4F21A

Crystal structure of carboxylesterase/phospholipase family protein from francisella tularensis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
217
Chain Sequence
NAMNYELMEPAKQARFCVIWLHGADGHDFVDIVNYFDVSLDEIRFIFPHADIIPVTINMGMQMRAWYDIKSLSLNRVVDVEINSSIAKVNKLIDSQVNQIASENIILAGFSQGGIIATYTAITSQRKLGGIMALSTYLPAWDNFKGKITSINKGLPILVCHGTDDQVLPEVLGHDLSDKLKVSGFANEYKHYVGMQHSVCMEEIKDISNFIAKTFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large scale structural rearrangement of a serine hydrolase from Francisella tularensis facilitates catalysis.
pubmed doi rcsb
molecule keywords Carboxylesterase/phospholipase family protein
source organism Francisella tularensis subsp. tularensis
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 217
sequence length 224
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f21A00
2HRQA 1H2YA 4X93A 3DYIA 4Y2PA 3R41A 2V9ZA 5FPPA 4BB0A 4F21A 3CN9A 1QIEA 1ZJ4A 1X2BA 4YX9A 3D2BA 1QIMA 1T2NA 2WSLA 2OQVA 2XUJA 2WFLA 4Q82A 4QDZA 4X3CA 1VJ5A 2VJAA 3R3UA 3STWA 1GQSA 4X6UA 4U2CA 5FKJA 1LPBB 1UKAA 3WA6A 5KWJA 4G9EA 1B6GA 4BE9A 1JKMA 2BGRA 2PX6A 2ZVDA 3ESCA 3I6MA 4IQ4A 3W04A 1VA5A 3WWOA 2G63A 3ZWQA 3HI4A 3DCNA 1KU0A 5E2IA 1A8SA 4CIBA 4OU4A 3D4LA 2XLBA 3STTA 4DNPA 4Q1VA 1NX9A 3ICVA 2ORYA 3FLBA 4RE6A 2WIDA 3T4UA 2ACKA 3SX4A 4BCBA 4CI9A 5KWIA 2WUGA 1CUFA 4HTAA 2VF2A 1CIJA 3WWPA 1XZJA 4B6GA 1XZDA 1ODTC 1GT6A 1EX9A 2XUOA 3FYUA 1K5PA 2LIPA 1AC5A 5CBKA 4KEAA 3G8YA 1E89A 4XJVA 5AM0A 1BN7A 5JD4A 1F8UA 3D7RA 1IZ8A 4BVJA 2DSNA 1EI9A 4OCZA 4ZGBA 5CURA 4UHDA 4YASA 2VQ6A 2WIFA 2XMGA 4GI1A 1ODCA 1EA5A 1CUEA 3P2MA 5JARA 1ZI9A 1AKNA 1Q84A 1QGED 2DQYA 3HSSA 5ALNA 1BE0A 1DX4A 2B9VA 1QLWA 3G0IA 5LZ8A 2J3DA 2K2QB 5AM4A 3DDUA 4UBLA 3QH4A 4G8DA 3FLAA 2QT9A 3AILA 4C4ZA 1BROA 5ALJA 1TQHA 2AJDA 2XUFA 1U4NA 4UFNA 3QMWA 5SYMA 1XQWA 2GYUA 5EIHA 2FJPA 2FX5A 1UK7A 3FNBA 1EB9A 2BAGA 2DHDA 5ALGA 4AO7A 4FNMA 5HKBA 2RHTA 1CUAA 3NOXA 5C8XA 4PSDA 4UPDA 2PUJA 2Z5GA 3F98A 3MUNA 2JGFA 2RONA 3WZMA 1QTRA 5ALYA 4KRXA 4ETWA 1ZIYA 1XZBA 1CR6A 2XUHA 5K3FB 4I19A 1WPRA 4O08A 2XUQA 3HXKA 5E4TA 2ES4A 5CT4A 3U0VA 1HPLA 3WJ2A 1VZ3A 3FOBA 5I8PA 2QUAA 4F5ZA 3TRDA 5DNWA 4M0MA 4LXHA 5AH0A 4PV7A 4BCDA 5BOVA 4U2FA 3JW8A 5AI6A 3ANSA 3F9CA 2OGTA 3G0GA 3H1AA 4Y7DA 3H2HA 2XQJA 3Q8WA 5FPQA 