4F1JA

Crystal structure of the mg2+ loaded vwa domain of plasmodium falciparum trap protein
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
200
structure length
200
Chain Sequence
EVCNDEVDLYLLMDCSGSIRRHNWVKHAVPLAMKLIQQLNLNENAIHLYANIFSNNAKEIIRLHSDASKNKEKALIIIKSLLSTNLPYGRTNLSDALLQVRKHLNDRINRENANQLVVILTDGIPDSIQDSLKESRKLNDRGVKIAVFGIGQGINVAFNRFLVGCHPSDGKCNLYADSAWENVKNVIGPFMKAVCVEVEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thrombospondin related anonymous protein
publication title Structure of Plasmodium falciparum TRAP (thrombospondin-related anonymous protein) A domain highlights distinct features in apicomplexan von Willebrand factor A homologues.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Cell adhesion
total genus 82
structure length 200
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4f1jA00
1RS0A 1LFAA 2I6QA 3TW0A 1T6BY 4HQKA 5KYUA 5KYXB 1AO3A 2XWBF 3GXBA 2QTVA 3K71B 1CK4A 1MF7A 2WW8A 1L5GB 3TXAA 3ZDYB 1PD1A 1SQ0A 2ODQA 4HQLA 1DGQA 4WFQA 1MJNA 4C29A 4JDUA 4HQNA 3N2NA 2NVOA 3K6SB 5KYYA 4WJKB 3ZQKA 1BHQ1 1XDDA 3F78A 4CN8A 5E6SA 3EFOA 3HI6A 3NIDB 3V4VB 4NEHB 1RD4A 2IUEA 1V7PC 1DZIA 3EGDA 4NENA 2VC2B 1XUOA 4XW2A 3EGXB 2XWJI 4CN9A 1JEYA 4UM8B 4Z7NB 4HQOA 3HXOA 3TVYA 5ES4B 2XGGA 1ZOOA 1JV2B 2VDNB 1PT6A 3K72B 1T0PA 4G1MB 4MMZB 5E6UB 3ZE0B 1JEQA 3ZDXB 4C2AA 1M2VA 2VDPB 3FCUB 5KYWA 2NUTA 3PPXA 3EG9A 1MQAA 3PPVA 3E2MA 1NA5A 2ODPA 3NIFB 3PPYA 1N3YA 1QC5B 4IGIA 1PCXA 3ZE1B 1RTKA 1MHPA 5KYUB 1SHTX 2NUPA 1FE8A 3F74A 1TYEB 3BQMB 1M1XB 4A0QA 3EH2A 4WK4B 4O02B 2O7NA 1IJBA 1CQPA 3VI3B 4MMYB 1Q0PA 2M32A 2X5NA 3EH1A 3TCXB 5KYYB 4Z7QB 3EOBI 4HQFA 5KYXA 4C2BA 1IDOA 1U0NA 2VDMB 2I91A 3NIGB 4M76B 3QA3E 5E6SB 3EFOB 4UM9D 1IDN1 2B2XA 1N9ZA 1UEXC 2VDOB 3BQNB 5BV8A 3IJEB 1BHO1 1PD0A 4F1JA 5HJ2A 3ZE2B 3EGDB 4NENB 4WK2B 1M1UA 5KYNA 3FCSB 3V4PB 1JEYB 1MQ9A 4IHKA 2WINI 4BJ3A 4IXDA 3K6SA 2I6SA 3ZDZB 3HXQA 5E6RA 4FX5A 1JLMA 2VDKB 5LN1A 1YVPA 2ICAA 3Q3GE 4CNBA 2VDRB 5KYWB 1JEQB 1M2VB 5HDBB 4G1EB 2NUTB 2VDQB 1AOXA 1SHUX 3BN3A 3EGXA 3EG9B 1RRKA 1U8CB 5HGJA 2VDLB 4WK0B 3VI4B 3T3PB 1M2OA 4DMUB 3EOAI 1XDGA 4MMXB 2NUPB 1OAKA 1MQ8B 1U0OC 1QCYA 3PPWA 5E6RB 4F1KA 5E6UA 1AUQA 1ZONA 1M10A 1FNSA 3RAGA 1YVRA 2ADFA 3M6FA 4UM9B 3IBSA 1ZOPA 3T3MB 4Z7OB 1IJKA 4PN7A 1ATZA 1QC5A
chains in the Genus database with same CATH superfamily
1AKRA 1GNQA 1QH8B 1DXQA 2OUKA 3KJHA 3L82B 1K7EB 1EFLA 1QFXA 2XWBF 4H7IA 1KI8A 3CRVA 2Q8PA 4WCVA 2Z1MA 4YMHA 3GLIA 5F2NA 3JAWB 5IBRA 4JSRA 4BV3A 1MF7A 1AQLA 1EB9A 3WGUA 1U4OA 1I4WA 1C0LA 1NDQA 3C97A 3FNFA 3KQMA 4KAFA 3OM9A 5J5CA 3ZYZA 4LXQA 1D04A 1I13A 1QO0A 3TM4A 3AEYA 2A0WA 4HYEA 5AO9A 4EHAA 1FP2A 2VYVD 1VPVA 2R84A 2XA1A 3BPSA 1UKVY 5I51A 4PX2A 3UICA 3SKYA 4CN8A 1AQ6A 2O2SA 4MH0R 3F47A 4OHFA 1YKGA 4NEHB 3KVNA 2IUEA 5TQ2B 5TIIA 2WD9A 3QBVA 2BKUA 3AESA 5H83A 3N1UA 1V1JA 5DW3A 4B6PA 3LSTA 2H0QA 4NHEA 5EJMA 1V45E 2Z98A 3KAKA 5CLJA 1A9ZA 4GXTA 2FZGA 1RBQA 2EGUA 2YS6A 3O8BA 4IRXA 2HIAA 2PZGA 4LJYA 3EXHB 4BATA 4B5KA 2D1SA 4WNAA 1CZUA 2ZULA 2XGMA 3HVIA 4L4RA 3P7MA 4R5HA 1LDGA 3KIPA 2VYND 2KJQA 3JR7A 3OD1A 2QRZA 4EPXA 5KTOA 3O3CA 5HG0A 4RHTA 3ZLBA 1TKBA 5J43A 3IB6A 2C7BA 4CUZA 1RKXA 3JQGA 2O3SA 2AE1A 4AQYB 4KRXA 3OOHA 2XCTB 1UPXA 1DHTA 4BO8A 1UKYA 2DQSA 2JJMA 5BWCA 3NHFA 2FI1A 1GZ5A 4K46A 1PQWA 5IF9A 4Q4AB 2I8LA 3VR3D 5KREA 2R44A 4NDAA 3DV0B 2JHCA 1DIRA 2I4MA 4AJ4A 4J75A 2ZIFA 1NOKA 2PWBA 1QVRA 1JLSA 3BRCA 1ESNA 1PZXA 3ZKWB 2X19A 3QOXA 2DHQA 4I1IA 3OAAA 3W7VA 4ZEWA 4BX9A 1ZBDA 1YOBA 4FBGA 3JAWA 1DAGA 3DFKA 3HCCA 2H07A 3NC1C 4IPTA 2RGRA 3D1LA 1FU4A 1ZIDA 2ZI3A 5JISA 3DTNA 5I7OA 1I5EA 1PR9A 3QPCA 3I9V1 3NRJA 4WK2B 1ZJ6A 3MG9A 2Z09A 3U3JA 1RAGA 4ESEA 5C4MA 4TZTA 1HLFA 4GLLA 3ERCA 4RVNA 5CH3A 2H5JA 1K5DA 3OX1A 3HMKA 3NV7A 3UATA 3WTBA 2BFMA 4LXHA 2FU5C 4AF6A 1AZWA 5KTSA 3E9RA 4B8WA 5GADl 4WLNA 1FFHA 1G0NA 2EFHB 3K9NA 3E23A 2GD1O 5IN5A 3LT0A 5TQ2A 4BO2A 2ANBA 1LLCA 1X15A 4TKLA 4RETA 1W52X 4ZODA 2L18A 4PLPA 2VN8A 2QMUA 4PNZA 3EMDA 4DJDC 1RC8A 3G0DA 4IJVA 4OJKA 3VBCA 2XMRA 3VI4B 5A3QA 1H9CA 4FUTA 3T3PB 5CNIA 3HSKA 4F6RB 4K9NA 3RHZA 1I9GA 2ZIWB 4XQEA 1ND5A 3LGAA 4GZ6A 3EXHA 1WL8A 1YRWA 5ETJA 1KY3A 4RTRA 1BCRB 2CJPA 3VKFA 5DTIA 1GRNA 4IJUA 1DJNA 1JHXA 4P3YA 2C7RA 2NADA 1V9LA 4ZVLA 1LK0A 3RS8A 3S81A 1ORHA 3RTGA 1K06A 3HDVA 3EDMA 3IBSA 4WWHA 4E4TA 4MK4A 2I9PA 1N2ZA 5CJ2A 1EYZA 1R0KA 1RC1A 5DT9A 3OC6A 5BURA 1D6MA 1R18A 3EX7C 4Z49A 4TWIA 2C8KA 1C4OA 1HURA 1JQLB 3JRWA 1K63A 3KDPA 4M0KA 4UNNA 2BFFB 2HMUA 3DDOA 2C7PA 3PLAE 2M6RA 2IU4A 5B2FA 3OPVA 3UA4A 2P11A 3E82A 3RFVA 3SAJA 4Q4AA 1XVAA 1F14A 1YB1A 4IIUA 5I9MA 5HP4A 1XA3A 3DV0A 4TXNA 3X1DA 4ZTUB 1MAUA 2AC4A 1QNLA 2D5IA 3EGEA 1B6RA 1EVKA 4XDZA 3ZKWA 4TYYA 5JCOC 2RGDA 3NIBA 2OHHA 1GZ7A 1GZ4A 3GF4A 1KJ8A 4LMRA 5TB5A 4E46A 2EDAA 1GN8A 3KJXA 2FB9A 5IXSA 1WMFA 1MO4A 3LCMA 4B5LA 3QVTA 1VSVA 1BGWA 1K6EA 3OPYI 4WECA 1X0VA 5GJBA 1IZ9A 4GZLA 4OMFG 4D44A 4IZ6A 1L8OA 4TPKA 4BOYA 4G07A 1GKIA 4G8CA 3EW7A 3BTSA 1JA9A 4CM4B 3OF2A 3GNQA 3PC8A 1LPPA 4IJKA 3KWLA 4G1MB 5ALXA 4JFRA 4FOTA 1VC2A 3FKSA 2NUAB 3ZBPA 1V7ZA 3W6NA 3WMWA 4HAXA 3AR9A 3VC1A 5MF6A 