1K8AR 2AZSA 2BZXA 3QZ5B 5LJ3e 2XDBA 2DJQA 3H6ZA 3P8HA 2HCKA 3G7ZA 3TQ7P 1N5ZA 2A36A 2QK0A 2E5QA 2QDYB 2I2LA 5C6SA 1Q82C 1BKBA 2IIMA 4XK8E 4A53A 2DTOA 4JLIA 1YBYA 4GLMA 2DRKA 4Y91A 4FYVB 2GTJA 3GF5A 3TCJA 1X2KA 2LX9A 2MIOA 4M78C 2JT4A 1YJ9T 2EAYA 3CCJA 2KXCA 1OPLA 2IG0A 1VQ4T 2DVEA 1OYXA 4GLKA 4RTWA 3M0PA 1SPKA 2O31A 4KGXB 5A0LA 1ABQA 2RI2A 4XU2A 4OMQA 4M7DD 2XDDA 1UUEA 2FZCB 3SWNA 2K2VA 5IAYA 4E7ZA 4CC4B 3M53A 4M78D 4R0KA 3V8KA 3BFMA 2EW3A 2O88A 1I8FA 2CP0A 3RIRA 5I21A 2P0KA 1BB9A 2EBPA 2ZZDA 1I1JA 1KC8R 1X6GA 2E70A 2E5KA 2OI3A 2PVDB 3OSVA 2DL8A 1YFNA 2NUPB 1SEMA 3IQLA 1LPLA 2F2XA 4M77F 5GANg 4V2SA 1ACMB 3CCMT 4PJJA 1ZA2B 2GFAA 2FZGB 3THKA 1ZSZA 4EMKC 2DK3A 1QVGS 2X3WD 2J6FA 5A0DA 3OYYA 1MV3A 1RL2A 2L3QA 2LMJA 4HCBA 3L1AA 2DERA 2R5MA 2NUTB 3M5AA 1OULA 5I22A 2V1QA 1X69A 5HCKA 2NUTA 3CMAT 1UJYA 2DF6A 5GJWB 2DD4A 2CDTA 2M51A 4A63B 2A28A 2X4YA 3O5ZA 2JXBA 1J3TA 2HBPA 3M0RA 2KXDA 5LJ5e 2DAQA 1NJIC 4C5EA 4XQ3A 4DBHA 5I11A 1XNIA 4O5VA 3ER0A 2XI9A 3N5BB 4KH1B 5LJ3j 2ROTA 3A8MB 1JU5C 2QQBA 2VYTA 3ME9A 3QBYA 4F17A 1GXIE 2CZ0B 4C5HA 2QG9B 4JUVA 4JLGA 5A2QE 5J39A 1AZEA 5DLOA 1ZQ1A 3ZBDA 4M7AB 2PZ1A 2YUPA 1M3AA 2RA2A 3EAEA 1OI1A 3U23A 2RB6A 1TUCA 1WZOA 3M0SA 4LDXA 1JRIA 1YJWA 1RACB 1MMNA 2E1HA 5FWCA 3A98A 3OW2A 1U06A 3KBGA 3RUXA 3CC2A 4LNPA 3M55A 2E12A 3CCJQ 3CD6Q 3M4YA 2LT4A 3LGLA 1VQ9Q 1QVFS 2D1XA 4BI8B 2BTTA 3ZEHA 1LOJA 2CT4A 1WX6A 2FYKA 1P92A 1H3ZA 2QTVA 1T0JA 1TOVA 5CO7A 3H8ZA 3HFOA 3TVTA 3LWHA 5FRNA 4J7IA 3KXTA 2ED0A 3H0IA 1JEGA 3QXEB 4M7DE 4J9GA 4BY6B 1N9SA 1R8OB 3HRSA 1K8AC 3JCMg 1X01A 3MP8A 2V1RA 1WJQA 5AT1B 1YN8A 2RO0A 4RTXA 4C5IA 4YTLA 1M30A 4OGCA 2ZAEA 4OMMA 1W1FA 3VRYA 3BDUA 1BI0A 2OTJA 2KVQG 4XAXB 3OYNA 2DE0X 3HSBA 5EC7A 1RADB 4J9CA 1N6AA 1MNDA 2A08A 2KR3A 4PNOA 3M0QA 1I4K1 4C0ZA 4UC4A 4ZTFA 1MMDA 1K76A 4RG2A 4FIBA 1HXDA 1QVGP 4QVDA 1D1CA 4DEYA 2YT6A 2LCSA 3QYHB 3OYFA 4LDVA 1KHIA 2L0AA 1O9SA 4X9CA 5LJ3g 3VYGA 1K1ZA 1MNEA 1O75A 4HXJA 1UFFA 4ZGDB 3HRTA 4OMLA 2A7YA 1NZ9A 1I81A 2C06A 5CIUA 4F16A 3EG1A 4KH0B 2K5LA 1K73C 2Z0WA 4DA4A 2MWPA 2G3RA 1VQLQ 3L2ZA 2JMAA 2FL7A 3EH1A 2DXCA 3CBMA 3JB9F 1LVKA 1QVPA 1NM7A 2DEUA 3BDLA 3CCMQ 2LQ8A 1KQSA 2EPDA 4BUGA 2JN0A 2LX7A 3EG3A 5CQXA 4XTYA 4BE2A 3A1PA 1NJIR 1PRMC 4HCKA 4KUIA 5GANj 1K9MU 4XTZA 3CC4T 3CCQQ 4E2FB 1UGSB 4M4ZA 4M7DC 7AT1B 4J5YA 3JCMb 1OZ2A 1SG5A 2CREA 3FRNA 3J80E 4JZ3A 5GAOr 1K73R 2EQKA 3GOXA 1YITQ 3GLXA 1M5Q1 4KULA 4J8OA 1QKXA 3VJPA 3CCVT 1Y07A 3REAB 4M7AC 3M58A 1B07A 1Q7YC 1QVFP 1TTHB 2D9TA 1W70A 1VQ6A 2JS2A 3CCQT 2LT1A 4ELZC 2KK4A 3PE0A 3JCMV 1FMWA 1G3TA 1E6GA 4QVCA 1WIEA 1PKSA 2JUFA 2KE9A 1M2OA 1Q81C 1ZUKA 1GBRA 2RQRA 2QA4T 4M7AD 4OMFB 1VQKT 3CC7T 5HK3A 1UECA 3JCMP 3A8GB 1W2BP 1MMAA 3FJPA 2B8AA 3CD6A 2EKOA 3SHWA 3J7AF 1VIEA 5LJ5g 4PJOB 3CC2Q 2EVRA 2XU8A 1G83A 2MWOA 3QKJA 1YNZA 3EHRA 5FU7B 1M8MA 2M0OA 1W4SA 2LZ6B 4M75E 4Z88A 1K73U 3UA7A 2DL4A 4CC7A 1BYMA 3BW1A 4M77A 2CT3A 4LXCA 1OV3A 3FDRA 4OB2B 5GAMj 3G71Q 3HFNA 4J9HA 4BDZA 2YDLA 2CUBA 1K9MR 1UJ0A 2RM4A 3EFSA 2DX1A 4IUPA 3VS1A 1NYFA 3CPWP 1NJIU 3VU3C 4N0AA 4RMOA 2O01E 3PFSA 2M1HA 1SHGA 1XQHA 2CSIA 2B86A 1QVGA 2ZPEB 4PFZA 2AK5A 4F14A 3G6EQ 2VV5A 2VC8A 2P4TA 3C4SA 4C92G 1KQSS 1U3OA 2HMAA 2ZCFB 3LH5A 1R77A 3VV0A 5KYNA 4WF2A 2AHJB 1MGQA 5GMKh 3CCLQ 4RCCA 4L6V5 3CCVQ 4M77B 2OTLA 1RABB 1PRLC 4BD3A 3MJXA 4X9DA 5FW9A 2EIFA 4C92A 1BU1A 1X6OA 1ZBXA 1H3HA 2GTOA 5KYWB 2DPPB 1WI7A 3V7SA 1RAIB 4M75A 3I55Q 3DB4A 1XOVA 2HKQB 2XHCA 2EJ9A 2MI6A 1WNLA 3CC4Q 1S72Q 2JM9A 2LVMA 3H0FA 4LUEA 3JCMe 5GMKe 2KROA 2RNAA 4FYWB 3CBPA 5HKCA 1X27A 2YRVA 4E6RA 2KT8A 4LDYA 3CCRT 2H8HA 1TH7A 2DNUA 4M75F 3NFCA 1PC0A 1T0HA 3JCMf 2R58A 1NPRA 2K7AA 3CCLA 1Q95G 5ECAA 5FU7C 1H8KA 1D1BA 2QA4A 3C94A 1B34B 3ULRB 2OTLQ 2LQWA 3OYBA 2DIGA 4EIKA 1NEGA 1U1TA 2ATCB 2EKHA 1H92A 2FB7A 1Y96B 2ZPBB 2YHTA 4OB1B 2PUOB 1PD0A 2DXTA 4NL3A 1V76A 4K11A 3QZ9B 1IHWA 3G4ST 3JB9J 2GGRA 1W6XA 1VQMA 2CH4W 1PNJA 2AT1B 2K2MA 3DLMA 2KNBB 4O6JA 4VUBA 2AIRB 3GPLA 1KQ2A 5GMKi 3HPWA 1KHCA 2GBQA 5HY6A 5GAN2 4M7AF 4QQDA 2DM1A 3CMAQ 1MUZA 2J06A 3REBB 4B6MA 2LQKA 5CKDA 2KY9A 2PVGB 2YLBA 1TU0B 4MZMA 4M7AE 3OS1A 3CC2T 3UPUA 1CSKA 4IUQA 5KYYA 4JPBW 2DKGA 8ATCB 3V8JA 4J9FA 3CMEA 5LJ5h 2E4HA 1AOJA 2QGGA 1VQLA 2KYMA 5CAIA 5D7UA 4F7UE 3RMQA 3OS2A 1M90C 4ANJA 1KJWA 3UDCA 1D09B 1YITT 4KGZB 3RERA 2COZA 5LJ5j 5CKFA 2ECZA 2P0PA 4ZN3A 2LJ0A 4F7UF 3JCMX 5C0MA 3EFOA 2RQWA 1M9SA 1B3QA 4JJNK 1E7OA 2RHYA 2HL3A 4J9IA 3FC3A 4NOYA 3BY7A 4ZGJB 1OU9A 2EQIA 3P8BB 4ELYC 2LTOA 4N4GA 5GAN6 3QWYA 2F69A 1WQWA 2HSEB 5DLQE 3X25B 1VQ8Q 2KRNA 5GAMf 4A4HA 1YWOA 2PUKB 2PQWA 3UT1A 1AZGB 3QPHA 2FPEA 1ZX6A 1UE9A 3OYCA 3OYMA 1VQPA 3QG1A 2R5AA 1S72T 3PIOA 2RMOA 2HQHA 1WHGA 1GFDA 2CSQA 1BI3A 4OB0B 2L2PA 3CPWA 1ZSZC 4MMKA 3RNJA 1VYTA 1EIFA 2QQAA 2HBWA 4PLLA 3I55T 4BDYA 3GBQA 2ZPGB 4LD9K 4TVRA 3CCQA 4LN2A 4P5NA 3DLLA 2LCLA 2RJEA 4EDUA 3KFVA 2LQNA 4J9EA 5IN1A 3PT9A 3JCMc 2BKDN 2CKKA 2ESWA 1VQMT 2WSCE 1IHVA 1OZ3A 1YI2Q 2KMTA 2L3SA 4PJOA 5D6WA 3MP1A 5FRMA 5KH6A 5KYUB 1QWEA 2HZYA 3VS5A 3G6ET 1R0CB 1ZHIA 1K4US 2QDLA 3LYIA 1HSQA 4F7UG 2Y4XA 1W2BS 1KC8U 3A5ZB 4M78F 5GAMe 3JCMQ 1G5VA 3WVEB 2CZ7B 1JB0E 1YJNQ 2K57A 