1XKLA 2XUIA 1MAHA 1QFMA 4HVTA 3FLEA 5T4FA 3M81A 1E5TA 2HA4A 2GYVA 1HKHA 1CV2A 2H9YA 1VZ2A 3FCXA 4OB6A 3H17A 5CT9A 1CUCA 1XZEA 4X97A 3M3DA 4AN0A 3IIIA 4X6XA 2QUBA 5EHQA 1ETHA 4MEAA 4EA6A 2WG1A 4QZVA 5HF9A 1TRHA 3C6YA 4B85A 3AINA 3IVMA 4UHHA 2H7CA 1GQRA 1YASA 5FP0A 2QJWA 3VJKA 1Z68A 2C4HA 4X7BA 1UOOA 2QR5A 4A5SA 2IX9A 4YPVA 5AKHA 3ZPXA 5JD6A 3KWJA 4HXEB 5D3KA 1MU0A 3KWFA 1HLGA 5ISMA 4B84A 1EK1A 3QPCA 4G8BA 1AURA 2BUAA 5IVKA 1BRTA 4J3JA 4F60A 4WFIA 1MX9A 5DNUA 4WY5A 4FHZA 3UUFA 2WKWA 5AOBA 2WJ4A 1MN6A 3GZJA 4DNFA 4OU5A 1MT3A 2G4LA 2JGEA 1BU8A 2PUHA 1CUJA 4J0JA 1DINA 5AM2A 3VJMA 3W05A 4ZXFA 1W76A 3CCCA 2ZYSA 1VE6A 3DYVA 2ZJFA 5F4ZA 3KSRA 1EK2A 3AFIA 3R3WA 4RGYA 4ROTA 4QLAA 2WTMA 4G8CA 1YS2X 4NZZA 4BZWA 1DWQA 1YS1X 5AIAA 3CN7A 4LKOA 1U8EA 1M33A 4Q3LA 3FCYA 4UFPA 1GXSA 3OOSA 2P8SA 3K9BA 1QE3A 2XMQA 2CJPA 2I03A 1RYYA 3H0CA 2B20A 4BATA 1QIJA 2PSDA 1VLQA 1VA4A 3HACA 1J1IA 1JT2A 1ZD3A 4Y2YA 3VDXA 1K4YA 5ALSA 5LZ9A 2JIDA 2HA2A 1UKBA 4B80A 4OUKX 5CXUA 5LZ4A 4HS9A 2GBFA 4M0FA 4E46A 3DL7A 2WHQA 2HM7A 1WM1A 1MNAA 3WKAA 1GKKA 1G5FA 4RE5A 2XLCA 1QJ4A 1N1MA 2DR0A 3HRHA 4BZZA 2JGJA 2CZQA 5AKLA 1UT6A 2OCKA 4LYEA 1JI3A 4DMHA 2WUDA 4Y9SA 1LPSA 3C8DA 5T4BA 4MWSA 5ALUA 2XI4A 3QVMA 4FKBA 4V2IA 1EDDA 2HFJA 3L1JA 4ARAA 5HK9A 5KREA 4G4JA 5AO9A 2I3DA 3G0CA 4EY6A 1YR2A 3V1NA 5LYYA 3O0DA 3BIXA 4D9JA 5JZBA 3YASA 1A8UA 4B82A 1SCIA 1ZI6A 2PVSA 5LZ5A 3O4IA 4BBZA 4FNGA 4FLEA 4QDXA 4H7EA 4AMYA 3WK6A 5IH7A 2Q0XA 5K3FA 1LPNA 4BVKA 5FOQA 4A16A 5ALFA 4GXNA 1PV1A 1CUZA 3H19A 3G9UA 1DQYA 2HDWA 1P0QA 2XUKA 3O95A 2HA6A 5JAPA 1H2ZA 3C5WP 5C7YA 4DM7A 3C43A 4JH0A 4WJLA 2HA5A 3R0VA 1CUWA 4U2EA 1F6WA 1QFSA 5AICA 5C8VA 2QTBA 4BP8A 2DCMA 3OURA 1YB7A 4BVLA 4DTCA 5AK5A 4BRZA 1G42A 2JGLA 2RI6A 5I7UA 2BGNA 2Z8XA 3DJYA 2QMQA 5EHXA 3BWXA 2JF0A 2OLEA 3EBLA 2WILA 2ZJ6A 3S8YA 5JATA 4FOLA 1DQZA 1OILA 4RNCA 2VJCA 3QITA 3BJMA 3DQZA 3WL7A 5DWDA 3KD2A 2C0PA 1JMYA 4N5IX 5ESRA 2CB9A 1FFDA 3IUQA 1A7UA 1XROA 5T4HA 3TEJA 2QM0A 2EEPA 3IUJA 1F0NA 1CUGA 1VE7A 4W63A 1VXOA 3QM1A 3PDCA 3GA7A 1XKTA 4PSUA 4EY5A 1J07A 1XZMA 4H0CA 4WDQA 3IUMA 2Y2UA 3I28A 5A7GA 4IH9A 4FLFA 4OPMA 1CUDA 3C45A 2JBWA 1DU4A 2VT6A 3VISA 5LKAA 1CUHA 5CT5A 1R50A 4B9EA 2FUKA 3RK4A 5ALWA 4H7IA 1WHTA 1FFAA 3F8SA 3DOHA 4X94A 5HZGA 2VJBA 4BAGA 3PI6A 1E8MA 3MGAA 