4F1MA

Crystal structure of the g1179s roco4 kinase domain bound to appcp from d. discoideum.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
278
structure length
278
Chain Sequence
b'KSRLPTLADNEIEYEKQIGKGGFGLVHKGRLVKDKSVVAIKSLILGDSEGETEMIEKFQEFQREVFIMSNLNHPNIVKLYGLMHNPPRMVMEFVPCGDLYHRLLDKAHPIKWSVKLRLMLDIALGIEYMQNQNPPIVHRDLRSPNIFLQSLDENAPVCAKVADFSLSQQSVHSVSGLLGNFQWMAPETIGAEEESYTEKADTYSFAMILYTILTGEGPFDEYSYGKIKFINMIREEGLRPTIPEDCPPRLRNVIELCWSGDPKKRPHFSYIVKELSEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase roco4
publication title Roco kinase structures give insights into the mechanism of Parkinson disease-related leucine-rich-repeat kinase 2 mutations.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase, signaling protein
total genus 77
structure length 278
sequence length 278
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4f1mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4f1mA01
4EZ3A 3KULA 3MSSA 4HOKA 4Y85A 2UW5A 4U8ZA 4GU9A 2PMIA 5ANGA 3QQLA 2R3IA 4BDIA 2PY3A 4BKYA 4CZTA 5FXRA 2C1AA 5LMAA 1PJKA 4FVRA 3WZDA 5JMSA 2OF2A 3HMNA 1IEPA 4FEQA 5FEQA 2GNFA 3LM0A 4DEIA 5C27A 2QHMA 1YW2A 5GNKA 4OGRA 3PWDA 4O1PA 4JR3A 3BEGA 3KEXA 1CKPA 1G8AA 2CKPA 1O9UA 1OECA 3FI2A 2EXCX 2GHMA 3UP2A 3MVLA 4FKPA 4WSQA 5KZ0A 5CSXA 3RZFA 2NPQA 3FSKA 4QTCA 3ZFMA 5E1SA 1TKIA 1UU8A 2RG6A 5CEQA 2Y0AA 4RLLA 4DFNA 2BR1A 2RFNA 3MPTA 1W8CA 4I23A 1NVRA 3BLHA 4ZTSA 2BIYA 1KE8A 2GFCA 4JR7A 4APPA 2PVKA 4L7SA 3DXPA 5CZIA 2W17A 2GMXA 2ZDUA 4YJOA 3IDPA 4JG8A 3U9CA 4A9RA 3WE4A 2FGIA 3H0ZA 1YHVA 3QD4A 1F5QA 5FEDA 3UPZA 1H1WA 4UALA 4F7JA 1STCE 1UU9A 5HNGA 4EK5A 4U3ZA 4XOYA 2Z7QA 1F3MC 2CKEA 3LHJA 5DR6A 4IQ6A 3W16A 4ACCA 5DPVA 5E90A 5HLNA 3MYGA 3MTLA 4RWIA 1Z9XA 2VWYA 2Y6OA 3BGPA 1CTPE 3CTQA 2CGUA 4Y5QA 5GZ9A 2BAKA 2BPMA 2WIHA 3MA3A 4R3CA 4BDHA 3A7GA 1SZMA 3V8TA 4G16A 4FZ7A 4TKSA 2C47A 3U55A 2F49A 3K54A 3DQWA 2UZWE 4FG8A 4KB8A 5LVNA 1Y8GA 4GUBA 2G2HA 4O2PA 3MI9A 4OLIA 4V01A 1P4OA 3VS1A 3FMJA 1M2QA 1W0XC 1M7NA 4L45A 2VU3A 3EQHA 5BYZA 5JRSA 4EK3A 4QT1A 3HA6A 4EOOA 1JBPE 1S9JA 3B8QA 4ZSJA 1OMWA 2ZM4A 4RC4A 4XG2A 3FMDA 4D9TA 2ZB0A 1T46A 5M55A 3LQ5A 5AA9A 3W2OA 3ROYA 2E9OA 5CLPA 4FL3A 2PMOX 3DDQA 4CT2A 3A7IA 2PTKA 5CAOA 1VEBA 3QAME 2WU7A 4GT4A 5FTGA 3DBCA 4BCNA 4YO4A 2P4IA 4J7BA 3NUAA 3JVRA 3UO4A 3QKMA 4ZSEA 5T6KA 5I9XA 4DN5A 1XBBA 2XUUA 2XH5A 3KULB 2I7QA 3E87A 4USFA 2OO8X 2VTMA 5GIOE 3Q2MA 3CIKA 4ZMFA 3SLSA 2WMBA 4S30A 1UA2A 3PVWA 1OZ1A 4QP1A 4KINA 1BI7A 2BTSA 4YZCA 5C9CA 3ZLSA 3ORMA 1OIRA 3MB6A 3AXWA 4NCTC 2QO9A 4LOQA 5I9YA 3L9LA 4FL1A 4O0YA 3GU6A 2Q83A 5C4KA 5K5XA 3OXIA 5DI1A 4BDGA 4V05A 4NFMA 3VQHA 4DFUA 4FKWA 4DG3E 5CQUA 4OTDA 1HCKA 4LGGA 2BRBA 5LMKA 2OJFE 5IUGA 4DTKA 4XS2A 5D12A 5IQEA 3S4QA 4A9YA 3KY2A 4K0YA 5TR6A 3FI8A 4FT3A 4F99A 2XJ1A 4QRCA 1P2AA 1YOLA 2JIVA 4UYAA 3UNKA 5A46A 2OJJA 4FMQA 4O6LA 3VBQA 4LMNA 2PK9A 4BYIA 3QTRA 4IDVA 3BX5A 3QTXA 4OTRA 4R78A 3CQEA 2CNVA 4W4YA 3PLSA 3TTIA 4KKGA 3QLGA 4S33A 4EYMA 5BUJA 2YIWA 4AE9A 2PVMA 3PJCA 5DT4A 3S2PA 3CPBA 3E5AA 4YHJA 4CTCA 3DKCA 5B7VA 1AQ1A 5CNNA 3ODZX 4JT3A 2BZIB 5DN3A 1NXKA 4BDCA 3RK7A 3REPA 3TWJA 5EYMA 3R9DA 5DYJA 1YXXA 5EFQA 2PPQA 4IX3A 4NU1A 2XYUA 3KXZA 3R00A 1ZY4A 3QA0A 4WUAA 5ACBC 5CAUA 5CF6A 2V0DA 3ITZA 4KIKA 5CU0A 2XJ2A 4S34A 3ZUVA 4D2TA 2YDIA 5ICPA 2XK6A 4CYJA 2CSNA 4H3PA 4QMOA 4GSBA 5HU3A 3OWLA 4YZNA 5KMMA 4PY1A 4QP2A 3NEWA 2BDJA 3OFMA 5TT7A 1VYZA 3BBWA 3LCKA 4FKSA 4MKCA 3UQGA 3PVUA 3KXHA 4BFMA 3ORLA 2GNIA 4GL9A 2YCFA 3ZRMA 3FXZA 2QI8A 2XNGA 3EN4A 2CKQA 1U54A 2JDTA 5CU4A 2H6DA 3R1SA 4IX4A 4KSQA 4J95A 4NZWB 3F5XA 4OAUC 5F4NA 4L3LA 4C4GA 2W5HA 2F2CB 3O23A 3KL8A 5KBQA 1PYXA 1JSUA 2F7EE 2HY0A 3BE9A 5H3QA 4FTMA 3VBVA 3R0TA 2OWBA 4X3FC 1OL1A 4RPVA 4FSQA 3FWQA 4KD1A 3RKBA 2W9ZB 4XUFA 3POOA 3E7OA 4FSMA 4FKUA 5A54A 3SRVA 5KKRB 2E9UA 5L3AA 2RFEA 3UP7A 3PVBA 4FOCA 4E3CA 5CF5A 3SA0A 3F3VA 4C3RA 4RIYA 2VX3A 4E5WA 4BIBA 4JRNA 1JKLA 4GH2A 4PDOA 2P3GX 2YM7A 4M0YA 4FSYA 2OU7A 4O96A 3N4VA 3FL4A 4C57A 4AAAA 3SVVA 4EH6A 1PMNA 5CVFA 4GUEA 3RINA 4FUXA 5EYDA 3TIYA 3GC9A 4RX8A 4AX8A 3VW6A 5J9YA 2CGWA 4DFXE 3FJQE 3GCUA 1YRPA 5DOSA 4AWIA 3L8SA 1J1CA 3NW7A 1XBCA 2HXLA 2UW4A 3D9VA 4JAJA 5ANOA 2OXYA 2ZAZA 3ZTXA 4CNHA 1GAGA 2IVSA 4YNEA 3G0FA 4L52A 5ANJA 2P2HA 4N6YA 2XF0A 4RWJA 2P0CA 3VIDA 4HCVA 3U9NA 2XIYA 4X21A 1V0OA 3KRWA 3RJCA 1T45A 4G1WA 4DC2A 3PXZA 5HE2A 5HG5A 2R0UA 3COMA 4QP4A 4TPTA 4E20A 4TTHB 5HG9A 4CLIA 3DT1A 4D1ZA 4TY1A 5KMIA 1M17A 3PFQA 5CI7A 4BBMA 2XKDA 3VUTA 5JZNA 4C2VA 2R3GA 3MJ1A 4Q5HA 3HEGA 2E2BA 2PUNA 2WQMA 5FBOA 5CXHA 2YERA 3SXRA 2F2UA 1B6CB 5EQEA 5F9EA 3KB7A 1CM8A 4EJNA 2BRHA 3QQFA 3QZHA 4DH5A 4TWPA 1IAHA 3QQUA 4KIKB 3VS2A 3QTSA 1E1XA 4D2VA 4KSPA 4KRDA 3MWUA 4KBKA 3SOCA 4R77A 5DHJA 3WIGA 4L7FA 4XG4A 1E9HA 2AC5A 2O65A 2BZHB 2OG8A 2XBAA 3NUUA 4KBAA 3PIYA 3TT0A 1NVSA 4FZDB 4I1ZA 3DDPA 4EQMA 3CKWA 3WARA 3ZMMA 4PTGA 2ZV8A 3QTWA 4FF8A 4P7EA 3KREA 2J51A 2HAKA 1OIQA 3E93A 4N57A 5CU2A 4QP7A 3ATTA 2EUFB 3SXSA 3ZSGA 2GS2A 1U54B 3VS5A 2J50A 4NJDA 5M4UA 2PVRA 2ETRA 1MRVA 3C51A 5KMLA 4AOJA 4U45A 4ZMEA 3E3BX 4FT0A 4X3JA 3F2NA 3UIMA 3RTPA 2SRCA 5J5SA 1Y8YA 4ZS0A 