4F1MA

Crystal structure of the g1179s roco4 kinase domain bound to appcp from d. discoideum.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
278
structure length
278
Chain Sequence
KSRLPTLADNEIEYEKQIGKGGFGLVHKGRLVKDKSVVAIKSLILGDSEGETEMIEKFQEFQREVFIMSNLNHPNIVKLYGLMHNPPRMVMEFVPCGDLYHRLLDKAHPIKWSVKLRLMLDIALGIEYMQNQNPPIVHRDLRSPNIFLQSLDENAPVCAKVADFSLSQQSVHSVSGLLGNFQWMAPETIGAEEESYTEKADTYSFAMILYTILTGEGPFDEYSYGKIKFINMIREEGLRPTIPEDCPPRLRNVIELCWSGDPKKRPHFSYIVKELSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Roco kinase structures give insights into the mechanism of Parkinson disease-related leucine-rich-repeat kinase 2 mutations.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase, signaling protein
molecule keywords Serine/threonine-protein kinase roco4
total genus 77
structure length 278
sequence length 278
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f1mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f1mA01
5JT2A 4FIGA 3LJ1A 4X2NA 4U42A 2G2FA 3C7QA 3RM6A 3V5WA 4AW0A 2JDOA 2UVZA 3CTJA 3EN9A 2GS6A 3FXWA 3EHAA 3G9NA 1E1VA 3LFFA 3PVUA 3RZBA 4BCPA 4A4LA 1F3MC 3I7CA 1GIJA 1Z5MA 4Y83A 5FWKK 5M4IA 4EOOA 3I4BA 4XCUA 4ANBA 5J9ZA 4QP4A 4LMNA 4FNWA 5L2TA 4XYFA 2ZAZA 3MH0A 3TI1A 5LQFA 3QBNA 2CKEA 1PXPA 1Q8YA 3PPZA 4G17A 4FL1A 3NW6A 3GU5A 3O8TA 5EDRA 2W1EA 2W1GA 4HYUA 5AV3A 3MBLA 3ETAA 3QQHA 4FVRA 5LVMA 3OFMA 5AFVA 5BX0A 3GC9A 3VHEA 2XJ1A 5H8GA 2VO6A 3OXIA 1SVGA 3R04A 2YDJA 4RX9A 2ZV8A 2BZIB 2C0OA 2F9GA 3I7BA 4LOPA 4ZIMA 5DIAA 4EYMA 2YWVA 1AGWA 4BDCA 3UQCA 2BTSA 1I09A 2HK5A 3MB7A 3DU8A 1ZARA 2BRBA 3MJ1A 3MA3A 3O71A 4QMYA 4BZDA 4PDSA 1GZ8A 2PE1A 2FUMA 3DBCA 4IB5A 5FDXA 1H28A 1KOBA 3WZDA 4CFVA 4BWPA 2VTRA 3D83A 2GS2A 4QP3A 3V01A 5FD2A 4IAYA 2B1PA 4NJDA 1G3NA 3FMKA 4PL5A 2ETKA 2PHKA 5HG8A 3N4TA 2XYUA 3TZ9A 5M09A 3ENMA 4OTFA 3VQUA 1QPCA 3VS6A 4YZ9A 4B8LA 3K54A 4B6LA 4BHNA 4C2VA 4MF0A 3FQEA 4X7QA 4MH7A 1GZNA 4FVQA 3PSDA 2VX0A 2W1CA 3ANQA 5K9IA 2AUHA 2ZYBA 5FBOA 1H1QA 2BCJA 2BZJA 2O2UA 1XHAA 2ZMDA 3FMDA 5ANEA 5F20A 4UN0C 5FRIA 5F9EA 4ZTNA 4RIYB 3QKKA 2XK7A 4BDGA 4EKLA 3MGYA 4DLJA 4EJNA 1YW2A 4MD8E 4YC3A 5BVFA 3VS0A 1LUFA 3BYMA 4IDTA 3SV0A 2XM8A 2CNVA 4WG4A 2R9SA 4YGAA 4RJ6A 4IC8A 5KKRB 5LXMA 4BY9E 2FA2A 4YZNA 3E87A 2RG5A 1JSVA 2RF9A 2WQOA 3K2LA 3KULB 3FI2A 3RK7A 4A7CA 4H1JA 3ZXZA 1URWA 3DZOA 3EFWA 4KNBA 4AUAA 4F6WA 5CAQA 5GZAA 4O0VA 3QTSA 4ZXTA 2OWBA 3C4CA 4S34A 3NUAA 3PJ1A 1M14A 2GHLA 2YLEA 3FHRA 3H0YA 4M66A 5B2KA 3ZUUA 3PSCA 4U7ZA 4CZUA 3SKCA 2R3PA 2YABA 3Q5ZA 1P4FA 5D12A 2GFSA 2Q0BA 5CSXA 1I44A 2X0GA 2X7OA 4IFCA 3VUTA 4CXAA 3C0HA 2FSMX 4XG4A 3UMWA 5HEZA 3EQGA 4JL9A 3KCKA 4R8QA 3UQGA 4R7BA 3DXQA 1SVHA 5JMSA 2BDJA 3KVXA 1PMEA 2WTKB 4G3GA 3EMGA 4MWIA 4EOPA 5HVKA 3WZKA 2C6LA 5TOZA 3O8PA 2OJ9A 4MD9E 4EK8A 4AFEA 2V7OA 2AC3A 4I5PA 3FI4A 4J7BA 3NCZA 4RJ3A 3A8WA 5L8JA 3RHXA 5CF6A 1JSTA 1WVYA 4YZBA 3I81A 4M68A 3U54A 5CI6A 2UZEA 3U4WA 4F9WA 2ZB0A 5A4QA 4CVAA 2OIQA 3BYOA 4IAFA 2VGOA 2VWUA 4H3PA 4QMOA 4JDHA 5LMBA 3DFAA 2ZM4A 4FIFA 4AZTA 4FSWA 5BVNA 4GG7A 3RCDA 2GHMA 3VBXA 2B0QA 1KSWA 2QI8A 3DAEA 4DBXA 5K5NA 2JDSA 3OEZA 3OUNB 1DS5A 2UW0A 3D5VA 4CRSA 1REKA 4MQ2A 5HCYA 2PULA 4Z7HA 3VS4A 3GGFA 4MK0A 4YJPA 2BMCA 3CC6A 4Y8DA 3F5PA 3ZRLA 4ASEA 1T45A 4PTCA 4HGLA 5EFQA 3IKAA 4IC7A 3DPKA 4FTAA 5AAGA 2QKWB 4D9TA 3QQGA 3V6SA 3W2QA 5ICPA 4E7WA 3QTZA 3R7IA 4FUXA 2WMWA 3CIKA 4DFYA 1PXLA 3NZ0A 3ORKA 3R01A 3R22A 4HYSA 4LGGA 4S30A 4BF2A 2VTPA 2C4GA 3PIZA 2CLXA 4YNEA 2CGUA 5CEMA 3PE2A 5G6VA 2RG6A 1OPKA 3WARA 2WMSA 5H8BA 2YLFA 3D7TA 4I5HA 4RA5A 4V0GB 3AC1A 4FSTA 4Y46A 5AR4A 4F1TA 1IR3A 5JSMA 4BCOA 4CLJA 5AM7A 2QR8A 1UWHA 3BRBA 3Q4CA 2R7IA 4YBKA 4HJOA 1Y6AA 2G2IA 4J1RA 2WIPA 5HIEA 2OH0E 1XJDA 3LFEA 3OC1A 1WVWA 1JPAA 1OIYA 4IWOA 4RPVA 1ZXEA 3B2WA 2QU5A 3R83A 2VGPA 2WQNA 2WKMA 4DH5A 1V0OA 3AT2A 4MYGA 4XV3A 4YHJA 4O27B 3LKMA 2ACXA 4JG8A 1KWPA 4KSQA 4FOCA 3D2KA 5JQ5A 3R7GA 4I1ZA 4G5PA 3CTQA 4KKEA 1XKKA 1ZOHA 4ZMEA 3O51A 1R0EA 5AV4A 1YXVA 4EK5A 2I0HA 3I0QA 1OL5A 4A9RA 3F3ZA 5I0BA 5F95A 4KBAA 3GC0A 3PE1A 3W2RA 5GINE 1ZLTA 3PYYA 2QOFA 2NO3A 3QCXA 4YURA 4XNEA 3UO5A 4C35A 4U45A 1OL2A 5IA3A 3VF8A 4G31A 3GCPA 2YA9A 4AOIA 2HW7A 1GIHA 3NYXA 3Q96A 3GQLA 3UYTA 3VS1A 2OG8A 5JGBA 1V0PA 4BTJA 2PUNA 3DGKA 2WMQA 3UZPA 4FV3A 5J7BA 3P08A 4OBOA 3TIYA 3TN8A 3ZLWA 3UTOA 4ACHA 3BPRA 5HX8A 2C5YA 4DG3E 2B7AA 3PIYA 3QRTA 5L6OA 2W5AA 4FV0A 3QC9A 3ACJA 2E9VA 2IZSA 3IS5A 3MPTA 3NEWA 4G6OA 2VWWA 1SYKA 5CU3A 3VO3A 3PLSA 3VJOA 2FVDA 3ORTA 3W55A 1YHSA 4BKZA 4BCGA 5AAEA 3E88A 2NPQA 4FZ7A 5ETFA 5AA9A 3HGKA 1R0PA 3HMNA 2XIZA 3IDBA 3G0FA 3LIJA 4UBAA 3TTJA 2WTDA 4BDAA 4WSQA 2OJFE 4AZVA 5AX3A 3HRFA 2GNJA 3H30A 3R02A 3DJ6A 5ANIA 4FGBA 5K4JA 4J96A 1U54B 4EH4A 2BILB 2C6KA 2YERA 4L52A 4BGQA 4YPDA 1H24A 2CDZA 4ZZMA 3MIYA 3ZO1A 4X2FA 4F7LA 3GBZA 4DT8A 4I6FA 5HESA 2EVAA 4O0WA 4ZLZA 2XA4A 2BHHA 3P0MA 3G2FA 2IWIA 2VNYA 4USDA 1Q62A 4CFFA 2XKFA 2NRUA 2IW6A 3P4KA 3W8QA 3CLYA 4F9CA 2GMXA 3NUXA 5HE1A 1OGUA 4C38A 4XMOA 4MTAA 3ZUVA 5BPYA 4PQNA 4EC9A 5FDPA 4DF3A 4O7LA 1ATPE 1Y8YA 1Q97A 3E7OA 4ID7A 1OBGA 3JY0A 4FI1A 2QKRA 3QYZA 3TZMA 4J97A 2V62A 2R4BA 2AC5A 4XV2A 4YUQA 