3EQ7A 1YA4A 5ALRA 5A71A 3AZQA 3IUNA 4AZ0A 2XQIA 5C81A 2QZPA 3WIOA 1MX1A 4QA9A 4BAZA 3DNMA 4LXGA 2RHWA 4N8SA 2XMDA 4G9GA 5IKXA 3D59A 2DHCA 3E4DA 1Q83A 1R4ZA 2O7VA 2XUGA 3LS2A 2H1IA 4IHAA 3TGLA 4AB1A 1ZD4A 1JJFA 5AKYA 1WB6A 1ZD2P 3ICWA 4PNZA 3A70A 3JWEA 2EDAA 3AJAA 3VKFA 1QIGA 1XZLA 5FUMA 4X90A 2R8BA 2OGSA 2RAUA 5I9IA 1BCRA 3O4GA 3WYDA 1RP1A 3QYJA 4B0PA 5ALZA 1K6EA 5HKAA 3KXPA 4Y2RA 2PSEA 1UFOA 3ZV7A 4KAAA 3F97A 4EUSA 5CT8A 1OXMA 4W9RA 3HZOA 2GYWA 4BTVA 2HU7A 4OD0A 4LIPD 3RLIA 1Y7HA 2I78A 4FFVA 5DYWA 1XLWA 4J7AA 4KACA 1BS9A 2QOEA 4OSEA 1CUYA 5BWBA 3W06A 1PFQA 1XFDA 3BF7A 3OG9A 3PF9A 4JUIA 4NS4A 2PU7A 4UHFA 4P9NA 5CW2A 3V1KA 1D07A 4GBGA 5DNVA 1AUOA 5EGNA 3A2NA 2YYSA 2PSFA 2XQFA 3I1YA 1ZGBA 3AIOA 3I2GA 3IB3A 2YXPX 2PU5A 2VATA 3O4HA 1Y7IA 1XZIA 5YASA 1B41A 3IA2A 2WJ6A 3LIPA 1QZ3A 2DFPA 2ZYHA 4J0CA 3W2TA 4ZWNA 1JMKC 1MO2A 3BF8A 4XX1A 4QDTA 5AIBA 2CMFA 5JAHA 1ZJ5A 3KDAA 4UBNA 1HBJA 4H7DA 1ACJA 3G0BA 3OM8A 3WI7A 1EVQA 3WZLA 2QKYA 4K5QA 4Q34A 2HA7A 1O6GA 2UZ0A 5JAUA 2ACEA 1SCKA 4BRSA 4DYHA 3CCBA 3FBWA 4FBMA 2WTNA 1WPXA 3KOOA 1GPLA 3D0KA 2C0QA 1H22A 1XZHA 3I6YA 4FTWA 1CQZA 3G9TA 1G66A 1ORWA 3MUOA 1LPAB 2GBIA 1FFCA 5IVDA 2NW6A 3M83A 5JIBA 1MPXA 3AIMA 5ALQA 1JFRA 4BDSA 4B0OA 1CPYA 1YCDA 2GBGA 4BDTA 2VAVA 2WU4A 4AN1A 1GPKA 1XZGA 5SYNA 4KR0A 3GELA 3PFBA 3ANTA 4FMPA 2C58A 5AK3A 1VXRA 1R3DA 2HHAA 1QIKA 5ALTA 1U2EA 3I2KA 3PICA 1C4XA 1X70A 1XZFA 4DNQA 1IZ7A 2DQZA 3ESDA 1E8NA 5CXXA 4KE7A 4X92A 5DTJA 1XRQA 3C6ZA 1L7QA 3O9VA 2V96A 5AKGA 4EY8A 4BC0A 3DS8A 5AI0A 3HLKA 3PFCA 2QXUA 5CH8A 5AKKA 2G5PA 1ZI8A 2WHRA 4ZREA 5K3CA 4NVRA 3WKBA 4AO8A 3RKSA 3C70A 1AX9A 2HA3A 4WDRA 1NU8A 4H7JA 2XUAA 4EZIA 1LBTA 3GFFA 1WCYA 3I2FA 5HQ3B 5LP1A 4RPCA 3EQ8A 5HK8A 3W9UA 1XQYA 5HF6A 3B5EA 1J06A 5JZ9A 2C5FA 3A2LA 3WWCA 2XUDA 2XMZA 2OAGA 4LHEA 4PO3X 1OCEA 3IURA 3B3QA 4M0EA 3OPMA 4P08A 3G02A 4N5HX 1ACLA 1LPOA 4QDUA 3HC7A 3V1LA 2Z3ZA 4EY4A 4C89A 4C88A 2GZRA 1W4LA 2WLSA 3GROA 2XQGA 4LXIA 4C4YA 1QONA 3BXPA 2WJ3A 5AK6A 3X3HA 5CT6A 2EDCA 3STXA 1WB5A 2BCEA 1UZAA 2OCGA 3FYUC 3RARA 1ZGCA 3WK4A 5ALMA 4Y2XA 5AOCA 1A88A 3VXKA 1LZKA 4X6YA 3ILSA 4J0KA 5CH3A 3H1BA 1DWPA 3GBSA 2ZYRA 4UBMA 4X71A 2HA0A 2WG0A 1LPPA 1SFRA 1H2WA 1J2EA 1QO9A 4XIIA 3C6BA 1E3QA 4MQLA 2XE4A 5ALLA 4QNNA 5ALXA 5DYYA 3QMVA 5H3HA 4Q3OA 