5L2TA 3CKXA 4RFZA 2W1DA 4FTQA 4HPUE 4ACGA 3EQDA 3EN9A 3V6RA 4FTRA 3E8NA 3EQBA 2P2IA 2C30A 2PUIA 3PRFA 2JGZA 4D5HA 2VNYA 4QO9A 3SRVB 3U4WA 5M4IA 1SM2A 2XZSA 3EJ1A 1K9AA 4EHGA 5CSWA 4IVDA 4RIYB 2Y8OA 4IAYA 4WIHA 3RWPA 2R7BA 3FUPA 4R5YA 1UWJA 1IR3A 3GOPA 3NIEA 4FTIA 4EL9A 3FAAA 4U6RA 4PV0A 5CEMA 5A14A 4UXLA 3BU3A 4BBFA 2C5YA 4QTBA 4BZOA 3TNHA 3PXYA 3LJ0A 5CEKA 3PWYA 5AUZA 5HVJA 2PE2A 3Q04A 4H1MA 4E4LA 3Q9WA 2FUMA 5T68A 4HVSA 2RFDA 3A60A 4I6HA 1V1KA 4M8TA 3KRLA 3TEIA 3W10A 1FMOE 2F7XE 4EWQA 1RW8A 3HGKA 3CXWA 3AMYA 3Q4CA 2H96A 2XK8A 2VTAA 3ZO2A 2HCKA 3A7JA 3I5ZA 4E5AX 3PY1A 4ZTMA 4IWDA 3I6WA 4IACA 1YWRA 2F9GA 1Z57A 4U43A 3DK6A 5DBXA 4WA9A 4EOIA 1YOMA 4C35A 3UNZA 4WBBB 3VULA 4D2PA 4NTTA 3NVKI 4GFOA 3RM6A 3EOCA 5IEYA 4BCHA 5AP3A 3TACA 5L2IA 4IM3A 4OW8A 2JD5A 1KE9A 4L42A 3OP5A 1H1SA 2YDKA 2Z7LA 3BYOA 3P4KA 5D41A 5AAEA 3QGWA 5L6PA 4XOZA 3FLQA 3TNIA 1MQBA 4CEGA 3DV3A 3FZPA 4RZWA 2GCDA 4FV9A 4GCJA 1WAKA 4FZFB 3H9RA 4FVPA 3U6HA 2XJ0A 1H4LA 4LI5A 4CYIA 4GMYA 4J71A 4FIIA 1YWNA 3WILA 4O7SA 4FBXA 4JIKA 4YMJA 4YNOA 3RAIA 4NM0A 3MN3A 4ANLA 3ZOSA 2B9IA 4JL9A 4JAIA 4BIDA 5HX8A 3I7BA 4D0XA 4ANSA 4K6ZA 3Q52A 4M3QA 2I0HA 5L4QA 2VWZA 2JDRA 1NT2A 5JK3A 4C02A 3LJ1A 3ODYX 4BDJA 4EKLA 3SKCA 3T9TA 5D9HA 5AR2A 1U46A 4FSNA 1XH9A 4BDAA 5AFVA 4MD8E 3BU5A 3LCTA 1OKVA 2B9FA 2W4JA 4WNPA 2H9VA 2ZVAA 4CMTA 3KGAA 4J8MA 3PIZA 4C58A 3EYGA 2ACXA 2GNLA 3TKHA 1H8FA 3GVUA 1XBAA 3V5TA 3ANRA 3BYUA 2VWXA 3HKOA 2C5NA 4J8NA 4O7WA 1DS5A 1PKGA 3HX4A 2OIBA 5FLFA 4GK2A 5EKNA 4FV8A 4DLIA 5AUXA 3IW8A 3P23A 4Y95A 4X6RA 4Y83A 4OTHA 1REJA 4F70A 3OOMA 3V5QA 4CZUA 2YZLA 3F2RA 4QPSA 1IG1A 5EHLA 3ANQA 3RCJA 4FODA 3KVXA 3ZZWA 4RT7A 4DG0E 3U6IA 3KA0A 5BUIA 3NW5A 4CQGA 1VZOA 3ZO3A 1WBPA 4BZDA 3R7UA 4EONA 2PL0A 2C4GA 5AAFA 1Y91A 3KK9A 4TXCA 2B1PA 3UBDA 4AGUA 4B0GA 4WSYA 3HV4A 3MH2A 3NCZA 4MQ1A 4AUAA 1PY5A 2H34A 3MFUA 3H10A 4YZ9A 4EJ7A 4MWHA 3NYVA 4E7WA 4AOTA 2OIDA 2XRUA 2AC3A 4UBAA 4U42A 4O0SA 3BRBA 4MXZA 4FK3A 4IW0A 2ZOQA 3T9IA 5CVHA 3RAKA 5IA2A 3N4UA 1QPEA 4L6QA 4RX5A 2YABA 3DY7A 3P7BA 3ZLXA 1O6YA 3F3WA 5CQWA 5ANDA 2HYYA 5IUIA 3TI1A 4B8MA 3RNYA 4F0FA 3DU8A 3ULZA 4FIFA 3NR9A 2CN8A 3A8XA 2I6LA 3HP2A 3KRXA 5F1ZA 5CEPA 4TYHA 1CSNA 4QMPA 1SMHA 2ZB1A 3Q32A 3KMUA 2R3RA 3R8VA 4C4JA 5HO7A 4TT7A 3UZRA 2R9SA 2ESMA 4D2SA 4U5JA 4C8BA 4FNXA 1ZYLA 3F5PA 1BI8A 2VTPA 5C1QB 5J7HA 5LXMA 1JKKA 4TL0A 2QODA 2OH0E 4Y72A 1WBNA 4XYFA 3FI3A 4QYHA 4ZTNA 3TN8A 4EBWA 4UY9A 4XNEA 3RPYA 1QPCA 1ZYDA 3ENMA 2JC6A 5HX6A 5FEEA 4NK9A 3UYSA 2WTDA 5FGKA 2JDSA 4N6ZA 2ZMCA 5K4JA 2YEXA 2C5OA 4HNFA 3UO6A 3O71A 3S0OA 3QRKA 4IWQA 3LFNA 3VUHA 1DI8A 4CRLA 4CZYB 4II5A 3NUYA 2PVYA 5DG5A 3WZEA 3ZLYA 3DXNA 4ANNA 3TL8A 3G33A 4N0SA 4OTGA 5M56A 3MTFA 4X3FA 3ET7A 1PF8A 4YLLA 3BPRA 4K9YA 2UW0A 4UWBA 4BC6A 3AD6A 4QTEA 5KO1A 3GCSA 5IQHA 4GFMA 5EKOA 3EWHA 5H8GA 4FKGA 3H3CA 1ZOEA 4E4MA 4RMZA 2W99B 5F95A 2HZNA 3VRYA 2VZ6A 4C3PA 4MXYA 2GNGA 5EDRA 4FYOA 3GFWA 1O6LA 1GZOA 4J1RA 4J53A 5JH6A 2VX1A 4O81A 3FYJX 3SC1A 2WPAA 5ETIA 1J7LA 2CKOA 4G34A 4GRBA 5JFVA 3JR1A 3D5XA 2JITA 3S95A 3GFEA 5E8WA 2WXVA 4C4HA 4IAFA 3SQQA 1E1VA 3C0HA 5GZ8A 3I6UA 1W84A 3LFFA 4G3EA 4OT6A 2UW6A 4CTBA 2XIXA 4ZEGA 2VWBA 3VO3A 3WF5A 5HBEA 3FSFA 3UJGA 4QPMA 4P4CA 2OZAA 3V5WA 3EFKA 2FVDA 5IEXA 5IA0A 2PVJA 3ZO1A 3FI4A 4AZEA 3AC3A 5IQIA 3OWPA 2BCJA 4XH6A 4Y46A 2W1IA 3F5UA 5K3YA 3IW5A 5EQPA 3ACKA 4XV2A 2NRYA 1FOTA 3BBTB 1VJYA 2XBJA 1OKZA 3MGYA 5JGAA 3L8XA 3FPMA 1GIIA 1REKA 3ENHA 1RE8A 4OTFA 4PWNA 1WBSA 4RQKA 5AX3A 4ZIMA 4CFWA 2PU8A 3KFAA 4FTUA 3EQIA 5DVRA 1IAJA 3NAYA 4TYHB 4GU6A 2XCHA 4QQ5A 2I0YA 3G2FA 2C6DA 1WMKA 2QNJA 3ETAA 3GU5A 4G6LA 3TV7A 4JG6A 2B0QA 2J5EA 2WQBA 4IAIA 2JFMA 4FTCA 2YACA 2JIUA 5GINE 1IASA 1URCA 3UOHA 2HK5A 2WELA 4LYNA 4W4WA 3L8PA 2Y4PA 4A9SA 1JNKA 3HRFA 3BHYA 2QU6A 4J99A 4KBCA 3FV8A 2C69A 2X2KA 4DHFA 4C34A 4TWNA 5I4NA 1V0BA 2XM8A 2RIOA 4L67A 1Q99A 4HZRA 4R7BA 3LXPA 4GYIA 4KWPA 1UU3A 3GEQA 4LFIA 3KKVA 2WZJA 2HENA 5A9UA 4H3QA 5LJJA 2ZM3A 4XCUA 5L8KA 5KBRA 5LWMA 2G15A 3RK5A 3R1YA 5JSMA 2EXMA 2VTSA 4FTLA 4O22A 4RX9A 1R39A 3FLYA 3SG9A 3EB0A 3I81A 5CWZA 4X3FB 2GTMA 4P5QA 4YPDA 5M4CA 4D4RA 4HYUA 2ONLC 3WBLA 1ZZ2A 2VWWA 4WNOA 2QOQA 5CYIA 4K33A 4KRCA 2B4SB 3FE3A 4CMUA 4FV2A 2WIPA 4I5CA 5KMNA 5HG7A 3PY3A 3NLBA 3Q2JA 2JAVA 1ZAOA 5FDPA 4DGMA 5KMJA 3DFCB 4Z3VA 3D14A 2VNWA 5AUVA 3THBA 1CMKE 4BI1A 2B55A 2VTLA 3BV2A 4M97A 4QMZA 3LOKA 4MD7E 4HGSA 4OTIA 4RJ3A 5LWNA 4DFLA 2CDZA 1YI4A 5AM7A 3W1FA 4WOVA 4NJ3A 5E8YA 4BHNA 1A48A 4ASEA 2C68A 4WO5A 2WMSA 2YLFA 3C7QA 3E7VA 3ZCLA 4ZTRA 2C6LA 3MBLA 4XG7A 4GKIA 4OTPA 1UNHA 1JAMA 2X6DA 4IVBA 5BMMA 3W32A 5DIAA 5JFXA 3A8WA 5AUTA 5LCJA 4D1SA 2QQ7A 3P08A 2OFUA 2ERZE 3O2MA 1FVRA 3BQCA 1PXMA 3FXWA 2WTCA 2QR7A 4IB1A 5HG8A 3PLAE 4RIWA 3IECA 4EBVA 5IEVA 5CALA 1KV2A 3O96A 3UZPA 5M57A 3LFAA 3KRRA 4LUEA 4CKIA 2VTNA 5AADA 4DA5A 3I0OA 3COKA 5JGBA 3NZ0A 4GS6A 2G1TA 3MY0A 5FXSA 2J0KA 3ATSA 3CR0A 4PP9A 4IZYA 3TTJA 3IK3A 1G5SA 5EG3A 3LW0A 5E8UA 4AT3A 3IDCA 2VO3A 2RKUA 4Z16A 4MEDA 3VS3A 4JBVA 4R1VA 3HL7A 3NGAA 4JLCA 3HYHA 5EQYA 1H1RA 3R2YA 4GK4A 4XMOA 3VS6A 5CAQA 4NKAA 3O17A 3F3TA 5AJQA 4IB3A 1XJDA 4FNWA 3ZHPC 5IQBA 5AAGA 