3M42A 4CQEA 4HVHA 3F88A 5C1QB 1UA2A 1QL6A 3PFQA 3ORXA 4FKPA 3A61A 3IG7A 3EB0A 2JIIA 2PWLA 4LYNA 4BBMA 3FLNC 4L44A 2PMIA 4F1OA 4NM7A 1XBCA 2CHLA 3AOXA 3TDVA 4WG3A 3PJ2A 1BLXA 2ERZE 4UYAA 4BBFA 5LOHA 3CSVA 2XIYA 5J9YA 3MDYA 1XH4A 4RC2A 3VUMA 4DFUA 3EQBA 5GHVA 3MN3A 2B9JA 2YAAA 4APCA 1O6KA 2RFDA 3QUPA 4OTRA 3OWLA 3R8PA 4CFMA 4ANQA 1RDQE 4APPA 4ZP5A 1ZY4A 4FV9A 3QLFA 4IBMA 1Q24A 4I22A 1YWNA 2X7GA 3TL8A 5CEPA 3DBFA 5AIKA 1BL7A 4KUJA 2BHEA 3SHEA 4A07A 2QO7A 2C5NA 1E1XA 5FBNC 5A4EA 3JS2A 2WXVA 3R21A 3GUBA 1YOLA 4MNEA 3S2PA 4ACCA 3VUDA 3ODYX 2XVDA 2VTQA 3F7WA 4BL1A 4IANA 5LARA 4RVTA 5CAPA 1H4LA 4FE2A 2W1FA 4O0XA 4YP8A 1RJBA 3FSKA 3KK8A 1DM2A 4D2SA 4GEOA 1LEZA 2CJMA 3O2MA 3VWAA 4RZVA 4M14A 5LJJA 5BUIA 1GZOA 5CS6A 2R0IA 3QF9A 2BRMA 3TUDA 1SVEA 4TYHB 4Q9SA 3ITZA 1UNHA 3VBWA 1J7UA 2C0IA 2RFEA 4TRLA 3P7BA 4BGHA 4R6VA 4P4CA 3W2CA 4E6DA 2QOOA 1UU9A 2BVAA 4FKOA 4LL0A 5M44A 1OIUA 3QCYA 4RIOA 4IM2A 4IJ9A 4L68A 4XP0A 3QGYA 1IG1A 4BRXA 5JH6A 4FX3A 2QOLA 4EZ5A 4ITJA 1JQHA 5CNNA 4C59A 2XNGA 4OTWA 4H36A 1FOTA 3R8ZA 5EQYA 2GDOA 1WCCA 2UUEA 4IJPA 2WTIA 3NUUA 2OFVA 4EEVA 3MVHA 2H96A 1QPDA 3QD0A 3LMGA 3MSSA 3F2RA 3OVVA 3QA8A 4MAOA 4FG8A 5CLPA 3QFVA 3CD8A 3KK9A 3QHWA 1VYZA 4C7TA 4W9XA 4QOXA 3V6RA 4BYIA 5C4LA 2J50A 4CEGA 3PP0A 3MPAA 2BALA 4EOKA 2A2AA 3MS9A 3U6HA 2CSNA 3HLLA 4Q2AA 4HVIA 4K2RA 3ZOSA 4Z55A 4FV4A 4HOKA 4AGUA 4F08A 4HCUA 1TVOA 4NCTA 4XLVA 5J1VA 4FC0A 4DTKA 3PJ3A 2XK9A 3LQ5A 2BTRA 2ITNA 2XKEA 4FG7A 5L2IA 4AZSA 5KMKA 5DRDA 1PYXA 4X3FC 3WBLA 3WF8A 2JAVA 5CF5A 4MD7E 3NPCA 1Q5KA 2WEVA 3Q32A 5EHYA 3GNIB 4JRNA 4E5WA 3Q4TA 3DB8A 2J7TA 2C1BA 2QOIA 3LAUA 4KA3A 3PLAE 2VO7A 2Y4IB 4KRCA 4RWIA 4YHFA 3UP7A 1ZMWA 3BU3A 2WNTA 1YXUA 3OWPA 2XK3A 4E26A 1Q99A 1YXTA 4W4XA 2Q83A 3M1SA 4FV6A 4I5MA 2QONA 2VX3A 4GV1A 2PU8A 2R2PA 5HG9A 3I79A 4BCHA 2W17A 5JZNA 3CJGA 5AMNA 3D94A 3Q9ZA 5L4QA 3ALNA 2YEXA 5E8TA 4C4IA 3ZRKA 5ANJA 4ZY6A 2O0UA 4KIKA 4IWPA 1H0VA 4YJSA 5BUJA 1H08A 3KXMA 4O86A 3PSBA 2XIKA 5I9VA 1WBOA 1IRKA 3KN6A 4QT1A 4EK3A 1PYEA 3DLZA 3O8UA 3Q9YA 4OBQA 3IQ7A 3GOKA 3W33A 3QX4A 1U54A 5DEYA 3VS5A 4DEIA 5IQIA 3P9JA 3LVPA 1GJOA 4O0RA 5IPJA 1FVRA 4TN6A 5DGZA 2OIDA 3ZC5A 3TACA 3OBJA 4C37A 3S00A 4CCUA 1CDKA 2YM3A 2I1MA 2R5TA 4YZMA 4R1VA 3R9HA 3ZO3A 1SM2A 3LFNA 4I41A 4Q5EA 1WBNA 2JD5A 3RINA 2VN9A 3V8WA 3QAME 4ACDA 5CSWA 4RJ4A 1WMKA 2Y9QA 3V04A 3TCPA 2VV9A 3GI3A 3KXHA 4JDKA 2J0JA 2IZUA 2OXXA 2XJ2A 3ENHA 1JSUA 3AMBA 1ZZLA 4ZZOA 1PKDA 4UEUA 2OZOA 4BTKA 4ZY4A 4DEDA 3QZFA 1NVSA 4YJNA 1R39A 4TNBA 4O38A 5TO8A 1XWSA 2R3RA 3GQIA 3E64A 2NP8A 3MW1A 2HZIA 3NYNA 3R6XA 3F3UA 5AP1A 3VBYA 4KS8A 2W7XA 3HP5A 2XEZA 3H4JA 4RLLA 5A3XA 4BCMA 4HVGA 5I9XA 5KZ0A 2OXYA 4BDFA 4LRJA 4MBJA 1SZMA 2XEYA 3W32A 5CEKA 1U46A 3MH3A 1XQZA 5CENA 3DOGA 3O50A 2YCQA 2ZMCA 4CYIA 4ZTMA 3CCNA 1WBTA 4PDYA 2X8DA 3CQUA 3F3WA 4DTBA 2GNLA 4UZHA 5CEIA 5FXSA 3WE8A 5GIOE 2XNMA 4YO6A 3OF0A 3QCSA 2B52A 3CY2A 3N9XA 4G9CA 4GS6A 4JAIA 4NSTA 4DYMA 4ZSAA 3AGLA 5JRSA 3C4WA 4DH8A 2EUFB 3MIAA 3W18A 3UIMA 2BAJA 2OBJA 3E5AA 3QX2A 4JNWA 4PNIA 5HGIA 3TT0A 5JEBA 2F49A 5EM6A 4A9YA 1H27A 4IX3A 4J8NA 5IQDA 3LLAA 3I5ZA 4AGDA 4JIAA 1OZ1A 4GK2A 3EN4A 5C8KA 1Q8ZA 4D2TA 3LFDA 1B6CB 3COHA 3PY3A 5L3AA 4D2VA 3E63A 4O2ZA 2CGXA 3H9RA 1UNGA 1ZZ2A 3DTWA 3K5UA 3ZZWA 4OW8A 3ZDIA 5KO1A 4JJRA 1NA7A 2GNHA 5E8ZA 3OXTA 1O9UA 3JR1A 2WFYA 1J1CA 4WUAA 2OZAB 4XEYA 2R3HA 4WSYA 1NW1A 4L67A 4AN3A 5BVEA 4IAAA 3Q6WA 2PUPA 4Z7GA 4PWNA 5A46A 3FI8A 3LCTA 3BHTA 3CD3A 2C30A 3R1NA 4YJVA 4ALUA 3H9FA 3ZO4A 3BKBA 2IZRA 4DFZE 2RIOA 5H9BA 3D15A 2BKZA 5F94A 2ZV2A 5HI2A 2XCHA 3W16A 4ERKA 4PNKA 5KMMA 3BCEA 3OT8A 3FBVA 3KFAA 4QQJA 3ZYAA 3QZHA 3WIGA 3QUEA 4F9YA 3JY9A 3ODZX 2BZHB 4FKUA 4MEDA 2VTIA 5CTPA 4ASXA 2WO6A 5CXHA 2LAVA 3MFSA 4GL9A 1PXMA 3MH1A 4D2WA 1Q8WA 5AM6A 5CVHA 3VUGA 3HV4A 5DR2A 3DBQA 2VTNA 3SDJA 5EOBA 1YHVA 4R7IA 3P7AA 2E9UA 4BKYA 3UC3A 4FZDB 3F5XA 5B7VA 2HIWA 3G6GA 5IQCA 3LMHA 3FLYA 3UVPA 3G33A 2UZVA 3BX5A 4NM5A 3RPSA 3VS3A 2X2MA 1OKZA 3VULA 2VTOA 2F7XE 3ZSGA 4FT3A 4TW9A 3DFCB 5J9LA 5M08A 4PF4A 4F7JA 4FTNA 1PJKA 2PYWA 2B9HA 3Q52A 5ANDA 3KXNA 3GC8A 3FKLA 4Q9ZA 5A6OA 3DK3A 3VW8A 2VTLA 3EFLA 4CLIA 5HG7A 4GU9A 2JDTA 3QL8A 4WKQA 2BRNA 2ETRA 3V5LA 3PZEA 1WAKA 3KRRA 4F99A 2IVUA 3OTVA 4QD6A 1GNGA 4OR5A 3K3JA 5DOSA 4HNIA 3NIEA 1G5SA 4I4EA 4ZLOA 5CVFA 4B99A 3QUDA 5E1EA 2UZWE 4M0ZA 4RC3A 1Q4LA 2O64A 1L3RE 1PXKA 4U8ZA 2IW9A 4I21A 2QURA 1YI6A 4U97A 3SVVA 1KOAA 3A60A 2W06A 4RIWA 3L9PA 3T9IA 2B9FA 1CSNA 4E4LA 4Z16A 4HGEA 2XCKA 4UALA 3KULA 5CZIA 1BX6A 3ZUTA 1G8SA 4MXZA 3W2SA 4BTMA 3QQLA 5KCVA 2SRCA 1JNKA 2A27A 3HMIA 3FPMA 4MXCA 4AZFA 3LZBA 2VZ6A 2JGZA 4UWCA 4M0YA 1A48A 3RPRA 2JKMA 4BDKA 2VWVA 4FTQA 4F64A 3OXZA 1V1KA 2XF0A 1CTPE 5LVNA 5JFVA 3F6XA 2UW6A 1WBSA 5AUYA 1EH4A 1OITA 4BCJA 4JBQA 3O96A 4MHAA 4O0SA 4GRBA 4OT6A 3LXPA 4YLJA 4YLKA 3V5QA 3EOCA 3HV5A 4OUCA 5A14A 3NDMA 5IMEA 1UV5A 4NKSA 3TTIA 1Q61A 3ELJA 3RAWA 5GZ8A 2W1HA 5KE0A 4ZSEA 4U41A 1SNUA 2XB7A 4FMQA 4OTDA 2R3NA 4AW1A 4O7YA 3HNGA 2QNJA 3UQFA 2PVJA 4BDBA 1ZWSA 2YCSA 4G1WA 5FEDA 5IH6A 2QO2A 4GIIA 3RI1A 4MXYA 4FKIA 3KY2A 3EQPA 3MY1A 4N70A 2VTHA 3MB6A 5IUGA 4WT6A 2C6EA 4AOJA 2OW3A 4NUSA 4GT5A 