3QTTA 5BNTA 2X6RA 3L02A 3QKIA 3HR8A 1CUXA 1OT3A 1R0SA 3PBKA 4AXBA 4F6RA 1CUZA 1RTKA 1QCCA 4EI7A 1BCRA 1DFGA 1ULZA 2H4FA 2D7DA 2QY6A 2XVAA 3ZZ0A 1CNMA 2EXXA 2KM1A 3AEKB 4RXUA 1EESA 4R1TA 1CJCA 1GARA 3LUDA 4P6VF 2ZATA 3P45A 4DJAA 2GZSA 2IHUA 3K5PA 4KV7A 3SX4A 3E4DA 4MKIA 5B6JA 1DB3A 3L8ZA 4PGHA 1SZJG 2BFFA 3E3MA 3AP2A 1SD2A 3A36A 3I1JA 5D2CA 4NFHA 1W29A 3H7IA 3N8KA 2DF8A 3DCNA 3U1BA 1E89A 2BGIA 3DQQA 4O8CA 3OTWA 4UTZA 2IUUA 4FB5A 3DFMA 1NPTO 3SHVA 4EQZA 2FUNB 1QU2A 2WINI 3NM5A 5DNDA 2ZXUA 3PICA 4NFYA 4X45A 4JQZA 4NOKA 5EVCA 1YVUA 1TAGA 3E05A 4G5QA 1C7FA 3NJ8A 4ZT2A 5LUBA 5E7MA 2RD2A 1Z56C 2F8MA 4RVSA 2CJWB 1EINA 2D4AA 3DTVB 3I9LA 3IXMA 1G2PA 1YJAA 5IU6A 1O6CA 3OJCA 1ONPA 1AJEA 3CXRA 4ME6A 3FAZA 3CW8X 4H4DA 1GG5A 4HEA1 1XAJA 5BN3B 1YS1X 1N2BA 1PJLA 3A4LA 3CUUA 3ICOA 3V4LA 1C3XA 1NW3A 1UOQA 3H8WA 3HFGA 4I8IA 5B3KA 1QP7A 4QDTA 3RSQA 2R60A 4D26A 4ARCA 1U0OC 3FPHA 4CM4A 2AJ8A 3H16A 1VE1A 3KZNA 4A6XA 1X2BA 1G7TA 3ETJA 2NGRA 3JQRA 2EFCB 3LAWA 4RY2A 2J6HA 4BMNA 2G6TA 4XSHA 3ZV3A 2NUAA 2REXB 4MRMB 1AU9A 3Q0TA 2Q4EA 3PL1A 2P1RA 1FXWF 3PIRA 4QDKA 5U1PA 5IUJC 2R8PA 1DBPA 4DXHA 1H2HA 1T3ZA 2F43B 4LRSB 3ER6A 1EFKA 3RUDA 3QUQA 1I30A 2DQYA 4KIWA 4WOPA 5A4IS 5LQNA 4ZVRA 2VQFB 1YASA 3TXAA 3AEKA 3UO8B 1B8VA 1I7NA 4YO7A 4AJIA 2DR3A 3EGIA 5BMVF 3PXXA 4MI9A 5SY6A 1W88B 1GL7A 3PCXA 5ESDA 3IHTA 4N3CA 2MHCA 1JQBA 1PL8A 5EQTA 4W9NA 4D4GA 3ETDA 3OPMA 1QIIA 3HUEA 2NZXA 3DGFC 3QZUA 1Y7LA 4EKGA 3L7CA 4Y9DA 4LOJA 2IX3A 2BCJQ 2D2EA 2PX6A 4H3KB 1U1GA 4NJOA 4PYIA 1ONOA 3TX6A 1YIDA 4WESB 2P3SA 4TMZA 3KJNA 2IYQA 3FROA 3MGGA 4UUNA 4G1UC 3TAUA 3VO2A 1V8ZA 2QLMA 4NSNA 1AK1A 2IA5A 3F6YA 3DDHA 3NBKA 2QOEA 2B8JA 1OXXK 3A25A 2OPHA 2PAFA 2WPNA 3VGJA 1UM8A 1D1PA 4FFBB 4KV9A 1UXOA 4UBJA 4JYPA 3V2IA 4ZKEA 5IC6A 3A1SA 2CJWA 3DTVA 2PRIA 2RH9B 3F9IA 1I0LA 4EUHA 3FY4A 4HX5A 4UHHA 1KYIA 2GCEA 4AS3A 1O3YA 3KM0A 2BMFA 3K8YA 1FTGA 3FA2A 3H8VA 4AQ7A 2NNLD 2PZAA 4RWEA 1A0OA 1X9HA 3WIUA 4RHYA 3H75A 1V2GA 1XWIA 1P4GA 5T8KC 4DLLA 5AW8A 4D02A 4BCBA 1ML3A 3DR5A 3FYUA 3O9VA 3JQ8B 1PS8A 4MRMA 3RRZA 4DHWA 3QLTA 1OPRA 2CL0X 2HN9A 3CIOA 2XB6A 2ZYWX 4MW0A 1CJTC 1YS7A 2PJZA 3H87A 3IP7A 3E7PA 3IVAA 4AMGA 1NFRA 2F43A 5JMPA 4L28A 1N0IA 4FTWA 4KFTA 4M1ZA 4DCPA 3RUCA 4DMKA 5IUNC 2ONJA 5H16A 1QE3A 1KZ4A 3M1IA 4RA9B 4BXOB 1QS0B 2D1FA 2ZM6B 1TZ2A 1IJFA 2C2MA 2AMLA 2DY0A 2GBGA 1FRFS 3NO4A 5F78A 4E5PA 5E2BA 2CUKA 5BR1A 1U9JA 3KFXA 3TOZA 2X14A 1JEEA 1YHNA 4YT5A 1W88A 1G16A 4RF4A 3LT2A 4C30A 4JI7B 2A0FA 2FJ0A 4N39A 1V0JA 3E2PA 2HF7A 4Y6RA 3SBEA 3WDLA 5DPMA 4E5NA 1ESDA 1ADYA 1Z7GA 5SZKB 3LJKA 1F06A 2BJHA 4AMYA 1U0HC 1WVMA 3FM9A 3OOYA 3COJA 2HREA 3AVTA 4K1LA 4M8KA 2ZJ3A 1SRRA 2WG0A 3QVJA 4FFBA 2P9GA 4NFSA 4OL0A 1NBME 1NVGA 2CHFA 2W8ZA 3AF4A 4MHTA 3BB1A 3DOEA 4EZEA 2FK7A 4J2OA 1OREA 3FYSA 3B7WA 1BE0A 4XQ0A 1JG7A 2H7CA 5D5QA 5EOVA 4C0LA 5CA1F 1VG8A 1TCAA 1M9NA 1U8AA 4GX2A 2G3YA 3BUSA 3I5XA 4YCMA 1IULA 5G02A 3C16C 7ADHA 3TUIC 4FHFA 5JAHA 3TQCA 3DBLB 1JXQA 1R4MB 2EF0A 1NQ5A 2KHZA 3JALB 1RHKA 2AHRA 1X74A 4ZJYA 3KJFA 3SJ7A 1XJQA 3JQ8A 1P9OA 1N5IA 3NDIA 4V0ME 2C3OA 5AOCA 3S55A 1QU3A 2IHTA 3JWHA 5BMVB 3X1JA 3REOA 4DUGD 1BCSB 1LBSA 2Q0XA 3C1UA 3JYPA 1B43A 3GGDA 4HRXA 3BDVA 4YV0A 2R68A 5K0SA 1CUWA 1D09A 1LPMA 3KOOA 3MFQA 3TZQA 4ZICA 3AVUA 4ZI3A 4FYWA 4RA9A 1QS0A 1VCHA 1RVV1 1VG1A 4JITA 3D3KA 1P72A 2JIBA 3AIIA 1Y8CA 3I53A 1YJQA 2GFIA 5ESRA 3U40A 4ECAA 2G82A 1Z5NA 1N6LA 1R88A 2X15A 3COPA 4FDUA 4OYHA 1MUUA 4TQAA 2CVZA 4RD4A 2KYRA 2W5UA 2XNHA 2O2JA 2P5YA 4KN9S 3UPTA 1OFGA 1T8YA 5AXAA 5KC9A 2B8NA 3NP9A 2Y77A 4YRFA 2LV8A 5G0WA 2FTKE 2IT1A 2BGRA 3HYSA 4TROA 2CNKA 4PLZA 2QV0A 1M34B 1VCNA 4ENQA 3C98A 1X80B 2ORED 3KKKA 5BYKA 1RRVA 1VE3A 2WWRA 4RDIA 5ALZA 4QARA 4Y6SA 1DCFA 2Y9PB 6YASA 3Q15C 2FKAA 4RTOA 4C6RA 3STXA 1ECPA 2J4CA 4Z3DA 4G56A 1JBEA 1NJFA 4QEDA 5SZHB 2VWQA 3RGGA 1RZRD 2PZJA 1G9SA 2Y68A 1OXVA 1N57A 4JBYA 3I8SA 4Z9AA 1J39A 3WLIA 1S2IA 2C1ZA 2P0AA 4JC5A 1UAGA 2H4WA 4G0NA 1T91A 2J5RA 4DWVA 2FW1A 1HXHA 2OENG 3R3ZA 2BCGY 1T8SA 2PX3A 4HNSA 3RSOA 5EJ8A 2EEPA 2I66A 1ES9A 2QNIA 3HGTA 4ATNA 1DRUA 1FXWA 1KTVA 5AVSA 3SR0A 5L9AA 4F06A 2AN3A 2X7JA 1BZYA 1MAVA 3R24A 4ZJZA 4X44A 2D5LA 3CCBA 1ADCA 5ENZA 5EMJA 1XTJA 3FZNA 1YJ8A 2YWFA 3JALA 3LA8A 3VR4H 4CKCA 3L4JA 4YDHB 4EJMA 4NF2A 5HJ2A 4QUKA 3H0EA 4US2R 3KVRA 5BMVA 3NTLA 1JEYB 3FF4A 1BCSA 5SYAA 2GAIA 1AZTA 1N5OX 3HRIA 5JLJA 3L7DA 2F3RA 1WU7A 3B3GA 3N8IA 1Y1LA 3F49S 3QMPA 1Z4JA 4TN5A 5D6OA 5ARCA 4HDOB 1D0SA 2GEBA 5TE9A 1CUJA 2BKLA 2PAAA 2Q7XA 5D86A 5ARDA 5A5GA 4V02A 2C07A 3AUKA 3I61A 1YRBA 3KEQA 3A3NA 1JI3A 3IH5A 4XQGA 4D97A 4Z53A 2XUPA 4FHCA 2NNWB 4XYBA 4JBLA 3VH2A 4N1AA 1OAKA 5A1TA 1VMIA 3IP5A 3MWLA 4OQXA 4IW3B 5CDFE 4RC9A 1IEXA 1M34A 1JU9A 4XWGA 1X80A 1RWXA 3UV6A 3PFCA 1ISHA 1V2HE 5HZMA 2Q3FA 5HQ3B 4DFDA 5HILA 5KWVA 1LI5A 2ZETA 5I5GA 4BAUA 3U4AA 1EP1B 3EEBA 3WKEA 3UN1A 4B83A 1FMTA 4RKRA 4EZIA 1BN6A 1Y80A 5I9BA 4ZMBA 1KYZA 2VJBA 5J63A 4YMGA 3W06A 1U3CA 3CC8A 4RZHA 4B44A 2JZNA 3ORYA 2ZYGA 3GJSA 1DC3A 1IQ0A 2XA2A 1CR1A 4DZRA 3GWGA 1ADJA 3JQ9A 1DELA 4ISCA 3V8VA 5K20A 3MHTA 1VGVA 1K3TA 1JLLB 1SBIA 2FPPB 2H5IA 2WDPA 1YU9A 