3VUZA 4QQGA 3VS4A 1VUBA 3G1JA 2YUOA 4IUTA 1TUDA 3AHUA 3L2RA 2RHIA 2EJFA 1UTIA 1YCSB 3CCUQ 5L8RE 3P8DA 2KDSA 3PTAA 3JSCA 2COWA 4HA8A 3JCMd 1VQOT 3CC4A 2DEQA 2BE9B 5CCAA 2LDMA 1QCOA 4C0FA 4ATOA 3UF4A 4A4KA 4AFSC 1X43A 3CCUT 2QYZA 2WSEE 4Y92A 4HT9A 1RAHB 1VIFA 4XU3A 4Z02A 1RI0A 1RLPC 1UHFA 4IURA 2VVKA 1YITA 3GNFB 3LWIA 2DL5A 2A3LA 1M90R 3L2UA 2CP6A 1RI9A 4M7DB 4M7AA 1IXDA 1XTDA 1M1KC 3QDRB 2NUPA 2OAWA 1F1BB 4C8QA 2E3HA 4FCYA 9ATCB 3PVLA 3S3MA 3L2WA 2XIDA 3M57A 2EYYA 1ABOA 4HKEA 2L3PA 2JNGA 5KE2A 1N9RA 2GF7A 4DEXA 3CCET 1K8AU 2HNIA 5LJ5d 4KBMB 4C0DB 2F2VA 3TSWA 5IHNA 1BK2A 3QYGB 4Z8AA 1IREB 2D6FA 4DQ2A 3CXCS 1PWTA 5GAN8 1QKWA 3NPFA 4XU0A 4JRIA 3RKWA 4E7KA 4JRPA 1VQ6T 1Y7XA 1BCMA 3M59A 1MV0B 1FYNA 3CC7A 1Q86R 3EG2A 4R55A 2CS7A 1PSEA 2D0NA 1GCQA 1M1FA 1ZLMA 2HL5C 1T3LA 2C0OA 1KQ1A 5I2SA 1JJ2A 1V29B 2QQ9A 2F1LA 1ZBJA 2X4WA 2ABLA 1PD1A 1HJDA 1EFNA 1WHKA 2K5IA 1KC8C 3OS0A 2CGHA 3JV3A 4C92F 1VQ7Q 1OX9A 4AG1C 1RAFB 2E6NA 1IZ6A 1YJWQ 2FRWA 1Y96A 4ZTJA 4B9WA 4A54A 3CCLT 2OTJQ 2DILA 1X75C 2EYQA 3C0CA 4ME7A 4M78G 2KYBA 3HTRA 2YUQA 2HKNA 2K79A 1YJ9Q 1WQ7A 2KSSA 2FHDA 2ZGWA 1EX4A 1NPPA 4A4GA 2GQIA 2EGCA 3OYHA 4FW2A 1MHNA 3QSUA 2J6OA 2X4JA 4HVVA 5HK0A 5FU6C 4BY6C 2MOXA 1N27A 2R57A 3CXCA 4NS5A 3MHXA 3S3OA 1QW1A 1RUWA 3OBYA 4OMNA 1UG1A 3H9NA 3VS0A 4AMCA 2YXYA 1YHQT 4LD6A 3JB9D 4RCBA 5IH2A 5DM7R 3QDFA 4DBRA 5L23A 1Q82R 5KYWA 4PJOE 2QGFB 4A4EA 2CP5A 2CH4A 5GAOl 1YHQA 1PSFA 3RDVA 2DA9A 3M0UA 4FU6A 3LW5E 2RJDA 4JS4A 2VXFA 2XG8D 1PG5B 4OVAA 5GANd 4BE0A 4C8QG 1VYUA 4CC3A 3OBWA 3L2VA 4HVUA 4HCCA 1QVFA 3TU4K 1NLPC 1YIJQ 2ENMA 3MO8A 4LUDA 3I5RA 1YJNA 3TSZA 2HEQA 3H41A 2HDAA 3CCRA 2Y90A 3OYJA 1C0MA 3CCEA 3UA6A 2A37A 4F7UB 3F70A 1G8XA 1D3BB 4J9BA 1SRLA 3MEVA 1VQMQ 1WPYA 4F04B 3X20B 2YSQA 1D1AA 2K5FA 2DTIA 1W2BA 1GRIA 2EJGA 5GAN7 5GAN4 4KUDK 1OPKA 5CQYA 4JRKA 3C95A 3CPFA 1VQLT 5CKEA 3CCSA 1UEBA 1SHFA 2FPFA 1UGPB 1OEBA 2LRQA 2O4XA 3CBOA 4IKFA 3HL8A 1S1NA 3TREA 3FEOA 2GNCA 1VQPQ 3EGUA 3QHSA 4LDWA 4ZN1A 2RK2A 1TWBA 2FEIA 3OMGA 2FZKB 4J9DA 1HD3A 3PNWC 3JB9H 2DLPA 5EG2A 1GCPA 1Z9ZA 5GAMg 5LL6S 1TS9A 4JJDA 2VUBA 2VKNA 2OTLT 2PNIA 3NMZC 1I0CA 2GQVA 3EFOB 2KAFA 1FWZA 2FO0A 3HP9A 1ZA1B 1K9AA 1AT1B 2VB6A 3WXMB 3CEYA 3JB9I 4Z89A 2V26A 3M56A 3CC7Q 2XK0A 4M75D 3M9QA 1QP3A 2PU9B 2KI7A 3JAME 1SRMA 5J26A 2DFUA 1NLOC 1ZSGA 3VRZA 3VS2A 3G4SQ 2KT1A 4MMLA 4FW1A 2A0FB 1SKUB 1LNXA 3VUBA 3CCUA 4IIOA 4PKCC 3I56Q 2NUZA 4PJOD 4RTYA 2RPNA 1IGQA 1I5OB 4MDXA 3HRUA 4M75C 4XTVA 3NGPA 3CXCP 4C8QF 1KD1R 1G3SA 3QJ6A 1VQ7T 4OP0A 3EHQA 2VXEA 2M9UA 2JW4A 1IRXA 5GMKm 2FVUA 2DZ9A 5KYYB 3QO3A 2YUNA 1B7TA 4PJOC 2JTEA 1VQNA 2QAZA 3OYKA 3NTKA 2H3JA 3PMTA 2CP7A 1VQ5Q 2DD5A 3JCMh 2MPXC 1GFCA 2AZVA 2W10A 3MPUB 3LH0A 3OSSC 5CR2A 1VYVA 4KGVB 1FX7A 2DVJA 2SRCA 2O9VA 2DRMA 1KD1C 1M27C 2RQUA 2RI3A 5KYXA 2ZPHB 1TSFA 3EG9A 5FLXE 1YHQQ 1VQOA 4RTUA 4XTXA 3HKSA 1OOTA 3G6EA 1D0ZA 3V7RA 2IVWA 4M78A 1VQ9T 1PHTA 2KRMA 4WCIA 1IGUA 1UB4A 4OB3B 5J3BA 3M0TA 5GAOp 1JBMA 4ZGEB 4NL2A 2DZCA 1AWJA 2EYZA 2JJ9A 2C0TA 2V8JA 5CKBA 3FIFA 5GAN5 1KSWA 1PCXA 3NTHA 2P84A 2FRYA 1AWXA 3GIBA 4BACA 2FG0A 1U5SA 4JJBA 4C8QE 2KRSA 4C8QB 3TEEA 2ZPIB 2YLCA 4AFUC 1TG0A 1ZUYA 4D6WA 5AYFA 1QP2A 3QJYA 1S72A 2G6FX 2EFIA 3FB9A 2V8KA 1AD5A 3JRZA 2AKLA 3VYHB 5LJ3h 4J6XA 2RI5A 1M2VB 2DBMA 2BE7D 2XMFA 3QIIA 2DYIA 2BZYA 2LP5A 1H641 1SSFA 2RK1A 1QQJA
chains in the Genus database with same CATH topology
2DL5A 1CKBA 3ZL7C 4RTVA 1NG2A 1RI9A 1NM7A 2RN8A 2OAWA 3UATA 5IHKA 4AG2C 1Z9QA 2EPDA 4ESRA 2LX7A 1GCQC 2J7IA 3EG3A 3I9QA 1WXBA 3PVLA 1PRMC 2EYYA 5IXBA 1NYGA 1ABOA 2KGTA 2L3PA 4HCKA 3CQTA 1K0SA 1NEBA 3VS3A 4DEXA 2RQVA 4M4ZA 2I0NA 1RLQC 2F2VA 3TSWA 5IHNA 1BK2A 1AWWA 2CREA 4Z8AA 5FWBA 2J05A 4JZ3A 3FJ5A 1Y0MA 1WXUA 2DYBA 1AEYA 1IO6A 1PWTA 1KFZA 1QKWA 2LJ3A 2M0YA 3NPFA 4RTZA 1E6HA 1AWOA 1QKXA 2D8JA 3REAB 2DBKA 1MV0B 1FYNA 1B07A 3EG2A 2ROLA 2DMOA 1W70A 2OJ2A 2JS2A 1JXOA 5IXFA 2D0NA 1GCQA 1ZLMA 3PE0A 3QWXX 1M3BA 4FSSA 4IIMA 1T3LA 2C0OA 1A0NB 2O9SA 1ZBJA 1E6GA 2ABLA 4D8DA 1WIEA 1PKSA 1HJDA 1EFNA 2SEMA 3JV3A 1I07A 4RTTA 2JMCA 2KE9A 1GL5A 4AG1C 2O2OA 2BZ8A 1ZUKA 1GBRA 1BBZA 2RQRA 2VWFA 2C0IA 2FRWA 2F2WA 4AFZC 2DILA 1UECA 3C0CA 2KYBA 1V1CA 2YUQA 3SHWA 2K79A 1CKAA 2EVRA 1G83A 1UHCA 1YNZA 2GQIA 2EGCA 2DL3A 3EHRA 1M8MA 2LZ6B 4Z88A 1Y57A 1VA7A 2DL4A 3UA7A 4HVWA 4CC7A 2RQTA 2CT3A 2J6OA 1OV3A 2LNHB 4HVVA 4J9HA 2AZSA 2BZXA 2CUBA 2YDLA 2MOXA 1G2BA 1UJ0A 2DX1A 3VS1A 1RUWA 1NYFA 4OMNA 1UG1A 2DJQA 3VS0A 5IHIA 1QCFA 3VS7A 2HCKA 5IH2A 3SEMA 1N5ZA 2A36A 5L23A 4QT7A 2NWMA 1SHGA 2CH4A 2CSIA 2B86A 2IIMA 2DA9A 3M0UA 1T3SA 2AK5A 4F14A 4GLMA 2DRKA 4OMPA 2GTJA 1VYUA 1U3OA 1X2KA 2MIOA 4CC3A 2JT4A 2KXCA 2FPDA 3LH5A 1OPLA 4HVUA 2EYXA 2D8HA 1NLPC 4RTWA 3M0PA 1SPKA 2O31A 2ENMA 4LUDA 1ABQA 3I5RA 4OMQA 2KBTA 3TSZA 2HEQA 3H41A 1UUEA 4ORZA 2HDAA 1PRLC 5FW9A 3I5SA 3UA6A 2A37A 1BU1A 1H3HA 2GTOA 1WI7A 1WYXA 4J9BA 1SRLA 4CC4B 4JJCA 4R0KA 1XOVA 2EW3A 2O88A 2YSQA 2JM9A 3H0FA 1GRIA 4LUEA 1BB9A 1ZUUA 2EBPA 2KROA 2RNAA 1OPKA 1I1JA 1WXTA 1X6GA 2E5KA 1X27A 2OI3A 4E6RA 1SHFA 2EGAA 2KT8A 2FPFA 2DL8A 2H8HA 1OEBA 1SEMA 1X2QA 3IQLA 2DNUA 4X1VA 2F2XA 1T0HA 1S1NA 2RF0A 2GNCA 