1M17A 3TNHA 4BBEA 2CNUA 4HGTA 5E8SA 3RBWA 4V01A 5AADA 3G90X 2BIYA 4O96A 4HZRA 3NVKI 5AA8A 3VJNA 5E8YA 1YI4A 3SLSA 2I6LA 1OBDA 4LG4A 4EKKA 1X8BA 4CV9A 3NS9A 3Q4UA 2VO0A 4EUTA 2XUUA 3PVGA 3OCSA 1M7NA 4FUYA 5CU4A 5LVLA 3UZTA 3RAHA 2W1IA 3TJDA 3BYVA 3EYGA 3FI3A 4C33A 3AXWA 4E6AA 3LJ2A 1S9JA 4GVAA 4O2PA 4RWJA 4AGCA 2CKPA 3TJCA 4H3QA 3Q4ZA 1IASA 3HA8A 3D2IA 4AA4A 2J2IB 3PG1A 4NKAA 4UMRA 4LFIA 5CX9A 5M07A 2ZB1A 3UG2A 1YWRA 2VRXA 4OTQA 4I92A 4XRJA 3ZLSA 4AT3A 4EOQA 1P2AA 1ND4A 3HV6A 2C0TA 2QO9A 1YDRE 4FSQA 4M69A 2RKUA 5EOLA 4YSJA 4EORA 4E4NA 4UZDA 4EH7A 5KMNA 1Q8TA 4QMWA 5K0KA 4GCJA 1XBAA 2IG7A 5IA1A 3EQFA 3TUCA 2OICA 4UB7A 3IW4A 2X4FA 4ZSJA 5KX8A 3LCDA 5IEXA 1F5QA 2UZBA 5CU6A 2OFUA 4UMUA 3UPXA 5B2MA 1ZAOA 3II5A 2W4OA 1K3AA 4MKCA 2GU8A 4CFXA 2W5BA 4O21A 2Y0AA 4YNOA 3DJ7A 2R3LA 3PXKA 3DAKA 3KF4A 2JIUA 1Q3DA 3RNIA 4WBOA 1GAGA 4I6BA 4C4GA 2HOGA 3F2AA 3MI9A 3G0EA 4ORKA 5HVYA 4FZFB 2X6EA 3TZ7A 4USEA 5KUPA 4RVMA 4CMTA 2B54A 4D58A 3MTFA 3I5NA 4GIHA 1Z57A 3PWYA 3WZEA 4C2WA 4M15A 4R3PA 4M69B 4F1MA 1F0QA 1P4OA 4I6HA 2BZKB 2QLUA 4XJ0A 3BIZA 4MNFA 2H9VA 4ZJVA 1K9AA 2Z2WA 3TXOA 3ZBFA 2YFXA 1YXXA 2BAQA 3FZTA 3V51A 3NNXA 3QQFA 4G16A 2YITA 4QNYA 2EXMA 2B4SB 4TXCA 5D1JA 4YJOA 1H25A 4CYJA 5BVKA 3P78A 2ZM1A 1DAYA 1M2QA 1WZYA 2YHVA 3IDPA 3LXNA 5EW3A 2IVTA 2VNWA 4J71A 2WQMA 4UWBA 3VRYA 4L01A 1PXOA 1OPJA 2FSOX 3QC4A 4GK3A 2WTWA 4BB4A 2IN6A 4IACA 2R3FA 3R0TA 1R3CA 4ZOGA 4BWXA 2GTNA 2W05A 4K77A 2BDWA 2VU3A 3NNUA 5LVOA 3UC4A 4FNZA 5EH0A 2QOHA 5HNIX 2ITUA 5TR6A 3TZ8A 5EKNA 1KE9A 5IA4A 4IZ7A 3IGGA 4GVJA 3SAYA 4ZTQA 3VQHA 4FKGA 4E6CA 5C27A 4AGWA 4D2RA 2O5KA 1H1SA 4N4SA 4WA9A 3FL4A 4XV9A 4YJUA 5JGAA 1H8FA 2E9NA 4OT5A 3W10A 3VAPA 2BDFA 4XX9A 2GFCA 3O7LB 4NTSA 1MQ4A 2Y7JA 3QHRA 4S31A 3KREA 4ONAA 1OKVA 2X9FA 3GT8A 3HVCA 4L7SA 3R8UA 4FTRA 1TKIA 2HZ4A 2R3OA 4PP7A 4YHTA 5TT7A 4C36A 2HWOA 2XMYA 4L7FA 2Z7LA 2VD5A 3AG9A 4LV5A 5CT0A 4H39A 5AP6A 4CKJA 5A9UA 3UVRA 1W98A 3BLRA 2Z7RA 4P2KA 5GJGA 2A19B 3FMHA 3OY3A 4I23A 3PA5A 1Y6BA 3TNQB 4IB3A 4YJRA 1V0BA 4C4EA 3VF9A 2JFLA 3NNVA 4KKHA 4OBPA 4RG0A 5J95A 2JEDA 4ZTRA 1G8AA 3PIXA 4D9UA 1YVJA 3R1YA 3R28A 3BELA 3HYHA 2NNWB 1YOJA 4L8MA 3QQKA 3CQWA 4KBKA 4FEQA 3V8TA 4R7HA 1M2PA 2F7EE 3FYKX 2XK8A 4RIXB 3R30A 1BI8A 2V0DA 3RHKA 3Q9WA 4F7NA 3BE2A 4AWIA 1ZMVA 3IPHA 3B2TA 2V7AA 3QZGA 4DBNA 4LI5A 3Q53A 4QYGA 4DH3A 3ZC6A 2GSFA 1DI9A 5FLFA 4BCKA 4CG8A 4LRKA 1H1PA 2XS0A 3UOHA 4GFOA 5AJQA 4E73A 2ITTA 5AP5A 4RFZA 2BAKA 3FZ1A 4M3QA 3BGQA 3F66A 4NIFB 3W1FA 4BCFA 4FA2A 4PMPA 1OPLA 3R71A 2E9PA 3A62A 4CD0A 3SOAA 4ZSLA 2YISA 1P14A 3HRCA 4G6NA 4IADA 4WBBB 3UODA 5KMOA 3TNPC 2DS1A 1PMNA 4IQ6A 2IJMA 4RJ8A 2C1AA 2OJJA 2WMXA 3UJGA 3HV3A 4PMSA 2F57A 3LCSA 2UVYA 1KE6A 2ONLC 4EK4A 4FF8A 3R00A 2OJGA 4EHEA 5KHXA 3NNWA 4F0GA 3A8XA 3ZDUA 1LP4A 3BHUA 2WMTA 4BIEA 5AP3A 2OZAA 3LXLA 4ZTHA 2BR1A 4F65A 3GENA 3NUYA 3NUNA 2XNNA 3AC3A 4EHZA 2YJRA 3POZA 3CGFA 4IX4A 4FK3A 4QPSA 5IQAA 4IAKA 3D7TB 3UE4A 2PMLX 2VTSA 3EZVA 1CM8A 4H05A 3PUPA 2G2HA 2Z7SA 5EM5A 5L6PA 3F82A 5CY3A 4C3PA 2W99B 3V5JA 3BLHA 4C3FA 2DUVA 4L3JA 3FV8A 4YPSA 4I24A 2PVKA 5JQ8A 4JS8A 3IGOA 5BVWA 4FIJA 3MFRA 2W96B 4DG2E 1RQQA 5DYJA 4IH8A 2F2UA 4BZNA 3RVGA 2H8HA 2R3QA 4PRJA 1UKIA 4L43A 3I6UA 4WUNA 3VBTA 4YLLA 1ZYSA 5DPVA 4ZTSA 3WIKA 4KD1A 3KC3A 1Q41A 4PTEA 5LVPA 4IVCA 2YAKA 4G3CA 4O7SA 5AP4A 4ZAUA 4ANSA 2JITA 4R3CA 2QOCA 3DBDA 4JBVA 5DBXA 3UOKA 4FZ6A 2IW8A 5KNJA 1XH5A 4BI0A 3R2BA 3NVMB 4AP7A 5EW8A 2DWBA 5HU3A 4CG9A 2FH9A 5KBQA 3JXWA 3MYGA 2X9EA 1YHWA 5BNJA 3MESA 4FT9A 2XP2A 3ORLA 4FSYA 5IISA 4N0SA 4Y95A 5JN2A 3D5WA 5HIDA 2QODA 4FL2A 5AP7A 4DGOA 4NEUA 3CP9A 5HIBA 3FL5A 2FSTX 4PPBA 3EJ1A 4FBXA 4K18A 3G5DA 4M12A 4BKJA 3OZ6A 4JDIA 4AA5A 4U3ZA 1OL6A 4RIXA 3QTUA 5BUEA 5EM8A 3KXGA 4LUEA 5AR2A 5EK7A 3KRJA 3QD2B 3ZLYA 4AW5A 3GU7A 3QKLA 3VBVA 5CF8A 5HKMA 1YDTE 4NM3A 4KKGA 1OIRA 3KU2A 1K2PA 1B39A 4EK6A 5CXZA 3KXZA 3A7IA 3CJFA 3U51A 2E9OA 3L1SA 4O1OA 4YZCA 3LM5A 1VEBA 3EQIA 5CAVA 2EB2A 1YOMA 4FTOA 4X3JA 3PXZA 3Q9XA 3G9LX 3CR0A 4GYGA 4BDHA 4GT4A 4X0MA 3OMVA 5CANA 3Q6UA 5A54A 3PY1A 5E8UA 4K11A 2O65A 2W4KA 2X8EA 2HENA 3GC7A 3OG7A 4UYNA 4X3FB 3S95A 4AG8A 4AE6A 5BQ0A 2X8IA 5CQWA 4U44A 2HY81 4YTIA 5HLPA 4A4OA 3AT4A 4IVAA 3UIXA 1U5QA 5LCKA 3PA4A 4QP2A 4KINA 2HZ0A 3JYAA 5FTOA 5ACKA 2QOQA 1BUHA 2REIA 3M2WA 3O7LD 4YSMA 1FPUA 4F0FA 3VRZA 1VR2A 3N51A 5A4TA 3WYXA 4BN1A 3IDCA 3ZEPA 1JOWB 4ENXA 4NIFA 2CN8A 5DA3A 2WQBA 1FMOE 3FQHA 5BYYA 3FJQE 5JZJA 4R77A 2R3IA 3Q2JA 4M8TA 5G1XA 4MXAA 2KTYA 3U9NA 3CY3A 3FEGA 5F4NA 2J0KA 3AD4A 5FP5A 5HE0A 4F70A 2GNGA 4LV8A 5E8WA 3QQUA 4ZEGA 4TZRA 3O17A 2UW7A 2H6DA 5IA5A 5IA2A 4EJ7A 3PPKA 5DR6A 5HLNA 4RSSA 3C4EA 1GZKA 2XBJA 3P7CA 2WMRA 5AUZA 3U8WA 4TWOA 2ZJWA 1CMKE 3FMMA 4PX6A 5DWRA 2IVVA 4W4WA 4XHKB 3SRVA 3VS7A 5I9ZA 4GG5A 4AFJA 1OIQA 4DLIA 3ROCA 2X6DA 5AUTA 5J1WA 4IWDA 2G9XA 5HLWA 4TYEA 2WEIA 3MV5A 4W4YA 3EQHA 4EHVA 4QTDA 2P0CA 4O0UA 3TKIA 3QRKA 3ANRA 4ANLA 3NX8A 4RRVA 4IW0A 1WBPA 2FSLX 3MH2A 5E1SA 4AZEA 3LLTA 4O0YA 3SXSA 5HX6A 3QTIA 3SW7A 4FEVA 4FNXA 3E3BX 1NXKA 1OM1A 4D4SA 3E3PA 4AQCA 3S1HA 3S0OA 3ULIA 2W4JA 3MVJA 4FV1A 4QPAA 5CVGA 2J0IA 4E5AX 3ZHPC 4D55A 2WIHA 