4O1OA 1Y6AA 5L2SA 3VF8A 5EI6A 4O7LA 4BGHA 1JLUE 4XJ0A 3A7FA 3V51A 3EFWA 4AGWA 4E4XA 2RF9A 4G3DA 4LV8A 4E26A 3KXXA 2IVVA 2O0UA 2R4BA 3IKAA 4Q5EA 3PIXA 2EB2A 5FTOA 4CFMA 1O6KA 2W4OA 4FI1A 4AZSA 4AA4A 5BUEA 1KOBA 2PE1A 1RQQA 1NW1A 1KOAA 4C4IA 2BKZA 2YM3A 4IZAA 4C3FA 2HZ0A 3ORNA 4XV1A 4O91A 3QKKA 3KN6A 4I5HA 5CTPA 4OAVB 3Q6UA 2R3QA 4O0VA 2XEYA 3RALA 3H9FA 4EI4A 1ZOHA 3CCNA 2BZJA 4YJQA 5ITAA 2W1EA 4MK0A 4S31A 4WKQA 4AACA 5CEIA 2WTKC 4HPTE 5BPYA 5HE1A 3NUSA 4IEBA 3UO5A 4NT4A 4BF2A 5BVWA 4MNFA 4CLJA 3FQHA 3D2IA 3KF7A 3LFCA 4BCPA 3W8LA 2W1GA 3GCQA 3VS0A 1ZLTA 3ERKA 3VVHA 3BE2A 2IW8A 2OJGA 4AA5A 4ARKA 2QKRA 2ITYA 5CT7A 3OEZA 3VJNA 4RJ7A 4E6QA 4CKJA 3MY5A 5M08A 3GC8A 3PVGA 3Q9YA 3QYWA 3W2RA 4BGGA 2ITQA 4FL2A 4IJ9A 1JQHA 3FMEA 3FMHA 2C6OA 3T3VA 4M14A 5DA3A 4AT4A 4UZDA 4I6FA 2CJMA 4MF1A 4ZY6A 1WVYA 3Q4UA 1ZARA 2Y4IC 2XCKA 4MNEA 3LLTA 4AW1A 1FVVA 2PSQA 3BYSA 3P7CA 4JQ8A 4PMPA 2W1HA 5F20A 4GG5A 3A62A 1YQJA 4RIWB 5DRDA 4FTAA 5HLWA 4H3BA 3ZC6A 4NW5A 3CGOA 1K2PA 2HWOA 4DEHA 2W4KA 1URWA 4F6WA 2Y6MA 3TV6A 4PDYA 2OKRA 2BVAA 4EHEA 1ZWSA 3EHAA 4QPAA 4AP7A 3SW7A 2PUPA 1GNGA 1M2PA 1PHKA 3EZVA 4YJUA 1Q8UA 2GFSA 5EW8A 3H0YA 4YTHA 1B39A 3D5UA 2ITZA 3R1QA 5HNBA 5TE0A 4FEUA 3LJ2A 3V5PA 3C0GA 2YA9A 4O6EA 2X9FA 2BALA 4P5ZA 1FGIA 1QPDA 4DEGA 2J90A 3D7TA 4IE9A 4LOOA 5AIKA 4ANMA 4DCAA 5KMKA 1FQ1B 2OK1A 3TM0A 1NY3A 4PTCA 3VBWA 3RPRA 3F61A 2I0EA 3TZ8A 3VS4A 4DH7A 5BQ0A 2XIZA 4G31A 4KNBA 3BYMA 4XLIA 3K3IA 4QMTA 2WEIA 3C4WA 3GC0A 4IJPA 4PMTA 5AUWA 4ZLYA 5C8MA 3ZO4A 5JRQA 3NPCA 4F65A 1L8TA 4TN6A 3EQCA 3C13A 4RWLA 2WQEA 4UMQA 1OIYA 2YHVA 4IAZA 4BWKA 4HGTA 4E6CA 3FQSA 4CKRA 5ANIA 5JEBA 5ANEA 5DRBA 3FKNA 4E4NA 4WHZA 4ERWA 3CSVA 3D5VA 3FC1X 4IFCA 3V04A 2JKMA 3FHIA 4M67A 4ZJIA 1M7QA 5A6NA 2UUEA 2OICA 2C3IB 4CT1A 3LXNA 3UC4A 4GEOA 3BWFA 4EWHA 5HEZA 3LXKA 4CRSA 3Q9ZA 2IVUA 3CPCA 4PX6A 4I3ZA 2X39A 3O7LD 3P9JA 4ZSLA 4HCUA 4B7TA 3BZ3A 4BCJA 3II5A 4OTQA 1QL6A 4NTSA 5LOHA 5JGDA 3FY2A 3C5UA 3OZ6A 4J98A 4WNMA 3PPZA 5J87A 1GZKA 3L9NA 3QZGA 3R71A 4TW9A 3VF9A 3CLYA 1YDRE 4MBJA 5AV2A 4F6UA 4R3RA 4KIPA 3UIUA 5DE2A 2OXDA 5E4HA 3Q4ZA 4XG6A 3DNDA 2B53A 1PXIA 4K11A 3C4ZA 3EYHA 4QMWA 2A4LA 4QP3A 1FVTA 4KS7A 5GJGA 3VN9A 5IA4A 3NCGA 2GQRA 3DB6A 2UZVA 1OI9A 3EMGA 3TG1A 1ND4A 4RWKA 4RVLA 3QGYA 5LVMA 4LM5A 1FPUA 4L8MA 1ZRZA 3QX4A 2W5BA 3NSZA 5HORA 4LGDA 4MNEB 1FMKA 2BILB 5D11A 4O0RA 3PSBA 2FSMX 3SHEA 4FKLA 3DK7A 5DT0A 4HZSA 4AW5A 5AA8A 4IXPA 4QP9A 3QALE 5I9WA 5HCYA 2F7ZE 1SVGA 2CLQA 1DI9A 4KKHA 4O0TA 3MB7A 4F9WA 2V22A 2FYSA 3MA6A 4G3FA 1P14A 4BTMA 4I0TA 4GW8A 3ZDUA 4GIIA 1KV1A 3I1AA 4IMYA 4P90A 2WQNA 2C1BA 3OTVA 2XIKA 4QYGA 4RJ8A 5E92A 5C03A 3QRJA 1JKTA 4TYEA 1ATPE 2I40A 3D7TB 5EK7A 4BCMA 4F1OA 2XS0A 4DYMA 4C2WA 3COHA 5H8EA 2J7TA 1ZMWA 4FKJA 4ITIA 2VTIA 4BBEA 4HVHA 4ORKA 2IW9A 3TDVA 3NNWA 3EQFA 3G6HA 3QD3A 2CLXA 4L53A 3ALOA 4K18A 3R1NA 4WUNA 5ANKA 3R8PA 3AQVA 3RPOA 5D1JA 4EH9A 3GU7A 3MVMA 4W8EA 2XNOA 5I5ZA 3FMKA 3VS7A 2QO7A 5DGZA 3SD0A 3R04A 1U5QA 3DJ6A 1CKJA 3VUKA 4BTFA 4ZAUA 4V0GA 1OBDA 3A2CA 3CGFA 5HNIX 4Z7HA 3HAVA 4DTBA 3JVSA 4M7IA 4F64A 3LQ8A 3OY1A 4YC3A 5CASA 5JN2A 4FEXA 3PUPA 3ZBXA 3GQLA 3ZM4A 3QZIA 5HZNA 3NS9A 3AMAA 4IWPA 3PA4A 3JS2A 2XKEA 3F7ZA 4F08A 3FKLA 4O38A 4XLVA 4KUJA 4Z7GA 4O86A 2HW6A 3AT2A 1U5RA 4MYGA 4RA4A 3M2WA 4M84A 3NMUF 5G6VA 1U59A 3GNIB 4Y8DA 5JFWA 4RFYA 3MW1A 4W4VA 4HJOA 4AE6A 4QTDA 3C4FA 3T8OA 4E6AA 4EH7A 2EWAA 3OROA 3OY3A 3DFAA 4CV8A 1UWHA 2QOKA 2RFSA 1H26A 4MVFA 2ITPA 4P2KA 2CCHA 4QMLA 4X0MA 3TNQB 4EHVA 4JX7A 1Q62A 4WD5A 4X2NA 2YWVA 2OBJA 3H4JA 3QTQA 3O51A 1XR1A 3OCSA 5IMEA 4DFYA 3QYZA 4O2ZA 1LPUA 3L1SA 3OCGA 3ORPA 4MXXA 3K5VA 5IQFA 5C4LA 1W82A 4ZSAA 3A4OX 2W7XA 3FC2A 2QU5A 4FKRA 2O63A 3D4QA 5FXQA 4PNIA 3S1HA 2C3JA 4WRGA 5I3RA 3LCSA 4RBLA 5IDNA 2UZTA 3C0IA 4UEUA 1WVWA 3AD4A 4N70A 4EK6A 3KRJA 2QOBA 4E6DA 3N9XA 2BKKA 4MXAA 1ZYSA 3LCOA 3O50A 4O0UA 4FSZA 1BKXA 1Q8WA 4GG7A 4QMVA 4U7ZA 2YIQA 1Z5MA 4UB7A 2XKFA 4W8DA 3BCEA 4TWOA 4I92A 4IX6A 3DAJA 2XEZA 3WZKA 5CU3A 1H08A 2X7FA 3FZRA 4CG9A 3GP0A 5AWMA 4CFVA 3A99A 3UOJA 4YJRA 1YXVA 4IZ7A 1M52A 3QWKA 4DH3A 2ZDTA 4G6NA 4PQNA 2CGXA 4I6BA 3DJ7A 4BICA 4DGNA 3FHRA 3LPBA 1TQPA 3OBGA 3CBLA 4U81A 3UMXA 2IZTA 4XV3A 3GU4A 3OWJA 3OUNB 2GSFA 3R7OA 3V8SA 4XP0A 5LQFA 4FX3A 5EOLA 4U0IA 5HKMA 5CENA 2LAVA 3ZZEA 4D2RA 1J7UA 2JFLA 5EH0A 4BDDA 1VR2A 1ERKA 1OIUA 2C6EA 3I7CA 2VTOA 3ALNA 2BAQA 2UZUE 2X81A 3NYXA 4H39A 5AX9A 3RGFA 4C59A 2A1AB 4E73A 5M06A 4XHKB 5DR9A 4U97A 3ZYAA 5IQGA 1H27A 4C4EA 1Q61A 1OKWA 3R2BA 4IVCA 2QOCA 4M69A 2XA4A 4B8LA 2GS6A 2WOTA 3ZDIA 2C6IA 3KMWA 4V0GB 1OL6A 2WMAA 3MVHA 3CQUA 3MVJA 4AFEA 4CFNA 5IISA 3R9RA 2WHBA 2UZDA 3PXQA 5B0XA 3ZFYA 5CSHA 1W7HA 2Q0NA 3VUGA 4EH3A 5HBHA 3UNJA 3PSCA 3QXPA 3ZS5A 2VGPA 3R9HA 1SVHA 4MF0A 2YWPA 3BHVA 3PJ8A 1PYEA 3RM7A 3F9NA 5JKGA 3LFSA 2QKWB 3BV3A 4ASDA 2HOGA 2JLDA 5AM6A 4W9WA 3Q5IA 3LIJA 1J7IA 2X4ZA 2HWPA 3DBQA 1UKIA 2RL5A 5G1XA 2P55A 2WKMA 4HVIA 2JDOA 1A9UA 4FKVA 1OL5A 3NYNA 2WMTA 4FKOA 3DK3A 4Q9SA 2PVNA 3CS9A 4GJ3A 4NCTA 4PTEA 2X0GA 4D55A 3VNTA 2R3FA 3QUDA 5B2MA 2ETKA 5CNOA 3A4PA 3UG1A 4UXQA 5GJDA 5FUTA 3HRBA 2J0MB 3OXTA 2XKCA 1R0PA 3LFEA 1KUTA 1YKRA 