2K7AA 3EGUA 5ECAA 1H8KA 2FEIA 2LJ1A 3ULRB 2LQWA 2K3BA 3THKA 2PTKA 2X3WD 4EIKA 1KIKA 1NEGA 2J6FA 4J9DA 1YWPA 2EKHA 1HD3A 1H92A 1MV3A 2L3QA 2LMJA 2DLPA 1M3CA 1GCPA 1Z9ZA 1WLPB 4K11A 4JJDA 2GGRA 1W6XA 2VKNA 2CH4W 1PNJA 2PNIA 5I22A 2K2MA 2V1QA 2KNBB 1X69A 5HCKA 3NMZC 2CUDA 1I0CA 1UJYA 2DF6A 5GJWB 2AKKA 2GBQA 1K0XA 2CDTA 2M51A 4A63B 2A28A 2DM1A 2FO0A 3O5ZA 2JXBA 1MUZA 2DL7A 1J3TA 1UDLA 1GBQA 2J06A 3REBB 3M0RA 2KXDA 1AVZC 4ZNXA 2J6KA 4OMOA 1K9AA 5I11A 1CSKA 4JPBW 4Z89A 4J9FA 2KEAA 2W0ZA 1AOJA 2KYMA 1JQQA 4LE9A 2ROTA 1QLYA 1SRMA 1JU5C 1KJWA 4JZ4A 2HSPA 4F17A 1NLOC 1ZSGA 2ECZA 2X3XD 3RBBB 2LJ0A 3VRZA 3VS2A 2KT1A 2ED1A 2RQWA 3R6NA 1AZEA 4IIOA 1B3QA 2NUZA 2PZ1A 2RPNA 4RTYA 4CC2A 1E7OA 2YUPA 1M3AA 4J9IA 1ARKA 4GBQA 3NGPA 3U23A 1TUCA 3M0SA 2EQIA 2EGEA 5FWCA 3A98A 1U06A 1WA7A 4LNPA 3EHQA 3QWYA 2JW4A 2KRNA 1YWOA 2D1XA 2YUNA 4AFQC 1AZGB 2BTTA 1FMKA 2JTEA 2FPEA 2CT4A 1WX6A 1UE9A 1WFWA 1ZX6A 1UGVA 2RMOA 1T0JA 3TVTA 2CSQA 1GFDA 2L2PA 1GFCA 2AZVA 2W10A 3RNJA 1VYTA 2MCNA 2HBWA 2ED0A 3H0IA 1QWFA 1YP5A 1VYVA 1JEGA 3GBQA 4J9GA 2DVJA 2SRCA 2O9VA 4LN2A 2V1RA 2DRMA 1YN8A 4RTXA 3PVQA 3VS6A 1M27C 2RQUA 1M30A 4OMMA 3H0HA 1W1FA 3KFVA 2LQNA 4J9EA 3VRYA 4KRTA 4RTUA 4RUGA 1OOTA 2ESWA 1X6BA 2DE0X 1PHTA 2KRMA 2L3SA 5EC7A 4J9CA 4WCIA 1SSHA 1QWEA 2A08A 2KR3A 3VS5A 3EG0A 3M0QA 1K4US 2QDLA 2K6DA 4D8KA 1HSQA 1JO8A 3M0TA 1K76A 3I35A 1AWJA 2EYZA 2P4RA 2C0TA 2JS0A 1KSWA 3VS4A 4DEYA 2FRYA 2YT6A 2LCSA 2EYWA 1AWXA 2YUOA 2FG0A 1TUDA 1LCKA 2L0AA 1U5SA 4JJBA 2KRSA 2K9GA 1K1ZA 1UTIA 1WDXA 1YCSB 4HXJA 1PKTA 3NHNA 1UFFA 4AFUC 1TG0A 1ZUYA 4OMLA 2G6FX 1AD5A 3UF4A 2AKLA 1JXMA 4AFSC 1X43A 2JM8A 3EG1A 4F16A 4Y92A 2DBMA 5GJVB 2XMFA 2BZYA 2LP5A 1RLPC 2JMAA 1UHFA 2VVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DL5 A;  1CKB A;  3ZL7 C;  4RTV A;  1NG2 A;  1RI9 A;  1NM7 A;  2RN8 A;  2OAW A;  3UAT A;  5IHK A;  4AG2 C;  1Z9Q A;  2EPD A;  4ESR A;  2LX7 A;  1GCQ C;  2J7I A;  3EG3 A;  3I9Q A;  1WXB A;  3PVL A;  1PRM C;  2EYY A;  5IXB A;  1NYG A;  1ABO A;  2KGT A;  2L3P A;  4HCK A;  3CQT A;  1K0S A;  1NEB A;  3VS3 A;  4DEX A;  2RQV A;  4M4Z A;  2I0N A;  1RLQ C;  2F2V A;  3TSW A;  5IHN A;  1BK2 A;  1AWW A;  2CRE A;  4Z8A A;  5FWB A;  2J05 A;  4JZ3 A;  3FJ5 A;  1Y0M A;  1WXU A;  2DYB A;  1AEY A;  1IO6 A;  1PWT A;  1KFZ A;  1QKW A;  2LJ3 A;  2M0Y A;  3NPF A;  4RTZ A;  1E6H A;  1AWO A;  1QKX A;  2D8J A;  3REA B;  2DBK A;  1MV0 B;  1FYN A;  1B07 A;  3EG2 A;  2ROL A;  2DMO A;  1W70 A;  2OJ2 A;  2JS2 A;  1JXO A;  5IXF A;  2D0N A;  1GCQ A;  1ZLM A;  3PE0 A;  3QWX X;  1M3B A;  4FSS A;  4IIM A;  1T3L A;  2C0O A;  1A0N B;  2O9S A;  1ZBJ A;  1E6G A;  2ABL A;  4D8D A;  1WIE A;  1PKS A;  1HJD A;  1EFN A;  2SEM A;  3JV3 A;  1I07 A;  4RTT A;  2JMC A;  2KE9 A;  1GL5 A;  4AG1 C;  2O2O A;  2BZ8 A;  1ZUK A;  1GBR A;  1BBZ A;  2RQR A;  2VWF A;  2C0I A;  2FRW A;  2F2W A;  4AFZ C;  2DIL A;  1UEC A;  3C0C A;  2KYB A;  1V1C A;  2YUQ A;  3SHW A;  2K79 A;  1CKA A;  2EVR A;  1G83 A;  1UHC A;  1YNZ A;  2GQI A;  2EGC A;  2DL3 A;  3EHR A;  1M8M A;  2LZ6 B;  4Z88 A;  1Y57 A;  1VA7 A;  2DL4 A;  3UA7 A;  4HVW A;  4CC7 A;  2RQT A;  2CT3 A;  2J6O A;  1OV3 A;  2LNH B;  4HVV A;  4J9H A;  2AZS A;  2BZX A;  2CUB A;  2YDL A;  2MOX A;  1G2B A;  1UJ0 A;  2DX1 A;  3VS1 A;  1RUW A;  1NYF A;  4OMN A;  1UG1 A;  2DJQ A;  3VS0 A;  5IHI A;  1QCF A;  3VS7 A;  2HCK A;  5IH2 A;  3SEM A;  1N5Z A;  2A36 A;  5L23 A;  4QT7 A;  2NWM A;  1SHG A;  2CH4 A;  2CSI A;  2B86 A;  2IIM A;  2DA9 A;  3M0U A;  1T3S A;  2AK5 A;  4F14 A;  4GLM A;  2DRK A;  4OMP A;  2GTJ A;  1VYU A;  1U3O A;  1X2K A;  2MIO A;  4CC3 A;  2JT4 A;  2KXC A;  2FPD A;  3LH5 A;  1OPL A;  4HVU A;  2EYX A;  2D8H A;  1NLP C;  4RTW A;  3M0P A;  1SPK A;  2O31 A;  2ENM A;  4LUD A;  1ABQ A;  3I5R A;  4OMQ A;  2KBT A;  3TSZ A;  2HEQ A;  3H41 A;  1UUE A;  4ORZ A;  2HDA A;  1PRL C;  5FW9 A;  3I5S A;  3UA6 A;  2A37 A;  1BU1 A;  1H3H A;  2GTO A;  1WI7 A;  1WYX A;  4J9B A;  1SRL A;  4CC4 B;  4JJC A;  4R0K A;  1XOV A;  2EW3 A;  2O88 A;  2YSQ A;  2JM9 A;  3H0F A;  1GRI A;  4LUE A;  1BB9 A;  1ZUU A;  2EBP A;  2KRO A;  2RNA A;  1OPK A;  1I1J A;  1WXT A;  1X6G A;  2E5K A;  1X27 A;  2OI3 A;  4E6R A;  1SHF A;  2EGA A;  2KT8 A;  2FPF A;  2DL8 A;  2H8H A;  1OEB A;  1SEM A;  1X2Q A;  3IQL A;  2DNU A;  4X1V A;  2F2X A;  1T0H A;  1S1N A;  2RF0 A;  2GNC A;  2K7A A;  3EGU A;  5ECA A;  1H8K A;  2FEI A;  2LJ1 A;  3ULR B;  2LQW A;  2K3B A;  3THK A;  2PTK A;  2X3W D;  4EIK A;  1KIK A;  1NEG A;  2J6F A;  4J9D A;  1YWP A;  2EKH A;  1HD3 A;  1H92 A;  1MV3 A;  2L3Q A;  2LMJ A;  2DLP A;  1M3C A;  1GCP A;  1Z9Z A;  1WLP B;  4K11 A;  4JJD A;  2GGR A;  1W6X A;  2VKN A;  2CH4 W;  1PNJ A;  2PNI A;  5I22 A;  2K2M A;  2V1Q A;  2KNB B;  1X69 A;  5HCK A;  3NMZ C;  2CUD A;  1I0C A;  1UJY A;  2DF6 A;  5GJW B;  2AKK A;  2GBQ A;  1K0X A;  2CDT A;  2M51 A;  4A63 B;  2A28 A;  2DM1 A;  2FO0 A;  3O5Z A;  2JXB A;  1MUZ A;  2DL7 A;  1J3T A;  1UDL A;  1GBQ A;  2J06 A;  3REB B;  3M0R A;  2KXD A;  1AVZ C;  4ZNX A;  2J6K A;  4OMO A;  1K9A A;  5I11 A;  1CSK A;  4JPB W;  4Z89 A;  4J9F A;  2KEA A;  2W0Z