4DEEA 1ZOEA 1UNLA 2XKCA 2XH5A 3AMYA 3DT1A 4FEWA 2GNFA 3DJ5A 4O81A 4G34A 5E90A 5CNOA 5DH3A 3SRVB 2PUIA 4MBLA 2GHGA 5HU9A 1RE8A 4RJ5A 2XNOA 3PVBA 4LRMA 4WNKA 4Z3VA 4O84A 4NYEA 2GQGA 1FINA 3I6WA 4BVUA 5LWNA 1NVQA 4YTHA 4IFGA 1YQJA 5D9HA 5IQFA 2JBPA 2YZAA 5J87A 2YM6A 3LXKA 5IUHA 4MNEB 1BKXA 2HAKA 4EOMA 4KB8A 4EZ7A 3ATTA 1PMUA 4GU6A 4JRVA 3E8DA 5DNRA 4EWQA 3ERKA 5GJFA 4XP2A 5I9WA 4IVDA 4U9AA 1YRPA 5ANOA 4B9DA 2OXDA 3LM0A 3MVLA 2HZNA 2PVMA 3ORPA 3V5PA 4BTFA 3BGPA 2QC6A 3T3UA 5IDPA 3R7VA 1JAMA 4GMYA 4O82A 1XBBA 1P5EA 4L3LA 2PVYA 3UO4A 1M2RA 3EQRA 2IPXA 3NIZA 2YM4A 4BDJA 4C3RA 3THBA 2UZTA 3EFJA 3F3TA 3GCSA 4A9TA 4ARKA 4F09A 3H0ZA 5IUIA 2QG5A 4FV5A 4NTTA 1KUTA 2R3MA 4OTPA 4QMPA 3LW0A 5AP2A 2EWAA 3OP5A 3BWFA 4EQCA 2C3JA 5JK3A 1APME 2UZNA 2FB8A 2DYLA 3UBDA 2GPHA 3ZLXA 3F69A 3R9RA 3IONA 1W0XC 2ITYA 5HE3A 2HXLA 2QG7A 4XRLA 4D28A 3FXXA 3HECA 4JBPA 3WOWA 5FUTA 5E7RA 3IOPA 2FGIA 4I0RA 3BEAA 5BYZA 3P23A 4DA5A 3DXNA 3FY0A 1W83A 3AC8A 3Q60A 4TKSA 4RWLA 4E1ZA 3DK6A 5LMKA 2QLQA 1RW8A 5M53A 2QD9A 4NL0A 2BIKB 5FM3A 4WRGA 1H1RA 3C5UA 4XG6A 1UU3A 5HBHA 3OW3A 3E8CA 3R1QA 3KL8A 1OI9A 1TQPA 1W84A 4KRDA 3LFCA 3RWPA 2PVFA 3W2OA 5HO6A 4RMZA 2JDVA 4CQGA 3BQCA 5CWZA 2W1ZA 4RBLA 1J91A 4D5HA 2ITOA 3ORIA 4J95A 4P7EA 3R9OA 3V3VA 2OF4A 3WF9A 2I7QA 3EN5A 3WYYA 3R8MA 3TKHA 4BGGA 2PSQA 2XRWA 3CKWA 4UV0A 5A6NA 5D7VA 3EN7A 3VUHA 3Q3BA 2RL5A 2WMVA 3DBEA 1NY3A 2X7FA 4IX6A 3TV6A 4NCTC 5HBJA 4FTMA 4UX9A 4FSMA 4XV1A 2BFYA 2XK4A 4O0TA 1OVEA 3LJ0A 4AE9A 4EOLA 1OKWA 4OAVB 4TT7A 3V8SA 3IW8A 2BPMA 4X21A 5AR5A 3DV3A 3KXXA 3MTLA 4CTBA 3RZFA 1PW2A 4WG5A 5HICA 4CT2A 4FT7A 2A1AB 4X6QC 4M97A 3VW6A 3UP2A 2CNQA 3HUCA 4O7TA 2OI4X 2HYYA 4I93A 1QPEA 4EH8A 1PXJA 3DNEA 4AN9A 4O7RA 5EI6A 3I60A 3HV7A 4PV0A 4RX8A 2ITWA 2X81A 2ZVAA 3U6JA 4R78A 5IKWA 4G3FA 4J99A 1ZY5A 4AOTA 2YZLA 2BROA 3GCVA 4QYHA 4IB1A 4QYFA 4RT7A 5CSVA 1ZMUA 3AC5A 4ZTLA 4DEBA 5DG5A 4ZJIA 5DT3A 4RZWA 5FQDC 5AWMA 2CN5A 4ASZA 3ZBXA 1CKJA 2XZSA 3ULZA 5FXRA 4UMPA 2LGCA 3NSZA 2C6MA 1CKIA 4I0TA 3VBQA 5LWMA 1U4DA 4AZWA 2YCFA 4BYJA 5HZNA 3DXPA 4E8AA 2XKDA 4DFNA 1ZRZA 1A06A 2ZM3A 4ZSGA 3NMUF 1JWHA 4EYJA 5KBRA 2BRHA 4IM0A 1HCKA 4U3YA 4TL0A 2OJIA 3R7UA 2UW4A 4JQ8A 1DI8A 4P5QA 1JBPE 3UMXA 4KABA 3BU6A 2UW3A 4LM5A 4D2PA 4E6QA 3FWQA 3FLSA 4D4RA 3LHJA 3QU0A 4PL3A 3S4QA 3RGFA 5DFPA 4JAJA 3PWDA 4PPCA 2C5VA 3U55A 3ZH8A 4DH7A 3B8RA 1NVRA 2J0MB 2XYNA 3FMLA 3EIDA 3CGOA 4QTCA 3R2YA 4F4PA 4NFNA 5CSPA 2J6MA 5E4HA 4C4HA 4HGSA 4LL5A 1VJYA 3SW4A 2Y6MA 5CEOA 3DQWA 4OAUC 4FTJA 3I1AA 4XS2A 2UZDA 3KKVA 4CT1A 3B8QA 2XNBA 4QMSA 4V0GA 1H00A 3CKXA 4CMOA 5IQHA 2Y6OA 3F9NA 3NUSA 4I6QA 4L46A 1QMZA 3ZEWA 3AC2A 3SGCA 4DT9A 2O3PA 4ACGA 4JX3A 2UV2A 3E8NA 3BLQA 2ITZA 4TWCA 4C57A 3R8VA 3LOKA 5EDPA 5H3QA 5IDNA 2WPAA 4EQMA 4WNPA 4G6LA 2UW8A 2J90A 3AMAA 1ZYLA 4D0WA 3N4UA 3WF6A 4FKSA 3MJ2A 1TQIA 1BI7A 5EM7A 3LFQA 4MBIA 2BUJA 5DT0A 4S32A 4R5SA 2CKQA 3GCUA 4YC8A 1OB3A 3DDQA 4B8MA 5IF1A 3EKKA 1JVPP 4N6YA 4UXQA 2JC6A 4B7TA 5LCJA 4Q5HA 4HZSA 2ZV9A 3U87A 1FGKA 3FY2A 4U0IA 1JLUE 4DE4A 3QLGA 3BWJA 3IW5A 3ID6C 4USFA 2F2CB 1GIIA 3QRJA 3F3VA 3OY1A 2WTKC 4JG6A 4E3CA 2WB8A 2PVRA 4BIBA 1ZYDA 4F6UA 3DKCA 4FSNA 3GFEA 5EI2A 4BCIA 2P2IA 4KIQA 5M4UA 3RPVA 4ASDA 3JVRA 3MY5A 4FKWA 5HORA 5BMMA 3VVHA 3BHHA 3BEGA 3KMUA 1SNXA 3MY0A 4BDDA 3RWQA 5FM2A 2PE2A 4EOJA 3BQRA 3LQ8A 3V5TA 3E93A 1H0WA 5K5XA 4H1MA 5IQBA 4IAZA 2PUUA 1MP8A 3DKGA 2B53A 3L9MA 5EHOA 5I9UA 3EN6A 3VS2A 4FT0A 4EH9A 4YR8A 3L8PA 5ACBC 3BBWA 4FSUA 4XOYA 4E93A 4QPMA 5DRBA 4FV2A 2JFMA 3K5VA 5EYDA 1S9IA 1MRYA 4HCTA 4EBVA 4N57A 4FT5A 5JGDA 1LPUA 2XJ0A 2R7BA 4CKRA 2JAMA 3QQJA 5M06A 4JVGA 3A99A 3FXZA 3OOMA 2WAJA 1URCA 3JVSA 4BC6A 4DGLC 1XH9A 3H3CA 4CNHA 3KGAA 5HVJA 3IO7A 3KCFA 2V22A 3AT3A 2G1TA 2PMOX 2EXCX 3DQXA 5E8VA 5M55A 5ITAA 3SC1A 2HWPA 3D7ZA 4U80A 3FMJA 3KA0A 2BKKA 1Z9XA 2WMAA 5KHWA 4J53A 2GNIA 5C01A 4F0IA 2JDRA 4K9YA 3PRFA 2WOTA 4MXOA 2WHBA 2EB3A 4K0YA 4NW6A 4Y73A 3EFKA 5DLSA 4YC6A 1UKHA 4IIRA 3FQSA 4OTGA 4W4VA 3HZTA 4F9BA 3HRBA 3ZM4A 4FEUA 4JX7A 4NW5A 5K0XA 4UXLA 2ZDTA 4AT5A 4C4JA 1IAJA 4JLCA 3C13A 2F7ZE 4HNFA 1OL1A 2OO8X 2I0VA 4IM3A 4FEXA 3TUBA 3KMMA 5AAFA 4JT3A 4XH6A 4FNYA 2QVSE 4YMJA 1OECA 2W1DA 3T8OA 1R1WA 4GKHA 4DFLA 2ONLA 1H07A 3ACKA 3SQQA 2CKOA 3BV3A 5I9YA 1KE5A 2I0YA 2WU7A 2OF2A 3EYHA 4FTUA 2R0UA 5CQUA 3HMPA 5L2QA 2J0LA 4EH2A 3I0OA 2JKKA 3R9DA 3UNJA 5LMAA 3WZJA 5AUXA 3AQVA 3EZRA 4FV8A 4LMUA 5D41A 4QMMA 3E8EA 4G3DA 2VX1A 3ET7A 3CE3A 5HBEA 4HW7A 3Q04A 5CYIA 1KV1A 1YWVA 3G6HA 4OGRA 4YJQA 5GZ9A 3HX4A 3MWUA 3RALA 5IG1A 5J7HA 3QTQA 3BE9A 2CGWA 4EONA 1W7HA 2Y4IC 3F5GA 5HG5A 3QKMA 1J3HA 4GK4A 4D0XA 4F63A 3WF5A 5HQ0A 4ENYA 3GP0A 2PK9A 4DAWA 3K3IA 3R1SA 4BI1A 5JFSA 3R8LA 4BDIA 3Q2MA 5FG8A 2R3KA 3IW7A 2OLCA 3CTHA 4K33A 3RPYA 2IVSA 3D9VA 4IMYA 3PG3A 3FYJX 4QO9A 3VUKA 4EL9A 2RSVA 3ZONA 2C5XA 5AV1A 3REPA 1T46A 3UPZA 3UO6A 4IXPA 2W0JA 4RGJA 3VC4A 3E92A 2HY0A 4AAAA 4FTCA 4BIDA 5M57A 4OTIA 3ZFMA 2ITPA 3QXOA 1M52A 1WBWA 1JKSA 1W82A 3CBLA 4E4XA 3UNZA 2XNPA 5TKDA 4QP1A 4C8BA 5JFXA 2C6TA 3OBGA 4IZ5A 3U9CA 3OW4A 3QRUA 3AD5A 5AUWA 2YACA 4RC4A 2OSCA 4QRCA 1O6LA 4KSPA 3T3VA 5C8NA 1H01A 4LGDA 4O6EA 5FGKA 4PTGA 3GU4A 