4QTAA 3FL5A 1OKYA 4WG5A 4XP2A 2OW3A 2QO2A 4F0IA 2J4ZA 3RCDA 4K8AA 1OPLA 4GFGA 4CCBA 5A6OA 2QOFA 4FOBA 2OZOA 2UW9A 2JDVA 2XIRA 5C8KA 4M12A 1PKDA 2J0LA 3QHWA 4B99A 2CMWA 2UW7A 4WG3A 1MP8A 4BCFA 3O0GA 4PDSA 4ZTQA 3CY2A 3MS9A 4JBPA 4DINA 2UV2A 1RDQE 4DGOA 2R3KA 4EYJA 4YTFA 3EFLA 4JDIA 4DH1A 4FT9A 1GIHA 1PW2A 3OXZA 5J9LA 3G51A 3ZXTA 4EQUA 1Y57A 2ITXA 2W5AA 4IAKA 1V0PA 2A19B 3CEKA 3DBEA 1OBGA 2XNBA 5J1VA 5L6WL 1BL6A 1DM2A 4AZVA 3OS3A 5CI6A 5AR8A 3GGFA 4GVAA 3IS5A 2PULA 3WF8A 2VWUA 4JRVA 4BCKA 2CGVA 4HYHA 3FBVA 5KKRC 4YJTA 4IDTA 5HU9A 5J8IA 4CFXA 5HIDA 5CX9A 4L3JA 3RK9A 3OUKA 4M69B 2CHLA 5CT0A 2BTRA 3PG3A 4ZLZA 2WGJA 2ZYBA 4IVAA 1XH4A 1FINA 2BUJA 2A0CX 1UV5A 5EI2A 3TNPC 1R3CA 4FV3A 3BHTA 5TF9A 3MIAA 3V5LA 5KUPA 5DFPA 4DGGA 1KE5A 5LMKC 2VTQA 1XH5A 4EOPA 4M68A 5FG8A 4X2JA 2YCQA 4OBPA 4F63A 1YHSA 4UMTA 3P1AA 5AP6A 1DAWA 4ZXTA 4UMUA 1BX6A 1PMUA 4FG9A 3UC3A 2JEDA 4APCA 3C50A 5HIBA 5E1EA 4BN1A 4NEUA 5CAVA 1Q41A 3EZRA 5M4FA 3LMHA 4G17A 4FNZA 1JKSA 3QU0A 3TIZA 4ASXA 2Z7RA 1ZZLA 3LFBA 4FTTA 3S3IA 4EEVA 3E64A 1BL7A 2DQ7X 4RJ4A 4CD0A 2XRWA 2R3LA 3IW4A 4KA3A 4X2KA 3KN5A 4BTKA 2VTJA 2WTWA 1K3AA 3HVCA 3RZBA 4O7NA 3FQEA 2YZAA 1UNGA 1J91A 4RVMA 4KABA 3TZ9A 2VGOA 3HUCA 3QD2B 2XNNA 4D5KA 3MIYA 1Q8TA 3SGCA 3AT3A 4QMYA 3TKUA 4JBOA 4U9AA 1YI3A 2QHNA 4IM2A 4R8QA 5M09A 1AGWA 3LMGA 3LMIA 3FYKX 2BRNA 1PXLA 3R7IA 1JSTA 3KQ7A 4LV5A 4RA5A 1W83A 1YXTA 4XX9A 3GBZA 2V55A 3OW3A 2IVTA 2VO6A 2R3NA 3KMMA 3MH0A 5AIRA 2VV9A 2WFYA 4XG8A 2P33A 4UX9A 3TJDA 2NNWB 3PDTA 4AOIA 4YC6A 5E8VA 3EL8A 3I60A 5BYLA 1SVEA 4EK4A 4NH1A 5IQDA 4H58A 2OJIA 2IN6A 3HRCA 4QYEA 4JI9A 5D7VA 3PG1A 3E8EA 4MTAA 3CTJA 4AN3A 5FRIA 4D4YA 3EFJA 1WBWA 5I9UA 3E62A 3QQJA 1SNXA 3Q60A 4DEBA 2EU9A 4WBOA 4ZJVA 2IWIA 3QXOA 1ZYJA 3FZSA 3PA3A 3E63A 2ZV2A 1QMZA 3ELJA 3NX8A 4FR4A 4LL0A 2J5FA 2FO0A 4ACDA 4EOLA 4BCGA 2V62A 4EOMA 3QCQA 1H0VA 4GT5A 5EOBA 2GDOA 4IZ5A 4RIXA 2AUHA 3R30A 4FUYA 3RNIA 2IJMA 3HP5A 3AOXA 3AD5A 5DH3A 5AV4A 2HIWA 4F0GA 5AV1A 3CJGA 4FSRA 4DT9A 5DT3A 2VAGA 1CDKA 3EL7A 5D10A 3G9NA 3HLLA 4O27B 2VTTA 4X7QA 3GOKA 5AP5A 2PE0A 4QMMA 4U40A 3UIBA 4AZTA 4Q9ZA 5IH5A 3FEGA 2YITA 5HE0A 5ACKA 4RX7A 3FY0A 3C9WA 4D28A 4O7VA 3ZRKA 4FV0A 2PVLA 4PUZA 4QMXA 4W4XA 2WMRA 3C4EA 3BQRA 4XBRA 2X9EA 1R78A 2W06A 1MUOA 3F69A 3DAEA 2QG5A 5AV0A 4FEVA 3QCXA 3QHRA 3D83A 5LVPA 4DF3A 4JNWA 3R7GA 5T3QA 5J95A 2V7AA 4EZ7A 3D0EA 5IH6A 1OVEA 4I5MA 3R7EA 2OSCA 4H1JA 1MRYA 4MCVA 4BKJA 4DEAA 3JPVA 3EKNA 4EK8A 3WI6A 3MH1A 1XHAA 3UZTA 3TXOA 4EZ5A 2UW3A 1UVRA 3ORZA 2YCRA 4I0RA 3HV5A 4JQEA 2ZJWA 3R7VA 3QBNA 4ZZMA 2OXXA 2OJ9A 5GJFA 1TQIA 4EOSA 3VUDA 3DKGA 5HTCA 1YHWA 2WAJA 5J7BA 2NO3A 3MJ2A 4I5PA 3TUDA 1OITA 2B54A 1OUKA 1KE6A 4BCQA 3BKBA 5M51A 3A61A 4IFGA 2PZIA 2HELA 2Y7JA 2FSTX 5H2UA 4DFBA 2W1CA 2GNJA 2ITTA 3DJ5A 3KVWA 4BDFA 3NVMB 2YIRA 3F6XA 2I0VA 1YVJA 2R3MA 3BWJA 4TNBA 2OZAB 4NSTA 1ZY5A 3E3PA 3C4CA 4F4PA 2PMLX 3PP1A 3H30A 2IW6A 2JAMA 2WQOA 3G6GA 3IGOA 3NNVA 5FWKK 5HI2A 4F7LA 4YR8A 4BHZA 2Z60A 4WG4A 2EXEA 2WD1A 4NL0A 2WNTA 4XRJA 4AG8A 4EUTA 4UWYA 5FM3A 2BMCA 1PMEA 3FLSA 5K0XA 4BTJA 2YM6A 4FIEA 2XVDA 3OG7A 3MH3A 4QMQA 5HBJA 2WEVA 1VYWA 2PHKA 1UKHA 4MXOA 1UU7A 4LL5A 4AQCA 5JT2A 5EDQA 5HO6A 4R7HA 2A27A 3R83A 2C3LA 3MFRA 4F9CA 5IU2A 3TJCA 2KTYA 3QUPA 1LEZA 2E9NA 4RIXB 4F1TA 2YIXA 3QCSA 3ULIA 4IBMA 3PXFA 4HVGA 4TNDA 3P5KA 4L68A 4XBUA 3M11A 4DT8A 3PE2A 4ZS4A 4ZP5A 5E8SA 2YM4A 2H8HA 2YISA 4AGCA 4C4FA 4D9UA 2PYWA 3BYVA 4EOJA 4LRMA 4NYEA 5GIPE 5EYKA 4DAWA 2C0IA 1SYKA 3U87A 4FG7A 3GCPA 2FA2A 4FZAB 1H24A 3OC1A 5AR7A 4WNKA 1IRKA 5HTBA 1X8BA 3V8WA 5HD7A 5BVDA 5IA1A 3R6XA 5E8ZA 3KXNA 4C0TA 5K9IA 4OT5A 3W2CA 3NYOA 3BGZA 4EOKA 2WTIA 4PF4A 1WFCA 3COIA 4O7RA 2ETMA 3F3ZA 3TKIA 3FZ1A 3DCVA 5BVKA 4PNKA 3IGGA 3JXWA 4FICA 4PPBA 1PXKA 2B52A 2XNPA 5CY3A 5EHOA 3NDMA 4ZTLA 2J2IB 3RMFA 3VQUA 5IA3A 1WBVA 2GU8A 5E8TA 3QTZA 4BI2A 4FV6A 3BI6A 3R22A 5DR2A 4NM3A 2G2FA 1YDSE 4PPCA 4DCEA 3CJFA 1Q5KA 2ZMDA 5KHWA 2PWLA 5E7RA 5AR4A 4UYNA 2QLQA 2VO7A 2YM8A 4TZRA 2XMYA 4K1BA 4BVUA 4C37A 3HECA 4OBOA 2GS7A 3AC2A 4ZZNA 5LMBA 2GHGA 3LKMA 1EH4A 4F9BA 3IW7A 4HYSA 1WCCA 3AC5A 3ORTA 4I21A 4IAAA 2JBOA 4LUDA 5AMNA 1MRUA 3OF0A 2BAJA 2XB7A 3AMBA 3QF9A 3CP9A 4FTKA 4I4FA 2XK4A 2JIIA 5CAPA 2REIA 3OD6X 1XKKA 4FKTA 3GXLA 5M53A 3CD3A 4YJNA 3HUBA 5IKWA 5A3XA 2XYNA 4AU8A 4D58A 2Z02A 3L9MA 4A4XA 2YN8A 3VRZA 4FNYA 4IHPA 5EM5A 2VN9A 2R3HA 2G9XA 4LG4A 1LP4A 3ZLWA 4PL3A 4QP6A 4YP8A 2OF4A 3RI1A 4JBQA 2XK7A 5CU6A 4QYYA 3KC3A 4YTIA 3M42A 2X8EA 3BLQA 1B38A 5AUYA 3OWKA 5I9VA 4JS8A 2W0JA 3OT3A 2XP2A 4MD9E 3JY9A 3NRMA 4USDA 2ITWA 3H9OA 1GZNA 4FTNA 4BB4A 4NKSA 3QCYA 4FC0A 2QG7A 2QCSA 4FGRA 4FIGA 3KXMA 3BEAA 3O7LB 3ROCA 4YBJA 1MQ4A 5HGIA 2CPKE 3AGLA 1OPKA 2EVAA 4ONAA 4RFMA 2WMUA 4FTOA 3NAXA 5BX0A 2UW8A 4HYIA 2UVYA 3VWAA 4F1MA 3C5IA 3DS6A 3HV6A 3GC7A 2WU6A 3UOLA 1GOLA 3R8LA 1Q24A 1H01A 1JWHA 4GJ2A 3FPQA 2YJRA 3DB8A 4ANOA 3UYTA 5GZAA 2XM9A 2GHLA 3BELA 4EORA 4BZNA 3LE6A 2IZUA 3QD0A 3EN5A 3O8PA 4G3CA 3UPXA 4FE2A 5IQCA 3QZFA 3L8VA 1HCLA 3PZEA 4IWOA 1GZ8A 3P78A 4FKQA 4MBIA 2FSOX 2B7AA 4OUCA 4EOQA 3DTWA 5LCKA 2YIYA 4HNIA 4G6OA 5HE3A 3I79A 1R0EA 3WYXA 4F9YA 4FVQA 5I9ZA 4AA0A 