4A1OA 2UYQA 4Z54A 2JLVA 1KVRA 4YJKA 2QUHA 1QORA 3FSJX 2YWDA 3I0NA 3OURA 3SQLA 5EMLA 1QYWA 3O83A 1M0EA 4M3NA 1XU4A 4J03A 1SHLA 1O6ZA 3K32A 5TGDA 2I54A 1E6KA 1QFJA 2A59A 2OUIA 4WEOA 3IL2A 2PUDA 3K8QA 3EAFA 1WMSA 4V3CA 1W5BA 3C3XA 4PLFA 2LKDA 1JEYA 3B85A 4NQRA 4XEHA 3PHJA 3QF4A 4MQEA 1QZTA 2V6IA 4ND1A 4EY4A 4LG1A 3CUWA 1FFGA 2GM9A 4DA9A 1VIMA 5I7WA 1XJ5A 2NV6A 2QX9A 3MIIA 4DOMA 3DNFA 5IK2A 5T4BA 2IBMA 4WI1A 5F2EA 1W36C 1OIXA 2PLAA 2W8BB 1M2NA 1QG2A 2SICE 5KOJB 1KH1A 3MJVA 5GGYA 3TZCA 5KINB 4B3SB 1OFUX 4KNYA 4TLMB 3E2MA 3V4SA 4II2A 4RANA 5FNVB 1AT1A 1HE4A 3GRAA 1C1DB 1L5FA 1T2NA 2WVGA 3EVAA 4UD6A 3U80A 2LD4A 3ZCQA 3OIFA 4YAUA 1GKLA 1Z5OA 2XUQA 1F12A 1KIMA 1Y98A 1MU0A 1OLXB 1NMSA 5B3JA 2VPQA 1Z26A 1H05A 1JH8A 1JIUA 1W75A 5D3QA 3W78A 3OF3A 4R71A 1N2CB 4FB4A 1A76A 1GEGA 1OH5A 1DO0A 4FNGA 5HQ3A 3TZHA 4EG6A 3R76A 3L7KA 4GVPA 1EVLA 4D9NA 3IMCA 1JSRA 2DUUA 5IM5A 2YFYA 4HGRA 3MWGA 4YQEA 1W4BA 2MWMA 2J41A 2IJGX 3FKQA 3AERA 5HVNA 4FHZA 5D3ZA 4FZJA 1VMAA 4IDQA 4K6FA 4YRRA 3RU3A 2QG9A 4JP2A 4JR2A 1Z38A 1VIDA 3L7NA 3E22B 1WOMA 1WDWB 2RB4A 2IIQA 2XF2A 2FPPA 1JLLA 1YL5A 3PXGA 4F4UA 3RUEA 4CETA 3FPSA 4O5AA 3TLEA 5JHGB 4I4TF 2ZE5A 1JILA 1O6BA 3O4IA 4E2FA 3NYWA 2EIHA 2P9CA 2O14A 1N7IA 3CW2A 8ATCA 1JT2A 3U81A 3PL5A 4LOIA 1I3KA 2CLDX 1NP6A 4YRPA 1HE5A 4A2CA 3I5UA 2C04A 3JYNA 4BO1A 1F2UB 1QIHA 4P35A 3UK1A 2GK7A 1M74A 4HS4A 4JYBA 4OCZA 3KSDO 1RJFA 2D2IA 3PA6A 4RD6A 4ZO6A 1N2CE 3PQDA 3RHSA 2D3WA 2TECE 5L8VA 2QUJA 3HO6A 4A8HA 2P3OA 2ZE6A 4BN0A 1CVRA 1AUQA 3OPXA 4R81A 4B2YA 2X1HA 1ZH0A 2FWBA 1NR1A 1QK5A 1G2QA 1ISFA 2J3HA 2PMCA 3CH7A 3WLOA 1WCIB 4CLEA 1OQAA 5KOJA 4QQNA 4YFYA 3PNQA 2INGX 3OQ6A 4HG2A 2DFVA 1ZUIA 1C1DA 4BX8A 1UINA 5KUTA 4QYIB 1G5PA 2VF2A 4HGZA 3ULKA 1E1KA 2P41A 4BBAA 3AP1A 3GGJA 5IVPA 1I4LD 2OE2A 3HNOA 4AMZA 4QKQA 4J7CA 5EMKA 5JTTA 2QR5A 2Q6LA 5TPWB 2ASEA 2CBXA 4AICA 2VHXA 1UXIA 3L0YA 4RPCA 2GHRA 5DCLA 1EXVA 1PJCA 1GTG1 2VRCA 3C5HA 1E98A 5EE0A 5AYVA 1FW8A 1SULA 2AR0A 1NUHA 3ESBA 2F59A 1DC6A 1X7DA 3IKMB 4OQFA 4WJKB 3NRCA 4AP5A 2JFGA 4PLYA 1OBOA 1SEPA 2BKVA 4EHJA 4ZV4A 3L5KA 2GN6A 4M21A 3ZE7A 4Q1AA 3UJNA 5AWFC 3E22A 1NKSA 2AB0A 3JWIA 1XRQA 4IV0A 4IUBS 4N6GA 4Z9XA 1KARA 1WG8A 3DONA 5KB3A 2I7VA 3LUAA 2Y1GA 2HJ9A 5B57C 1XZCA 4FHGA 4P7GA 3WG9A 1EFTA 1DARA 2BDEA 1Q3KA 1XRJA 3O4GA 4XCVA 2C4HA 1I36A 3IV6A 2VAVA 2LR0A 4KO3S 4BX0A 5K2MA 1DEKA 4NAHA 4BO0A 3WYGA 2VDNB 4G25A 1Y3CE 4EYSA 2VWPA 1AN0A 3LW7A 4KZKA 1RYNA 1ZW6A 3OCUA 3FRIA 4H1TA 1FC0A 4JAVC 4QOFA 4M46A 4LF9B 1RLOA 1F2UA 4OQDA 1TTHA 3GEBA 3PPYA 5DN6A 1IN7A 5LQAA 1EVJA 4QXPA 1UMCB 3KR2A 3PYLA 2XE7A 4RPKA 5EZ5A 1OX4A 3L0SA 4FJ0A 1EXWA 1P7ZA 1U0TA 3ETCA 3LE8A 4NCJA 4CBVA 1HORA 4GQIA 3WGJA 4BB0A 1J9ZA 4HDRB 1DG1G 2SNIE 2OOSA 5C5EA 2D3TA 4DJFC 1JFLA 2C9OA 4FYYA 3VAAA 2VHQA 3ZZ1A 2YYAA 1G6OA 3CS3A 2ETXA 4K6HA 4QYIA 3UUWA 5HJ7A 1QRDA 3LQQA 3CF4A 4NS4A 3DBHB 1MPTA 1JZSA 3AI2A 1T8RA 4PSVA 5CDYA 4JODA 2ZR0A 5JASA 5K6RA 3BIFA 4LJRA 5BV8A 4UEJA 4DGQA 2R6GA 3UMCA 3QX7A 1IUNA 3M7IA 5IZCA 2F1OA 4GPIB 5DBOA 5FLEX 2PKRA 4I4TB 1XAHA 3L5OA 5CVJA 1JNXX 5ELXA 4FFDA 3UV7A 1W25A 1U5BB 4LDZA 5EE9A 2VJPA 1ZCFA 3ICWA 1XZLA 2DCMA 4AWBA 1I7SB 1L9XA 3DZJA 1NXXA 5GZ3A 3DP7A 2TMYA 1JR3D 1KZ6A 3PJFA 1RWQA 2VNIA 3ENKA 1Z5WA 2E5WA 1NVXQ 3MINB 3O4FA 2X5XA 5DTMA 4JN6B 2ZBRA 5CEFA 3QI7A 1TPZA 1BXGB 2BVNA 2ZIAA 3ZEAA 5L3RA 1SU4A 2OO5C 1PUIA 2EL7A 4Q00A 1THGA 3OEHD 4HTAA 4ZO4A 1HL3A 2ORYA 1KEZA 1QQ7A 5FRDA 4DAOA 2ZQYA 3IT0A 2XYPA 2GPBA 1ML4A 3E5NA 1H2BA 1OZFA 4O33A 3WTCA 1BX1A 3WGVA 4FM9A 4LF4B 4IICA 2UZ4A 2ADFA 3GT3A 1XKTA 1SA0B 1GCAA 3SD7A 2Q0HA 1QFYA 3NHAA 4MQFA 2GQ0A 5IUKC 2O59A 3SC4A 4MVJD 2AWOA 1A88A 2TMGA 5LFAA 2NSDA 2X5OA 1KFKB 1E1QD 2FCAA 1QRSA 3ADCA 5A4AA 5SYNA 5CDTA 1L4NA 3JZDA 2DFKB 2HMWA 5EKSA 2ZAOA 3JPWA 2RGCA 1BRTA 2FEAA 1RHQA 2ZSFA 5DBEX 3SI7A 1XCOA 3GP3A 3NTUA 3T5MA 4H1WA 2HPAA 4UOZA 3D0KA 3CTPA 4NESA 4DCOA 5JYDA 1R5OA 2CD9A 3BRQA 3F6CA 4RZSA 4BMSA 4CQJA 4PLCA 3O8OB 4U9UA 1Q3HA 3MCWA 5FBQB 4P08A 4J3NA 3W8RA 1YSCA 3DBHA 4U5QA 3WV4A 4EHDA 2IS4A 1K0UA 1XLTC 2CFCA 1S89A 3IOEA 3R6WA 1ID8A 1V5EA 5K0BA 5DISB 3OKCA 1DBWA 4ROTA 2D7CA 5KVAA 3PEWA 3FWYA 3IIEA 3JQCA 3JWPA 1Y8QB 3UC9A 1M8GA 1QTRA 4XH9B 3AT1A 2DB3A 4KQGA 4I4TA 5H70A 1VB3A 5ALQA 3WYFA 4CMEC 2DHCA 4RMNA 4F86A 5JU6A 5I9SA 1JJFA 3SGLA 3MS2A 3ZGOA 2HK7A 3NP7A 4V2IA 3CBQA 1C9JA 1I5OA 2WIJA 3EF0A 2QLJA 3EY9A 4JJ4A 5LP6F 2V55B 3N70A 3MINA 1RRMA 3WXMA 1JSZA 5F9FA 2OD2A 4U7DA 2GT1A 4H60A 1JJAA 1BXGA 4L4YA 3AUYA 3Q2OA 4Q0MA 4L0DA 1GGJA 3V2GA 2JNWA 1YS2X 1G42A 2AQ8A 3G2IA 1W59A 3FZEA 1E1CA 5LB4A 3WJAA 2QD4A 3BMCB 2IV2X 1RAIA 2G8LA 3EJWA 3I5MA 4EFMA 3B1YA 4I8DA 3LZDA 3SQMA 1L5SA 1OFTA 1QKKA 3B89A 3LKVA 1SA0A 4R8LA 4W5HA 4FWTA 2G25A 3TQIA 1YRAA 2UYGA 4LZAA 4GF5A 4GMGA 3QLJA 3D6MA 2CBGA 5CVVA 5IFKA 5A02A 2AOWA 4CLOB 3G9QA 1D9ZA 1H0HA 1KJJA 2ZOSA 1ZGZA 2QZ9A 1E8NA 2B8EA 1J1ZA 2P79A 2R00C 2X7XA 3EIFA 2RHMA 4J2TA 2P78A 1Z4NA 4JVSB 4C76A 5HMMA 4MP8A 1O8BA 4O2AF 2IS6A 1LTHR 1XWWA 1XWFA 2Q4BA 2Z5FA 2CVPA 3O8OA 3RBZA 4DQXA 4NOMA 4RTLA 1KRHA 3LUGA 3C70A 3PA8A 4JBNA 2WM2A 4JLJA 4MLDA 5LN1A 3DKPA 4MS3A 1BDHA 3UWKA 2H57A 1DBVO 