4HXGA 2AJLI 3AIKA 3WA7A 5HFAA 3ESAA 4Y2JA 4HRYA 1ORVA 3T52A 3FSGA 4QWWA 3ZLTA 1CVLA 4KAFA 3WK5A 4HZGA 1CUVA 4DSAA 4P92A 2HFKA 5AM1A 2Z3WA 4C4XA 1TAHA 4OYLA 2WIKA 2HU5A 1AZWA 1WHSA 2WM2A 3K6KA 1EVEA 3R40A 1AMNA 4MQMA 1TK3A 5A7FA 1UKCA 1U65A 3WKDA 4MYDA 5AP9A 2OCLA 4L72A 4WCVA 2ONCA 3R3XA 4KE6A 3UUEA 1R9MA 4DMCA 2J4FA 1QO7A 4PF1A 4B83A 4FLMA 5AKXA 5K3BA 3DLTA 4UBKA 2XUPA 1SCQA 3C5VA 3I2IA 1THTA 3EQ9A 1EB8A 5DLPA 3PUHA 4J0GA 5EFZA 1DT3A 3WWDA 2V98A 1DTEA 2OPHA 4C87A 3BDVA 2QXTA 3D5EA 2J3QA 5AI8A 4F0JA 3ED1A 4BC1A 5FV4A 3M82A 1N8SA 1JJBA 3L1IA 2XQKA 4KE9A 4UHBA 2AXEA 1YB6A 5A62A 1NU6A 2WFMA 2VJDA 2ZSIA 4W1RA 2YASA 4DIUA 1G4HA 4E11A 2BKLA 1Q0ZA 2QJRA 5JANA 3L1HA 5AKEA 2DHEA 3G0DA 5CH5A 1F0PA 2D5LA 2Z8ZA 4EY7A 5LKRA 2O2GA 1VKHA 1HQDA 4HRXA 1ZOIA 2H7YA 3V48A 3G7NA 4GW3A 1W1IA 4QLOA 2HU8A 3H04A 1CUSA 1P0IA 3JYHA 1CUIA 3F96A 2RGUA 4BTLA 1EINA 3HEAA 5EIAA 5A2GA 4XVCA 3IDAA 4UBOA 4ZV7A 3QZUA 5ALHA 2ZYIA 4K2AA 4B9AA 4J0HA 1YAHA 4X00A 1R9NA 2O2IA 1R88A 3SC2A 3I2HA 3NWOA 2WHPB 4JYMA 3NUZA 4ZI5A 3W9BA 2HADA 3HABA 1X2EA 4TGLA 5AI4A 1QOZA 3QPDA 3DKRA 2PL5A 4GLBA 1W75A 2VEOA 3ZLVA 1BCSA 4AMZA 1CRLA 4GECA 4MYSA 5AM5A 1QIHA 3SK0A 1XRMA 3PF8A 3QMMA 4DNOA 4FDMA 3STUA 4CCYB 4L3WA 4AQDA 1ZIXA 5HQ3A 5K5EA 4BCCA 2VTVA 1CUUA 4U2DA 4BYMA 4X95A 4UHCA 4I4CA 3VVMA 5AM3A 5LIPA 4GHWA 1MTZA 4IH1A 5LLSA 1CUBA 1EHYA 3S2ZA 3AZPA 4Z49A 1TKRA 5ALKA 5LZ7A 2IIVA 1USWA 4FFWA 3WYNA 3BL8A 4G4GA 2VAXA 5D3ZA 3ZI7A 4G4IA 4WY8A 2JEYA 4GWLA 1YSCA 2JGIA 4J0IA 3K2IA 1GPNA 3A6ZA 3AZOA 4CG2A 3STYA 5ALDA 5HCUA 4DLNA 2PM8A 5HF5A 3A2MA 3DOIA 3H2IA 4OB7A 4DGQA 2XDWA 4J03A 3PUIA 4H7KA 1QTIA 1IVYA 2J4CA 1XRRA 4KJXA 2X8BA 1C7IA 1UK9A 2B61A 2XMSA 3WK7A 4KE8A 2OQIA 1GKLA 2GZSA 5ALOA 2JGKA 1L7AA 5DTIA 5EI5A 5JD5A 2HIHA 1JU3A 3CXUA 5JAOA 3C8HA 3WLAA 1UK8A 4HAIA 3WIBA 5ALIA 2BUBA 1AGYA 2B4KA 5A6VA 1I6WA 3WKEA 4NMWA 2WIJA 1TCAA 4CG1A 3R3VA 5HFNA 2CBGA 5K3EA 3BIWA 2WQZA 3HJUA 3BDIA 1EDBA 4DSZA 7YASA 1C7JA 2GBCA 4PW0A 3WL5A 3QBJA 2JEZA 4Y2SA 5E4JA 2QVBA 4CCWA 3H2JA 2QS9A 3LLCA 1BEEA 5ALEA 3BE8A 1W52X 4INZA 3Q0TA 5T4EA 3ZLUA 4A23A 1WB4A 2PSJA 5C8ZA 4CG3A 4YK7A 5AJHA 3OC0A 1R1DA 2ROQA 2FJ0A 5EIEA 2C7BA 2HRRA 1N5MA 1MX5A 3U1TA 3ESBA 1QIIA 4TVKA 2WUFA 1TCCA 2VT7A 1VOTA 1E66A 4W1SA 3WKCA 2CKMA 1ISPA 1K63A 4LYDA 3IBTA 1T4MA 