3N4TA 3HDNA 4BYJA 4RJ5A 1R1WA 3DKFA 4B9DA 3R8ZA 4QQCA 3R7YA 1ZMVA 3DAKA 2BFXA 4U44A 5FP5A 1H1PA 3FMNA 4NM7A 2O3PA 3V3VA 2I1MA 3PP0A 4F09A 3IQ7A 2DWBA 3U4UA 4FSTA 3HV3A 3P86A 4MX9A 2PZRA 3ZEWA 3PXRA 3FZTA 3QTUA 3LFDA 2OH4A 3LZBA 3NUXA 4M15A 4PL5A 3WYYA 4TRLA 5CANA 4GIHA 2Z8CA 4CGAA 3UVQA 3QC9A 2VUWA 3IPHA 5C01A 5TO8A 3AT4A 3RHKA 5AP1A 4A07A 5J79A 1GIJA 2WMVA 5ETCA 3RVGA 4ACMA 3WZUA 5HVKA 3HZTA 5ETFA 3VHEA 2C6TA 2UZBA 1FBNA 4I41A 3FLWA 3AC8A 1GY3A 4YZBA 5DEWA 3U54A 4BY9E 4FK6A 5HQ0A 1OPJA 4C33A 5HESA 3SV0A 2C3KA 2VTHA 1BYGA 2VX0A 4I24A 2VWVA 2BRGA 4QNYA 4RLKA 5FM2A 4U80A 5HLPA 4UMPA 4AN2A 2YM5A 4L9IA 3MPMA 2ERKA 2R5TA 4RVKA 2OFVA 4GKHA 3JYAA 5GHVA 3UGCA 5KMOA 1XO2B 3L9PA 4I4EA 3P7AA 3D15A 4MAOA 4UWCA 3M1SA 4BDBA 3I0QA 3ZONA 5A4CA 3E88A 5BMSA 1GJOA 3NNUA 4Q2AA 5CF8A 4WT6A 3EIDA 1UNLA 4FV1A 4Z55A 2Q0BA 3DKOA 3QUEA 5IG1A 2G01A 4A4OA 3BHHA 3BIZA 5KHXA 4G2FA 4R3PA 4YHFA 4S2ZA 3LXLA 3R9OA 4YC8A 4FT7A 5AEPA 1BLXA 5HHWA 4XP3A 3TNWA 3ZXZA 4R1YA 4EH4A 3PPKA 5EI8A 5IH4A 4YHTA 4I22A 5AP2A 5J5TA 3Q5ZA 3ZM9A 4RSSA 4NIFA 4MHAA 4AGDA 2XK3A 3BGQA 4EKKA 2KULA 3ORKA 3RP9A 4BCOA 2PVFA 3VUIA 4ENYA 3NWWA 1WBTA 3QL8A 4AW2A 3QQHA 2CNQA 2QOLA 3KXGA 1WVXA 4DEDA 4F7SA 4JVGA 2PZ5A 4LRJA 4N4SA 5I3OA 3OHTA 4UV0A 3R63A 1NVQA 1S9IA 2WMXA 1I44A 1TQMA 3DZQA 4DTAA 3UTOA 3VBXA 2ONLA 1H1QA 5HOAA 4DH8A 1KSWA 4CFFA 1DAYA 4FKIA 4K2RA 2IZSA 5J9ZA 4AXAA 2CCIA 3HMMA 2X4FA 3Q96A 1LR4A 4I20A 4RC3A 4Y5HA 3BHUA 3NUPA 4HVDA 3FXXA 4KS8A 2C5VA 3HMOA 1JPAA 3PA5A 2JKOA 2DS1A 4BRXA 5JQ8A 5M07A 3SAYA 3ZFXA 1LUFA 4YBKA 1H07A 4JX3A 3VBYA 2J0IA 2Z2WA 2R3PA 3FZOA 1PMVA 3N51A 4E1ZA 2C0OA 4DITA 2Y9QA 1G8SA 5E9EA 3MPAA 2VRXA 3S00A 2A2AA 4MWIA 3RAWA 3ZH8A 3OBJA 3CQWA 2HXQA 4RJ6A 5IUHA 2BROA 4AN9A 5M44A 3E8DA 4MBLA 3ORXA 4A9UA 4BDKA 5E91A 4B6LA 4J96A 4PMSA 4I93A 4C36A 3UE4A 3EQGA 4FT5A 4L44A 1APME 4D1XA 4DE4A 1OGUA 1L3RE 4FSUA 3Q3BA 1ZXEA 2B9JA 4LQMA 3DPKA 5A4QA 2UZOA 3R9NA 4PMMA 2FSLX 3FMLA 3QRUA 5TOZA 2HY81 2XNMA 3ZU7A 5EW3A 2R7IA 2O8YA 3ID6C 3CTHA 4L00A 3ORIA 4M13A 5LVLA 4CSVA 1BUHA 4L43A 3SDJA 3WE8A 3BLRA 2PUUA 4DG2E 4YPSA 3SG8A 2QOOA 2XNEA 3B2TA 3W2QA 3OCBA 2RSVA 3AC1A 4AW0A 3KCFA 4UZHA 3OEFX 1ZMUA 4NFNA 2RG5A 4BWXA 3EH9A 2YDJA 1Q97A 3ZC5A 2UVXA 3PJ1A 4OBQA 3UVPA 4CVAA 4CCUA 4DBNA 4OTWA 4U41A 4DGLC 4NIFB 3F3UA 5FQDC 4BCIA 3SW4A 3Q53A 1YXSA 2V7OA 1Y6BA 5BVFA 4JOAA 1IA9A 2R2PA 2QURA 4LOPA 3TCPA 3PE1A 4TWCA 4W9XA 3MESA 3WIKA 3RPVA 2C0TA 4PPAA 3Q4TA 5IF1A 2R3OA 3F7WA 1IA8A 4TYJA 5AP0A 2GTNA 4X6QC 3OVVA 3VJOA 5FTQA 4KIOA 5DWRA 2WMQA 4EHZA 5KNJA 5L2WA 5I0BA 3D2KA 2BHEA 2LGCA 3QFVA 3LFQA 5EHYA 3TV4A 4O7TA 3DZOA 5L2QA 1XQZA 4LMUA 3K5UA 5AP4A 2JKQA 3PY0A 3WF6A 3ZUUA 3QRTA 2O2UA 4G5JA 4ZSGA 4X2FA 4L01A 5L8JA 1Q3WA 1JVPP 2VWIA 5HIEA 3LAUA 2BFYA 3PJ2A 3EN7A 1XH8A 4C61A 1BMKA 3GCVA 4IANA 4FGBA 5KCVA 5HICA 3UG2A 4FTJA 3IOPA 4FV4A 5HVYA 4D2WA 1TVOA 2W1ZA 2JKKA 1H0WA 4YJPA 4XV9A 5LARA 4QOXA 2Z7SA 3V6SA 1PRYA 2BDFA 3WOWA 4RIOA 4CFUA 3O8TA 1YOJA 4ZY4A 5A4LA 2QC6A 4IM0A 3DGKA 3NNXA 1JSVA 4ITJA 5AP7A 2NP8A 3QQGA 4FIJA 5A4TA 4YSMA 4O21A 3SXFA 2QOIA 2X2LA 3R28A 4LRKA 3ZRLA 4L3PA 4DBXA 4G3GA 1OL2A 1PXOA 2ZM1A 2JBPA 3W33A 3WF7A 4F6SA 3C1XA 4ANBA 1J1BA 4BL1A 4LGHA 3R21A 2W96B 3KF4A 5DEYA 4AS0A 4ENXA 3JY0A 2UZLA 4I6QA 4FYNA 5H8BA 3DNEA 2YJSA 2WMWA 4XRLA 1KWPA 3VC4A 4PL4A 4U3YA 4ALUA 4D4VA 4I94A 4TYGA 3PYYA 4FV5A 3F5GA 3R73A 4RVTA 3U51A 3ZSHA 4BKZA 5EM7A 2UZEA 3CC6A 3HV7A 1ZOGA 4ZTHA 2QONA 3DLSA 1M14A 2DYLA 5L6OA 5AUUA 3HDMA 3DBFA 4HCTA 1AD5A 4YGAA 5KX8A 2WO6A 4RG0A 2GPHA 2YFXA 2BIKB 4QMNA 4XEYA 4IC7A 5CF4A 4KIQA 3TUCA 4ANQA 4B4LA 3D7ZA 1A06A 4G9CA 4TYIA 5EM6A 3QA8A 5DMZA 1F0QA 3PSDA 1H28A 2ITUA 3AG9A 3DA6A 5EM8A 5AR5A 3G0EA 4E8AA 3DLZA 3LVPA 3QRIA 4RZVA 4AZFA 3LM5A 4QNAA 3ACJA 3RWQA 3UVRA 3VBTA 4FEWA 1P4FA 4IH8A 4AF3A 5JZJA 3PRIA 3JUHA 2F57A 4RGJA 4YJVA 2YAKA 4ZY5A 3HMIA 4C62A 3RBWA 4BI0A 5L8LA 4E5BA 4ID7A 4M66A 3F88A 4QQTA 5J1WA 2WTKB 5DNRA 4EC8A 3GT8A 5HCZA 3HAMA 3WF9A 3QTIA 5FBNC 3A7HA 4BIEA 3DQXA 5ETAA 3POZA 4H36A 4AZWA 5LVOA 4F9AA 4HW7A 3QC4A 3GQIA 3B8RA 5DLSA 3KK8A 4NM5A 2HW7A 3TZ7A 3NUNA 3OTUA 2VTRA 4O7ZA 5KZIA 3K3JA 2RGPA 2QLUA 3U6JA 4GT3A 4EQCA 1FGKA 2R64A 3D5WA 3LLAA 3EQRA 3IOKA 4ACHA 4FZ6A 4QMSA 4IC8A 1Q8ZA 1QCFA 3F82A 1JOWB 4KAOA 5EW9A 3AGMA 3R8UA 2V5QA 4ZLOA 4XG3A 4IADA 2O64A 2WB8A 5EDPA 2G2IA 4USEA 2GQSA 3Q9XA 4NW6A 4BGQA 3OMVA 1I09A 2ITOA 2R0IA 2WTVA 3IDBA 2Y4IB 4RC2A 4U79A 5AR3A 1Q8YA 2PZYA 2W9FB 5BNJA 3MFSA 4RQVA 4ZOGA 3V01A 4A9TA 4BDEA 2E9PA 3GUBA 2C6MA 2J6MA 3HMPA 4J52A 5JQ5A 1OL7A 2BRMA 3FLNC 3VAPA 4YLJA 3P0MA 5CVGA 2FB8A 3GENA 3O8UA 4AFJA 4E93A 4BR3A 2BZKB 2R3JA 2VO0A 4A4LA 5IQAA 4A06A 4YU2A 3MDYA 4GK3A 4YO6A 4WRSA 3T3UA 4ASZA 5CXZA 4JDHA 4DEEA 5F94A 3VHKA 5A4EA 2FH9A 4JDJA 2IZRA 3E8CA 3CE3A 4QYFA 5HD4A 3TZMA 4IB0A 3UODA 4CMOA 1WZYA 2E9VA 4EC9A 3Q6WA 5JFSA 1YDTE 4O83A 4GYGA 3UOKA 4K77A 2QVSE 3OT8A 4O0WA 4HGEA 5C26A 4MH7A 1Q4LA 3UDBA 2C6KA 4IX5A 4PDPA 3U8WA 4YUQA 2HZ4A 3G5DA 3UQCA 3I5NA 3SOAA 4QP8A 3EN6A 3EQPA 3AC4A 4KKEA 3GB2A 1YWVA 2ZV7A 3DOGA 4O0XA 1CKIA 2BHHA 3K2LA 5B2KA 3ZBFA 4C7TA 4RRVA 2X1NA 4R6VA 4D0WA 5K5NA 1OB3A 4O82A 5KE0A 3QX2A 4ZZOA 