A;  1AOJ A;  2KYM A;  1JQQ A;  4LE9 A;  2ROT A;  1QLY A;  1SRM A;  1JU5 C;  1KJW A;  4JZ4 A;  2HSP A;  4F17 A;  1NLO C;  1ZSG A;  2ECZ A;  2X3X D;  3RBB B;  2LJ0 A;  3VRZ A;  3VS2 A;  2KT1 A;  2ED1 A;  2RQW A;  3R6N A;  1AZE A;  4IIO A;  1B3Q A;  2NUZ A;  2PZ1 A;  2RPN A;  4RTY A;  4CC2 A;  1E7O A;  2YUP A;  1M3A A;  4J9I A;  1ARK A;  4GBQ A;  3NGP A;  3U23 A;  1TUC A;  3M0S A;  2EQI A;  2EGE A;  5FWC A;  3A98 A;  1U06 A;  1WA7 A;  4LNP A;  3EHQ A;  3QWY A;  2JW4 A;  2KRN A;  1YWO A;  2D1X A;  2YUN A;  4AFQ C;  1AZG B;  2BTT A;  1FMK A;  2JTE A;  2FPE A;  2CT4 A;  1WX6 A;  1UE9 A;  1WFW A;  1ZX6 A;  1UGV A;  2RMO A;  1T0J A;  3TVT A;  2CSQ A;  1GFD A;  2L2P A;  1GFC A;  2AZV A;  2W10 A;  3RNJ A;  1VYT A;  2MCN A;  2HBW A;  2ED0 A;  3H0I A;  1QWF A;  1YP5 A;  1VYV A;  1JEG A;  3GBQ A;  4J9G A;  2DVJ A;  2SRC A;  2O9V A;  4LN2 A;  2V1R A;  2DRM A;  1YN8 A;  4RTX A;  3PVQ A;  3VS6 A;  1M27 C;  2RQU A;  1M30 A;  4OMM A;  3H0H A;  1W1F A;  3KFV A;  2LQN A;  4J9E A;  3VRY A;  4KRT A;  4RTU A;  4RUG A;  1OOT A;  2ESW A;  1X6B A;  2DE0 X;  1PHT A;  2KRM A;  2L3S A;  5EC7 A;  4J9C A;  4WCI A;  1SSH A;  1QWE A;  2A08 A;  2KR3 A;  3VS5 A;  3EG0 A;  3M0Q A;  1K4U S;  2QDL A;  2K6D A;  4D8K A;  1HSQ A;  1JO8 A;  3M0T A;  1K76 A;  3I35 A;  1AWJ A;  2EYZ A;  2P4R A;  2C0T A;  2JS0 A;  1KSW A;  3VS4 A;  4DEY A;  2FRY A;  2YT6 A;  2LCS A;  2EYW A;  1AWX A;  2YUO A;  2FG0 A;  1TUD A;  1LCK A;  2L0A A;  1U5S A;  4JJB A;  2KRS A;  2K9G A;  1K1Z A;  1UTI A;  1WDX A;  1YCS B;  4HXJ A;  1PKT A;  3NHN A;  1UFF A;  4AFU C;  1TG0 A;  1ZUY A;  4OML A;  2G6F X;  1AD5 A;  3UF4 A;  2AKL A;  1JXM A;  4AFS C;  1X43 A;  2JM8 A;  3EG1 A;  4F16 A;  4Y92 A;  2DBM A;  5GJV B;  2XMF A;  2BZY A;  2LP5 A;  1RLP C;  2JMA A;  1UHF A;  2VVK A; 
#chains in the Genus database with same CATH topology
 2O4X B;  3G71 A;  2X35 A;  4EPC A;  4DBQ A;  4MZT A;  1M1G A;  2RN8 A;  2DET A;  3EFR A;  5IHK A;  1Z9Q A;  2CYZ B;  2EQM A;  2LCC A;  1GCQ C;  2J7I A;  2JOY A;  4QKU A;  3I9Q A;  1WHJ A;  1WXB A;  4PFP A;  4PFO A;  4MDW A;  2QQS A;  2QQR A;  2IPO B;  2KGT A;  3CQT A;  3EGX B;  4M78 E;  2K4Y A;  2X9H A;  4GY5 A;  4PLI A;  1C6V X;  1VQK Q;  2L8D A;  1HYO A;  4IUV A;  3MEA A;  5KCH A;  4HCZ A;  5FWB A;  2J05 A;  3CD6 T;  1WXU A;  2DYB A;  1IO6 A;  1KFZ A;  5GAN 3;  3CCJ T;  1WHM A;  1KK7 A;  4RTZ A;  2QTX A;  1G3Y A;  1YIJ A;  1M1K R;  3CME Q;  2DBK A;  5GAO q;  1Q82 U;  1DJ7 B;  2ROL A;  1OX8 A;  3SWN C;  2OJ2 A;  4EMK B;  1JXO A;  2OX7 A;  4J83 A;  4E7J A;  3QWX X;  4IIM A;  1I5L A;  4J7F A;  5KE3 A;  4C5G A;  2O9S A;  4N4I A;  1VQ8 T;  2E65 A;  4D8D A;  1WJS A;  4M7D G;  2JMC A;  2KQW A;  3SDZ A;  1GL5 A;  2BZ8 A;  3I56 A;  2VWF A;  1BI2 A;  2QXF A;  3E1S A;  2F2W A;  1QCN A;  4WTO B;  3I56 T;  3S6W A;  3RKX A;  1CKA A;  3E9F A;  3MP6 A;  1YJW T;  1VQN Q;  3PIP A;  3MCA B;  4EMK A;  3E19 A;  4QQ6 A;  5CKH A;  1Y57 A;  2GCX A;  1VA7 A;  4HVW A;  2RQT A;  3RES A;  1WHH A;  1D0X A;  2GFU A;  2LNH B;  1KQS P;  4DOW A;  3ZFJ A;  4OF1 A;  1G2B A;  2YWW A;  3QUI A;  2RH2 A;  5IHI A;  1QCF A;  3VS7 A;  3ASK A;  3DKM A;  3X26 B;  3SEM A;  3V8L A;  2JVV A;  4C8Q C;  1N8R R;  4QT7 A;  4KT0 E;  2NWM A;  3CMA A;  3UWN A;  1BI1 A;  2M02 A;  2V8I A;  1M4Z A;  1T3S A;  4N4H A;  4Y28 E;  3LX7 A;  4L5G A;  4OMP A;  4JS5 A;  3X24 B;  1VQK A;  3D7S B;  1YIJ T;  2NYS A;  2FPD A;  3M4G A;  2CZ6 B;  2EYX A;  1OU8 A;  2X4X A;  4FYY B;  2D8H A;  3OW2 P;  2DIQ A;  2KBT A;  4QW2 A;  3OYA A;  4ORZ A;  4E7L A;  1OQK A;  2X51 A;  2DJZ A;  2WSF E;  5DY9 A;  1VQ6 Q;  5LJ3 d;  3I5S A;  5GAN h;  2HAX A;  1LJO A;  1WYX A;  4JJC A;  4QVZ A;  4FYX B;  1M90 U;  2LNV A;  1ZUU A;  2EQJ A;  1WXT A;  4M7A G;  2MYS A;  3OQ5 A;  2EGA A;  4EMH A;  3MEW A;  1X2Q A;  1VQO Q;  3NTI A;  4X1V A;  5I2M A;  4R56 A;  2RF0 A;  1JJ2 P;  3SB2 A;  2MAM A;  3CCV A;  2DXB A;  2LJ1 A;  2XDP A;  2XD0 A;  2K3B A;  2PTK A;  3CCM A;  3A8H B;  1KIK A;  1YWP A;  3WVD B;  4C0D C;  5D6X A;  2CP3 A;  1M3C A;  3O8V A;  2RHU A;  2MF2 A;  4DBF A;  1WLP B;  1VQ4 Q;  3E2U A;  2OTJ T;  3JCM W;  4JRQ A;  4RG8 A;  2CUD A;  4J6W A;  2AKK A;  1K0X A;  3E9G A;  2E10 A;  4M7D A;  2JZ2 A;  1QMC A;  2DL7 A;  1UDL A;  5KCO A;  1GBQ A;  4EMG A;  1AVZ C;  2MK5 A;  4ZNX A;  3GP8 A;  2J6K A;  4OMO A;  1WHL A;  2RJF A;  4C0G A;  2KEA A;  2W0Z A;  3BE3 A;  2BUD A;  2JTM A;  1JQQ A;  4LE9 A;  5LJ3 f;  3PGG A;  4CI0 C;  1QLY A;  4OGE A;  2QAS A;  2RHX A;  4II1 A;  1KD1 U;  4IUU A;  3M54 A;  4JZ4 A;  2HSP A;  4JDS A;  1VQ5 A;  2X3X D;  3MET A;  4L59 A;  3RBB B;  1BCO A;  2ED1 A;  1Y71 A;  2F5T X;  1BIA A;  3R6N A;  1RAA B;  3INZ A;  1WGS A;  2L3R A;  1N8R U;  4XU1 A;  5GAO m;  4CC2 A;  2CZ1 B;  1ARK A;  1VQ7 A;  1RAG B;  4GBQ A;  4C92 B;  1D0Y A;  3MKD A;  4C92 E;  2LC4 A;  3LLR A;  2EGE A;  4M77 E;  2E6Z A;  1ZSZ B;  3R6O A;  3CCS T;  1WA7 A;  5GMK j;  4FSX A;  3OY9 A;  3OYD A;  3A8L B;  4XTW A;  4FL6 A;  3EGD B;  1TUG B;  2H3E B;  4AFQ C;  1YJ9 A;  1FMK A;  4E7H A;  5FU6 B;  1WFW A;  3KUF A;  1D3B A;  1UGV A;  2COY A;  