2BFNA 4H35A 2JGMA 3MVEA 1S8OA 4G1FA 4TPKA 4Y2VA 4IH4A 1RWQA 4JNCA 1XZKA 3C87A 3R3YA 1XRNA 1LBSA 5AK4A 1XRPA 5ALVA 5HF8A 1XQXA 4EBBA 1SOMA 4B7ZA 2QRUA 4JEIA 5JALA 5D7BA 1TIBA 1Q0RA 3GUUA 3DKKA 4S0XA 1THGA 3IULA 1DWOA 4KRYA 2CEKA 2PSHA 1UOQA 5BWCA 1IMJA 4K6HA 4H7FA 5AI5A 3H2GA 4X85A 2OG1A 2OGZA 5BV7A 4HXFB 1IUOA 5AKIA 1TCBA 3E1GA 4CIAA 5FXMA 4MWTA 3N2ZB 4Y2TA 5CRIA 1MAAA 3NGMA 2C5GA 4ZRDA 4Q05A 4W1QA 2V97A 4PQEA 1CUXA 2WFLB 4JYPA 3WWEA 2Y2VA 4H7HA 4K6GA 1UK6A 4XWGA 2X76A 4H77A 4G5XA 5IVHA 1P0PA 2ZSHA 5LZ2A 3LCRA 2HL6A 1UXOA 5DJ5A 4WFKA 5FRDA 4OB8A 1FFBA 3LP5A 1CFJA 5A7HA 3FAKA 3V9AA 1LGYA 4AZ3A 1O6FA 1K8QA 1AQLA 1PJAA 2RIPA 5CTAA 1HDEA 4Q3KA 2W6CX 2OCIA 2OAEA 5K3AA 2R11A 1DT5A 1IUNA 3FYTA 2WHPA 4OYYA 4DMKA 3BJRA 3DD5A 2WG2A 1GZ7A 2ECFA 3FYUB 2I3ZA 1JU4A 1EH5A 3H2KA 1XLUA 1HL7A 5IVIA 1GGVA 4X91A 2Y6UA 5EHNA 2O7RA 4UBIA 3V1MA 4CCYA 1WOMA 3DEAA 4UFOA 1Y37A 3HYSA 3WL6A 3I1IA 4AXBA 1CQWA 3EF3A 1FFEA 2PPLA 1UOPA 4Y2UA 4MEBA 5K3DA 4AO6A 5JYCA 3LIIA 3G9XA 2Y1KA 4UBJA 4WFJA 1JJIA 4KAJA 1YA8A 4N8EA 3E0XA 1E8DA 4QE3A 2XMBA 3FVTA 1MNQA 2WIGA 5AKJA 5E4YA 4EB0A 1FSSA 5JADA 5DYTA 1QIDA 3O9MA 4U2GA 4N8DA 3WMRA 2H7XA 3AUKA 1EXWA 4GDMA 2CUTA 2ZJ7A 2WU3A 1XLVA 4ARBA 3I2JA 5JASA 1SC9A 1XZCA 3WK8A 1XRLA 2E3JA 4GEGA 3FSGD 3R3ZA 4U2BA 1ODSA 2VSQA 4FBLA 2X5XA 4QEKA 1FJ2A 1YAJA 1P0MA 4Y2QA 3C6XA 1BEZA 4L0CA 2WFZA 1N5RA 3STVA 4FWBA 3FVRA 2PKYX 4AX4A 1ZICA 2D0DA 1UWCA 3N0TA 1L7RA 2O2HA 2G5TA 1KEZA 3D3NA 1H2XA 6YASA 4MXDA 2IITA 3PE6A 3WJ1A 3WQHA 2XMRA 3UMJA 3SWWA 4C6HA 4W1PA 4MJ3A 4C01A 5D6OA 1H23A 3I6ZA 4E14A 3B12A 2AJ8A 1A8QA 3D2CA 1DX6A 3VVLA 1BN6A 3O4JA 5KBYA 4BP9A 1CLEA 4UUQA 3RM3A 4EHBA 5FDFA 1CEXA 2OXEA 4P93A 5AI9A 4QWMA 3QPAA 3VJLA 5EHZA 4E15A 2VA9A 3D2AA 4L9AA 4IO0A 4PSCA 1W6RA 4CFSA 2W22A 3WL8A 4DMFA 4QDOA 1LLFA 1LPMA 2WUEA 3E3AA 4H18A 5AOAA 4J0DA 3H18A 2YH2A 4ITVA 2AJCA 1KU6A 2XB6A 3F67A 4BE4A 4B81A 4UHEA 2BJHA 4I3FA 1ZD5A 2XT0A 1EDEA 5AKZA 3WK9A 3EIOA 1XQVA 5JZSA 5ALPA 5AHXA 2XMCA 3OTQA 3G9ZA 3TJMA 4K6KA 2BUCA 5FLKA 2AJBA 2Y6VA 3DL4A 4BAUA 1LZLA 2PBLA 1IUPA 4ZV9A 5CMLA 1XZAA 1QIFA 3FWHA 1LNSA 5J3JA 4KYVA 1MJ5A
chains in the Genus database with same CATH superfamily