5IZFA 1QPJA 1XH7A 2EB3A 4EH5A 4IIRA 4J97A 3UIXA 2O5KA 1YI6A 2B9HA 2ITNA 3GU8A 4ZJJA 2WTJA 1G3NA 3HNGA 5TKDA 4AT5A 4YTCA 4ERKA 2IG7A 4NWMA 3V5JA 5C8NA 3RAHA 2NRUA 2OIQA 5IPJA 3PJ3A 1Q3DA 3FMMA 2UVZA 3PPJA 3QLFA 2OI4X 3QWJA 4JXFA 3RPSA 3WZJA 4EUUA 5K4IA 2X8IA 2BDWA 3RHXA 3R01A 4FIHA 3W8QA 4A7CA 2UZNA 1J3HA 3F2AA 2XK9A 2OLCA 2PMNX 3D94A 3I4BA 1U4DA 4ALWA 4MQ2A 1XWSA 4CXAA 2VD5A 4R7IA 4YSJA 4F7NA 1M2RA 1H00A 5B2LA 3UMWA 3W2PA 3CD8A 5IMXA 2J9MA 2QD9A 3HA8A 3VW8A 4Z9LA 5CS6A 4CQEA 4IB5A 4FA2A 4PP7A 5BVNA 4O84A 1SNUA 3GI3A 2HZIA 5EYCA 3P79A 4EH8A 4I0SA 3DBDA 2W05A 3KCKA 2YLEA 3KU2A 3OCTA 5HO8A 5CEOA 5HTIA 3LQ3A 4X2GA 1WBOA 4UN0C 1P5EA 1HOWA 2GQGA 2YCSA 3W18A 4BWPA 2IPXA 4JIAA 1PXNA 2X8DA 4FV7A 3FDNA 4FSWA 4C38A 3TDWA 3G15A 1KE7A 2J0JA 3NW6A 2W1FA 3CY3A 4GV1A 3MFTA 4YZMA 3R02A 4S32A 3ZEPA 3G90X 4D4SA 4YJSA 2GNHA 3FLZA 5E8XA 4NUSA 5HCXA 4ALVA 4EH2A 2X7GA 4JG7A 2IO6A 1NA7A 3NIZA 2WOUA 3LCDA 1RJBA 5BVEA 3ZSIA 2F4JA 4DLJA 2X6EA 5H9BA 3OW4A 2CN5A 4JJRA 3IO7A 4M0ZA 4OR5A 5FP6A 4O7YA 5FDXA 1XH6A 2OGVA 3W55A 1OM1A 3PTGA 2QOHA 3MV5A 5IDPA 5CZHA 3PZHA 1H25A 4DFZE 2AYPA 3DTCA 3QKLA 4CV9A 4XG9A 1W98A 4PRJA 3QQKA 4MXCA 5BYYA 3MY1A 3VUMA 2ZV9A 3E92A 4JDKA 4YZDA 2ITVA 3OOGA 5K0KA 3EKKA 4UMRA 2PVHA 3ZUTA 4QQJA 3IG7A 4HGLA 4QD6A 2QR8A 3PXKA 3B2WA 1OUYA 4YLKA 4V04A 2CNUA 4CG8A 4GVJA 4L46A 1YXUA 2X7OA 3FKOA 3C4XA 4QMUA 4Y73A 5CSVA 4ZK5A 3IONA 3TUBA 2YAAA 3F66A 4G5PA 4YURA 1ZYCA 4R5SA 4H05A 3G9LX 3IW6A 5CSPA 5D7AA 1LEWA 2X2MA 3BU6A 3R8MA 3SX9A 3W2SA 1PXPA 3UQFA 2PZPA 1PXJA 2C5XA 4G9RA 4ITHA 4JQ7A 5IA5A 5BVOA 5AV3A 3DXQA 5FD2A 2DUVA
chains in the Genus database with same CATH superfamily
4EZ3A 3KULA 3MSSA 4HOKA 4Y85A 2UW5A 4U8ZA 4GU9A 2PMIA 5ANGA 3QQLA 2R3IA 4BDIA 2PY3A 1W2DA 4BKYA 4CZTA 2C1AA 5LMAA 5FXRA 1PJKA 4FVRA 3WZDA 5JMSA 2OF2A 3HMNA 1ST4A 1IEPA 4FEQA 5FEQA 2GNFA 3LM0A 4DEIA 5C27A 2QHMA 1YW2A 5GNKA 4OGRA 3PWDA 4O1PA 4JR3A 3BEGA 3KEXA 1CKPA 1G8AA 2CKPA 1O9UA 1OECA 3FI2A 2EXCX 2GHMA 3UP2A 3MVLA 4FKPA 4WSQA 5KZ0A 5CSXA 3RZFA 2NPQA 3FSKA 4QTCA 3ZFMA 5E1SA 1TKIA 1UU8A 2RG6A 5CEQA 2Y0AA 4RLLA 4DFNA 2BR1A 2RFNA 3MPTA 1W8CA 4I23A 1NVRA 3BLHA 4ZTSA 2BIYA 1KE8A 2GFCA 4JR7A 4APPA 2PVKA 4L7SA 3DXPA 5CZIA 2W17A 2GMXA 2ZDUA 4YJOA 3IDPA 4JG8A 3U9CA 4A9RA 3WE4A 2FGIA 3H0ZA 1YHVA 3QD4A 1F5QA 5FEDA 3UPZA 1H1WA 4AXFA 4UALA 4F7JA 1STCE 1UU9A 5HNGA 4EK5A 4U3ZA 4XOYA 2Z7QA 1F3MC 2CKEA 3LHJA 5DR6A 4IQ6A 3W16A 4ACCA 5DPVA 5E90A 5HLNA 3MYGA 3MTLA 4RWIA 1Z9XA 2VWYA 2Y6OA 3BGPA 1CTPE 3CTQA 2CGUA 4Y5QA 5GZ9A 2BAKA 2BPMA 2WIHA 3MA3A 4R3CA 4BDHA 3A7GA 1SZMA 3V8TA 4G16A 4FZ7A 4TKSA 2C47A 3U55A 2F49A 3K54A 3DQWA 2UZWE 4FG8A 4KB8A 5LVNA 1G8KA 1Y8GA 4GUBA 2G2HA 4O2PA 3MI9A 4OLIA 4V01A 1P4OA 3VS1A 3FMJA 1M2QA 1W0XC 1M7NA 4L45A 2VU3A 3EQHA 5BYZA 5JRSA 4EK3A 2XALA 4QT1A 3HA6A 4EOOA 1JBPE 1S9JA 3B8QA 4ZSJA 1OMWA 2ZM4A 4RC4A 4XG2A 3FMDA 4D9TA 2ZB0A 1T46A 5M55A 3LQ5A 5AA9A 3W2OA 3ROYA 2E9OA 5CLPA 4FL3A 2PMOX 3DDQA 4CT2A 3A7IA 2PTKA 5CAOA 1VEBA 3QAME 2WU7A 4GT4A 5FTGA 3DBCA 4BCNA 4AXEA 4YO4A 2P4IA 4J7BA 3NUAA 3JVRA 3UO4A 3QKMA 4ZSEA 5T6KA 5I9XA 4DN5A 1XBBA 2XUUA 2XH5A 3KULB 2I7QA 3E87A 4USFA 2OO8X 2VTMA 5GIOE 3Q2MA 3CIKA 4ZMFA 3SLSA 2WMBA 4S30A 1UA2A 3PVWA 1OZ1A 4QP1A 4KINA 1BI7A 2BTSA 4YZCA 5C9CA 3ZLSA 3ORMA 1OIRA 3MB6A 3AXWA 4NCTC 2QO9A 4LOQA 5I9YA 3L9LA 4FL1A 4O0YA 3GU6A 2Q83A 5C4KA 5K5XA 3OXIA 5DI1A 4BDGA 4V05A 4NFMA 3VQHA 4DFUA 4FKWA 4DG3E 5CQUA 4OTDA 1HCKA 4LGGA 2BRBA 5LMKA 2OJFE 5IUGA 4DTKA 4XS2A 5D12A 5IQEA 3S4QA 4A9YA 3KY2A 4K0YA 5TR6A 3FI8A 4FT3A 4F99A 2XJ1A 4QRCA 1P2AA 1YOLA 2JIVA 4UYAA 3UNKA 5A46A 2OJJA 4FMQA 4O6LA 3VBQA 4LMNA 2PK9A 4BYIA 3QTRA 4IDVA 3BX5A 3QTXA 4OTRA 4R78A 3CQEA 2CNVA 4W4YA 3PLSA 3TTIA 4KKGA 3QLGA 4S33A 4EYMA 5BUJA 2YIWA 4DDGA 4AE9A 2PVMA 3PJCA 5DT4A 3S2PA 3CPBA 3E5AA 4YHJA 4CTCA 3DKCA 5B7VA 1AQ1A 5CNNA 3ODZX 4JT3A 2BZIB 5DN3A 1NXKA 4BDCA 3RK7A 3REPA 3TWJA 5EYMA 3R9DA 5DYJA 1YXXA 5EFQA 2PPQA 4IX3A 4NU1A 2XYUA 3KXZA 3R00A 1ZY4A 3QA0A 4WUAA 5ACBC 5CAUA 5CF6A 2V0DA 3ITZA 4KIKA 5CU0A 2XANA 2XJ2A 4S34A 3ZUVA 4D2TA 2YDIA 5ICPA 2XK6A 4CYJA 2CSNA 4H3PA 4QMOA 4GSBA 5HU3A 3OWLA 4YZNA 5KMMA 4PY1A 4DHIB 4QP2A 3NEWA 2BDJA 3OFMA 5TT7A 1VYZA 3BBWA 3LCKA 4FKSA 4MKCA 3UQGA 3PVUA 3KXHA 4BFMA 3ORLA 2GNIA 4GL9A 2YCFA 3ZRMA 3FXZA 2QI8A 2XNGA 3EN4A 2CKQA 1U54A 2JDTA 5CU4A 2H6DA 3R1SA 4IX4A 4KSQA 4J95A 4NZWB 3F5XA 4OAUC 5F4NA 4L3LA 4C4GA 2W5HA 2F2CB 3O23A 3KL8A 5KBQA 2X0PA 1PYXA 1JSUA 2F7EE 2HY0A 3BE9A 5H3QA 4FTMA 3VBVA 3R0TA 2OWBA 4X3FC 1OL1A 4RPVA 4FSQA 3FWQA 4KD1A 3RKBA 2W9ZB 4XUFA 3POOA 3E7OA 4FSMA 4FKUA 5A54A 3SRVA 5KKRB 2E9UA 5L3AA 2RFEA 3UP7A 3PVBA 4FOCA 4E3CA 5CF5A 3SA0A 3F3VA 4C3RA 4RIYA 2VX3A 4E5WA 4BIBA 4JRNA 1JKLA 4GH2A 4PDOA 2P3GX 2YM7A 4M0YA 4FSYA 2OU7A 4O96A 2XAOA 3N4VA 3FL4A 4C57A 4AAAA 3SVVA 4EH6A 1PMNA 5CVFA 4GUEA 3RINA 4FUXA 5EYDA 3TIYA 3GC9A 4RX8A 4AX8A 3VW6A 5J9YA 2CGWA 4DFXE 3FJQE 3GCUA 1YRPA 5DOSA 4AWIA 3L8SA 1J1CA 3NW7A 1XBCA 2HXLA 2UW4A 3D9VA 4JAJA 5ANOA 2OXYA 2ZAZA 3ZTXA 4CNHA 1GAGA 2IVSA 4YNEA 3G0FA 4L52A 5ANJA 2P2HA 4N6YA 2XF0A 4RWJA 2P0CA 3VIDA 4HCVA 3U9NA 2XIYA 4X21A 1V0OA 3KRWA 3RJCA 1T45A 4G1WA 4DC2A 3PXZA 