1AO0A 3H5OA 1Q0LA 2ENUA 5HQJA 5CCBA 1NKVA 3FETA 4AKHA 1XVLA 1V5FA 3OFND 1AOXA 3RHTA 4ZDJA 1T8TA 3CX6A 1Y8QA 3N6VA 2GRAA 5K9ZA 1Q77A 5GV8A 1YKSA 2M9MA 5DNUA 1TJ4A 2AC7A 4NU5A 5DWQA 2VBCA 2VUIB 4L50A 3QFCA 5KVCA 5KO2A 5GAJA 3AFOA 4BAZA 1U1IA 4PPNA 1J7KA 4O4IF 3ZWAA 4K0KB 4OHKA 3HCEA 3SVTA 5K0CA 4I55B 1RZVA 4MRPA 2BE7A 3BAZA 3IPAA 4GEGA 5M34A 2YCLA 1NNLA 3ZWMA 2I6UA 3BH0A 3ZCPA 4E5UA 2YIDA 5JPDA 5EXSA 1T36A 1SU8A 3BZWA 1Y42X 3T3MB 1GT6A 1IY2A 5CLLA 1VHWA 3IPLA 3NHKA 1A96A 1WLYA 2WJJA 4PAQA 5K8TA 3VDNB 3TUZC 1OLSB 5DI9A 5BN4B 2JLYA 4KQCA 5CK4A 5GINE 3HA3A 5E4YA 3GRPA 4RK1A 4BRWA 3YASA 1D6NA 4RQAA 3BMCA 4KYTA 1F7UA 1ACLA 4AB1A 1E0SA 3FKJA 4YK7A 3QXCA 3SDSA 3JU3A 2ID4A 1UPFA 4ZAYA 1N1MA 3WNCA 3P94A 3ZCUA 2WR8A 3TBHA 3BD7A 3OG9A 2GK6A 8OHMA 1JHYA 5IAAA 3PUVA 4CLOA 3NPMA 4AJEA 4ONEA 4QREA 4NARA 3ZIAA 2NTYC 721PA 5CLIA 1P7YA 3V7YA 5JFTA 1C3VA 3H6HA 2F1IA 1UKEA 3HDGA 1K66A 1QSGA 3A14A 3LPNA 5EXDA 3GU3A 4XDGA 2FOLA 2X0FA 4BTVA 3NOXA 2JFNA 2BMVA 3JYLA 4E4YA 4U00A 4Z7NB 1YA6A 2XT6A 4NE9A 4UVGA 4ETIA 1EAYA 2GRJA 4FGUA 2H2HA 2AR9A 4GAEA 4MUNA 3RROA 1ISJA 2BGGA 2C3PA 5KYTA 1ZSVA 2O19A 4PZDA 3FTCA 2JKYA 2PSFA 2ZIUB 4OQPA 3O8NA 1YR2A 1TO2E 5FI1B 3U3MA 5LP6B 3IEVA 1GKKA 2F4VB 1KJ9A 3PCRB 5DM4A 4P92A 4EX7A 5J1SB 1Y8RB 2OWEA 1JRLA 2C4WA 2IEGA 3ZNOA 4RZ2A 4F92B 1VCMA 1BG6A 2H2DA 4B85A 3JTEA 3C7CB 3D7SA 1FE8A 3MBKA 3O31A 4JQSA 1ISRA 3LY8A 4IH9A 3T3EA 2PUCA 3FPEA 3MLEA 4I55A 4BLWA 4F5WA 5DU2A 5E3JA 1H69A 1VL5A 3CT6A 4G0YA 4CT0A 3LQ1A 1VCOA 3DTTA 3A1FA 3BF7A 2H1IA 4IGAA 4FDTA 4D3YA 4JZYA 1OLSA 5BN4A 4XD2A 1B6GA 1QR2A 1SQ6A 4JLSA 4L8GA 1BYUA 2KW5A 2YNMD 4OMCA 3DMTC 2Q50A 2QTWB 4GXNA 2C9YA 3ZS8A 4YUYA 1VKHA 1BMQA 4XVQA 5A5DA 4RTMA 5HK8A 1ZIOA 3ISJA 2FZ5A 3OZEA 1NXTA 1GGNA 1V95A 3CLHA 4ALLA 4K8RB 1BEUB 2WJVA 4U63A 3WOHA 4DR2B 4HNQA 1WNFA 3L0IB 4N3NA 3WA6A 2PA0A 3MERA 3TZ6A 4KB5A 1G8AA 2HCBA 4P84A 5F3RA 4W63A 2MSNA 3N3BC 4CCAA 4BP8A 2JARA 1INLA 1AKTA 1PTKA 1CUIA 3DNPA 3FPCA 3LD9A 1XPOA 4KWCA 4ASUA 3CLSD 4HX2A 3LCUA 4HVTA 2NZ8A 1SVOA 3SJZA 2W2LD 3HA7A 1U94A 1WM1A 5AFSA 1M5TA 2BBWA 2CNLA 4HJXA 1RVDA 1XDGA 2XE4A 3QXXA 4M1SA 4K05A 1WO8A 1QLWA 2JGDB 2OM6A 3L7AA 4FFPA 5CVEA 3KEGA 4V03A 3WB9A 4Y2QA 1V6SA 2V1XA 4JSTA 3CKLA 5LP6A 4DV4B 5KHAA 1Z74A 2QP3A 2DTEA 2ODTX 4CM6A 4QOIA 4YQFA 4CIAA 1Y8RA 1W0JA 1TLLA 2CUZA 5HCIA 5JS2A 1Z18A 4PONA 3DLHA 4JBGA 3NATA 1DAOA 4ES6A 4MB6A 3GWZA 5KTRA 4GPBA 3JY6A 1LBTA 2C2BA 3F7NA 2PV0A 3LP8A 1PLKA 1WY7A 2IS2A 2PG3A 1NXOA 1G3UA 4CQMD 3RU7A 1WSDA 1C2TA 1ZSNA 3EARA 2B2NA 1G20B 2IUYA 3E3OA 3KT8A 1U3VA 5TJ9A 1CB0A 3NANA 4HDSA 4GOND 3EPLA 1GPWB 5BW5A 1Q3TA 2QJWA 4I4CA 1VJ5A 1F48A 1X7HA 2Q1SA 4ER6A 5ALTA 4KR3A 3DDNA 2PKWA 5EI5A 5GM2A 5JS1A 2GBPA 3UJ9A 5CM8B 2NXJA 3OZSA 4COOA 4HSEA 3RKRA 4AY2A 2BI8A 2VHUA 3R5TA 4I8XA 4B6GA 2P0EA 3P9PA 1UOEA 1VTKA 2QGNA 4V0RA 1L3IA 4I08A 2RG7A 4MJ7A 4QQFA 5B5SA 5KWSA 1J21A 1J5PA 3AUTA 3NRBA 4MKRA 2IUTA 4M9UA 5FEMA 4UTRA 1WUYA 4UDYX 3RYIB 4EH1A 4ZJPA 1ICIA 1SC9A 2NYUA 1H2EA 5F64A 3VJMA 3RVDA 4EY6A 4D3XA 5DGHA 3IULA 5FWAA 4M1EA 3WC4A 4GSYA 4IYJA 2K7ZA 1QX3A 2ZIXB 2PL5A 2PLFA 4RD1A 3QEJA 4BMDA 4Z4FA 3FZYA 3GLHB 2G9UA 2O2YA 2OM2A 3U1TA 5B2EA 4LQ4A 1THTA 2HCJB 5JO0A 4A6PA 1Y5NA 3SQOA 1L3BA 3UQZA 2CFIA 2F9LA 1R4AA 4KDFA 1X86B 2VAWA 3T1NA 4O4IA 1C9KA 3HJNA 3BWEA 1YIOA 2JGDA 1WPXA 4PR3A 4EFKA 1D2MA 1E4EB 3K5IA 3OSZA 4LPKA 4YEDA 5EP4A 1WW2A 3OM0A 1EEHA 2FWAA 1RM3A 3HZRA 1YS6A 2PS0A 2D2VA 5DNWA 4EO4A 3SDZA 2YBDA 2R6DA 5IMSA 3HJTA 4H3VA 3TW8A 2QRKA 2H1FA 1GFIA 1RM5A 1VLZA 2YZKA 3UJAA 2G9QA 4ZVSA 1A8IA 1GAXA 2Q21A 2WG1A 4R4JA 2XWQA 1ICEA 1U5AA 1ZD2P 3VPCA 1AF4A 1HLGA 1EG2A 3KKQA 4H9GA 4XRRA 5A4KA 3L8YA 4MIYA 1PD0A 3ORFA 1U3FA 4CM1A 5EIXA 1KQPA 1G20A 3DO5A 3R0VA 4NULA 1DRJA 1N1GA 3GJRA 3JATB 4JLNA 4W6ZA 3VU9B 3I1FA 3QVKA 4EPWA 1QAMA 5JC1A 3VSCA 1EA7A 5NULA 2HA5A 4OQEA 1DXYA 1JKIA 2PLRA 2WYWA 2VHVA 4M89A 2Q9UA 4RE6A 4U8HA 4CM7A 4B76A 1MRZA 5IDWA 1CV2A 2C2XA 4MARA 4CWAA 4ND3A 3IURA 4YAEA 2B21A 1YFZA 3SE7A 4HH1A 1IHOA 2C4NA 4GUAA 1GO2A 3Q87B 3R3SA 4ALNA 1KNXA 3R9WA 3RYIA 2AG5A 3RK1A 5LZ5A 2H1VA 3A7EA 3GLKA 1U0EA 3U09A 3S8EA 5KYXB 5HJ5A 5KPJA 3GXOA 1F5SA 1SVIA 4DVJA 3EMBA 2ZIXA 4NBNA 3VMFA 1TC2A 1WZNA 1FJXA 3GLHA 2WWXA 3DZ8A 3SF0A 3ZK7A 1LVGA 2NQTA 1ESZA 5JYCA 3PNVA 2V45A 1CJUC 3IQEA 3LBAA 1EK5A 2X1MA 3ZZUA 1S4QA 4ZN6A 5AMXA 3W1VA 4NX2A 4WW0A 1Y8ZA 2LWIA 1E4EA 1RPNA 2K4MA 2Q3LA 5L6LB 1PS0A 4X8MA 3U37A 4HQLA 3OJEA 5GWXA 4F4CA 3PEVA 3K0AA 1FU8A 1QHYA 1RZRA 1SN7A 3G85A 1KTIA 3S27A 1WPGA 3FFTA 2CLSA 2YW2A 5HF9A 3J80A 4XUEA 5CNMA 2HQ1A 2WMNB 1OW3B 5D01A 2CYBA 1Z88A 3CGGA 4PVDA 1PNVA 5L7TA 3O1HB 3WAGA 3D8BA 2PH3A 4MW1A 4M7PA 4B82A 4D82A 1YMUA 2K87A 4BZZA 4FLFA 2HU8A 1R3UA 1Y5RA 3JATA 3MT7A 3VU9A 3ZY2A 4NYIQ 1GPKA 1WCV1 1U31A 5D5PA 3EDQA 3IQWA 3O84A 2UU9B 1YRLA 3PGA1 5EQJB 2CMDA 2C58A 3QVXA 2JH3A 2Z4SA 2HLNA 1H4QA 1B0AA 3EMVA 5BORA 2QD2A 1D1QA 2BLNA 3CNQS 1AQIA 3GBSA 3TZKA 3VPDA 1XZIA 5HJEA 2NU8A 1ORIA 3KO8A 1E3MA 3IE1A 1DAFA 2EIXA 1CUHA 1J8MF 2H1OA 1CC1S 3M6UA 2P2DA 4M4SA 3B1XA 3UGQA 4S0XA 5EIEA 5C5CA 3WWDA 2HFKA 1DQYA 3MCAA 3RT9A 3GAMA 3EYAA 3ZHTA 5AW5A 3KFLA 5DHFA 