1Q7Y R;  5GAM d;  4RKU E;  4HT8 A;  1N8R C;  3AT1 B;  2MCN A;  3OW2 S;  4XTU A;  4N0A C;  2DXU A;  1QWF A;  1YP5 A;  1UGR B;  1JJ2 S;  3LGF A;  4M77 G;  1U8R A;  2M16 A;  5A0G A;  2XIC A;  4PJO G;  5CVI A;  3PVQ A;  3VS6 A;  3OMC A;  1Q86 C;  3H0H A;  5GAO n;  2K3X A;  2CP2 A;  4KRT A;  4E7I A;  3Q1J A;  3SD4 A;  4RUG A;  4FT4 A;  5GAN e;  4PJN A;  2WAC A;  2RHZ A;  3SWN B;  1X6B A;  2L89 A;  2EQU A;  2QA4 Q;  1HK9 A;  1SF9 A;  1M1K U;  1SSH A;  3C12 A;  4M7D F;  3EG0 A;  4FM4 B;  2K6D A;  3OS5 A;  4D8K A;  2QI2 A;  4CRI A;  5KYX B;  4M75 G;  1Q81 U;  1JO8 A;  1RAE B;  2QEX T;  3I35 A;  2P4R A;  5IT9 E;  2E41 A;  2NLU A;  2ZPF B;  2JS0 A;  1TXQ A;  4MZP A;  3CPW S;  3T9N A;  3I55 A;  2QEX A;  2EYW A;  4B9X A;  2HQE A;  3RKY A;  3G4S A;  2VGM A;  1LCK A;  4PL6 A;  2K9G A;  1WDX A;  5M9O A;  4AT1 B;  1PKT A;  3NHN A;  1UGQ B;  1B34 A;  2XKO C;  2VGN A;  1VQN T;  1JXM A;  2JM8 A;  1YI2 A;  2YRC A;  2K3Y A;  3OYG A;  5GJV B;  2VAS A;  2F5K A;  3EH2 A;  2RD1 A;  4M78 B;  1VQ5 T;  4C8Q D;  3GNG A;  1PM3 A;  3EGD A;  3RMS A;  4M77 C;  3FLG A;  4J6Y A;  2EWN A;  1WJR A;  1CKB A;  1VQ9 A;  3PMI A;  3ZL7 C;  3A8O B;  4RTV A;  1NG2 A;  1Q81 R;  1VQP T;  2HD0 A;  2QEX Q;  2BIV A;  1R0B G;  4FT2 A;  3UAT A;  1BIB A;  4AG2 C;  4E47 A;  2DO3 A;  4ESR A;  1YI2 T;  3CCR Q;  4PJO F;  3J81 E;  3JB9 G;  2RJC A;  2E64 A;  3CCE Q;  5LJ5 f;  2MMP A;  1MMG A;  3L42 A;  5IXB A;  1NYG A;  4M77 D;  2D0Q B;  1K0S A;  5KYU A;  1NEB A;  5GAN f;  2PVO B;  3VS3 A;  3OYL A;  3MEU A;  2RQV A;  2YRD A;  2L5Q A;  5GAM h;  2I0N A;  3OYI A;  1RLQ C;  1AWW A;  3EGX A;  1C1A A;  4F7U A;  3X28 B;  3CME T;  5GMK l;  1VQ8 A;  1KG1 A;  3FJ5 A;  4X34 A;  5D6Y A;  1Y0M A;  3CCS Q;  2DTH A;  1AEY A;  2LJ3 A;  2M0Y A;  1E6H A;  1M2V A;  1AWO A;  3RR6 A;  2D8J A;  1G3W A;  4PK4 A;  1FXX A;  5CK9 A;  1Q7Y U;  4BI3 A;  1YCY A;  2DMO A;  2OAU A;  5FRO A;  4C92 C;  5IXF A;  3SFM A;  4FSS A;  1M3B A;  4BI4 A;  4BB7 A;  3S3N A;  1A0N B;  4M75 B;  4Q5W A;  1M8V A;  3DB3 A;  3EG9 B;  3V7C A;  3JCM J;  3HHT B;  1VQ4 A;  2P0Q A;  2SEM A;  1I07 A;  4RTT A;  2JTF A;  4A4F A;  2O2O A;  3OB9 A;  2HQX A;  1BBZ A;  1U1S A;  2Y4Y A;  2C0I A;  4PJM A;  3OYE A;  4DOV A;  4LDU A;  3URG A;  1XJW B;  4AFZ C;  8AT1 B;  3L2Q A;  2E3I A;  4C92 D;  1V1C A;  6AT1 B;  1Q86 U;  3VKI A;  1NE8 A;  1IB8 A;  3OA6 A;  1YJN T;  1K9M C;  1EZZ B;  1NBE B;  1AHJ B;  1UHC A;  4BE1 A;  1FMV A;  2DL3 A;  4E7S A;  3G71 T;  4PJL A;  1VOM A;  1K8A R;  2AZS A;  2BZX A;  3QZ5 B;  5LJ3 e;  2XDB A;  2DJQ A;  3H6Z A;  3P8H A;  2HCK A;  3G7Z A;  3TQ7 P;  1N5Z A;  2A36 A;  2QK0 A;  2E5Q A;  2QDY B;  2I2L A;  5C6S A;  1Q82 C;  1BKB A;  2IIM A;  4XK8 E;  4A53 A;  2DTO A;  4JLI A;  1YBY A;  4GLM A;  2DRK A;  4Y91 A;  4FYV B;  2GTJ A;  3GF5 A;  3TCJ A;  1X2K A;  2LX9 A;  2MIO A;  4M78 C;  2JT4 A;  1YJ9 T;  2EAY A;  3CCJ A;  2KXC A;  1OPL A;  2IG0 A;  1VQ4 T;  2DVE A;  1OYX A;  4GLK A;  4RTW A;  3M0P A;  1SPK A;  2O31 A;  4KGX B;  5A0L A;  1ABQ A;  2RI2 A;  4XU2 A;  4OMQ A;  4M7D D;  2XDD A;  1UUE A;  2FZC B;  3SWN A;  2K2V A;  5IAY A;  4E7Z A;  4CC4 B;  3M53 A;  4M78 D;  4R0K A;  3V8K A;  3BFM A;  2EW3 A;  2O88 A;  1I8F A;  2CP0 A;  3RIR A;  5I21 A;  2P0K A;  1BB9 A;  2EBP A;  2ZZD A;  1I1J A;  1KC8 R;  1X6G A;  2E70 A;  2E5K A;  2OI3 A;  2PVD B;  3OSV A;  2DL8 A;  1YFN A;  2NUP B;  1SEM A;  3IQL A;  1LPL A;  2F2X A;  4M77 F;  5GAN g;  4V2S A;  1ACM B;  3CCM T;  4PJJ A;  1ZA2 B;  2GFA A;  2FZG B;  3THK A;  1ZSZ A;  4EMK C;  2DK3 A;  1QVG S;  2X3W D;  2J6F A;  5A0D A;  3OYY A;  1MV3 A;  1RL2 A;  2L3Q A;  2LMJ A;  4HCB A;  3L1A A;  2DER A;  2R5M A;  2NUT B;  3M5A A;  1OUL A;  5I22 A;  2V1Q A;  1X69 A;  5HCK A;  2NUT A;  3CMA T;  1UJY A;  2DF6 A;  5GJW B;  2DD4 A;  2CDT A;  2M51 A;  4A63 B;  2A28 A;  2X4Y A;  3O5Z A;  2JXB A;  1J3T A;  2HBP A;  3M0R A;  2KXD A;  5LJ5 e;  2DAQ A;  1NJI C;  4C5E A;  4XQ3 A;  4DBH A;  5I11 A;  1XNI A;  4O5V A;  3ER0 A;  2XI9 A;  3N5B B;  4KH1 B;  5LJ3 j;  2ROT A;  3A8M B;  1JU5 C;  2QQB A;  2VYT A;  3ME9 A;  3QBY A;  4F17 A;  1GXI E;  2CZ0 B;  4C5H A;  2QG9 B;  4JUV A;  4JLG A;  5A2Q E;  5J39 A;  1AZE A;  5DLO A;  1ZQ1 A;  3ZBD A;  4M7A B;  2PZ1 A;  2YUP A;  1M3A A;  2RA2 A;  3EAE A;  1OI1 A;  3U23 A;  2RB6 A;  1TUC A;  1WZO A;  3M0S A;  4LDX A;  1JRI A;  1YJW A;  1RAC B;  1MMN A;  2E1H A;  5FWC A;  3A98 A;  3OW2 A;  1U06 A;  3KBG A;  3RUX A;  3CC2 A;  4LNP A;  3M55 A;  2E12 A;  3CCJ Q;  3CD6 Q;  3M4Y A;  2LT4 A;  3LGL A;  1VQ9 Q;  1QVF S;  2D1X A;  4BI8 B;  2BTT A;  3ZEH A;  1LOJ A;  2CT4 A;  1WX6 A;  2FYK A;  1P92 A;  1H3Z A;  2QTV A;  1T0J A;  1TOV A;  5CO7 A;  3H8Z A;  3HFO A;  3TVT A;  3LWH A;  5FRN A;  4J7I A;  3KXT A;  2ED0 A;  3H0I A;  1JEG A;  3QXE B;  4M7D E;  4J9G A;  4BY6 B;  1N9S A;  1R8O B;  3HRS A;  1K8A C;  3JCM g;  1X01 A;  3MP8 A;  2V1R A;  1WJQ A;  5AT1 B;  1YN8 A;  2RO0 A;  4RTX A;  4C5I A;  4YTL A;  1M30 A;  4OGC A;  2ZAE A;  4OMM A;  1W1F A;  3VRY A;  3BDU A;  1BI0 A;  2OTJ A;  2KVQ G;  4XAX B;  3OYN A;  2DE0 X;  3HSB A;  5EC7 A;  1RAD B;  