5HE2A 5HG5A 2R0UA 3COMA 4QP4A 4TPTA 4E20A 4TTHB 5HG9A 4CLIA 3DT1A 4D1ZA 4TY1A 5KMIA 1M17A 3PFQA 5CI7A 4BBMA 2XKDA 3VUTA 5JZNA 4C2VA 2R3GA 3MJ1A 4Q5HA 3HEGA 2E2BA 2PUNA 2WQMA 5FBOA 5CXHA 2YERA 3SXRA 2F2UA 1B6CB 5EQEA 5F9EA 3KB7A 1CM8A 4EJNA 2BRHA 3QQFA 3QZHA 4DH5A 4TWPA 1IAHA 3QQUA 4KIKB 3VS2A 3QTSA 1E1XA 4D2VA 4KSPA 4KRDA 3MWUA 4KBKA 3SOCA 4R77A 5DHJA 3WIGA 4L7FA 4XG4A 1E9HA 2AC5A 2O65A 2BZHB 2OG8A 2XBAA 3NUUA 4KBAA 3PIYA 3TT0A 1NVSA 4FZDB 4I1ZA 3DDPA 4EQMA 3CKWA 3WARA 3ZMMA 4PTGA 4DHZA 2ZV8A 3QTWA 4FF8A 4P7EA 4O4BB 3KREA 2J51A 2HAKA 1OIQA 3E93A 4N57A 5CU2A 4QP7A 3ATTA 2EUFB 3SXSA 3ZSGA 2GS2A 1U54B 3VS5A 2J50A 4NJDA 5M4UA 2PVRA 2ETRA 1MRVA 3C51A 5KMLA 4AOJA 4U45A 4ZMEA 3E3BX 4FT0A 4X3JA 3F2NA 3UIMA 3RTPA 2SRCA 5J5SA 1Y8YA 4ZS0A 5L2TA 3CKXA 4RFZA 2W1DA 4FTQA 4HPUE 4ACGA 3EQDA 3EN9A 3V6RA 4FTRA 3E8NA 3EQBA 2P2IA 2C30A 2PUIA 3PRFA 2JGZA 4D5HA 2VNYA 4QO9A 3SRVB 3U4WA 5M4IA 1SM2A 2XZSA 3EJ1A 1K9AA 4EHGA 5CSWA 4IVDA 4RIYB 2Y8OA 4IAYA 4WIHA 3RWPA 2R7BA 3FUPA 4R5YA 1UWJA 1IR3A 3GOPA 3NIEA 4FTIA 4EL9A 3FAAA 4U6RA 4PV0A 5CEMA 5A14A 4UXLA 3BU3A 4BBFA 2C5YA 4QTBA 4BZOA 3TNHA 3PXYA 3LJ0A 5CEKA 3PWYA 5AUZA 5HVJA 2PE2A 3Q04A 4H1MA 4E4LA 3Q9WA 2FUMA 5T68A 4HVSA 2RFDA 3A60A 4I6HA 1V1KA 4M8TA 3KRLA 3TEIA 3W10A 1FMOE 2F7XE 4EWQA 1RW8A 3HGKA 3CXWA 3AMYA 3Q4CA 2H96A 2XK8A 2VTAA 3ZO2A 2HCKA 3A7JA 3I5ZA 4E5AX 3PY1A 4ZTMA 4IWDA 3I6WA 4IACA 1YWRA 2F9GA 1Z57A 4U43A 3DK6A 5DBXA 4WA9A 4EOIA 1YOMA 4C35A 3UNZA 4WBBB 3VULA 4D2PA 4NTTA 3NVKI 4GFOA 3RM6A 3EOCA 5IEYA 4BCHA 5AP3A 3TACA 5L2IA 4IM3A 4OW8A 2JD5A 1KE9A 4L42A 3OP5A 1H1SA 2YDKA 2Z7LA 3BYOA 3P4KA 5D41A 5AAEA 3QGWA 2ZFYA 5L6PA 4XOZA 3FLQA 3TNIA 1MQBA 4CEGA 3DV3A 3FZPA 4RZWA 2GCDA 4FV9A 4GCJA 1WAKA 1XMLA 4FZFB 3H9RA 4FVPA 3U6HA 2XJ0A 1H4LA 4LI5A 4CYIA 4GMYA 4J71A 4FIIA 1YWNA 3WILA 4O7SA 4FBXA 4JIKA 4YMJA 4YNOA 3RAIA 4NM0A 3MN3A 4ANLA 3ZOSA 2B9IA 4JL9A 4JAIA 4BIDA 5HX8A 3I7BA 3KIOC 4D0XA 4ANSA 4K6ZA 3Q52A 4M3QA 2I0HA 5L4QA 2X0OA 2VWZA 2JDRA 1NT2A 5JK3A 4C02A 3LJ1A 3ODYX 4BDJA 4EKLA 3SKCA 3T9TA 5D9HA 5AR2A 1U46A 4FSNA 1XH9A 4BDAA 5AFVA 4MD8E 3BU5A 3LCTA 1OKVA 2B9FA 2W4JA 4WNPA 2H9VA 2ZVAA 4CMTA 3KGAA 4J8MA 3PIZA 4C58A 3EYGA 2ACXA 2GNLA 3TKHA 1H8FA 3GVUA 1XBAA 3V5TA 3ANRA 3TMOA 3BYUA 2VWXA 3HKOA 2C5NA 4J8NA 4O7WA 1DS5A 1PKGA 3HX4A 2OIBA 5FLFA 4GK2A 5EKNA 4FV8A 4DLIA 5AUXA 3IW8A 3P23A 4Y95A 4X6RA 4Y83A 4OTHA 1REJA 4F70A 3OOMA 3V5QA 4CZUA 2YZLA 3F2RA 4QPSA 1IG1A 5EHLA 3ANQA 3RCJA 4FODA 3KVXA 3ZZWA 4RT7A 4DG0E 3U6IA 3KA0A 5BUIA 3NW5A 4CQGA 1VZOA 3ZO3A 1WBPA 4BZDA 3R7UA 4EONA 2PL0A 2C4GA 5AAFA 1Y91A 3KK9A 4TXCA 2B1PA 3UBDA 4AGUA 4B0GA 4WSYA 3HV4A 3MH2A 3NCZA 4MQ1A 4AUAA 1PY5A 2H34A 3MFUA 3H10A 4YZ9A 4EJ7A 4MWHA 3NYVA 4E7WA 3PUFC 4AOTA 2OIDA 2XRUA 2AC3A 4UBAA 4U42A 4O0SA 3BRBA 4MXZA 4FK3A 4IW0A 2ZOQA 3T9IA 5CVHA 3RAKA 5IA2A 3N4UA 1QPEA 4L6QA 4RX5A 2YABA 3DY7A 3P7BA 3ZLXA 1O6YA 3F3WA 5CQWA 5ANDA 2HYYA 5IUIA 3TI1A 4B8MA 3RNYA 4F0FA 3DU8A 3ULZA 4FIFA 3NR9A 2CN8A 3A8XA 2I6LA 3HP2A 3KRXA 5F1ZA 5CEPA 4TYHA 1CSNA 4QMPA 1SMHA 2ZB1A 3Q32A 3KMUA 2R3RA 3R8VA 4C4JA 5HO7A 4TT7A 3UZRA 2R9SA 4O4EA 4O4DA 2ESMA 3BL7A 4D2SA 4U5JA 4C8BA 4FNXA 1ZYLA 2QG7A 3F5PA 1BI8A 2VTPA 5C1QB 5J7HA 5LXMA 1JKKA 4TL0A 2QODA 2OH0E 4Y72A 1WBNA 4XYFA 3FI3A 4QYHA 4ZTNA 3TN8A 4EBWA 4UY9A 4XNEA 3RPYA 1QPCA 1ZYDA 3ENMA 2JC6A 5HX6A 5FEEA 4NK9A 3UYSA 2WTDA 5FGKA 2JDSA 4N6ZA 2ZMCA 5K4JA 2YEXA 2C5OA 4HNFA 3UO6A 3O71A 3S0OA 3QRKA 4IWQA 3LFNA 3VUHA 1DI8A 4CRLA 4CZYB 4II5A 3NUYA 2PVYA 5DG5A 3WZEA 3ZLYA 3DXNA 4ANNA 3TL8A 3G33A 4N0SA 4OTGA 5M56A 3MTFA 4X3FA 3ET7A 1PF8A 4YLLA 3BPRA 4K9YA 2UW0A 4UWBA 4BC6A 3AD6A 4QTEA 5KO1A 3GCSA 5IQHA 4GFMA 5EKOA 2IF8A 3EWHA 5H8GA 4FKGA 3H3CA 1ZOEA 4E4MA 4RMZA 2W99B 5F95A 2HZNA 4LDTA 3VRYA 2VZ6A 4C3PA 4MXYA 2GNGA 5EDRA 4FYOA 3GFWA 1O6LA 1GZOA 4J1RA 4J53A 5JH6A 4QEBA 2VX1A 4O81A 3FYJX 3SC1A 4BJJA 2WPAA 5ETIA 3VONA 1J7LA 2CKOA 4G34A 4GRBA 5JFVA 3JR1A 3D5XA 2JITA 3S95A 3GFEA 5E8WA 2WXVA 4C4HA 4IAFA 3SQQA 3W0OA 1E1VA 3C0HA 5GZ8A 3I6UA 1W84A 3LFFA 4G3EA 4OT6A 2UW6A 4CTBA 2XIXA 4ZEGA 2VWBA 3VO3A 3WF5A 5HBEA 3FSFA 3UJGA 4QPMA 4P4CA 2OZAA 3V5WA 3EFKA 2FVDA 5IEXA 5IA0A 2PVJA 3ZO1A 3FI4A 4AZEA 3AC3A 5IQIA 3OWPA 2BCJA 4XH6A 4Y46A 2W1IA 3F5UA 5K3YA 3IW5A 5EQPA 3ACKA 2IEWA 4XV2A 2NRYA 1FOTA 3BBTB 1VJYA 2XBJA 1OKZA 3MGYA 5JGAA 3L8XA 3FPMA 1GIIA 1REKA 3ENHA 1RE8A 4OTFA 4PWNA 1WBSA 4RQKA 5AX3A 4ZIMA 4CFWA 2PU8A 3KFAA 4FTUA 3EQIA 5DVRA 1TFFA 1IAJA 3NAYA 4TYHB 4GU6A 2XCHA 4QQ5A 2I0YA 3G2FA 2C6DA 1WMKA 2QNJA 3ETAA 3GU5A 4G6LA 3TV7A 4JG6A 2B0QA 2J5EA 2WQBA 4IAIA 2JFMA 4FTCA 2YACA 2JIUA 5GINE 1IASA 1URCA 3UOHA 2HK5A 2WELA 4LYNA 4W4WA 3L8PA 2Y4PA 4A9SA 1JNKA 3HRFA 3BHYA 2QU6A 4J99A 4KBCA 3FV8A 2C69A 2X2KA 4DHFA 4C34A 4AQKA 4TWNA 5I4NA 1V0BA 2XM8A 2RIOA 4L67A 1Q99A 4HZRA 4R7BA 3LXPA 4GYIA 4KWPA 1UU3A 3GEQA 4LFIA 3KKVA 2WZJA 2HENA 5A9UA 4H3QA 5LJJA 2ZM3A 4XCUA 5L8KA 5KBRA 5LWMA 2G15A 3RK5A 3R1YA 5JSMA 2EXMA 2VTSA 4FTLA 4O22A 4RX9A 1R39A 3FLYA 3SG9A 3EB0A 3I81A 5CWZA 4X3FB 2GTMA 4P5QA 4YPDA 5M4CA 4D4RA 4HYUA 2ONLC 3WBLA 1ZZ2A 2VWWA 4WNOA 2QOQA 5CYIA 4K33A 4KRCA 2B4SB 3FE3A 4CMUA 4FV2A 2WIPA 4I5CA 5KMNA 5HG7A 