4TPTA 4FKJA 5H2UA 4A06A 5J79A 3WE4A 3COMA 1ZOGA 4L53A 4YTCA 3UNKA 4FL3A 4DGGA 3ROYA 2XNEA 1JKTA 3DA6A 5L6WL 5T3QA 4V05A 2YJSA 4EI4A 1KE8A 4C62A 1UU7A 3ZTXA 4NU1A 4O91A 2Z8CA 3M11A 4IDVA 5HE2A 4E4MA 3R73A 2FYSA 4ALWA 4EQUA 4IZYA 1A9UA 1CKPA 5DMZA 4I94A 4GFMA 1UWJA 4TWPA 4C58A 5DEWA 4M84A 3EQCA 3C50A 2YCRA 4YTFA 3SD0A 3H10A 5AX9A 5AR7A 3VNTA 4QQTA 4DEGA 4ZLYA 5KMJA 4ALVA 4QTEA 2O63A 4KIPA 4ZY5A 4MQ1A 4JOAA 3LPBA 1W8CA 3NRMA 1Y8GA 3PRIA 3QGWA 4ZS4A 3HMMA 3KMWA 4CFWA 1WFCA 2NRYA 4WNMA 5FXQA 3SXFA 2GS7A 4AU8A 3RM7A 2WD1A 4QYYA 4RQKA 3GU8A 1XH6A 3OTUA 2X39A 2CLQA 4PDPA 4RLKA 1KE7A 2QCSA 4PUZA 4U5JA 3HP2A 1Q3WA 4GJ3A 4IVBA 4LQMA 3R7YA 4CCBA 3RAKA 3HAMA 3SG9A 5E91A 4IAIA 3RCJA 4BWKA 2P3GX 3LFAA 4RQVA 5IU2A 3UVQA 3UIUA 4F9AA 5D11A 4PMTA 4RX7A 5IQEA 4DH1A 2WMUA 2BRGA 2FO0A 3AC4A 4QTAA 2XK6A 5DI1A 3PJCA 2JKQA 4GJ2A 4FKLA 4O7ZA 5IEVA 5EYMA 3OT3A 4E20A 3FDNA 4B4LA 3OHTA 5L8KA 1WBVA 3HA6A 4FIEA 2QHNA 3DK7A 4O7WA 3OCBA 5I3RA 2ETMA 2EU9A 5CASA 3O0GA 2PZRA 5E8XA 3TEIA 4FR4A 4IEBA 2R3JA 4K1BA 4DEHA 1XH8A 2ITQA 2PY3A 4LGHA 4XLIA 2J4ZA 3H9OA 2WELA 4UMQA 1KV2A 3QTXA 3NR9A 4JR7A 1MRVA 5T6KA 4AA0A 3CPBA 3WILA 4O6LA 2UZLA 2QOBA 4XG8A 3ZXTA 2GQSA 4ITIA 3FZRA 5AIRA 3A7FA 4F7SA 3HDNA 1YXSA 4FG9A 3NCGA 4QMXA 3ATSA 3G51A 1GOLA 1J7LA 5EQEA 4JQEA 1OUYA 3CXWA 1GY3A 4RA4A 1U5RA 5D7AA 5IQGA 3HKOA 3HEGA 2HXQA 2VWBA 3TM0A 3LE6A 4O83A 2QU6A 3QWKA 2C68A 2VTMA 2CCHA 3TG1A 4Y5QA 3BZ3A 5EDQA 1MRUA 2X2LA 4L00A 4GFGA 4FYOA 4TYJA 4XP3A 3JPVA 4D4VA 3L9LA 3DLSA 1VZOA 3ORMA 3PZHA 5KKRC 4UWYA 3ORZA 3QTRA 3R63A 3TNWA 5CF4A 1SMHA 5I5ZA 5HNBA 1VYWA 2HW6A 2P4IA 3DZQA 4XG3A 4LOQA 5BVDA 3LFSA 4FICA 1R78A 3NYOA 4QP9A 3FZPA 2A0CX 2PVLA 2R64A 2C3LA 3DTCA 5ANGA 3FLQA 4DFBA 3OS3A 1UVRA 3ZCLA 2QHMA 4XBUA 5JKGA 5EI8A 2UZUE 4H58A 2PMNX 2CGVA 3PXQA 4OLIA 2WZJA 1XH7A 2C3KA 4R1YA 5C9CA 3QRIA 1LR4A 3COIA 3KVWA 4DG0E 4RIYA 3ZZEA 5ETAA 2YDIA 1ZYCA 1FQ1B 3D4QA 4QQ5A 2RFNA 1B38A 4PY1A 5E92A 5IH5A 3ZM9A 3DCVA 4FYNA 3CS9A 3MFUA 4RIWB 4GUEA 1FGIA 5AV0A 4BDEA 3Q5IA 3DY7A 4QP7A 3BI6A 2OK1A 5EW9A 5ETCA 5CAOA 2BFXA 4PPAA 1O6YA 1PKGA 2C5OA 3OCTA 2WU6A 4FKVA 4EUUA 2UW9A 3PP1A 4LUDA 3KN5A 4FOBA 5AP0A 5LMKC 3DB6A 4J98A 4AT4A 5FEEA 3TNIA 4FODA 2YIYA 4XUFA 5D10A 4M7IA 5HNGA 3F2NA 4RVLA 5B2LA 4EC8A 1PF8A 5L2SA 3ALOA 5DVRA 4DINA 5ETIA 4QMVA 2OIBA 3PY0A 4EBWA 4NT4A 3PDTA 3OROA 4CSVA 3NYVA 5M51A 4KAOA 2V5QA 3KRWA 3PPJA 3FE3A 3QCQA 4WRSA 4NM0A 4DN5A 3VIDA 2WGJA 3UIBA 4P5ZA 4EOSA 4OTHA 3EL7A 1IA8A 5HOAA 3A7JA 3FC2A 3AD6A 3UDBA 4QMNA 3LMIA 3FLWA 4JR3A 3C5IA 3ORNA 1OL7A 2PTKA 3MFTA 4W8EA 1BL6A 4I3ZA 4FKTA 2XBAA 5K4IA 3PXYA 2YN8A 1E9HA 2B55A 2C47A 2IZTA 4FSZA 4GYIA 4J52A 4V04A 3D5XA 3OUKA 3C9WA 1MQBA 2OH4A 2VAGA 4ACMA 3GEQA 2QOKA 5EQPA 3UZRA 4HPTE 4A9SA 1IAHA 4NK9A 1XR1A 5F1ZA 3EH9A 4JDJA 4FTKA 2WTJA 4I5CA 2WQEA 3AGMA 4RFYA 1FVTA 3GB2A 3DAJA 3TV4A 4R5YA 4X3FA 2CCIA 3HL7A 5CALA 2ZOQA 4ZS0A 2A4LA 4GKIA 1JKLA 1HCLA 1PXIA 3A7HA 4HVDA 2X4ZA 5HD4A 3NW7A 5T68A 2IO6A 4BCQA 4MXXA 4D5KA 4QMQA 4ITHA 3F7ZA 4QYEA 5JFWA 2GQRA 3NAYA 1JKKA 4DCAA 3PXRA 4FVPA 3DKOA 3E62A 3QYWA 3IOKA 5HCZA 2YIRA 4CTCA 5EHLA 2PZYA 4NZWB 2C6IA 3C4FA 3FZSA 4CFNA 5KMIA 4O7NA 4WIHA 4A9UA 1Q8UA 4CRLA 4BI2A 1TQMA 3COKA 1BMKA 3TKUA 3CQEA 2YIQA 4L3PA 5AUUA 4AW2A 4FKRA 3HAVA 2W9ZB 3NUPA 3FKOA 1QCFA 5J8IA 5C4KA 3FZOA 2Q0NA 4DHFA 5FTQA 4EH6A 3F61A 5EYCA 1YI3A 2HELA 4C61A 2VTTA 2VUWA 3RNYA 4JQ7A 2Z7QA 1BYGA 3A4OX 4UY9A 5CZHA 1FBNA 3TV7A 3P1AA 4A4XA 4AN2A 3QWJA 5KZIA 4R3RA 3ZSHA 2H34A 1IEPA 4O22A 4U81A 4YJTA 3KB7A 4AXAA 4KBCA 3HDMA 3NAXA 4RX5A 2W9FB 2PL0A 4XBRA 4BHZA 5AV2A 4FKQA 5CT7A 4KIKB 3RTPA 3BV2A 4M13A 4HCVA 4QNAA 3OWJA 4J8MA 4H3BA 2VWXA 3BYUA 5TF9A 3VUIA 4TY1A 4U43A 4UMTA 5A4LA 2C3IB 3BHVA 2XRUA 2ITVA 4D1ZA 1OKYA 2Y8OA 3KRLA 5K3YA 4GSBA 3FKNA 2WTVA 2PZIA 3OEFX 4O1PA 3R7OA 4BCNA 4D1XA 4P90A 3DDPA 4G5JA 2UW5A 4S33A 5L8LA 4TYIA 4CZTA 2VWIA 3QD4A 3EKNA 5HO7A 4I20A 1PHKA 1H26A 2RFSA 4CFUA 4ANNA 4PP9A 5HD7A 3UGCA 3RJCA 5CEQA 2E2BA 4HYIA 4FIHA 3NWWA 2JLDA 4IB0A 4F6SA 5KMLA 3S3IA 2YDKA 2J5EA 2XIXA 4NH1A 4FIIA 3EL8A 4L9IA 2W5HA 3DKFA 3RMFA 4B0GA 4IHPA 4YO4A 3MPMA 3DS6A 3G15A 4QMLA 1PY5A 3ZU7A 4BICA 2P2HA 5AR8A 5HO8A 2C6OA 4L42A 2I0EA 4L45A 3KQ7A 4C4FA 2YM5A 3L8SA 3C0IA 5DR9A 3N4VA 4TNDA 3BYSA 3JUHA 4CKIA 4DGNA 3T9TA 2ERKA 3BHYA 3SA0A 1ZYJA 4X2JA 3F5UA 4C02A 1YKRA 4IZAA 4JG7A 4MCVA 4Y5HA 5TE0A 4CMUA 4WO5A 3GCQA 4DEAA 5M4FA 3LQ3A 5E9EA 4QMTA 4RVKA 3POOA 2UZOA 3BU5A 4LOOA 5FP6A 4ZK5A 3TIZA 4II5A 1OMWA 4K6ZA 5A4CA 3O23A 4S2ZA 4XG9A 3UOLA 1YDSE 4YZDA 1UU8A 3PVWA 1QPJA 4YBJA 3ZSIA 1L8TA 2ITXA 4Y85A 3TWJA 5IMXA 5GIPE 4BFMA 3L9NA 1J1BA 2YIWA 1MUOA 2PVNA 3R7EA 4W8DA 4BZOA 2J9MA 3GOPA 3RKBA 2PZPA 3OWKA 4AS0A 2X2KA 3C51A 4TYGA 5CAUA 5L2WA 1U59A 5IEYA 3UOJA 5IZFA 1FVVA 3A7GA 3C4ZA 4TTHB 2AYPA 1AQ1A 5ANKA 4I4FA 5M56A 2GCDA 4K8AA 3KRXA 2WOUA 2X1NA 3D0EA 4RFMA 4PDOA 3NLBA 4CZYB 4IE9A 4IX5A 2VWZA 5FEQA 1NT2A 4DITA 2GTMA 2YWPA 4HPUE 1H1WA 3LCKA 2ZDUA 4QQCA 1Y57A 2PE0A 3A4PA 3L8XA 4MF1A 3FPQA 4D1SA 5BMSA 3UG1A 2JKOA 4O7VA 2OGVA 5CSHA 4I0SA 3D14A 4HVSA 3C1XA 4Y72A 5HTCA 4E5BA 3GXLA 3A2CA 3OD6X 3QTWA 5C8MA 3PJ8A 2G01A 2C69A 2JBOA 5I3OA 2I40A 