4J9C A;  1N6A A;  1MND A;  2A08 A;  2KR3 A;  4PNO A;  3M0Q A;  1I4K 1;  4C0Z A;  4UC4 A;  4ZTF A;  1MMD A;  1K76 A;  4RG2 A;  4FIB A;  1HXD A;  1QVG P;  4QVD A;  1D1C A;  4DEY A;  2YT6 A;  2LCS A;  3QYH B;  3OYF A;  4LDV A;  1KHI A;  2L0A A;  1O9S A;  4X9C A;  5LJ3 g;  3VYG A;  1K1Z A;  1MNE A;  1O75 A;  4HXJ A;  1UFF A;  4ZGD B;  3HRT A;  4OML A;  2A7Y A;  1NZ9 A;  1I81 A;  2C06 A;  5CIU A;  4F16 A;  3EG1 A;  4KH0 B;  2K5L A;  1K73 C;  2Z0W A;  4DA4 A;  2MWP A;  2G3R A;  1VQL Q;  3L2Z A;  2JMA A;  2FL7 A;  3EH1 A;  2DXC A;  3CBM A;  3JB9 F;  1LVK A;  1QVP A;  1NM7 A;  2DEU A;  3BDL A;  3CCM Q;  2LQ8 A;  1KQS A;  2EPD A;  4BUG A;  2JN0 A;  2LX7 A;  3EG3 A;  5CQX A;  4XTY A;  4BE2 A;  3A1P A;  1NJI R;  1PRM C;  4HCK A;  4KUI A;  5GAN j;  1K9M U;  4XTZ A;  3CC4 T;  3CCQ Q;  4E2F B;  1UGS B;  4M4Z A;  4M7D C;  7AT1 B;  4J5Y A;  3JCM b;  1OZ2 A;  1SG5 A;  2CRE A;  3FRN A;  3J80 E;  4JZ3 A;  5GAO r;  1K73 R;  2EQK A;  3GOX A;  1YIT Q;  3GLX A;  1M5Q 1;  4KUL A;  4J8O A;  1QKX A;  3VJP A;  3CCV T;  1Y07 A;  3REA B;  4M7A C;  3M58 A;  1B07 A;  1Q7Y C;  1QVF P;  1TTH B;  2D9T A;  1W70 A;  1VQ6 A;  2JS2 A;  3CCQ T;  2LT1 A;  4ELZ C;  2KK4 A;  3PE0 A;  3JCM V;  1FMW A;  1G3T A;  1E6G A;  4QVC A;  1WIE A;  1PKS A;  2JUF A;  2KE9 A;  1M2O A;  1Q81 C;  1ZUK A;  1GBR A;  2RQR A;  2QA4 T;  4M7A D;  4OMF B;  1VQK T;  3CC7 T;  5HK3 A;  1UEC A;  3JCM P;  3A8G B;  1W2B P;  1MMA A;  3FJP A;  2B8A A;  3CD6 A;  2EKO A;  3SHW A;  3J7A F;  1VIE A;  5LJ5 g;  4PJO B;  3CC2 Q;  2EVR A;  2XU8 A;  1G83 A;  2MWO A;  3QKJ A;  1YNZ A;  3EHR A;  5FU7 B;  1M8M A;  2M0O A;  1W4S A;  2LZ6 B;  4M75 E;  4Z88 A;  1K73 U;  3UA7 A;  2DL4 A;  4CC7 A;  1BYM A;  3BW1 A;  4M77 A;  2CT3 A;  4LXC A;  1OV3 A;  3FDR A;  4OB2 B;  5GAM j;  3G71 Q;  3HFN A;  4J9H A;  4BDZ A;  2YDL A;  2CUB A;  1K9M R;  1UJ0 A;  2RM4 A;  3EFS A;  2DX1 A;  4IUP A;  3VS1 A;  1NYF A;  3CPW P;  1NJI U;  3VU3 C;  4N0A A;  4RMO A;  2O01 E;  3PFS A;  2M1H A;  1SHG A;  1XQH A;  2CSI A;  2B86 A;  1QVG A;  2ZPE B;  4PFZ A;  2AK5 A;  4F14 A;  3G6E Q;  2VV5 A;  2VC8 A;  2P4T A;  3C4S A;  4C92 G;  1KQS S;  1U3O A;  2HMA A;  2ZCF B;  3LH5 A;  1R77 A;  3VV0 A;  5KYN A;  4WF2 A;  2AHJ B;  1MGQ A;  5GMK h;  3CCL Q;  4RCC A;  4L6V 5;  3CCV Q;  4M77 B;  2OTL A;  1RAB B;  1PRL C;  4BD3 A;  3MJX A;  4X9D A;  5FW9 A;  2EIF A;  4C92 A;  1BU1 A;  1X6O A;  1ZBX A;  1H3H A;  2GTO A;  5KYW B;  2DPP B;  1WI7 A;  3V7S A;  1RAI B;  4M75 A;  3I55 Q;  3DB4 A;  1XOV A;  2HKQ B;  2XHC A;  2EJ9 A;  2MI6 A;  1WNL A;  3CC4 Q;  1S72 Q;  2JM9 A;  2LVM A;  3H0F A;  4LUE A;  3JCM e;  5GMK e;  2KRO A;  2RNA A;  4FYW B;  3CBP A;  5HKC A;  1X27 A;  2YRV A;  4E6R A;  2KT8 A;  4LDY A;  3CCR T;  2H8H A;  1TH7 A;  2DNU A;  4M75 F;  3NFC A;  1PC0 A;  1T0H A;  3JCM f;  2R58 A;  1NPR A;  2K7A A;  3CCL A;  1Q95 G;  5ECA A;  5FU7 C;  1H8K A;  1D1B A;  2QA4 A;  3C94 A;  1B34 B;  3ULR B;  2OTL Q;  2LQW A;  3OYB A;  2DIG A;  4EIK A;  1NEG A;  1U1T A;  2ATC B;  2EKH A;  1H92 A;  2FB7 A;  1Y96 B;  2ZPB B;  2YHT A;  4OB1 B;  2PUO B;  1PD0 A;  2DXT A;  4NL3 A;  1V76 A;  4K11 A;  3QZ9 B;  1IHW A;  3G4S T;  3JB9 J;  2GGR A;  1W6X A;  1VQM A;  2CH4 W;  1PNJ A;  2AT1 B;  2K2M A;  3DLM A;  2KNB B;  4O6J A;  4VUB A;  2AIR B;  3GPL A;  1KQ2 A;  5GMK i;  3HPW A;  1KHC A;  2GBQ A;  5HY6 A;  5GAN 2;  4M7A F;  4QQD A;  2DM1 A;  3CMA Q;  1MUZ A;  2J06 A;  3REB B;  4B6M A;  2LQK A;  5CKD A;  2KY9 A;  2PVG B;  2YLB A;  1TU0 B;  4MZM A;  4M7A E;  3OS1 A;  3CC2 T;  3UPU A;  1CSK A;  4IUQ A;  5KYY A;  4JPB W;  2DKG A;  8ATC B;  3V8J A;  4J9F A;  3CME A;  5LJ5 h;  2E4H A;  1AOJ A;  2QGG A;  1VQL A;  2KYM A;  5CAI A;  5D7U A;  4F7U E;  3RMQ A;  3OS2 A;  1M90 C;  4ANJ A;  1KJW A;  3UDC A;  1D09 B;  1YIT T;  4KGZ B;  3RER A;  2COZ A;  5LJ5 j;  5CKF A;  2ECZ A;  2P0P A;  4ZN3 A;  2LJ0 A;  4F7U F;  3JCM X;  5C0M A;  3EFO A;  2RQW A;  1M9S A;  1B3Q A;  4JJN K;  1E7O A;  2RHY A;  2HL3 A;  4J9I A;  3FC3 A;  4NOY A;  3BY7 A;  4ZGJ B;  1OU9 A;  2EQI A;  3P8B B;  4ELY C;  2LTO A;  4N4G A;  5GAN 6;  3QWY A;  2F69 A;  1WQW A;  2HSE B;  5DLQ E;  3X25 B;  1VQ8 Q;  2KRN A;  5GAM f;  4A4H A;  1YWO A;  2PUK B;  2PQW A;  3UT1 A;  1AZG B;  3QPH A;  2FPE A;  1ZX6 A;  1UE9 A;  3OYC A;  3OYM A;  1VQP A;  3QG1 A;  2R5A A;  1S72 T;  3PIO A;  2RMO A;  2HQH A;  1WHG A;  1GFD A;  2CSQ A;  1BI3 A;  4OB0 B;  2L2P A;  3CPW A;  1ZSZ C;  4MMK A;  3RNJ A;  1VYT A;  1EIF A;  2QQA A;  2HBW A;  4PLL A;  3I55 T;  4BDY A;  3GBQ A;  2ZPG B;  4LD9 K;  4TVR A;  3CCQ A;  4LN2 A;  4P5N A;  3DLL A;  2LCL A;  2RJE A;  4EDU A;  3KFV A;  2LQN A;  4J9E A;  5IN1 A;  3PT9 A;  3JCM c;  2BKD N;  2CKK A;  2ESW A;  1VQM T;  2WSC E;  1IHV A;  1OZ3 A;  1YI2 Q;  2KMT A;  2L3S A;  4PJO A;  5D6W A;  3MP1 A;  5FRM A;  5KH6 A;  5KYU B;  1QWE A;  2HZY A;  3VS5 A;  3G6E T;  1R0C B;  1ZHI A;  1K4U S;  2QDL A;  3LYI A;  1HSQ A;  4F7U G;  2Y4X A;  1W2B S;  1KC8 U;  3A5Z B;  4M78 F;  5GAM e;  3JCM Q;  1G5V A;  3WVE B;  2CZ7 B;  1JB0 E;  1YJN Q;  2K57 A;  3VUZ A;  4QQG A;  3VS4 A;  1VUB A;  3G1J A;  