3TECE 5J23A 1CIPA 4REOA 4YXWD 2QTVB 1MENA 4C6SA 1HYGA 1ODLA 5CYFA 2A3NA 3A6LA 3BHMA 2OYCA 2VJCA 4PZEA 3ADDA 3IV7A 1MPXA 2IV7A 1DTWA 1T4CB 1TLFA 2D0OB 4FNMA 4IUCS 3SEQA 4A8PA 4W5NA 4XCXA 1YKFA 4NPAA 4DL9A 2X8WA 1VDMA 1X8XA 2QT0A 2TYSB 3S2YA 1BTOA 1TIKA 2I7CA 1CU1A 2HU5A 1U2ZA 1FMLA 1TF2A 1P5RA 2VUSA 3QWFA 1XNHA 2HRCA 1T8PA 4MJXA 1YZGA 1XTUA 3E8MA 5LA6F 3OZGA 1JXAA 2BDUA 1SVNA 1OKKA 2FVXA 1OV6A 1TZMA 1U90A 1VYTA 2HDNB 4R3NA 4ZEOA 2O8CA 1L8AA 1XOIA 4QFCA 4RHCA 3A31A 4OGGA 2Z6AA 1KBQA 3VKVA 4BVGA 3HBAA 2XSZD 4TOIA 1BVRA 5F5NA 1TF7A 4R2HA 2R6CA 1P3Y1 3AYZB 4LGCA 2W83A 4O29A 3WJ1A 1OB2A 4PC1A 2FKNA 2ZE7A 3VO8A 2J0QA 1A9QA 2CXNA 4LDAA 1NJ2A 4UMFA 2JJ8A 3QUCA 3EODA 3Q1LA 4IEEA 4CKBB 3TQFA 1PJAA 2JVJA 1CZLA 2PS1A 3B3AA 2OD9A 4JLOA 2V4ZA 4TL9A 4BMOB 4DBLE 3BERA 3MCUA 4JROA 3WISA 2GCPA 2ZJ0A 1XDUA 3AY0A 3P4YA 1D4ZA 3OLVA 4IS2A 4KXXA 3INGA 2WWIA 4K9MA 3WK7A 3JD2A 4MLCA 1USUA 3QHQA 4UFNA 2WI8A 2J3EA 2RGXA 4QT4A 1W1WA 1LRKA 1VLLA 1ZKMA 2NWQA 1C8KA 4QU9A 2FY8A 5EERA 1OH8A 1OGJA 1Y6ZA 1NUUA 1FRQA 3PD0A 4RGVA 1ZD1A 2C5HA 2I3AA 1O95D 2OZKA 1U2SA 5AK3A 3D5QA 4LTNA 1EQ2A 3E9NA 1WU8A 3KUKA 2OLJA 1JKJB 3BOSA 3KZMA 1NXVA 3VHQA 1MJ5A 2DUJA 3C39A 2YUIA 2QTVA 5AJHA 2LIPA 4YIKA 1YHYA 1VHDA 4PGAA 2DKFA 2OCIA 4WZ6A 1UK7A 4Y2PA 5E7QA 3C3BA 5CBPB 1V8PA 3RTDA 1T4CA 2RKWA 3DM5A 2G5PA 3DP9A 4HQNA 4NIMA 2I0FA 1E5VA 1KPHA 3MJDA 5EUBA 3H8SA 4PZUA 4BJ1A 3SHFA 5L3QA 3LOQA 4U2BA 4OX9Y 4UOQA 1KH3A 4JLAA 1M1NB 4N48A 1WKVA 2FZWA 4HWOA 4YREA 2WJWA 1RKUA 2QR2A 2V7UA 1PEYA 1KMCA 2CC2A 3RWOA 4AF8A 1PG0A 1WTAA 3RU2A 2VYNA 3TMKA 1HZJA 3H4MA 3PJEA 5FAXA 5ITWA 4CL8A 3I30X 2CDNA 3PFIA 4KLAA 1J2JA 4KIUA 1A9PA 3EGVA 1MIHA 4HXYA 5HKBA 1O03A 3UXEA 1VRWA 2CSUA 2QMHA 1RYZA 2RI6A 3WDKA 2A1TS 4B4DA 3Q85A 1I1NA 4K6MA 5I01A 3KBBA 3IIIA 4PVCA 4LC9A 4QODA 2WJPA 4FGSA 4FKZA 1TQ2A 3DKRA 4UE3S 3KL4A 3IHWA 5K3OA 1BAPA 3MGKA 1H0SA 4EOGA 3DL7A 3SBDA 3SYLA 2VHEA 4LFCB 1AM4D 1LZLA 3EN0A 3GA5A 2VHCA 3SY8A 1CR0A 4YN3A 2HHAA 1AN9A 1QV9A 1WIWA 5JAOA 1U2RA 1G1MA 1HO3A 1L7OA 1N6OA 2ERXA 2WAYA 2R00A 4KFUA 4KSCA 1HDGO 1LF0A 1OCEA 2PUFA 4Y2YA 4JENA 5K8VA 3PT5A 3RE1A 3TE6A 2O57A 1Z25A 2OHJA 1QFMA 4ZYYA 2OVBA 3KKOA 3O2JA 1ZIXA 1SMKA 2NSJA 5JWRA 2IW1A 2X9LA 1JFRA 2JB9A 3KDSE 1UFRA 2JA1A 2PR2A 4YP0A 3NBMA 3QV1A 4MUAA 3TR5A 3E6AA 4PZLA 4CFZA 2EC5A 1NQOA 1ZHHA 2VF4X 4HMQA 1KFBB 1ZIYA 4CUJA 5CBPA 1RI1A 1C7IA 3TW6A 3QXSA 1D07A 1E1RA 1NLZA 4ZCLA 4WXPA 4B7XA 1KXJA 4ER0A 2CHEA 3RC3A 3S7TA 3W8FA 1Z8HA 4Z3KA 2I6SA 2JPDA 2PUVA 3M1YA 4QYWA 1WUKS 4R2IA 3W1EA 3NTOA 3KLMX 4HDQB 1R64A 3W7AA 4ACBA 5FLYA 1GILA 3NVMB 4RQUA 4D0NA 4UFOA 3Q3CA 2ILTA 2XD4A 2XNJA 3BN3A 4Y2JA 4XLLA 5L3ZA 5I45A 5HGJA 5J3JA 1N8SA 3P9QA 5BN1A 3HYLA 1I4TD 1JQAA 4YMSA 5HNKA 2ZI9A 3PLRA 1F20A 4LGVA 3ZWNA 2Q9CA 3RADC 2PWZA 4A8JC 1EHCA 2EEZA 4B75A 3F3KA 3KKNA 5B4UA 4M0DA 3A6GA 2CYAA 4EHIA 3TMAA 4X41A 2ON6A 3PWKA 1NXSA 2XCUA 4M6WB 3V8QA 5LJIA 3SYNA 3O8RA 2GKGA 2GO7A 1E69A 1N6RA 3MPUA 3LUPA 2LNDA 4MWBA 2UUAB 4CQLB 5H80A 1JXOA 3LVBA 4W8OA 4URVR 4PSCA 4PO3X 3KSBC 4BLTA 5FUXA 1EX6A 1V8BA 1ULHA 2Q5CA 3OESA 3QU5A 3KJGA 4GMDA 7GPBA 4ACAA 1OYYA 4QGHA 3P5SA 4W8HA 3ICEA 4G89A 3B2NA 2RI0A 4GPD1 2ZIZA 4NNJA 5EIOA 2NVWA 4D43A 1A9YA 3SBOA 3H4TA 4JUCA 2WWWA 3V2UA 4HVLA 2DWPA 1UANA 2WE8A 1IVYA 3MWDB 4TZ6A 5JSYA 1ESMA 1P2TA 3PG5A 1NW7A 2VRWA 4HR7A 2X8LA 1CR2A 3R23A 2Z5GA 2XUKA 4JP8A 3AONB 3HKEB 5LA6A 2RKOA 1K3FA 1T1GA 1V6CA 2VNSA 3CUSA 3LHKA 3MJRA 5CFQA 1VLHA 2C4MA 5KOYA 2GJ4A 1Z6QA 2PUAA 4W4TA 2FGJA 4PYOA 2VDWB 2Q5IA 2XXBA 1WMEA 4DRZA 4DYHA 2YXPX 5LOVF 5HF5A 3FWKA 3RREA 2AI2A 3K20A 1X1DA 1IAVA 5AP9A 2BSAA 3PP8A 1TM5E 3DSRA 4KE6A 3GJ3A 5AI8A 1N2SA 5JFOA 2ZB4A 1Q2XA 1ZVJA 2XYQA 121PA 4JNCA 3THSA 1DKNA 2CMKA 3PXBA 4NNPA 3UAVA 1NA5A 1JDZA 1NF9A 2ODPA 5CT9A 5DHPA 1XTQA 3DL4A 1YBFA 1N3YA 2V6MA 2BW0A 4LDPA 4MEBA 5BYBA 1JU3A 4C21A 4GP9A 3WAJA 1MHPA 3BD8A 2WFZA 4PRYA 3UAOA 3TJZA 1ECGA 3JZAA 2OCPA 1P8JA 2IW3A 3MRTA 5DBFA 3B6JA 4D3FA 1VKJA 1Y6FA 2ZLBA 1BKDR 4Q21A 1QOQB 4M6WA 4L02A 1K6XA 3WL6A 3SHWA 3ME5A 3PFGA 4ZARA 4NXMB 2JS7A 1UF9A 3EWSA 5JPIA 4WLVA 1FYWA 4WVLA 4CQLA 4HAZA 4IUYA 3FSGD 4RHFA 3X2SA 1M1YE 1DIBA 3A27A 2BY4A 1FYFA 3I42A 4UM9D 2IZOA 1V1MB 4WLFA 2CEKA 3LF2A 3B3FA 4DMFA 4HRAA 3RSLA 1P0MA 1QGDA 1H8HA 5CMLA 3E9EA 2H65A 1BKSB 3MJTA 3C8UA 3MWJA 2EF1A 3N07A 1DHRA 4AN0A 3D54D 1FXSA 3A2NA 2BBTA 3C7KA 2WABA 1LJUA 3P2MA 4O1HA 4OHVA 1HM5A 4B3DA 1OX6A 3IOYA 3AG6A 5BN5B 3HKEA 2A7XA 2QHXA 2WIBA 3LLSA 3W5AA 3H1FA 1ORTA 4YWHA 5ALLA 4DLRA 1E7QA 3B6KA 3GELA 5FX2A 1LLQA 2ZSIA 3A6KA 3H5LA 2VDWA 3WSVA 1GA6A 2FWJA 2R6JA 3L7LA 5FNZA 3GA0A 3GJ0A 3O1IC 2V6GA 2W2QA 4GZMA 1ZH2A 4H16A 1OU4A 1XN1A 1RYBA 5DNAA 3TM5A 2NZJA 3LWBA 2EZUA 1JTEA 1Z75A 2QMEA 5BVGB 4CR6A 2NZUG 4NU6A 3CR3C 1C0IA 2OXEA 2R25B 1XJ0A 3IXLA 4MTLA 4XTCS 1WBBA 1LLUA 2B35A 4KAAA 1NFFA 2F2TA 3T1TA 2V58A 4X85A 2DR2A 3ZJTA 4WAUA 4DDTA 2GM3A 2IITA 2B7CA 5BWOA 5KYGA 1BDJA 3DA8A 1Y9EA 2CW5A 4YT8A 1AO3A 1MX5A 2RK4A 1G6Q1 2X7HA 3R0QA 5CXUA 5JTUA 2JLUA 3QITA 2BFNA 4IIBA 5SYMA 2DBQA 1ZNWA 1E2KA 3NM6B 4DBZA 1OWPA 2RONA 4N6OA 4FXPA 1GQSA 1QGAA 3DOUA 4QDXA 1XQ1A 2PGNA 5I7SA 4FEEA 3G17A 