1LEWA 3LFBA 5C26A 4FSRA 4PL4A 4FGRA 4WOVA 4EWHA 1PRYA 2P55A 4XG2A 5EG3A 1J7IA 4WD5A 3FAAA 4CV8A 5HTIA 4RJ7A 5GJDA 5J5SA 5FTGA 4DGMA 2ESMA 4U79A 3CEKA 3OOGA 4MVFA 4YU2A 3MVMA 4QTBA 4FZAB 5CU2A 5BYLA 4GUBA 3FMNA 1PXNA 4NFMA 4C34A 1AD5A 4XG7A 2VTAA 3VN9A 2O8YA 4FV7A 5IH4A 4G3EA 2J51A 3BBTB 3QXPA 4ZMFA 5AUVA 4ZJJA 5IA0A 2PVHA 5C03A 4FK6A 2OKRA 2HCKA 3QZIA 4MWHA 4W9WA 1WVXA 3QD3A 3FC1X 1HOWA 4JXFA 2PPQA 2Y4PA 3EQDA 4L6QA 2J5FA 3WF7A 3PXFA 4G9RA 4QMUA 5CI7A 3FSFA 5I4NA 3WZUA 3RK5A 3P79A 2QQ7A 1FMKA 3RPOA 3ZS5A 3ZO2A 3C0GA 3GU6A 3LCOA 2V55A 3WI6A 4D4YA 1Y91A 4DC2A 4ERWA 3KF7A 5DE2A 3VHKA 2VTJA 3FMEA 3GFWA 5EKOA 4X6RA 3P5KA 3IW6A 2Z02A 4EH3A 2UVXA 3DNDA 4EHGA 5DT4A 4WNOA 3RP9A 4KIOA 4MX9A 4NWMA 5EYKA 3D5UA 5HHWA 4EZ3A 4DCEA 5AR3A 4N6ZA 3U4UA 2ZV7A 5DN3A 2VWYA 3BGZA 4GW8A 4AX8A 1REJA 3FUPA 3CPCA 4JI9A 2CPKE 3ZFYA 4HYHA 3R9NA 3P86A 3RK9A 3NGAA 5B0XA 2B9IA 2DQ7X 4QP6A 3QALE 4GT3A 1M7QA 4QP8A 5GNKA 2R3GA 4XOZA 4IWQA 4AF3A 5H8EA 5AEPA 2RGPA 3QA0A 3MA6A 3E7VA 3OCGA 2F4JA 4KWPA 2YIXA 3L8VA 3TDWA 3ZFXA 3IK3A 3C4XA 2QR7A 4C0TA 4BR3A 4PMMA 2WTCA 3RAIA 2P33A 3HUBA 3EWHA 4EOIA 3NW5A 4RWKA 5BVOA 2C6DA 5JRQA 4DTAA 3GVUA 4M67A 4ANOA 3PA3A 4FTIA 2YM8A 3FHIA 5HCXA 3U6IA 5CU0A 4QMZA 4X2KA 4DFXE 4TYHA 3W2PA 4FTTA 4CGAA 3SX9A 3SOCA 4TWNA 4JIKA 1IA9A 3SG8A 4U6RA 3SXRA 5M4CA 2VO3A 4GH2A 2XM9A 4KS7A 3HMOA 1XO2B 2CMWA 4NJ3A 3ZMMA 4ANMA 5HTBA 1STCE 4Z9LA 3FLZA 2KULA 3UYSA 1PMVA 5DHJA 2PZ5A 4EH5A 5J5TA 1ERKA 2G15A 4G2FA 4U40A 2YM7A 3ZRMA 1DAWA 1OUKA 4ZZNA 2OU7A 3IECA 3PTGA 3KEXA 4AACA 4X2GA 3W8LA 4FTLA 2JIVA 4WHZA 2XIRA 4JBOA 2WMBA 2Z60A 2EXEA
chains in the Genus database with same CATH superfamily
5JT2A 4FIGA 3LJ1A 4X2NA 4U42A 2G2FA 3C7QA 3RM6A 3V5WA 4AW0A 2JDOA 2UVZA 3CTJA 3EN9A 2GS6A 3FXWA 3EHAA 3G9NA 1E1VA 3LFFA 3PVUA 3RZBA 4BCPA 4A4LA 1F3MC 3I7CA 1GIJA 1Z5MA 4Y83A 5FWKK 5M4IA 4EOOA 3I4BA 4XCUA 4ANBA 5J9ZA 4QP4A 4LMNA 4FNWA 5L2TA 2XAMA 4XYFA 2ZAZA 3MH0A 3TI1A 5LQFA 3QBNA 2CKEA 1PXPA 1Q8YA 3PPZA 4G17A 4FL1A 3NW6A 3GU5A 3O8TA 5EDRA 2W1EA 2W1GA 4HYUA 5AV3A 3MBLA 3ETAA 3QQHA 4FVRA 5LVMA 3OFMA 5AFVA 5BX0A 4QDEA 3GC9A 3VHEA 2XJ1A 5H8GA 2VO6A 3OXIA 1SVGA 3R04A 2YDJA 4RX9A 2ZV8A 2BZIB 2C0OA 2F9GA 3I7BA 4LOPA 4ZIMA 5DIAA 4EYMA 2YWVA 1AGWA 4BDCA 3UQCA 2BTSA 1I09A 2HK5A 3MB7A 3DU8A 1ZARA 2BRBA 3MJ1A 3MA3A 3O71A 4QMYA 4BZDA 4PDSA 1GZ8A 2PE1A 2FUMA 3DBCA 4IB5A 5FDXA 1H28A 1KOBA 3WZDA 4CFVA 4BWPA 2VTRA 3D83A 2GS2A 4QP3A 3V01A 5FD2A 4IAYA 2B1PA 4NJDA 1G3NA 3FMKA 4PL5A 2ETKA 2PHKA 5HG8A 3N4TA 2XYUA 3TZ9A 5M09A 3ENMA 4OTFA 3VQUA 1QPCA 3VS6A 4YZ9A 4B8LA 3K54A 4B6LA 4BHNA 4C2VA 4MF0A 3FQEA 4X7QA 4MH7A 1GZNA 4FVQA 3PSDA 2VX0A 2W1CA 3ANQA 5K9IA 2AUHA 2ZYBA 5FBOA 1H1QA 2BCJA 2ZMDA 2BZJA 2O2UA 1XHAA 3FMDA 5ANEA 5F20A 4UN0C 5FRIA 5F9EA 4ZTNA 4RIYB 3QKKA 2XK7A 4BDGA 4EKLA 3MGYA 4DLJA 4EJNA 1YW2A 4MD8E 4YC3A 5BVFA 3VS0A 1LUFA 3BYMA 4IDTA 3SV0A 2XM8A 2CNVA 4WG4A 2R9SA 4YGAA 4RJ6A 4IC8A 5KKRB 5LXMA 2ZFYA 4BY9E 2FA2A 4YZNA 3E87A 2RG5A 1JSVA 2RF9A 2WQOA 3K2LA 3KULB 3FI2A 3RK7A 4A7CA 4H1JA 3ZXZA 1URWA 3DZOA 3EFWA 4KNBA 4AUAA 4F6WA 5CAQA 4DDGA 5GZAA 4O0VA 3QTSA 4ZXTA 2OWBA 3C4CA 4S34A 3NUAA 3PJ1A 1M14A 2GHLA 2YLEA 3FHRA 3H0YA 4M66A 5B2KA 3ZUUA 3PSCA 4U7ZA 4CZUA 3SKCA 2R3PA 2YABA 3Q5ZA 1P4FA 5D12A 2GFSA 2Q0BA 5CSXA 1I44A 2X0GA 2X7OA 4IFCA 3VUTA 4CXAA 3C0HA 2FSMX 4XG4A 3UMWA 5HEZA 3EQGA 4JL9A 3KCKA 4R8QA 3UQGA 4R7BA 3DXQA 1SVHA 5JMSA 2BDJA 3KVXA 1PMEA 2WTKB 4G3GA 3EMGA 4MWIA 4EOPA 5HVKA 3WZKA 2C6LA 5TOZA 3O8PA 2OJ9A 4MD9E 4EK8A 4AFEA 2V7OA 2AC3A 4I5PA 3FI4A 4J7BA 3NCZA 4RJ3A 3A8WA 5L8JA 3RHXA 5CF6A 1JSTA 1WVYA 4YZBA 3I81A 4M68A 3U54A 5CI6A 2UZEA 3U4WA 4F9WA 2ZB0A 5A4QA 4CVAA 2OIQA 3BYOA 4IAFA 2VGOA 2VWUA 4H3PA 4QMOA 4JDHA 5LMBA 3DFAA 2ZM4A 4FIFA 4AZTA 4FSWA 5BVNA 4GG7A 3RCDA 2GHMA 3VBXA 2B0QA 1KSWA 2QI8A 3DAEA 4DBXA 5K5NA 2JDSA 3OEZA 3OUNB 1DS5A 2UW0A 3D5VA 4CRSA 1REKA 4MQ2A 5HCYA 2PULA 4Z7HA 3VS4A 3GGFA 4AXEA 4MK0A 4YJPA 2BMCA 3CC6A 4Y8DA 3F5PA 3ZRLA 3TYKA 4ASEA 1T45A 4PTCA 4HGLA 5EFQA 3IKAA 4IC7A 3DPKA 4FTAA 5AAGA 2QKWB 4D9TA 3QQGA 3V6SA 3W2QA 5ICPA 4E7WA 3QTZA 3R7IA 4FUXA 2WMWA 3CIKA 4DFYA 1PXLA 3NZ0A 3ORKA 3R01A 3R22A 4HYSA 4LGGA 4S30A 4BF2A 2VTPA 2C4GA 3PIZA 2CLXA 4YNEA 2CGUA 5CEMA 3PE2A 5G6VA 2RG6A 1OPKA 3WARA 2WMSA 5H8BA 2YLFA 3D7TA 4I5HA 4RA5A 4V0GB 3AC1A 4FSTA 4Y46A 5AR4A 4F1TA 1IR3A 5JSMA 4BCOA 4CLJA 5AM7A 2QR8A 1UWHA 3BRBA 3Q4CA 2R7IA 4YBKA 4HJOA 1Y6AA 2G2IA 4J1RA 2WIPA 5HIEA 2OH0E 1XJDA 3LFEA 3OC1A 1WVWA 1JPAA 1OIYA 4IWOA 4RPVA 1ZXEA 3B2WA 2QU5A 3R83A 2VGPA 2WQNA 2WKMA 4DH5A 1V0OA 3AT2A 4MYGA 4XV3A 4YHJA 4O27B 3LKMA 2ACXA 4JG8A 1KWPA 4KSQA 4FOCA 3D2KA 5JQ5A 3R7GA 4I1ZA 4G5PA 3CTQA 4KKEA 1XKKA 1ZOHA 4ZMEA 3O51A 1R0EA 5AV4A 1YXVA 4EK5A 2I0HA 2X0QA 3I0QA 1OL5A 4A9RA 3F3ZA 5I0BA 5F95A 4KBAA 3GC0A 3PE1A 3W2RA 1XMLA 1ZLTA 5GINE 3PYYA 2QOFA 2NO3A 3QCXA 4YURA 4XNEA 3UO5A 4C35A 4U45A 1OL2A 5IA3A 3VF8A 4G31A 3GCPA 2YA9A 4AOIA 2HW7A 1GIHA 3NYXA 3Q96A 3GQLA 3UYTA 3VS1A 2OG8A 5JGBA 1V0PA 4AQKA 4BTJA 2PUNA 3DGKA 2WMQA 3UDTA 3UZPA 4FV3A 5J7BA 3P08A 4OBOA 3TIYA 3TN8A 3ZLWA 3UTOA 4ACHA 3BPRA 5HX8A 2C5YA 4DG3E 2B7AA 3PIYA 3QRTA 5L6OA 2W5AA 4FV0A 3QC9A 3ACJA 