3EDRA 1G18A 3ZK9A 4DLVA 1H2YA 2POQX 1CDDA 2F90A 2QLMA 3AUSA 3K20A 2LUOA 3QWIA 1NKSA 1R0ZA 3QKWA 1KY4A 2QORA 2PN1A 4ITRC 2ECOA 3IV7A 1KYTA 1OLSB 2BEVB 3IR5A 3FDFA 2V9ZA 4B3DA 5CEEA 2UUOA 3SMVA 3UN1A 1KSJA 3UENA 1E9RA 1BMFD 1AKQA 1BMFA 1W93A 4WZBB 1N9KA 2V74B 5TMPA 4KN8A 5K1ZA 1BMQA 4EITA 4BQSA 1ZJ4A 3D0OA 3GNTA 1U81A 4DJJA 1FTGA 3ZCPA 4FS8A 3MT0A 4RQTA 3WLNA 1IJBA 3E7PA 3K9GA 3TB4A 5ELXA 1UIMA 4ZQCB 1JIKA 1T2NA 4AT1A 1ZVQA 3MCWA 2P79A 3IUYA 4HTFA 4PCAA 1UZUA 5HKLA 3TG8A 3UHAA 2CDCA 4Q82A 4QDZA 5A9TA 5B4UA 4KBFA 1VJ5A 3BM5A 4KQMA 3STWA 2I54A 1NNUA 3FTPA 5BN3B 3N6RA 1GQSA 3IRVA 3OTGA 4U6QA 3ZV4A 6ABPA 1XK6A 2W7TA 1O2DA 4P7FA 5DDIP 2C54A 3AFGA 3WYBA 4AJ2A 4MV1A 5CBPA 1M34E 2P6UA 2XRZA 3FPKA 1IE3A 2D4AA 4G9EA 5KWJA 4J1TA 2BISA 1HYHA 3M5DA 3CLRD 3GEBA 4DLSA 4NMXB 1J7JA 2UYOA 3CWZA 3I6MA 3KR0A 3TVYA 3W04A 2NO0A 4JT4A 4B6JA 3HB1A 3R5HA 4OXRA 4QJ5A 3U49A 3KQTA 4A0QA 5IJ0B 1D04A 1T5HX 2A2ZA 2G80A 4C4OA 1OMOA 1Q0PA 2G63A 4JT8A 2CMDA 3ZWQA 4FDUA 5I7FA 3R0IA 3TI9A 4NYIR 2FW9A 4DR7B 2QU7A 2JAXA 1RM3A 2HDNB 2GXSA 4OJQA 1SQ5A 4Y0VA 4AFNA 1H8HD 3RIGA 2QLJA 1USGA 4RENA 2JGRA 3OP1A 3PRHA 5FBQB 4CIBA 1JHXA 4EHJA 1TAUA 3QTBA 3HJFA 3OMXA 4GZMA 1C81A 2A7XA 1G8HA 3PIRA 1UC9A 2VQSA 4LDNA 2ZE7A 1P1CA 2CL6X 2F67A 4HWSA 3S2FA 3T4UA 3WOHA 4BJ6A 4G67A 4W5HA 3SJAA 5JY6A 1A04A 3LX6A 4N3BA 4U2KA 3MZ0A 1VIMA 5DWQA 4BCBA 3IEPA 2O3JA 1PJ8A 3Q5EA 1P9WA 1OKKD 1VMAA 2GILA 2WUGA 3C7KA 3H6KA 3I37X 3JR7A 1OKKA 4Y67A 4IIXA 1VI5A 2YWCA 1IN6A 4ZO9A 4G26A 3RC3A 4YRZA 1N9ZA 1VHLA 2VF2A 4EI2A 4CKYA 3IAM1 1K88A 3WWPA 4E51A 4B6GA 2FSSA 4NS1A 4Q93A 3A6LA 1GT6A 3FKSD 4IO1A 5CTJA 3TNJA 1Q77A 5I01A 4ZCMA 3W77A 1EX9A 1XA4A 3PTAA 5CHYA 3NHMA 3X1MA 2QR2A 1OLXA 1V8PA 2JHAA 3DMPA 3PR3A 1GL9B 1SXJD 3BE4A 1IPFA 2HHCA 1L8LA 3ITKA 4Q0MA 5COQA 1K5PA 4KN5A 1X14A 1PJCA 3I04A 3ZKWA 2GQ0A 3RUPA 2HJWA 4D9NA 1WZUA 2COEA 4KEAA 4AP9A 4QGFA 3AYZB 3G8YA 4BKUA 1NMYA 2ZUDA 1RWPA 1ZZGA 1E89A 3M4NA 1F2VA 3IP8A 3ZTYA 3VAAA 1T3LA 4BXOB 1BN7A 2XEXA 3EWSA 1U28C 1Z4KA 2ISCA 3H5VA 4XIGS 2IWHA 3B9QA 1DXOA 4L7VA 2DLDA 2W5UA 9GPBA 1XD8A 3T1TA 2DSNA 1WVMA 2WDZA 1VJRA 1WV1A 4I6EA 4YLGA 2CMKA 4OCZA 1AJEA 4ZGBA 3IAAA 4UHDA 3EUWA 4DWOA 2ATCA 1CETA 1JHDA 2FZ5A 2KHZA 3HDQA 2DJIA 2XCTB 1HY3A 2HCRA 1DJMA 2R47A 3BIJA 2XMGA 2CMHA 2I55A 3HU2A 4AP5A 1G55A 5DBGA 1J8VA 1Q1GA 5TGZA 3HRKA 4F4CA 2GEBA 1FDTA 2L2QA 3VR4D 4BWVA 3IEVA 1CUEA 3E2MA 3P2MA 1IHYA 