4US0R 5K3DA 4HFRA 3W8DA 1DKQA 1WP4A 1ZOLA 1AB6A 3C6QA 4WVFA 5DWVA 3RVKA 3R4VA 4WXRA 4ZCTA 3JVVA 1HDYA 4U7JA 4HD8A 4HBZA 1P4HA 4W7SA 4FE7A 5DK4A 1TCBA 3E5RA 5JAQA 3O4RA 4DTIA 4ZDKA 1IHYA 1V1MA 1I6LA 4ZC1A 5KJ1A 2GN0A 1OTHA 3F5SA 3UBTA 2JLSA 4FUQA 4N7MA 2ZBGA 4MPTA 4B4WA 1WB4A 1G6HA 1OUMA 3QVOA 3AM5A 4BKMA 4DSUA 2AFIE 4JBXA 5B6PA 3ORHA 5LMZA 5LP1A 1NVAA 2C61A 2UVDA 5LOVB 3E8SA 2I4OA 2C95A 2QW1A 2BEJA 2YTZA 1E1LA 3GZJA 3O2NA 1U4SA 4RK5A 4DCMA 5BN5A 1XPUA 1K75A 3E9CA 4DC0A 1MG0A 4XWTA 1LKZA 3TTYA 3ZHVA 4KUEA 1HL7A 2ZKLA 1A2OA 1E3JA 3GG9A 1PJTA 1RYMA 3AF2A 3WWPA 2WUWE 2DUWA 5DM2A 4BBPA 5ICSA 4DNXA 2P3LA 1BO6A 3PF8A 2JG3A 4E5SA 4KN6A 2NUBA 1XE3A 5BVGA 1D8TA 5EJAA 2YJNA 3KOWA 1J2TA 4ABYA 3G2NA 4OYYA 2GOYA 1KZ7B 1IXKA 4JXZA 5FPQA 5LWHA 1A9TA 1R6UA 1AH2A 4AP9A 1HSOA 1WW8A 2E6KA 2NYAA 2GMWA 3ANXA 1L4KA 1QZXA 4P5DA 2CDAA 2GEJA 3DFUA 2Y99A 3DZBA 3KPUA 3L0PA 3LS2A 2Q45A 3KEMA 3PWZA 4BN4A 1Z34A 1ZQ1A 4N4AA 4RV4A 4EMTA 2H9IA 2C9DA 2HJSA 3DF7A 4E21A 1FMFA 2XYHA 3VVLA 2X4DA 3DCYA 5B7GA 3D7MA 3OTOB 4S24A 3ZXYA 1MMFB 2FP4B 2AE2A 2ZEJA 3PDCA 3G2PA 2JHAA 4TXHA 3TPFA 5KX5F 1EE9A 2FFHA 3ZU5A 1YR7A 1ORVA 1ESCA 4EYGA 5E6RA 1A72A 3DAHA 3MXOA 4CEIB 2ICAA 5M2QA 3HP1A 5DX8A 2HMVA 1UJ5A 2PD3A 2YN4A 3OF5A 2D00A 3QE3A 4B6FA 3QX3A 5TV2A 4GMXA 3HY4A 3AOEC 5J58A 3EC7A 4X94A 1HT1E 3C6KA 4BQQA 1QRAA 3USZA 5IWAB 4F56A 4FINA 1S9DA 3QTBA 5JLAA 3MCVA 3SSNA 3ZE9A 1IQUA 1XDBA 3T94A 4BC1A 1JPVA 3ZV5A 2YH2A 1VJCA 3COZA 3E3LA 4XPIB 5LOVA 2JAOA 4EG7A 1UZAA 1Q0UA 3EXAA 2PZFA 1KFEB 4MB2A 1G8PA 1TEHA 2JVIA 2OR3A 3L1JA 3TLCA 2ECPA 4G8JA 4HKTA 3OT1B 4LSMA 3T5DA 4UCXA 3DJFA 4JQCA 3AKEA 1OJ7A 2Q5FA 4JJAA 5F1KA 2K2QB 5GY7A 2WT4A 4DUGA 1SCDA 4PFJA 5E9AA 4EQ6B 1DC8A 2G63A 3QPVA 2IHZA 4BQRA 2P6PA 2ZRKA 4UD2A 4DXAA 4G0ZA 2AQIA 1D9XA 1FP7A 2JZCA 2OCXA 3LY9A 3ZJ4A 1IM2A 2EG5A 3KP1A 3LIPA 1HDIA 1I33A 3JAMA 2H1CA 4UZEA 5E1OA 3OFVA 4NR0A 4DA8A 1MW8X 1UKBA 3QKTA 5F77A 3STHA 3H4VA 4HGYA 2E7ZA 2R11A 3R9IA 3UCXA 1W0KA 1H6CA 2VCEA 3E4CA 4WMLA 3VDXA 1IHDA 1BH6A 4XB6B 4KW7A 2R1TB 2A2ZA 2GK4A 1RHUA 3GI1A 5FPPA 1Z68A 1TW2A 1K9VF 2FP4A 4UAUA 3FCYA 2XNKA 3A10A 2AFRA 4Y9UA 3OO0A 4UARA 5JY6A 3F7MA 4ARAA 3ASVA 4CEIA 1P6UA 3O4HA 1TC1A 2I3DA 3LPAA 1KMIY 4M53A 5DEOA 3K72B 3KX2A 3MRXA 4OI1A 4DW8A 5DNCA 1DSSG 1JLHA 3LSYA 3IA2A 4UZFA 4Z4IA 2DBYA 1Z12A 1ITZA 1H5QA 2IXEA 3UF0A 4B6RA 4JCCA 1K8XB 5IDYA 2WDZA 2AGVA 4J3FA 4BV9A 2CJYA 2MTBA 3KB1A 4UTVA 2GB4A 1EUYA 3Q3IA 2BMAA 3BA1A 3VDQA 1SUDA 4XPIA 2Z4TA 3RKUA 2ST1A 2RAFA 3ANNA 1JYEA 4LDQA 5BNIA 2PBRA 3UAXA 3AWDA 3I23A 3PFBA 3EQ2A 5LBUA 1KI4A 3PQCA 3ONDA 1CETA 1U3WA 3ZLVA 1RXWA 2OC4A 1C7RA 3LUHA 2QVLA 4J1QA 2P2ZA 5CH8A 2NIPA 2I91A 4EQ6A 2OGTA 3KL2A 1P45A 3VU0A 1GCOA 5EPOA 1KJYA 3DBIA 1RQXA 4PZAA 5CFLA 4JLPA 1E5TA 4UBLA 5FL7D 4CV3A 5B7PA 2AJLI 1OU0A 2PRSA 5JNTA 1J0XO 2Y1XA 1H9BA 2IH4A 3TS1A 4DIFA 4A03A 2AN4A 4G1FA 1H94A 3T1OA 1NDUA 5TQ0B 2D5BA 3CWCA 4J9VA 4RIHA 4BEBA 2JBHA 5KX5B 3KYIB 5CVDA 5KJ6A 1X1EA 4K2AA 5EJIA 3M1LA 1QAOA 2R1TA 5B4TA 2N1MA 5AUQA 4C0KA 3LKDA 1FVXA 1HFEL 4CGZA 4AWAA 3V1MA 2HD4A 5B30A 2YJ5A 2WIFA 1Y1RA 1I2DA 4RH3A 3I64A 4QNNA 1BS2A 3QFFA 4Q3BA 1E2PA 2Y66A 3QUSA 5IH7A 5D51S 3R8CA 4EZBA 2QVZX 3UGJA 2ECFA 1QFZA 4JCOA 5EHGA 4ZDWA 3OX4A 2LP4Y 2YZ2A 3IUJA 2J59A 2XYGA 3CJTA 1MQ8B 3JVIA 1GSOA 3CF4G 1HPLA 4LV8B 4YY3B 2QTTA 1KOFA 3ZWWA 1HV8A 1RSZA 4JX8A 4QUGA 2QZJA 4DR3B 4MQBA 3RRFA 1PEAA 2O0KA 5AUNB 1X8LA 3AHHA 3HCDA 1Y34E 1IJKA 3EPJA 1O87A 1SVWA 2YJ4A 3BHJA 2B4TO 4N6NA 2O1EA 2RH4A 1Y1QA 4RGBA 1GXSB 1SO8A 1JQKA 3GUVA 1AS0A 1A3CA 1FLVA 1Z35A 2CF6A 2GPAA 2QN2A 3KKZA 2XEXA 4RJIA 1GCUA 3R8XA 3TKYA 4A10A 5U9CA 1ABBA 4E5MA 2EKLA 3RVSA 4C4SA 2J31A 3FNHA 4JY7A 4YX9A 1ZUNB 4PGGA 1TNDA 1MFPA 2GF9A 1MO2A 3RVQA 1VSQA 3W9BA 4GI1A 1COZA 2B83A 1EWYA 2RFLA 5ENDA 2CLLB 2UYYA 1A9SA 2AZMA 3TIIA 1WSAA 3QG1A 1U28C 1WUIS 2FW8A 4XJVA 4YGYA 3MIZA 3RSSA 3N6XA 3SLKA 2C2YA 2G67A 5TQ0A 1CQIA 1SIBE 5IVIA 5FBZA 3EPHA 2IXBA 4ECEA 5KX5A 2ZS8A 1I7PA 2NO9A 4MVJF 1FSFA 5CBKA 1Y6RA 2PMEA 1K4YA 3STTA 1I4DD 2QVYX 4WERA 3AR3A 5ALMA 1NVFA 2VG8A 3SS8A 1N6IA 2VJQA 1AZLA 2OFOA 4YRAA 3BEOA 1QG0A 1YD7A 2OCGA 1J8DA 2RJOA 3WYNA 4D9FA 2RKBA 2XBUA 4FOOA 4ITVA 2AR7A 4JDPA 3THOA 2W70A 1EVYA 2QG4A 4UMEA 1Z2DA 3L0CA 2RJ3A 3DWIA 4KLCA 4X6XA 4IDPA 1M2JA 4A92A 5AI4A 4U1RA 3V1YA 3WRXC 2CKDA 2R8RA 3EH2A 3ZGXA 5DASA 2KE5A 2XUFA 3L79A 5BSTA 2DUMA 2JIMA 1ZOSA 1O97C 5K0GA 1DDOA 3ADKA 3GLFE 4WOJA 3UKDA 4IRMA 2IRWA 2ZYUX 1M5RA 5TF4A 2W6MA 2PYIA 1CDOA 1E94E 4G23A 4FFRA 4WXEA 3AJAA 3V34A 3WZMA 4PN3A 3CF6R 2BZGA 1GXSA 4EA6A 1QIDA 1QP4A 2ZVQX 1OZAA 8AT1A 2I71A 3DEKA 5AIAA 4CV1A 5JD3A 3GNSA 2J3LA 4YQZA 1GUFA 2E1PA 2XE8A 3HE3A 3PE3A 3PYXA 2Y3IA 4PNPA 4MR7B 4TQUS 3S7ZA 4JB0A 1ZUNA 2BEVB 4GICA 3QBDA 1YL6A 5B2ZA 4NG5A 1SBTA 4NPHA 3T0GA 2R2GA 3WNZA 5KSWB 3IBGA 3OQJA 4LS3A 2WIKA 5EWJB 3RSGA 3FUXA 4HH3C 3ZIUA 2VDRB 4BZQA 4TSKA 1TECE 3UAGA 3G1TA 1PF7E 1E6CA 2WYUA 3IERA 3OOWA 4GLOA 3JRNA 5TS3A 1H9AA 2R97A 4URUR 3U3RA 3WB2A 1LGYA 2G04A 4Y2SA 1VKRA 1TUBB 4MWGA 1X1TA 1T3LA 2C7VA 3AFMA 3E61A 4Q1DA 3WL4A 5JMWA 2DQZA 2YHUA 4H4EA 5AK4A 3MHPA 2QSYA 2OHOA 2QRVA 1KZHA 3UVEA 4E22A 