3PY3A 3NLBA 3Q2JA 2JAVA 1ZAOA 5FDPA 4DGMA 5KMJA 3DFCB 4Z3VA 3D14A 2VNWA 5AUVA 3THBA 1CMKE 4BI1A 2B55A 2VTLA 3BV2A 4M97A 4QMZA 4BJJB 3LOKA 4MD7E 4HGSA 4OTIA 4RJ3A 5LWNA 4DFLA 2CDZA 1YI4A 5AM7A 3W1FA 4WOVA 4NJ3A 5E8YA 4BHNA 1A48A 4ASEA 2C68A 4WO5A 2WMSA 2YLFA 3C7QA 3E7VA 3ZCLA 4ZTRA 2C6LA 3MBLA 4XG7A 4GKIA 4OTPA 1UNHA 1JAMA 2X6DA 4IVBA 5BMMA 3W32A 5DIAA 5JFXA 3A8WA 5AUTA 5LCJA 4D1SA 2QQ7A 3P08A 2OFUA 2ERZE 3O2MA 1FVRA 3BQCA 1PXMA 3FXWA 2WTCA 2QR7A 4IB1A 5HG8A 3PLAE 4RIWA 3IECA 4EBVA 5IEVA 5CALA 1KV2A 3O96A 3UZPA 5M57A 3LFAA 3KRRA 4LUEA 4CKIA 2VTNA 5AADA 4DA5A 3I0OA 3COKA 5JGBA 3NZ0A 4DDIA 4GS6A 2G1TA 3MY0A 5FXSA 2J0KA 3ATSA 3CR0A 4PP9A 4IZYA 3TTJA 3IK3A 1G5SA 5EG3A 3LW0A 5E8UA 4AT3A 3IDCA 2VO3A 2RKUA 4Z16A 4MEDA 3VS3A 4JBVA 4R1VA 3HL7A 3NGAA 4JLCA 3HYHA 5EQYA 1H1RA 3R2YA 4GK4A 4XMOA 3VS6A 5CAQA 4NKAA 3O17A 3F3TA 5AJQA 4IB3A 1XJDA 4FNWA 3ZHPC 5IQBA 5AAGA 4O1OA 1Y6AA 5L2SA 3VF8A 5EI6A 4O7LA 4BGHA 1JLUE 4XJ0A 3A7FA 3V51A 3EFWA 4AGWA 4E4XA 2RF9A 4G3DA 4LV8A 4E26A 3KXXA 2IVVA 2O0UA 2R4BA 3IKAA 4Q5EA 3PIXA 2EB2A 5FTOA 4CFMA 1O6KA 2W4OA 4FI1A 4AZSA 4AA4A 5BUEA 1KOBA 2PE1A 1RQQA 1NW1A 1KOAA 4C4IA 2BKZA 2YM3A 4IZAA 4C3FA 2HZ0A 3ORNA 4XV1A 4O91A 3QKKA 3KN6A 4I5HA 5CTPA 4OAVB 3Q6UA 2R3QA 4O0VA 2XEYA 3RALA 3H9FA 4EI4A 4AXCA 1ZOHA 3CCNA 2BZJA 4YJQA 5ITAA 2W1EA 4MK0A 4S31A 4WKQA 4AACA 5CEIA 2WTKC 4HPTE 5BPYA 5HE1A 3NUSA 4IEBA 3UO5A 4NT4A 4BF2A 5BVWA 4MNFA 4CLJA 1G8JA 3FQHA 3D2IA 3KF7A 3LFCA 4BCPA 3W8LA 2W1GA 3W0PA 3GCQA 3VS0A 1ZLTA 3ERKA 3VVHA 3BE2A 2IW8A 2OJGA 4AA5A 4ARKA 2QKRA 2ITYA 5CT7A 3OEZA 3VJNA 4RJ7A 4E6QA 4CKJA 3MY5A 5M08A 3GC8A 3PVGA 3Q9YA 3QYWA 3W2RA 4BGGA 2ITQA 4FL2A 4IJ9A 1JQHA 3FMEA 3FMHA 2C6OA 3T3VA 4M14A 5DA3A 4AT4A 4UZDA 4I6FA 2CJMA 4MF1A 4ZY6A 1WVYA 3Q4UA 1ZARA 2Y4IC 2XCKA 4MNEA 3LLTA 4AW1A 1FVVA 2PSQA 3BYSA 3P7CA 4JQ8A 4PMPA 2W1HA 5F20A 4GG5A 3A62A 1YQJA 4RIWB 5DRDA 4FTAA 5HLWA 4H3BA 3ZC6A 4NW5A 3CGOA 1K2PA 2HWOA 4DEHA 2W4KA 1URWA 4F6WA 2Y6MA 3TV6A 4PDYA 2OKRA 2BVAA 4EHEA 1ZWSA 3EHAA 4QPAA 4AP7A 3SW7A 2PUPA 1GNGA 1M2PA 1PHKA 3EZVA 4YJUA 1Q8UA 2GFSA 5EW8A 3H0YA 4YTHA 1B39A 3D5UA 2ITZA 3R1QA 5HNBA 5TE0A 4FEUA 3LJ2A 3V5PA 3C0GA 2YA9A 4O6EA 2X9FA 2BALA 4P5ZA 1FGIA 1QPDA 4DEGA 2J90A 3D7TA 4IE9A 4LOOA 5AIKA 4ANMA 4DCAA 5KMKA 1FQ1B 2OK1A 3TM0A 1NY3A 4PTCA 3VBWA 3RPRA 3F61A 2I0EA 3TZ8A 3VS4A 4DH7A 5BQ0A 2XIZA 4G31A 4KNBA 3BYMA 4XLIA 3K3IA 4QMTA 2WEIA 3C4WA 3GC0A 4IJPA 4PMTA 5AUWA 4ZLYA 5C8MA 3ZO4A 5JRQA 3NPCA 4F65A 1L8TA 4TN6A 3EQCA 3C13A 4RWLA 2WQEA 4UMQA 1OIYA 2YHVA 4IAZA 4BWKA 4HGTA 4E6CA 3FQSA 4CKRA 5ANIA 5JEBA 5ANEA 5DRBA 3FKNA 4E4NA 4WHZA 4ERWA 3CSVA 3D5VA 3FC1X 4IFCA 3V04A 2JKMA 3FHIA 4M67A 4ZJIA 1M7QA 5A6NA 2UUEA 2OICA 2C3IB 4CT1A 3LXNA 3UC4A 4GEOA 3BWFA 4EWHA 5HEZA 3LXKA 4CRSA 3Q9ZA 3W0MA 2IVUA 3CPCA 4PX6A 4I3ZA 2X39A 3O7LD 3P9JA 4ZSLA 4HCUA 4B7TA 3BZ3A 4BCJA 3II5A 4OTQA 1QL6A 4NTSA 5LOHA 5JGDA 3FY2A 3C5UA 3OZ6A 4J98A 4WNMA 3PPZA 5J87A 1GZKA 3L9NA 3QZGA 3R71A 4TW9A 3VF9A 3CLYA 1YDRE 4MBJA 5AV2A 4F6UA 4R3RA 4KIPA 3UIUA 5DE2A 2OXDA 5E4HA 3Q4ZA 4XG6A 3DNDA 2B53A 1PXIA 4K11A 3C4ZA 3EYHA 4QMWA 2A4LA 4QP3A 1FVTA 4KS7A 5GJGA 3VN9A 5IA4A 3NCGA 2GQRA 3DB6A 2UZVA 1OI9A 3EMGA 3TG1A 1ND4A 4RWKA 4RVLA 3QGYA 5LVMA 4LM5A 1FPUA 4L8MA 1ZRZA 3QX4A 2W5BA 3NSZA 5HORA 4LGDA 4MNEB 1FMKA 2BILB 5D11A 4O0RA 3PSBA 2FSMX 3SHEA 4FKLA 3DK7A 5DT0A 4HZSA 4AW5A 5AA8A 4IXPA 4QP9A 3QALE 5I9WA 5HCYA 2F7ZE 1SVGA 2CLQA 1DI9A 4KKHA 4O0TA 3MB7A 4F9WA 2V22A 2FYSA 3MA6A 4G3FA 1P14A 4BTMA 4I0TA 4GW8A 3ZDUA 4GIIA 1KV1A 3I1AA 4IMYA 4P90A 2WQNA 2C1BA 3OTVA 2XIKA 4QYGA 4RJ8A 5E92A 5C03A 3QRJA 1JKTA 4TYEA 1ATPE 2I40A 3D7TB 5EK7A 4BCMA 4F1OA 2XS0A 4DYMA 4C2WA 3COHA 5H8EA 2J7TA 1ZMWA 4FKJA 4ITIA 2VTIA 4BBEA 4HVHA 4ORKA 2IW9A 3TDVA 3NNWA 3EQFA 3G6HA 3QD3A 2CLXA 4L53A 3ALOA 4K18A 3R1NA 4WUNA 5ANKA 3R8PA 3AQVA 3RPOA 5D1JA 4EH9A 3GU7A 3MVMA 4W8EA 2XNOA 5I5ZA 3FMKA 3VS7A 2QO7A 5DGZA 3SD0A 3R04A 1U5QA 3DJ6A 1CKJA 3VUKA 4BTFA 4ZAUA 4V0GA 1OBDA 3A2CA 3CGFA 5HNIX 4Z7HA 3HAVA 4DTBA 3JVSA 4M7IA 4F64A 3LQ8A 3OY1A 4YC3A 5CASA 5JN2A 4FEXA 3PUPA 3ZBXA 3GQLA 3ZM4A 3QZIA 5HZNA 3NS9A 3AMAA 4IWPA 3UDTA 3PA4A 3JS2A 2XKEA 3F7ZA 4F08A 3FKLA 4O38A 4XLVA 4KUJA 4Z7GA 4O86A 2HW6A 3AT2A 1U5RA 4MYGA 4RA4A 3M2WA 4M84A 3NMUF 5G6VA 1U59A 3GNIB 4Y8DA 5JFWA 4RFYA 3MW1A 4W4VA 4HJOA 4AE6A 4QTDA 3C4FA 3T8OA 4E6AA 4EH7A 2EWAA 3OROA 3OY3A 3DFAA 4CV8A 1UWHA 2QOKA 2RFSA 1H26A 4MVFA 2ITPA 4P2KA 2CCHA 4QMLA 4X0MA 3TNQB 4EHVA 4JX7A 1Q62A 4WD5A 4X2NA 2XAMA 2YWVA 2OBJA 3H4JA 3QTQA 3O51A 1XR1A 3OCSA 5IMEA 4DFYA 3QYZA 4O2ZA 1LPUA 3L1SA 3OCGA 3ORPA 4MXXA 3K5VA 5IQFA 5C4LA 1W82A 4ZSAA 3A4OX 2W7XA 3FC2A 2QU5A 4FKRA 2O63A 3D4QA 5FXQA 4PNIA 3S1HA 4JMQA 2C3JA 4WRGA 5I3RA 3LCSA 4RBLA 5IDNA 2UZTA 3C0IA 4UEUA 1WVWA 3AD4A 4N70A 4EK6A 3KRJA 2QOBA 4E6DA 3N9XA 2BKKA 4MXAA 1ZYSA 3LCOA 3O50A 4O0UA 4FSZA 1BKXA 1Q8WA 4GG7A 4QMVA 4U7ZA 2YIQA 1Z5MA 4UB7A 2XKFA 4W8DA 3BCEA 4TWOA 4I92A 4IX6A 3DAJA 2XEZA 3WZKA 5CU3A 1H08A 2X7FA 3FZRA 4CG9A 3GP0A 5AWMA 4CFVA 3A99A 3UOJA 4YJRA 1YXVA 4IZ7A 1M52A 3QWKA 4DH3A 2ZDTA 4G6NA 4PQNA 2CGXA 4I6BA 3DJ7A 4BICA 4DGNA 3FHRA 3LPBA 1TQPA 3O5AA 3OBGA 3CBLA 4U81A