2YUO A;  4IUT A;  1TUD A;  3AHU A;  3L2R A;  2RHI A;  2EJF A;  1UTI A;  1YCS B;  3CCU Q;  5L8R E;  3P8D A;  2KDS A;  3PTA A;  3JSC A;  2COW A;  4HA8 A;  3JCM d;  1VQO T;  3CC4 A;  2DEQ A;  2BE9 B;  5CCA A;  2LDM A;  1QCO A;  4C0F A;  4ATO A;  3UF4 A;  4A4K A;  4AFS C;  1X43 A;  3CCU T;  2QYZ A;  2WSE E;  4Y92 A;  4HT9 A;  1RAH B;  1VIF A;  4XU3 A;  4Z02 A;  1RI0 A;  1RLP C;  1UHF A;  4IUR A;  2VVK A;  1YIT A;  3GNF B;  3LWI A;  2DL5 A;  2A3L A;  1M90 R;  3L2U A;  2CP6 A;  1RI9 A;  4M7D B;  4M7A A;  1IXD A;  1XTD A;  1M1K C;  3QDR B;  2NUP A;  2OAW A;  1F1B B;  4C8Q A;  2E3H A;  4FCY A;  9ATC B;  3PVL A;  3S3M A;  3L2W A;  2XID A;  3M57 A;  2EYY A;  1ABO A;  4HKE A;  2L3P A;  2JNG A;  5KE2 A;  1N9R A;  2GF7 A;  4DEX A;  3CCE T;  1K8A U;  2HNI A;  5LJ5 d;  4KBM B;  4C0D B;  2F2V A;  3TSW A;  5IHN A;  1BK2 A;  3QYG B;  4Z8A A;  1IRE B;  2D6F A;  4DQ2 A;  3CXC S;  1PWT A;  5GAN 8;  1QKW A;  3NPF A;  4XU0 A;  4JRI A;  3RKW A;  4E7K A;  4JRP A;  1VQ6 T;  1Y7X A;  1BCM A;  3M59 A;  1MV0 B;  1FYN A;  3CC7 A;  1Q86 R;  3EG2 A;  4R55 A;  2CS7 A;  1PSE A;  2D0N A;  1GCQ A;  1M1F A;  1ZLM A;  2HL5 C;  1T3L A;  2C0O A;  1KQ1 A;  5I2S A;  1JJ2 A;  1V29 B;  2QQ9 A;  2F1L A;  1ZBJ A;  2X4W A;  2ABL A;  1PD1 A;  1HJD A;  1EFN A;  1WHK A;  2K5I A;  1KC8 C;  3OS0 A;  2CGH A;  3JV3 A;  4C92 F;  1VQ7 Q;  1OX9 A;  4AG1 C;  1RAF B;  2E6N A;  1IZ6 A;  1YJW Q;  2FRW A;  1Y96 A;  4ZTJ A;  4B9W A;  4A54 A;  3CCL T;  2OTJ Q;  2DIL A;  1X75 C;  2EYQ A;  3C0C A;  4ME7 A;  4M78 G;  2KYB A;  3HTR A;  2YUQ A;  2HKN A;  2K79 A;  1YJ9 Q;  1WQ7 A;  2KSS A;  2FHD A;  2ZGW A;  1EX4 A;  1NPP A;  4A4G A;  2GQI A;  2EGC A;  3OYH A;  4FW2 A;  1MHN A;  3QSU A;  2J6O A;  2X4J A;  4HVV A;  5HK0 A;  5FU6 C;  4BY6 C;  2MOX A;  1N27 A;  2R57 A;  3CXC A;  4NS5 A;  3MHX A;  3S3O A;  1QW1 A;  1RUW A;  3OBY A;  4OMN A;  1UG1 A;  3H9N A;  3VS0 A;  4AMC A;  2YXY A;  1YHQ T;  4LD6 A;  3JB9 D;  4RCB A;  5IH2 A;  5DM7 R;  3QDF A;  4DBR A;  5L23 A;  1Q82 R;  5KYW A;  4PJO E;  2QGF B;  4A4E A;  2CP5 A;  2CH4 A;  5GAO l;  1YHQ A;  1PSF A;  3RDV A;  2DA9 A;  3M0U A;  4FU6 A;  3LW5 E;  2RJD A;  4JS4 A;  2VXF A;  2XG8 D;  1PG5 B;  4OVA A;  5GAN d;  4BE0 A;  4C8Q G;  1VYU A;  4CC3 A;  3OBW A;  3L2V A;  4HVU A;  4HCC A;  1QVF A;  3TU4 K;  1NLP C;  1YIJ Q;  2ENM A;  3MO8 A;  4LUD A;  3I5R A;  1YJN A;  3TSZ A;  2HEQ A;  3H41 A;  2HDA A;  3CCR A;  2Y90 A;  3OYJ A;  1C0M A;  3CCE A;  3UA6 A;  2A37 A;  4F7U B;  3F70 A;  1G8X A;  1D3B B;  4J9B A;  1SRL A;  3MEV A;  1VQM Q;  1WPY A;  4F04 B;  3X20 B;  2YSQ A;  1D1A A;  2K5F A;  2DTI A;  1W2B A;  1GRI A;  2EJG A;  5GAN 7;  5GAN 4;  4KUD K;  1OPK A;  5CQY A;  4JRK A;  3C95 A;  3CPF A;  1VQL T;  5CKE A;  3CCS A;  1UEB A;  1SHF A;  2FPF A;  1UGP B;  1OEB A;  2LRQ A;  2O4X A;  3CBO A;  4IKF A;  3HL8 A;  1S1N A;  3TRE A;  3FEO A;  2GNC A;  1VQP Q;  3EGU A;  3QHS A;  4LDW A;  4ZN1 A;  2RK2 A;  1TWB A;  2FEI A;  3OMG A;  2FZK B;  4J9D A;  1HD3 A;  3PNW C;  3JB9 H;  2DLP A;  5EG2 A;  1GCP A;  1Z9Z A;  5GAM g;  5LL6 S;  1TS9 A;  4JJD A;  2VUB A;  2VKN A;  2OTL T;  2PNI A;  3NMZ C;  1I0C A;  2GQV A;  3EFO B;  2KAF A;  1FWZ A;  2FO0 A;  3HP9 A;  1ZA1 B;  1K9A A;  1AT1 B;  2VB6 A;  3WXM B;  3CEY A;  3JB9 I;  4Z89 A;  2V26 A;  3M56 A;  3CC7 Q;  2XK0 A;  4M75 D;  3M9Q A;  1QP3 A;  2PU9 B;  2KI7 A;  3JAM E;  1SRM A;  5J26 A;  2DFU A;  1NLO C;  1ZSG A;  3VRZ A;  3VS2 A;  3G4S Q;  2KT1 A;  4MML A;  4FW1 A;  2A0F B;  1SKU B;  1LNX A;  3VUB A;  3CCU A;  4IIO A;  4PKC C;  3I56 Q;  2NUZ A;  4PJO D;  4RTY A;  2RPN A;  1IGQ A;  1I5O B;  4MDX A;  3HRU A;  4M75 C;  4XTV A;  3NGP A;  3CXC P;  4C8Q F;  1KD1 R;  1G3S A;  3QJ6 A;  1VQ7 T;  4OP0 A;  3EHQ A;  2VXE A;  2M9U A;  2JW4 A;  1IRX A;  5GMK m;  2FVU A;  2DZ9 A;  5KYY B;  3QO3 A;  2YUN A;  1B7T A;  4PJO C;  2JTE A;  1VQN A;  2QAZ A;  3OYK A;  3NTK A;  2H3J A;  3PMT A;  2CP7 A;  1VQ5 Q;  2DD5 A;  3JCM h;  2MPX C;  1GFC A;  2AZV A;  2W10 A;  3MPU B;  3LH0 A;  3OSS C;  5CR2 A;  1VYV A;  4KGV B;  1FX7 A;  2DVJ A;  2SRC A;  2O9V A;  2DRM A;  1KD1 C;  1M27 C;  2RQU A;  2RI3 A;  5KYX A;  2ZPH B;  1TSF A;  3EG9 A;  5FLX E;  1YHQ Q;  1VQO A;  4RTU A;  4XTX A;  3HKS A;  1OOT A;  3G6E A;  1D0Z A;  3V7R A;  2IVW A;  4M78 A;  1VQ9 T;  1PHT A;  2KRM A;  4WCI A;  1IGU A;  1UB4 A;  4OB3 B;  5J3B A;  3M0T A;  5GAO p;  1JBM A;  4ZGE B;  4NL2 A;  2DZC A;  1AWJ A;  2EYZ A;  2JJ9 A;  2C0T A;  2V8J A;  5CKB A;  3FIF A;  5GAN 5;  1KSW A;  1PCX A;  3NTH A;  2P84 A;  2FRY A;  1AWX A;  3GIB A;  4BAC A;  2FG0 A;  1U5S A;  4JJB A;  4C8Q E;  2KRS A;  4C8Q B;  3TEE A;  2ZPI B;  2YLC A;  4AFU C;  1TG0 A;  1ZUY A;  4D6W A;  5AYF A;  1QP2 A;  3QJY A;  1S72 A;  2G6F X;  2EFI A;  3FB9 A;  2V8K A;  1AD5 A;  3JRZ A;  2AKL A;  3VYH B;  5LJ3 h;  4J6X A;  2RI5 A;  1M2V B;  2DBM A;  2BE7 D;  2XMF A;  3QII A;  2DYI A;  2BZY A;  2LP5 A;  1H64 1;  1SSF A;  2RK1 A;  1QQJ A; 
#chains in the Genus database with same CATH homology