5LDGA 5BSHA 1Y0BA 3DMDA 1W4CA 1QIKA 1GIAA 2A1TR 2X9NA 3GFBA 3OECA 1ZISA 4PPYA 5F9MA 2O8EB 2FWNA 2UUBB 5FUVA 4Z86A 5KQRA 1T5HX 5K4GA 3STVA 1J56A 1H1DA 2WV9A 5CHEA 4D57A 5KYKA 3B12A 3B6EA 3NTQA 1MT0A 3IXQA 4KX3A 4WZAB 5IN4A 2RAPA 1VYVA 2BOVA 2C3UA 4BS9A 1VLMA 3F9RA 1EP2B 2L2QA 1U2DA 2ZPUA 2IS1A 2NVOA 4C2UA 4CF3A 3U3DA 4OF4A 3K6SB 5D87A 2G40A 3GRYA 1J2YA 4MUYA 4RZ3A 3ZY6A 3LW8A 3TMYA 1BNCA 1T13A 3PQFA 4A8TA 3WQQA 4BWGA 5JI3E 1HLDA 4BDSA 1V7PC 2HF8A 4UJ5A 4M9ZA 2W6NA 3FZQA 5JD5A 1W19A 4Q1VA 4R69A 1GOTA 4MR7A 3AJ9A 4BZXA 3NHWA 5K1ZA 4LE1A 13PKA 2FSGA 3H65A 1NUAA 2RGEA 3C7TA 4P4LA 1B1CA 3OZ7A 5EWJA 3PKJA 4D79A 1IZ7A 5HS6A 3S28A 3OQHA 2FN3A 2PGOA 1HBJA 3FR7A 2XGOA 5AR1A 3G9XA 3PUJA 3U0VA 4B0OA 1T5SA 1KJWA 4EFDA 4DJTA 4LBVA 3ZTTA 1RABA 1A7UA 1TUBA 3U44B 3O3OB 1NBEA 1IB6A 2EYQA 2I6GA 4G1CA 5FO0A 1DKMA 3N2LA 2O1WA 1YZYA 2H54A 2Q8QA 3PB3A 3NBFA 3OFSA 4N47A 3VZDA 4M9RA 4C04A 3HGMA 4Z9FA 5ALKA 1ZOIA 4U0JA 4B0PA 2O8EA 1GTMA 1Y3HA 5G40A 5A5EA 1KK0A 2OP1A 1U0FA 2V4UA 1VMEA 4TYPA 1ZPDA 1K88A 4WA7A 3V3KA 3ZWCA 1WDTA 4I6EA 2VNHA 4RFSA 2WZCA 3M6WA 3MA0A 1WB9A 1G291 2FR0A 2VTDA 3GP5A 3IP9A 4YPVA 2OCKA 5AM2A 3KR1A 4WZAA 2YDYA 1C7JA 3HZZA 4W1SA 4AZ3B 1E2JA 1JFFB 1XZQA 1XF1A 3CRRA 4IGFA 4EL5A 1QQ6A 3BS4A 1JR3A 2P9TA 2PU5A 2QYOA 3NBYC 3RLIA 5I4BA 2AW3A 4M8LA 1OBCA 3K6SA 3MYYA 4HY3A 1EM8B 4I5FA 5EESA 5BWNA 3EUFA 2XDWA 1QHSA 5ALFA 4F46A 3MAGA 1XD8A 1TA0A 2EKZA 4PC6A 4YRJA 5LPNA 1ZYUA 2YWHA 1K1EA 3OEHA 5K99A 1JS1X 1FMCA 3HP7A 1XCJA 1OTXA 1AXEA 3ZY4A 3T7IA 3GLQA 1VG0B 4ISBA 1OLUB 2CXUA 2UYOA 2Z83A 3AR2A 4JC8A 3ZWPA 2E82A 1ZMTA 1WXEA 1U11A 2WZDA 1E79D 2PRYA 2SCUA 3ZQJA 4QGSA 4ZEVA 1CG6A 5A6VA 4LY0A 1O0BA 4U6SA 2QRPA 3GFRA 4MVJA 4ZT7A 4L9WA 5EHIA 3VISA 4P5EA 5DP2A 5JQGB 1E1QA 4KLRA 1G38A 3U6BA 1NXPA 2E2WA 3CN9A 1WUTA 2DPLA 3WLPA 3ZW7A 3DEIA 2H1SA 2JGEA 3UMFA 3MXTA 1A1SA 4XGNA 2QI9F 1UFQA 4LF6B 4HDAA 2F3UA 4JT4A 1TL7C 5ALIA 3JVDA 2PSDA 5C8ZA 2X0NA 4JEUA 4WN3A 3NCTA 5CVCA 5DTJA 2R62A 4G1VA 1G5FA 3X1ZA 3PI7A 4MDFA 1RIIA 3BL8A 1C4XA 3CGWA 3RS5A 5FWXB 1SUSA 3GHHA 3CIFA 4LMPA 2PE5A 2JLXA 3OMLA 3TDNA 1SXJD 2Y0DA 3ZXUB 4GQAA 1WETA 1YDFA 1T2DA 4MUHA 4DB2A 2C5EA 4K6GA 3A0UA 3THWB 1QFSA 4X63A 1VJGA 3IAHA 5H81A 3ZWOA 1R6XA 2IH5A 4CM5A 2XJ9A 1XZPA 2JFVA 1JFFA 2JF0A 1C3EA 3OHMA 2DM6A 5IT5A 2QUIA 1Y89A 1AUOA 1YJ5A 2UVPB 2X3YA 4R1QA 1UBRS 4EELA 2IU3A 3LYHA 2HADA 5T67A 1YAJA 4JOCA 1N6PA 3HXOA 3U19A 4QWMA 4DMRA 3JR3A 3BB3A 4GBJA 3FUTA 3GZNB 4G0QA 3RD5A 3OLWA 1JHOA 4GU5A 1GPYA 2ZSUA 2Q6OA 5BP7A 1LV8A 3JQ7B 3R8FA 2R8EA 2Y2UA 5AQ1A 4RLFA 2O07A 3ROQA 1A9OA 1L7NA 2GTHA 1EDDA 1AF7A 1OLUA 2ODAA 2XOKD 1WXFA 5G4KB 2I03A 1N5KA 2Y92A 3NXSA 1COWD 4O08A 3T4EA 3FI0A 4FN5A 4UXHA 1R0XA 4LWPA 3N59A 3VVMA 4GE3A 3FWNA 3ZTYA 1FSSA 4FONA 1ZSYA 1Q7RA 4A0QA 5AVZA 2O20A 4MGKR 4L4ZA 5H1YA 1PR0A 5B12A 4U02A 2L19A 3V48A 4WCFB 5HQTA 4NQZA 4PV7A 2PNFA 4X54A 1XNRB 2IY7A 5AI9A 2R8BA 3GL9A 3IKVA 1FP4B 4NYMR 1U8TA 4KPUB 3SXPA 4XJXA 2AOVA 2V7TA 2WHPB 2NVUB 1MC4A 4BN5A 3FLEA 4WKNA 2HK6A 4BCDA 1QPZA 4C20A 2ZT8A 1N6HA 3HKBA 2J85A 4NZPA 4LV6A 5HIIA 3BYZA 2QTFA 4YJDA 2UAGA 5FWXA 2F7SA 2GEDA 4LCJA 3WY9A 4Z1OA 3OFNA 1OBFO 2B7BA 2BDTA 4DV7B 3AM3A 4HEQA 1KPGA 1JG4A 2D0DA 3T9DA 2WC1A 4XDYA 1FDUA 5JDIC 2PWAA 4DBLC 3ONNA 1YR1A 1X8JA 1CUYA 4QPZA 5I3CA 1QH0A 3THWA 2IHNA 1SCNE 3HNPA 4DSTA 5H3CA 2NACA 1JEQB 4LFBB 1VG9B 1X14A 3ZK9A 3AGQA 1FUYB 1QDUA 1T0UA 1K7CA 2UVPA 5K01A 4LJ6A 3ZNPA 2UUOA 4DLKA 1MCZA 5IG2A 4E2ZA 4LVNA 1WX1A 1MIOB 3ZU4A 4WLEA 1FS5A 4WY5A 1IPFA 2Q6TA 4D92A 1PP4A 3GZNA 1K2WA 2R85A 2LW7A 4X93A 2VUTA 5AKLA 1E9FA 4CI0B 4DPLA 1EK0A 2EHJA 1ECLA 2XDYA 3CF0A 1ZS9A 1XK6A 2KLHA 3B2QA 3DVAA 3JQ7A 4UUAA 5DWDA 1M10A 3VRHA 1KI1A 1W9HA 2QL7A 2V7EA 1WZCA 3AY7A 3URKA 3PEEA 3DL2A 4G5OA 5G4KA 4PN7A 4E14A 5IAOA 3C8DA 3HACA 4RDHA 2JI9A 1UIMA 4YCBA 5BUCA 2DERA 1J20A 2J3JA 4NBTA 1KSGA 1E2MA 2GLUA 4BFWA 3TXYA 8ADHA 3W2HA 3TGPA 4HN2A 3LOPA 1WS6A 2CLFB 3DUFB 4FE4A 3RG2A 4IO1A 3AB8A 3LXXA 1DEXA 2Y4NA 1A2QA 4WCFA 4XKJA 3VXKA 4BMYA 3AIMA 4CHTA 2Y6VA 5ICMA 1YH3A 1JXMA 5IHPA 4E2XA 5JHHB 2OAP1 3V8BA 4OQQA 2WVJA 2CXXA 3E7DA 1FP4A 1DX6A 2YC2C 1BJRE 4KPUA 4BGEA 4TS4A 3IPXA 4K2HA 1K97A 5AHKA 1XRMA 3OFJA 1N5RA 2WHPA 2NVUA 3MQ4A 2EG9A 4OIMA 4PW0A 1GQYA 5G3YA 4FC7A 2GPTA 2XVYA 3OQ1A 5B6IA 2VO1A 1RACA 1MT3A 3L4BA 3AFGA 3LRPA 4GVLA 2WLSA 3L0OA 3UOAB 1NNUA 4E11A 2R79A 3D2AA 4D41A 5GVRA 3UYLA 3FYTA 3OIDA 4IVRA 2EARA 2JFZA 3BXZA 5KNLA 1P9NA 2P4UA 1AG9A 4TT3D 3SBXA 1ACMA 4TWAA 4I2NA 1EVZA 1O89A 2PIAA 3ZHQA 3BK1A 3WADA 1A8PA 2H08A 3HWWA 4CPDA 2GDJA 4NV0A 4DMMA 1JEQA 4I1OA 1AHPA 2QRMA 1TAHA 4S12A 2VLIA 3TCKA 2HV9A 5JS8A 2OCDA 4CQMB 3TTVA 5BQ5A 5M04A 3UMMA 3IBTA 4ESVA 5ECYA 1M7HA 1OJLA 1PDWA 3M6IA 4W1PA 3EQ9A 5B1EA 2CXSA 1UIRA 2IXGA 1HT2E 1MIOA 1NW4A 3ASYA 1C8VB 2I5PO 1P1IA 2PH1A 3LCCA 3OAAD 1VFNA 3DOOA 3SF8B 2XQFA 5DEIA 2VKTA 2I4LA 3LQFA 4GO1A 4BUZA 2ATIA 3EC2A 3RIGA 1H1LB 2MJLA 3IBYA 1LF5A 3CZCA 1RWNA 5FLKA 2GBLC 1LSJA 4K9RA 3M9WA 4MMYB 2XQJA 3UJ6A 5BVHB 4GBMA 1G3MA 1H4TA 1CLUA 1Y4UA 2ZJ1A 4MIKA 3HC7A 3EOBI 4D0RA 5K6AA 3I32A 2D6FA 5H9WA 2C59A 1XCMA 3OQVA 4J76A 4DJEC 4XWWA 1J2EA 4BMZA 5IHXA 