2E9VA 2IZSA 3IS5A 3MPTA 3NEWA 4G6OA 2VWWA 1SYKA 5CU3A 3VO3A 3PLSA 3VJOA 2FVDA 3ORTA 3W55A 1YHSA 4BKZA 4BCGA 5AAEA 3E88A 2NPQA 4FZ7A 2IF8A 5ETFA 5AA9A 3HGKA 1R0PA 3HMNA 2XIZA 3IDBA 3G0FA 3LIJA 4UBAA 3TTJA 2WTDA 4BDAA 4WSQA 2OJFE 4AZVA 5AX3A 3HRFA 2GNJA 3H30A 3R02A 3DJ6A 5ANIA 4FGBA 5K4JA 4J96A 1U54B 4EH4A 2BILB 2C6KA 2YERA 4L52A 4BGQA 3W0OA 4YPDA 1H24A 2CDZA 4ZZMA 3MIYA 3ZO1A 4X2FA 4F7LA 3GBZA 4DT8A 4I6FA 5HESA 2EVAA 4O0WA 4ZLZA 2XA4A 2BHHA 3P0MA 3G2FA 2IWIA 2VNYA 4USDA 1Q62A 4CFFA 2XKFA 2NRUA 2IW6A 3P4KA 3W8QA 3CLYA 4F9CA 2GMXA 3NUXA 5HE1A 1OGUA 4C38A 4XMOA 4MTAA 3ZUVA 5BPYA 4PQNA 4EC9A 5FDPA 4DF3A 4O7LA 1ATPE 1Y8YA 1Q97A 3E7OA 4ID7A 1OBGA 3W0MA 3JY0A 4FI1A 2QKRA 3QYZA 3TZMA 4J97A 2V62A 2R4BA 2AC5A 4XV2A 4YUQA 3M42A 4CQEA 4HVHA 3F88A 5C1QB 1UA2A 1QL6A 3PFQA 3ORXA 4FKPA 3A61A 3IG7A 3EB0A 2JIIA 2PWLA 4LYNA 4BBMA 3FLNC 4L44A 2PMIA 4F1OA 4NM7A 1XBCA 2CHLA 3AOXA 3TDVA 4WG3A 3PJ2A 1BLXA 2ERZE 4UYAA 4BBFA 5LOHA 3CSVA 2XIYA 5J9YA 3MDYA 1XH4A 4RC2A 3VUMA 4DFUA 3EQBA 5GHVA 3MN3A 2B9JA 2YAAA 4APCA 1O6KA 2RFDA 3QUPA 4OTRA 3OWLA 3R8PA 4CFMA 4ANQA 1RDQE 4APPA 4ZP5A 1ZY4A 4FV9A 3QLFA 4IBMA 1Q24A 4I22A 1YWNA 2X7GA 3TL8A 3W0PA 5CEPA 3DBFA 5AIKA 1BL7A 4KUJA 2BHEA 3SHEA 4A07A 2QO7A 2C5NA 1E1XA 5FBNC 5A4EA 3PFYA 3JS2A 2WXVA 3R21A 3GUBA 1YOLA 4MNEA 3S2PA 4ACCA 3VUDA 3ODYX 2XVDA 2VTQA 3F7WA 4BL1A 4IANA 5LARA 4RVTA 5CAPA 1H4LA 4FE2A 2W1FA 4O0XA 4YP8A 1RJBA 3FSKA 3KK8A 1DM2A 4D2SA 4GEOA 1LEZA 2CJMA 3O2MA 3VWAA 4RZVA 4M14A 5LJJA 5BUIA 1GZOA 5CS6A 2R0IA 3QF9A 2BRMA 3TUDA 2AQXA 1SVEA 4TYHB 4Q9SA 3ITZA 1UNHA 3VBWA 1J7UA 2C0IA 2RFEA 4TRLA 3P7BA 4BGHA 4R6VA 4P4CA 3W2CA 4E6DA 2QOOA 1UU9A 2BVAA 4FKOA 4LL0A 5M44A 1OIUA 3QCYA 4RIOA 4IM2A 4IJ9A 4L68A 4XP0A 3QGYA 1IG1A 4BRXA 5JH6A 4FX3A 2QOLA 4EZ5A 4ITJA 1JQHA 5CNNA 4C59A 2XNGA 4OTWA 4H36A 1FOTA 3R8ZA 5EQYA 2GDOA 1WCCA 2UUEA 4IJPA 2WTIA 3NUUA 2OFVA 4EEVA 3MVHA 2H96A 1QPDA 3QD0A 3LMGA 3MSSA 3F2RA 3OVVA 3QA8A 4MAOA 4FG8A 5CLPA 3QFVA 3CD8A 3KK9A 3QHWA 1VYZA 4C7TA 4W9XA 4QOXA 3V6RA 4BYIA 5C4LA 2J50A 4CEGA 3PP0A 3MPAA 2BALA 4EOKA 2A2AA 3MS9A 3U6HA 2CSNA 3HLLA 4Q2AA 4HVIA 4K2RA 3ZOSA 4Z55A 4FV4A 4HOKA 4AGUA 4F08A 4HCUA 1TVOA 4NCTA 4XLVA 5J1VA 4FC0A 4DTKA 3PJ3A 2XK9A 3LQ5A 2BTRA 2ITNA 2XKEA 4FG7A 5L2IA 4AZSA 5KMKA 5DRDA 1PYXA 4X3FC 3WBLA 3WF8A 2JAVA 5CF5A 4MD7E 3NPCA 1Q5KA 2WEVA 3Q32A 5EHYA 3GNIB 4JRNA 4E5WA 3Q4TA 3DB8A 2J7TA 2C1BA 2QOIA 3LAUA 4KA3A 3PLAE 2VO7A 2Y4IB 4KRCA 4RWIA 4YHFA 3UP7A 1ZMWA 3BU3A 2WNTA 1YXUA 3OWPA 2XK3A 4E26A 1Q99A 1YXTA 4W4XA 2Q83A 3M1SA 4FV6A 4I5MA 2QONA 2VX3A 4GV1A 2PU8A 2R2PA 5HG9A 3I79A 4BCHA 2W17A 5JZNA 3CJGA 5AMNA 3D94A 3Q9ZA 5L4QA 3ALNA 2YEXA 5E8TA 4C4IA 3ZRKA 5ANJA 4ZY6A 2O0UA 4KIKA 4IWPA 5BV3A 1H0VA 4YJSA 5BUJA 1H08A 3KXMA 4O86A 3PSBA 2XIKA 5I9VA 1WBOA 1IRKA 3KN6A 4QT1A 4EK3A 1PYEA 3DLZA 3O8UA 3Q9YA 4OBQA 3IQ7A 3GOKA 3W33A 3QX4A 1U54A 5DEYA 3VS5A 4DEIA 5IQIA 3P9JA 3LVPA 1GJOA 4O0RA 5IPJA 1FVRA 4TN6A 5DGZA 2OIDA 3ZC5A 3TACA 3OBJA 4C37A 3S00A 4CCUA 1CDKA 2YM3A 2I1MA 2R5TA 4YZMA 4R1VA 3R9HA 3ZO3A 1SM2A 3LFNA 4I41A 4Q5EA 1WBNA 2JD5A 3RINA 2VN9A 3V8WA 3QAME 4ACDA 5CSWA 4RJ4A 1WMKA 2Y9QA 3V04A 3TCPA 2VV9A 3GI3A 3KXHA 4JDKA 2J0JA 2IZUA 2OXXA 2XJ2A 3ENHA 1JSUA 3AMBA 1ZZLA 4ZZOA 1PKDA 4UEUA 2OZOA 4BTKA 4ZY4A 4DEDA 3QZFA 1NVSA 4YJNA 1R39A 4TNBA 4O38A 5TO8A 1XWSA 2R3RA 3GQIA 3E64A 2NP8A 3MW1A 2HZIA 3NYNA 3R6XA 3F3UA 5AP1A 3VBYA 4KS8A 2W7XA 3HP5A 2XEZA 3H4JA 4RLLA 5A3XA 4BCMA 4HVGA 5I9XA 2XANA 5KZ0A 2OXYA 4BDFA 4LRJA 4MBJA 4MUQA 1SZMA 2XEYA 3W32A 5CEKA 1U46A 3MH3A 1XQZA 5CENA 3DOGA 3O50A 2YCQA 2ZMCA 4CYIA 4ZTMA 2XARA 3NFFB 3CCNA 1WBTA 4PDYA 2X8DA 3CQUA 3F3WA 4DTBA 2GNLA 4UZHA 5CEIA 5FXSA 3WE8A 5GIOE 2XNMA 4YO6A 3OF0A 3QCSA 2B52A 3CY2A 3N9XA 4G9CA 4GS6A 4JAIA 4NSTA 4DYMA 4ZSAA 3AGLA 5JRSA 2NYAA 3C4WA 4DH8A 2EUFB 3MIAA 3W18A 3UIMA 2BAJA 2OBJA 3E5AA 3QX2A 4JNWA 4PNIA 5HGIA 3TT0A 5JEBA 2F49A 5EM6A 4A9YA 1H27A 4IX3A 4J8NA 5IQDA 3LLAA 3I5ZA 4AGDA 4JIAA 1OZ1A 4GK2A 3EN4A 5C8KA 1Q8ZA 4D2TA 3O5AA 3LFDA 1B6CB 3COHA 3PY3A 5L3AA 4D2VA 3E63A 4O2ZA 2CGXA 3H9RA 1UNGA 1ZZ2A 3DTWA 3K5UA 3ZZWA 4OW8A 3ZDIA 5KO1A 4JJRA 1NA7A 2GNHA 5E8ZA 3OXTA 1O9UA 3JR1A 2WFYA 1J1CA 4WUAA 2OZAB 4XEYA 2R3HA 4WSYA 1NW1A 4L67A 4AN3A 5BVEA 4IAAA 3Q6WA 2PUPA 4Z7GA 4PWNA 5A46A 3FI8A 3LCTA 3BHTA 3CD3A 2C30A 3R1NA 4YJVA 4ALUA 3H9FA 3ZO4A 3BKBA 2IZRA 4DFZE 2RIOA 5H9BA 3D15A 2BKZA 5F94A 2ZV2A 5HI2A 2XCHA 3W16A 4ERKA 4PNKA 5KMMA 3BCEA 3OT8A 3FBVA 3KFAA 4QQJA 3ZYAA 3QZHA 3WIGA 3QUEA 4F9YA 3JY9A 3ODZX 2BZHB 4FKUA 4MEDA 2VTIA 5CTPA 4ASXA 2WO6A 5CXHA 2LAVA 3MFSA 4GL9A 1PXMA 3MH1A 4D2WA 1Q8WA 5AM6A 5CVHA 3VUGA 3HV4A 5DR2A 3DBQA 2VTNA 3SDJA 5EOBA 1YHVA 4R7IA 3P7AA 2E9UA 4BKYA 3UC3A 4FZDB 3F5XA 5B7VA 2HIWA 3G6GA 5IQCA 3LMHA 1TFFA 3FLYA 3UVPA 3G33A 2UZVA 3BX5A 4NM5A 3RPSA 3VS3A 2X2MA 1OKZA 3VULA 2VTOA 2F7XE 3ZSGA 4FT3A 4TW9A 3DFCB 5J9LA 5M08A 4PF4A 4F7JA 4FTNA 1PJKA 2PYWA 2B9HA 3Q52A 5ANDA 3KXNA 3GC8A 3FKLA 4Q9ZA 5A6OA 3DK3A 3VW8A 2VTLA 3EFLA 4CLIA 5HG7A 4GU9A 2JDTA 3QL8A 4WKQA 2BRNA 2ETRA 3V5LA 3PZEA 1WAKA 3KRRA 4F99A 2IVUA 3OTVA 4QD6A 1GNGA 4OR5A 3K3JA 5DOSA 4HNIA 3NIEA 1G5SA 4I4EA 4ZLOA 5CVFA 4B99A 3QUDA 