1TZMA 3NAGA 4D4JA 3V6MA 3AVXA 2R00A 2P69A 1Q84A 2DQYA 4WBNB 3K3PA 3BHNA 2J32A 4NYMR 1BKSB 1FU4A 1NV9A 1NDHA 5JS7A 1ESNA 5D1NA 1BE0A 3GPLA 2EFGA 3DWGA 4ESOA 3SC6A 1ZL2A 3P9ZA 1I80A 1IXRC 3FUWA 4LOJA 5I7HA 3KJQA 3H9QA 3Q7TA 3U3ZA 4UBLA 4G8DA 3F3YA 2HMWA 3FLAA 4N9QA 5EJMA 1TCUA 3KJHA 3S28A 4GR4A 3WP0A 3D1LA 4LZLA 1Z7GA 4RSHA 3AILA 2BFPA 5DBOA 2IXTA 2QAGC 1PF7E 5K3SA 4M89A 4WLOA 5HUHA 5IULC 2PUCA 1JJVA 3GFVA 3R9KA 3I01M 2NVUA 5KOHA 2AJDA 3PA6A 1TM1E 3K2EA 1FYVA 1U4NA 2H5JA 5AXAA 5TJ9A 1FMCA 4M37A 4UFNA 5KQLA 3WNQA 2C98A 2XR1A 1L5ZA 5FTMA 3FFBA 1ULBA 2DXIA 1LLCA 1OXTA 1ZO8A 2GYUA 3GARA 4RZQA 2YUIA 5EIHA 3W78A 4A26A 3QV2A 1XPUA 2QENA 3TVTA 1KSHA 2ATXA 1SEPA 1KFCB 1U2QA 1D4FA 2VJQA 4EKYA 4ZC1A 3IILA 3FBTA 1P39A 1ECBA 2QLTA 3K32A 4PSDA 4UPDA 5FNVA 5C8XA 3U4MA 2Z5GA 5CLHA 2ZRDA 2AS0A 1J8QA 1YZGA 3HKEA 3MJ4A 2X4GA 3LAWA 4UAUA 2C4WA 5H9VA 4DA4A 4AAYA 4LHSA 1VFPA 4H6VA 5ALYA 4FCTA 4KRXA 2W70A 1ZIYA 3SHFA 5K3FB 2Y68A 1JAIA 1SUSA 3GDWA 1CDZA 1UFKA 3BAFA 1PR5A 1WPRA 5CPFA 4B47A 3ZCQA 1N0WA 2O2CA 3OZVA 5E4TA 3S2EA 4WKGA 3IDSA 2ES4A 4ZEXA 1ZPDA 1K75A 3BC1A 1HPLA 3L92A 4BRWA 1NMZA 4JXZA 4QT4A 5U4XA 1B3BA 4UUNA 1Z6XA 5K9ZA 4RXMA 4OEHA 1E63A 1NVFA 3FOBA 5FADA 1K6MA 4RVSA 2QTTA 1TRKA 4IDCA 1VIYA 2OVFA 3WXMA 2BOVA 2VNAA 3GT7A 4PLYA 2UZ1A 2OCBA 4BKRA 3VH4A 2PRZA 3HGMA 3AHHA 5EXEA 3T3GA 5DNWA 1AKEA 3PQ3A 1E58A 4LY3A 3UK0A 2PUAA 1CT9A 2OHJA 4PNPA 1VECA 4LXHA 5AH0A 2Z1NA 4J3NA 4DQLA 4PV7A 3O47A 5DI3B 5BOVA 3LCUA 3TTXA 4BCDA 2PBFA 2PL1A 2FLVA 3JW8A 4WUVA 4X54A 3VR6A 5CB0A 3BL5A 4ABYA 4UOEA 3JVEA 1R3UA 5LXTF 3JZAA 4RDXA 2BELA 4PAGA 4RAOA 3CKLA 1M6WA 1ORDA 2Y0CA 1QG0A 2QROA 1YJXA 4YRCA 3RAJA 3CEHA 1RPTA 4HNHA 2FPIB 1QU3A 3ST7A 2IYUA 1AK2A 3H7AA 4Y7DA 3VKVA 3ZU6A 3H2HA 3IP7A 4WNYA 2O3UA 4LGVA 1D2NA 1C1XB 3GLGB 2B7LA 1M7GA 4F92B 1Y8RA 3KLBA 4KLAA 5FPQA 1XKLA 4DKXA 2JL1A 2WYVA 4ZAXA 3QFRA 2XUIA 2ZQZA 1DFHA 4JLAA 1GZDA 4HVTA 2Q5JA 3Q6IA 2DJ5A 3FVQA 4YCDA 5T4FA 2DF8A 5IASA 3GVHA 1EFRD 4PFQA 3ESRA 3DEZA 3FMIA 3O4VA 4GMKA 1O54A 3I9NA 4JT2A 1CBUA 3QVVA 2IZ0A 2EKQA 3QUBA 4LWQA 4N39A 2GJKA 4YRSA 1Y8ZA 4NDNE 1XEXA 2AFHA 1E3MA 4NENA 4RPLA 2RKWA 1HSOA 2RGYA 2H9YA 3G2PA 4LZPA 4C7BA 5FX2A 5ECYA 5J2UB 4OB6A 3H17A 4CF6A 4IUCS 5G0WA 3AVUA 2GK6A 3I73A 4PPFA 4QYTA 4X97A 1MENA 3IIIA 3WHLA 2FFAA 3TQFA 