1X0XA 1XCGB 2VNAA 3DUFA 3DUWA 3I09A 4C0WA 4FYXA 4DANA 5CFNA 4BVJA 3KXDA 2Q07A 1TQ6A 3QFSA 3RTBA 4FW8A 3I8OA 3VV3A 4O4HF 1FFWA 2PCLA 2ZAYA 2BFDA 5DOVA 4ARSA 4NMMA 1KBZA 2P9FA 4B31A 4A91A 1B2LA 4GX0A 1E2FA 1E0JA 4BLPA 4DJ5X 3DZKA 1UP7A 2EYUA 2IE8A 3ZDDA 3KVYA 4U7FA 3GMTA 2W2LA 2ZBDA 3LBNA 5DVZA 2OGZA 2P8SA 3IEUA 2G28A 3E58A 1I94B 2XCSB 3WK6A 2CCGA 3GLSA 4R6WA 1V16B 4JI8B 3WWZA 4YO8A 4FFMA 5CGZA 1Q12A 1E6MA 1EWKA 3C5WP 4D9CA 3O74A 4RH1A 5A5FA 2APJA 4EGQA 1E9CA 2FSVC 4D56A 3G88A 1JPUA 3AI3A 2G7MC 3FG9A 3CF2A 4MMXB 1XT6A 2ZKIA 4KE8A 1T29A 3SZLA 4F3RA 1EFDN 1EFRD 4OHRA 1EUQA 1FSZA 4JVNA 1B41A 4M0CA 1D3AA 1NYLA 4XSVA 4NBRA 3ADPA 1WA5A 3NPAA 2CLHB 3GR6A 3I6MA 2GJAA 4NCNA 1DEAA 4CQMA 3ESQA 3DZIA 4X62B 1N75A 1TU0A 1DTEA 4JBIA 1J9EA 1Y1KE 1FUIA 1UC4B 2W58A 4B3BA 4CG3A 2J3DA 4QYMA 1Y3FE 4FYVA 3E1GA 4DM7A 1B4DA 1JEAA 1RFLA 4G65A 3SF8A 1FSPA 2MR6A 3ENVA 4YJGB 5B1SA 1RXEA 2CWDA 4G4SP 5A05A 3ZWBA 2A1UB 3U5TA 1E96A 4I9HA 1TOAA 2WW8A 1H1LA 3NJ4A 4WA8A 5FTJA 4ZHSA 1XZHA 2D2FA 2GH1A 5LDDC 4A3SA 1ILEA 3R1IA 3KKLA 2AVNA 3BA6A 4QL3A 5KJFA 1CRPA 2E4VA 4K8OA 4TVBA 2GPWA 2FEKA 1WDLA 1ZM7A 1XZNA 2Q3MA 1YQDA 5BVHA 2YJ6A 5F23A 3S40A 1GNSA 4Z0NA 5JMOA 4LX0A 4IDGA 3BORA 5DBGA 5A2QA 4NBVA 4P4SB 4BMCA 3RFXA 3SIWA 1HNNA 2IYWA 5I7RA 1QMGA 1WEHA 3HI6A 3G2JA 5KHLB 3C7AA 3HBFA 2AYXA 1RLIA 3AZPA 5A7FA 5LQUA 3ITDA 4TTPA 3EK2A 1TD1A 1G0OA 4HLUA 3OJOA 5COBA 3ZI7A 5CCDA 2JIZD 3WGTA 1NRWA 1RI3A 1NOJA 1C7QA 2HMYB 1RMYA 3D4BA 4HB3A 3KLBA 4MCJA 1UOPA 2V97A 2VQ3A 4MV1A 2H8GA 3OKFA 4ZVUA 4TTAA 3HB0A 2OLEA 1NT2A 4RY8A 1K7YA 1ZOOA 1CR4A 2ZREA 1UL1X 1WMAA 1Y63A 1CYEA 1OMOA 4U7GA 1V16A 1L1EA 4UHBA 1MEEA 5I7FA 4WCDA 2DFLA 2IVZA 1ENYA 3D6AA 2J3MA 2FMKA 3JVUA 2ZZMA 3OCCA 3C3WA 4EHFA 2AQHA 1G5TA 1E0AA 3SIPA 3CR7A 2AK3A 2GFQA 1GLNA 4ITUA 2QLFA 5FA5A 4KLNA 3FOZA 1PT7A 2IIVA 1E2IA 3HADA 2A3RA 1IJBA 4ICIA 3SVZA 3NG1A 2Q5LA 4B6SA 4LRYA 2FR1A 5C18A 1LVHA 1QZZA 1CHNA 1V8FA 2FFRA 4LJSA 3S99A 4YHHB 5IVKA 3REGA 2X2OA 3G0HA 3HU3A 3KXIA 3UCEA 4HCJA 1IBSA 4BNJA 4EG1A 2A1UA 1FS4A 3DE6X 4XWAA 4KNVA 1QO9A 4A9AA 4O4HB 3ILHA 3NBQA 3FPGA 4QUAA 1NW5A 1V8DA 2FR8C 1QPBA 4Q7KA 2IXAA 3EDRA 4RIEA 1WR8A 2XOEA 5DNEA 1YC5A 2QTAA 1UMDB 1VE7A 2VHJA 2Z95A 4KEAA 3B82A 4EJSC 4P4SA 2Q2QA 2ES4A 5CB0A 3U4DA 3CG0A 1LQUA 1ST2A 4O8ZA 3FFAA 1U0BB 4I3HA 5KYWB 1UM9B 2WM9B 4ZI7F 1YR3A 4BE4A 7ABPA 1UBEA 3JQAD 5SY4A 3RH0A 4F85A 5IP5A 3S1SA 3QELB 4OGWA 4ZXFA 3ML1A 2PJUA 4QGFA 2YFHA 2QA5A 3GGSA 2QW0X 4R5MA 4CM8B 4RKFA 2SECE 3K0CA 2RSLA 5EYPB 1DZ3A 3WKBA 4BQSA 1NM5A 4H31A 5SICE 4RD0A 3NS7A 1E59A 1CY4A 2JFUA 1I1OA 3T5PA 4B3TB 3I2HA 4MEAA 1FNSA 2IYZA 1YDMA 1KO1A 4NZZA 1JH9A 3KXKA 3NC4A 3QXGA 3CH5A 1ISIA 2EZ8A 2YVKA 2FF5A 2WF5A 3BE5A 3LPMA 2Y0EA 1O94D 4IWYA 4NVRA 4QAQA 3V4ZA 5MN6A 2I4TA 5CRIA 3EVBA 1KO5A 4NZMA 3ZE6A 4CV0A 4OI0A 3VX3A 1N9GB 3ONVA 2ZWIA 3HWSA 3ITNA 2B4AA 1NWHA 3ZWDA 1SUFA 5EMHA 2PKEA 1TKCA 2JFHA 1NRJB 2YUTA 4AAYA 4F12A 4QG3A 1ZICA 3DVQX 4PLWA 4TMYA 1L6IA 1SUCA 2HV8A 2HI0A 3KE9A 1DADA 1P1KA 2WYIA 3L84A 5E8RA 3ZTWA 4WBNA 1BHQ1 4QDZA 1YZKA 2EFYA 3FSRA 4C08A 5K45A 3RAEC 4ZQFA 3FDIA 3I04A 4HSGA 4IIGA 4BFUA 2JKZA 1GGMA 5HFNA 4O4HA 4EIWA 1Y4SA 1D7AA 1Z47A 2RK6A 3NHRA 2WUFA 2GZRA 3L2OB 1YFLA 3LYAA 1PGPA 1F0NA 4M99A 3CU5A 3GN2A 4O3MA 2OC9A 1DLJA 3B5IA 2WIAA 1UMDA 1YR6A 3WGKA 5C4IA 1ZL0A 2Q7DA 3VH4A 2O5CA 1FNDA 1BRMA 1QB8A 3H1BA 4AJ9A 2V6FA 5IKXA 1Q7BA 1TIPA 5KYWA 1UM9A 4YXWA 2IHKA 3OQNA 4CMJA 3LO5A 3QELA 4RJ2A 2C8JA 4UTNA 4MS4B 1HZZA 2OBNA 1RCTE 3H2JA 3K1ZA 4ZI2A 4Z1MA 2DT5A 1Y3IA 1RRCA 1IYZA 3CVUA 4ZZ1A 1MZVA 4J8PA 1CS4C 2AOUB 5EYPA 2HY7A 3G23A 3ILYA 3QIVA 1P5HA 4FYPA 1BN7A 1UC5B 4EHHA 4D2IA 3Q8KA 2GZ2A 3DPSA 3QTLA 1SUEA 4OB8A 4YMWA 2GBCA 1NNEA 2O0LA 4NOLA 1JQEA 2H16A 2OCYC 4MUFA 2A94A 4WBNB 2VXYA 1E7RA 2I2XB 3QSGA 4KH0A 4UCWA 4Q4JB 5D1HA 3EASA 4Z9YA 3WIOA 5HKKD 3NHLA 3L8MA 3TEJA 1T1IA 4JBHA 4HQFA 4FMCB 2K2WA 2XSZA 4HC4A 3O91A 1J07A 3VOTA 2IOHA 4YP9A 1F3OA 1N9GA 2ID9A 3STYA 2R8YA 2PQ0A 3QFTA 4K9KA 1DAHA 1O08A 4E88A 3KSUA 5EIFA 4UE2A 4B3GA 2I2BA 1U8UA 1QR6A 5GIOE 5WRFA 1G3IA 1NHGA 4BNZA 4GI2A 1P0FA 2W2OA 3FJYA 4HNRA 3ABOB 1KU0A 3AOGA 2GR9A 1WPRA 3DQPA 2DH6A 1KDOA 2QGFA 4CG0A 5I5EA 2VAXA 1E64A 3E35A 2O7QA 2GEKA 4Y30A 4ZI7B 3GCXA 4H35A 5EEGA 4FN4A 1WAMA 1BMFD 1E2LA 1T5IA 4ZQHA 9LDTA 2X0IA 3IFSA 1I1HA 3GYGA 4RYLA 3A4NA 1O95A 1QHIA 3D43A 4BFYA 4DA6A 1BWQA 2HM7A 3BREA 5FUBA 4OMDA 3CSUA 1WJGA 1IY1A 2IYLD 4EPYA 3L9WA 4R8RA 4JI5B 1CUBA 3MMXA 3EEFA 1T0JB 3GEGA 2XCRB 1Q1EA 3B6MA 4G0OA 4YP6A 4FEGA 3GMDA 4EMBA 1CKEA 3I52A 3EZXA 3H9QA 3OD5A 5AM3A 2JH8A 2AOUA 4Y0VA 3N75A 2W4IA 3O26A 4LKOA 4EG8A 3FLAA 1EBBA 3TLBA 4F5EA 3H1GA 1T5TA 1PNTA 2OXCA 2PPVA 4ZYTA 1CP3A 5G0VA 2CSXA 5C1IA 5DLDA 1N7GA 3G5AA 3P9RA 1ULBA 2IPOA 5HKLA 3NH9A 4RD3A 2OVFA 1CULC 3T6KA 4RK0A 3WX0A 1E20A 2WBLC 1NE7A 4J1TA 1A5ZA 3K4QA 4MUIA 4PO8A 3HJFA 2PO5A 3QQPA 4W5RA 4DLUA 3TH5A 1O0SA 1LC0A 2PFKA 4V0OA 1KOLA 3T1VA 4BLVA 4HJRA 4NCXA 5H4HA 3QPUA 4JGIA 4H0NA 4O4JF 1PU2A 1Z13A 1TYZA 2AW5A 5C80A 1T24A 1J8VA 1M2EA 2GK3A 1GPAA 4Q3CA 1SRQA 4UU7A 5IW8A 1I3MA 1PNRA 1CFZA 3JQ6A 2QAGB 3QA9A 2H18A 1JDBB 5F21A 3TDKA 3VC7A 2Y05A