5E1EA 2UZWE 4M0ZA 4RC3A 1Q4LA 2O64A 1L3RE 1PXKA 4U8ZA 2IW9A 4I21A 2QURA 1YI6A 4U97A 3SVVA 1KOAA 3A60A 2W06A 4RIWA 3L9PA 3T9IA 2B9FA 1CSNA 4E4LA 4Z16A 4HGEA 2XCKA 4UALA 3KULA 5CZIA 1BX6A 3ZUTA 1G8SA 4MXZA 3W2SA 4BTMA 3QQLA 5KCVA 2SRCA 1JNKA 1ST0A 2A27A 3HMIA 3FPMA 4MXCA 4AZFA 3LZBA 2VZ6A 2JGZA 4UWCA 4M0YA 1A48A 3RPRA 2JKMA 4BDKA 2VWVA 4FTQA 4F64A 3OXZA 1V1KA 2XF0A 1CTPE 5LVNA 5JFVA 3F6XA 2X0OA 2UW6A 1WBSA 5AUYA 1EH4A 1OITA 4BCJA 4JBQA 3O96A 4MHAA 4O0SA 4GRBA 4OT6A 3LXPA 4YLJA 4YLKA 3V5QA 3EOCA 3HV5A 4OUCA 5A14A 3NDMA 5IMEA 1UV5A 4NKSA 3TTIA 1Q61A 4AAYA 3ELJA 3RAWA 5GZ8A 2W1HA 5KE0A 4ZSEA 4U41A 1SNUA 2XB7A 4FMQA 4OTDA 2R3NA 4AW1A 4O7YA 3HNGA 2QNJA 3UQFA 2PVJA 4BDBA 1ZWSA 2YCSA 4G1WA 5FEDA 5IH6A 2QO2A 4GIIA 3RI1A 4MXYA 4FKIA 3KY2A 3EQPA 3MY1A 4N70A 2VTHA 3MB6A 5IUGA 4WT6A 2C6EA 4AOJA 2OW3A 4NUSA 4GT5A 1M17A 3TNHA 4BBEA 2CNUA 4HGTA 5E8SA 3RBWA 4V01A 5AADA 3G90X 2BIYA 4O96A 4HZRA 3NVKI 5AA8A 3VJNA 5E8YA 1YI4A 3SLSA 2I6LA 1OBDA 4LG4A 4EKKA 1X8BA 4CV9A 3NS9A 3Q4UA 2VO0A 4EUTA 2XUUA 3PVGA 3OCSA 1M7NA 4FUYA 5CU4A 5LVLA 3UZTA 3RAHA 2W1IA 3TJDA 3BYVA 3EYGA 3FI3A 4C33A 3AXWA 4E6AA 3LJ2A 1S9JA 4GVAA 4O2PA 4RWJA 4AGCA 2CKPA 3TJCA 3UDZA 4H3QA 3Q4ZA 4FJVA 1IASA 3HA8A 3D2IA 4AA4A 2J2IB 3PG1A 4NKAA 4UMRA 3BL9A 4LFIA 5CX9A 5M07A 2ZB1A 3UG2A 1YWRA 2VRXA 4OTQA 4I92A 4XRJA 3ZLSA 4AT3A 4EOQA 1P2AA 1ND4A 3HV6A 2C0TA 2QO9A 1YDRE 4FSQA 4M69A 2RKUA 5EOLA 4YSJA 4EORA 4E4NA 4UZDA 4EH7A 5KMNA 1Q8TA 4QMWA 5K0KA 4GCJA 1XBAA 2IG7A 5IA1A 3EQFA 3TUCA 2OICA 4UB7A 3IW4A 2X4FA 4ZSJA 5KX8A 3LCDA 5IEXA 1F5QA 2UZBA 5CU6A 2OFUA 4UMUA 3UPXA 5B2MA 1ZAOA 3II5A 2W4OA 1K3AA 4MKCA 2GU8A 4CFXA 2W5BA 4O4EA 2Y0AA 4O21A 4YNOA 3DJ7A 2R3LA 3PXKA 3DAKA 3KF4A 2JIUA 1Q3DA 3RNIA 4WBOA 1GAGA 4I6BA 4C4GA 2HOGA 3F2AA 3MI9A 3G0EA 4ORKA 5HVYA 4FZFB 2X6EA 3TZ7A 4USEA 5KUPA 4RVMA 4CMTA 2B54A 4D58A 3MTFA 3I5NA 4GIHA 1Z57A 3PWYA 3WZEA 4C2WA 4M15A 4R3PA 4M69B 4F1MA 1F0QA 1P4OA 4I6HA 2BZKB 2QLUA 4XJ0A 3BIZA 4MNFA 2H9VA 4ZJVA 1K9AA 2Z2WA 3TXOA 3ZBFA 2YFXA 1YXXA 2BAQA 3FZTA 3V51A 3NNXA 3QQFA 4G16A 2YITA 4QNYA 2EXMA 2B4SB 4TXCA 1W2CA 5D1JA 4YJOA 1H25A 4CYJA 5BVKA 3P78A 2ZM1A 1DAYA 1M2QA 1WZYA 2YHVA 3IDPA 3LXNA 5EW3A 2IVTA 2VNWA 4J71A 2WQMA 4UWBA 3VRYA 4L01A 1PXOA 1OPJA 2FSOX 3QC4A 4GK3A 2WTWA 4BB4A 2IN6A 4IACA 2AEGA 2R3FA 3R0TA 1R3CA 4ZOGA 4BWXA 2GTNA 2W05A 4K77A 2BDWA 2VU3A 3NNUA 5LVOA 3UC4A 4FNZA 5EH0A 2QOHA 5HNIX 2ITUA 5TR6A 3TZ8A 5EKNA 1KE9A 5IA4A 4IZ7A 3IGGA 4GVJA 3SAYA 4ZTQA 3VQHA 4FKGA 4E6CA 5C27A 4AGWA 4D2RA 2O5KA 1H1SA 4N4SA 4WA9A 3FL4A 4XV9A 4YJUA 5JGAA 1H8FA 2E9NA 4OT5A 3W10A 3VAPA 2BDFA 4XX9A 2GFCA 3O7LB 4NTSA 1MQ4A 2Y7JA 3QHRA 4S31A 3KREA 4ONAA 1OKVA 2X9FA 3GT8A 3HVCA 4L7SA 3R8UA 4FTRA 1TKIA 2HZ4A 2R3OA 4PP7A 4YHTA 5TT7A 4C36A 2HWOA 2XMYA 4L7FA 2Z7LA 2VD5A 3AG9A 4LV5A 5CT0A 4H39A 5AP6A 4CKJA 5A9UA 3UVRA 1W98A 3BLRA 2Z7RA 4P2KA 5GJGA 2A19B 3FMHA 4O4DA 3OY3A 4I23A 3PA5A 1Y6BA 3TNQB 4IB3A 4YJRA 1V0BA 4C4EA 3VF9A 2JFLA 3NNVA 4KKHA 4OBPA 4RG0A 5J95A 2JEDA 4ZTRA 1G8AA 3PIXA 4D9UA 1YVJA 3R1YA 3R28A 3BELA 3HYHA 2NNWB 1YOJA 4L8MA 3QQKA 3CQWA 4KBKA 4FEQA 3V8TA 4R7HA 1M2PA 2F7EE 3FYKX 2XK8A 4RIXB 3R30A 1BI8A 2V0DA 3RHKA 3Q9WA 4F7NA 3BE2A 4AWIA 1ZMVA 3IPHA 3B2TA 2V7AA 3QZGA 4DBNA 4LI5A 3Q53A 4QYGA 4DH3A 3ZC6A 2GSFA 1DI9A 5FLFA 4BCKA 4CG8A 4LRKA 1H1PA 2XS0A 3UOHA 4GFOA 5AJQA 4E73A 2ITTA 5AP5A 4RFZA 2BAKA 3FZ1A 4M3QA 3BGQA 3F66A 4NIFB 3W1FA 4BCFA 4FA2A 4PMPA 1OPLA 3R71A 2E9PA 3A62A 4CD0A 3SOAA 4ZSLA 2YISA 1P14A 3BL7A 3HRCA 4G6NA 4IADA 4WBBB 3UODA 5KMOA 3TNPC 2DS1A 1PMNA 4IQ6A 2IJMA 4RJ8A 2C1AA 2OJJA 2WMXA 3UJGA 3HV3A 4PMSA 2F57A 3LCSA 2UVYA 1KE6A 2ONLC 4EK4A 4FF8A 3R00A 2OJGA 4EHEA 5KHXA 3NNWA 4F0GA 4JMQA 3A8XA 3ZDUA 1LP4A 3BHUA 2WMTA 4BIEA 5AP3A 2OZAA 3LXLA 4ZTHA 2BR1A 4F65A 3GENA 3NUYA 3NUNA 2XNNA 3AC3A 4EHZA 2YJRA 3POZA 3CGFA 4IX4A 4FK3A 4QPSA 5IQAA 4IAKA 3D7TB 3UE4A 2PMLX 2VTSA 3EZVA 1CM8A 4H05A 3PUPA 2G2HA 2Z7SA 5EM5A 5L6PA 3F82A 5CY3A 4C3PA 2W99B 3V5JA 3BLHA 4C3FA 2DUVA 4L3JA 3FV8A 4YPSA 4I24A 2PVKA 5JQ8A 4JS8A 3IGOA 5BVWA 4FIJA 3MFRA 2W96B 4DG2E 1RQQA 5DYJA 4IH8A 2F2UA 4BZNA 3RVGA 2H8HA 2R3QA 4PRJA 1UKIA 4L43A 3I6UA 4WUNA 3VBTA 4YLLA 1ZYSA 5DPVA 4ZTSA 3TMOA 3WIKA 4KD1A 3KC3A 1Q41A 4PTEA 5LVPA 4IVCA 2YAKA 4G3CA 4O7SA 5AP4A 4ZAUA 4ANSA 2JITA 4R3CA 2QOCA 3DBDA 4JBVA 5DBXA 3UOKA 4FZ6A 2IW8A 5KNJA 1XH5A 4BI0A 3P5JC 3R2BA 3NVMB 4AP7A 5EW8A 2DWBA 5HU3A 4CG9A 2FH9A 5KBQA 3JXWA 3MYGA 2X9EA 1YHWA 5BNJA 3MESA 4FT9A 2XP2A 3ORLA 4FSYA 5IISA 4N0SA 4Y95A 5JN2A 3D5WA 5HIDA 2QODA 4FL2A 5AP7A 4DGOA 4NEUA 3CP9A 5HIBA 3FL5A 2FSTX 4PPBA 3EJ1A 4FBXA 4K18A 3G5DA 4M12A 4BKJA 3OZ6A 4JDIA 4AA5A 4U3ZA 1OL6A 4RIXA 3QTUA 5BUEA 5EM8A 3KXGA 4LUEA 5AR2A 5EK7A 3KRJA 3QD2B 3ZLYA 4AW5A 3GU7A 3QKLA 3VBVA 5CF8A 5HKMA 1YDTE 4NM3A 4KKGA 1OIRA 3KU2A 1K2PA 1B39A 4EK6A 5CXZA 3KXZA 3A7IA 3CJFA 3U51A 2E9OA 3L1SA 4O1OA 4YZCA 3LM5A 1VEBA 3EQIA 5CAVA 2EB2A 1YOMA 4FTOA 4X3JA 3PXZA 3Q9XA 3G9LX 3CR0A 4GYGA 4BDHA 4GT4A 4X0MA 3OMVA 5CANA 3Q6UA 5A54A 3PY1A 5E8UA 4K11A 2O65A 2W4KA 2X8EA 2HENA 3GC7A 3OG7A 4UYNA 4X3FB 3S95A 4AG8A 4AE6A 5BQ0A 2X8IA 5CQWA 4U44A 2HY81 4YTIA 5HLPA 4A4OA 3AT4A 4IVAA 3UIXA 1U5QA