 2DL5 A;  1CKB A;  3ZL7 C;  4RTV A;  1NG2 A;  1RI9 A;  1NM7 A;  2RN8 A;  2OAW A;  3UAT A;  5IHK A;  4AG2 C;  1Z9Q A;  2EPD A;  4ESR A;  2LX7 A;  1GCQ C;  2J7I A;  3EG3 A;  3I9Q A;  1WXB A;  3PVL A;  1PRM C;  2EYY A;  5IXB A;  1NYG A;  1ABO A;  2KGT A;  2L3P A;  4HCK A;  3CQT A;  1K0S A;  1NEB A;  3VS3 A;  4DEX A;  2RQV A;  4M4Z A;  2I0N A;  1RLQ C;  2F2V A;  3TSW A;  5IHN A;  1BK2 A;  1AWW A;  2CRE A;  4Z8A A;  5FWB A;  2J05 A;  4JZ3 A;  3FJ5 A;  1Y0M A;  1WXU A;  2DYB A;  1AEY A;  1IO6 A;  1PWT A;  1KFZ A;  1QKW A;  2LJ3 A;  2M0Y A;  3NPF A;  4RTZ A;  1E6H A;  1AWO A;  1QKX A;  2D8J A;  3REA B;  2DBK A;  1MV0 B;  1FYN A;  1B07 A;  3EG2 A;  2ROL A;  2DMO A;  1W70 A;  2OJ2 A;  2JS2 A;  1JXO A;  5IXF A;  2D0N A;  1GCQ A;  1ZLM A;  3PE0 A;  3QWX X;  1M3B A;  4FSS A;  4IIM A;  1T3L A;  2C0O A;  1A0N B;  2O9S A;  1ZBJ A;  1E6G A;  2ABL A;  4D8D A;  1WIE A;  1PKS A;  1HJD A;  1EFN A;  2SEM A;  3JV3 A;  1I07 A;  4RTT A;  2JMC A;  2KE9 A;  1GL5 A;  4AG1 C;  2O2O A;  2BZ8 A;  1ZUK A;  1GBR A;  1BBZ A;  2RQR A;  2VWF A;  2C0I A;  2FRW A;  2F2W A;  4AFZ C;  2DIL A;  1UEC A;  3C0C A;  2KYB A;  1V1C A;  2YUQ A;  3SHW A;  2K79 A;  1CKA A;  2EVR A;  1G83 A;  1UHC A;  1YNZ A;  2GQI A;  2EGC A;  2DL3 A;  3EHR A;  1M8M A;  2LZ6 B;  4Z88 A;  1Y57 A;  1VA7 A;  2DL4 A;  3UA7 A;  4HVW A;  4CC7 A;  2RQT A;  2CT3 A;  2J6O A;  1OV3 A;  2LNH B;  4HVV A;  4J9H A;  2AZS A;  2BZX A;  2CUB A;  2YDL A;  2MOX A;  1G2B A;  1UJ0 A;  2DX1 A;  3VS1 A;  1RUW A;  1NYF A;  4OMN A;  1UG1 A;  2DJQ A;  3VS0 A;  5IHI A;  1QCF A;  3VS7 A;  2HCK A;  5IH2 A;  3SEM A;  1N5Z A;  2A36 A;  5L23 A;  4QT7 A;  2NWM A;  1SHG A;  2CH4 A;  2CSI A;  2B86 A;  2IIM A;  2DA9 A;  3M0U A;  1T3S A;  2AK5 A;  4F14 A;  4GLM A;  2DRK A;  4OMP A;  2GTJ A;  1VYU A;  1U3O A;  1X2K A;  2MIO A;  4CC3 A;  2JT4 A;  2KXC A;  2FPD A;  3LH5 A;  1OPL A;  4HVU A;  2EYX A;  2D8H A;  1NLP C;  4RTW A;  3M0P A;  1SPK A;  2O31 A;  2ENM A;  4LUD A;  1ABQ A;  3I5R A;  4OMQ A;  2KBT A;  3TSZ A;  2HEQ A;  3H41 A;  1UUE A;  4ORZ A;  2HDA A;  1PRL C;  5FW9 A;  3I5S A;  3UA6 A;  2A37 A;  1BU1 A;  1H3H A;  2GTO A;  1WI7 A;  1WYX A;  4J9B A;  1SRL A;  4CC4 B;  4JJC A;  4R0K A;  1XOV A;  2EW3 A;  2O88 A;  2YSQ A;  2JM9 A;  3H0F A;  1GRI A;  4LUE A;  1BB9 A;  1ZUU A;  2EBP A;  2KRO A;  2RNA A;  1OPK A;  1I1J A;  1WXT A;  1X6G A;  2E5K A;  1X27 A;  2OI3 A;  4E6R A;  1SHF A;  2EGA A;  2KT8 A;  2FPF A;  2DL8 A;  2H8H A;  1OEB A;  1SEM A;  1X2Q A;  3IQL A;  2DNU A;  4X1V A;  2F2X A;  1T0H A;  1S1N A;  2RF0 A;  2GNC A;  2K7A A;  3EGU A;  5ECA A;  1H8K A;  2FEI A;  2LJ1 A;  3ULR B;  2LQW A;  2K3B A;  3THK A;  2PTK A;  2X3W D;  4EIK A;  1KIK A;  1NEG A;  2J6F A;  4J9D A;  1YWP A;  2EKH A;  1HD3 A;  1H92 A;  1MV3 A;  2L3Q A;  2LMJ A;  2DLP A;  1M3C A;  1GCP A;  1Z9Z A;  1WLP B;  4K11 A;  4JJD A;  2GGR A;  1W6X A;  2VKN A;  2CH4 W;  1PNJ A;  2PNI A;  5I22 A;  2K2M A;  2V1Q A;  2KNB B;  1X69 A;  5HCK A;  3NMZ C;  2CUD A;  1I0C A;  1UJY A;  2DF6 A;  5GJW B;  2AKK A;  2GBQ A;  1K0X A;  2CDT A;  2M51 A;  4A63 B;  2A28 A;  2DM1 A;  2FO0 A;  3O5Z A;  2JXB A;  1MUZ A;  2DL7 A;  1J3T A;  1UDL A;  1GBQ A;  2J06 A;  3REB B;  3M0R A;  2KXD A;  1AVZ C;  4ZNX A;  2J6K A;  4OMO A;  1K9A A;  5I11 A;  1CSK A;  4JPB W;  4Z89 A;  4J9F A;  2KEA A;  2W0Z A;  1AOJ A;  2KYM A;  1JQQ A;  4LE9 A;  2ROT A;  1QLY A;  1SRM A;  1JU5 C;  1KJW A;  4JZ4 A;  2HSP A;  4F17 A;  1NLO C;  1ZSG A;  2ECZ A;  2X3X D;  3RBB B;  2LJ0 A;  3VRZ A;  3VS2 A;  2KT1 A;  2ED1 A;  2RQW A;  3R6N A;  1AZE A;  4IIO A;  1B3Q A;  2NUZ A;  2PZ1 A;  2RPN A;  4RTY A;  4CC2 A;  1E7O A;  2YUP A;  1M3A A;  4J9I A;  1ARK A;  4GBQ A;  3NGP A;  3U23 A;  1TUC A;  3M0S A;  2EQI A;  2EGE A;  5FWC A;  3A98 A;  1U06 A;  1WA7 A;  4LNP A;  3EHQ A;  3QWY A;  2JW4 A;  2KRN A;  1YWO A;  2D1X A;  2YUN A;  4AFQ C;  1AZG B;  2BTT A;  1FMK A;  2JTE A;  2FPE A;  2CT4 A;  1WX6 A;  1UE9 A;  1WFW A;  1ZX6 A;  1UGV A;  2RMO A;  1T0J A;  3TVT A;  2CSQ A;  1GFD A;  2L2P A;  1GFC A;  2AZV A;  2W10 A;  3RNJ A;  1VYT A;  2MCN A;  2HBW A;  2ED0 A;  3H0I A;  1QWF A;  1YP5 A;  1VYV A;  1JEG A;  3GBQ A;  4J9G A;  2DVJ A;  2SRC A;  2O9V A;  4LN2 A;  2V1R A;  2DRM A;  1YN8 A;  4RTX A;  3PVQ A;  3VS6 A;  1M27 C;  2RQU A;  1M30 A;  4OMM A;  3H0H A;  1W1F A;  3KFV A;  2LQN A;  4J9E A;  3VRY A;  4KRT A;  4RTU A;  4RUG A;  1OOT A;  2ESW A;  1X6B A;  2DE0 X;  1PHT A;  2KRM A;  2L3S A;  5EC7 A;  4J9C A;  4WCI A;  1SSH A;  1QWE A;  2A08 A;  2KR3 A;  3VS5 A;  3EG0 A;  3M0Q A;  1K4U S;  2QDL A;  2K6D A;  4D8K A;  1HSQ A;  1JO8 A;  3M0T A;  1K76 A;  3I35 A;  1AWJ A;  2EYZ A;  2P4R A;  2C0T A;  2JS0 A;  1KSW A;  3VS4 A;  4DEY A;  2FRY A;  2YT6 A;  2LCS A;  2EYW A;  1AWX A;  2YUO A;  2FG0 A;  1TUD A;  1LCK A;  2L0A A;  1U5S A;  4JJB A;  2KRS A;  2K9G A;  1K1Z A;  1UTI A;  1WDX A;  1YCS B;  4HXJ A;  1PKT A;  3NHN A;  1UFF A;  4AFU C;  1TG0 A;  1ZUY A;  4OML A;  2G6F X;  1AD5 A;  3UF4 A;  2AKL A;  1JXM A;  4AFS C;  1X43 A;  2JM8 A;  3EG1 A;  4F16 A;  4Y92 A;  2DBM A;  5GJV B;  2XMF A;  2BZY A;  2LP5 A;  1RLP C;  2JMA A;  1UHF A;  2VVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...