5A3QA 4RY9A 1N2OA 1V8ZA 3LTEA 1BIFA 3X0DA 3ROMA 4B3SB 3ZGVA 3TIFA 2BP7A 3GZNA 2GZ3A 3EVEA 3ULKA 2HQRA 1RRGA 4O2RA 1YBMA 3PFNA 4JLSA 3RBAA 3HVRA 1ZWLA 4PQGA 5JFGA 3KTDA 5KYXA 1Z63A 2YCLA 5LYJB 1YZQA 2BGJA 2H2GA 2VBIA 3Q3JB 4UZEA 3T3OA 2Q2OA 3N8NA 3O8QB 2IXBA 1M2KA 4YRQA 2V03A 2L69A 3QOXA 1T1RA 2I1VB 2IEGA 2V7TA 4F85A 2KW5A 1GQRA 1W5SA 1ICIA 1YASA 3Q8KA 1IAVA 1YQTA 5FP0A 2WUVA 3CRQA 2QJWA 4YIHA 4YJGA 2BFEB 2QZ4A 2YJTD 4JODA 4GOXA 5BR1A 3BICA 3I34X 1Z68A 2R65A 2F3PA 3IMGA 1WG8A 3NYIA 4K9SA 4GRIA 4MVJP 4RULA 3T1YB 4HGOA 1IBRA 2FQWA 2A5JA 2Z58A 4UD2A 4UJ5A 1BA3A 3F4BA 3OFVA 2VPZA 2WA2A 1S96A 4Y2HA 10MHA 1LU9A 1RXIA 2C9DA 2VDQB 1GUAA 1YWGO 2PS1A 2VTBA 3ZIAD 2DTEA 1IY2A 2HLDA 3NHPA 3ZIAA 1KE1A 1N6NA 3S55A 4LYGA 2XRMA 4R8RA 3KWFA 4YT5A 2R6ZA 1WCIA 1SVNA 4JCCA 5T41A 2TS1A 3ADCA 1DC6A 3AF2A 2ZJ4A 2WF5A 3GJ4A 3QPCA 1ZLYA 3M6MD 4L15A 3TB6A 3W8EA 3F0TA 3UMMA 3TO5A 3M34A 4IJWA 1D4OA 2OHFA 1AURA 2RMKA 1W4AA 1KBQA 1W1UA 4LDAA 1KTVA 4DEXA 1AK9A 4UATA 1VLMA 1OLSA 4F60A 2DERA 2BEVA 5G3YA 2H1OA 5DGIA 1Q0QA 3HYTA 2W58A 2XBMA 3GJ0A 3LC7O 4FHZA 4MVWA 4AP6A 1EQAA 1ZH2A 2QNBA 1SHTX 3AEUB 3UUFA 2R85A 3HK2A 4WZBA 1M54A 2A57A 2ONKA 1SMKA 1TJYA 2P4QA 4FXOA 1YZHA 5FAKA 2G9VA 1C30B 4Q1CA 4HC4A 3NTXA 4KWHA 4FHFA 2YZGA 1XVAA 3DEYX 4PQFA 4AF7A 1Y3CE 4K9OA 4I9UA 4RORA 3TIIA 3L0DA 4U9IS 1PE0A 2P2GA 1AXGA 4DPKA 3NPAA 3T7CA 4DGSA 3AVPA 2H08A 3PZBA 2XE8A 5BN3A 1G5TA 2GX6A 2FOLA 3OCVA 2OA0A 5CK5A 5T7BA 1J0CA 1LLDA 1WMAA 4TQGA 3VZQA 3KZMA 4Z9YA 4LHWA 2ZUUA 4FGJA 4M1TA 2ZYSA 5SY9A 3U4HA 3WMFA 2QPAA 1E2DA 3NTLA 3MJHA 2GZAA 2IL1A 2J9RA 3DOFA 3UBMA 5F4ZA 4IP0A 1PQUA 1ECGA 2NTEA 2GDZA 3TTSA 4D79A 1U0NA 3KSRA 4M21A 2FF7A 2DETA 2RG7A 5IJ0A 5DYIA 1G59A 1UEJA 1K4MA 1PWXA 4ROTA 3CG0A 2PRKA 1YHYA 2CCJA 2WWYA 1FDIA 4G41A 4QLAA 4XB1A 3V8RA 1H85A 5GZ1A 3PG5A 3S2IA 3ZDFA 4PYLA 3R0ZA 4NZZA 2FR8A 3THSA 4C7VA 2QD2A 1DWQA 1BCRB 2O3QA 2VJMB 4IVRA 2ZJ2A 3JV7A 4LY0A 1KI3A 5AIAA 5EUMA 4B8ZA 4CM6A 5CEFA 4FE7A 1GUZA 1M33A 1NN3A 2WMNB 4CM3A 1BXZA 4F6RB 3FCYA 2FN9A 3EFEA 2AYZA 4Q9HA 1AO3A 3TR5A 1PSWA 4ZCSA 4Y1RB 1JHPA 4ZTZB 1XNHA 1FL9A 1WP4A 1A5SB 1PU2A 1DQRA 2CSUA 4TTAA 3K15A 2EERA 1F51E 2FXVA 4E5KA 5E9WA 1OH8A 4U39A 2FE1A 2HIAA 3DNFA 3JARB 1DB3A 3WBJA 5LLTA 3ASYA 3UG7A 4CIWA 2R62A 1DARA 1NW9B 4NNJA 2ZUTA 1GVNB 3GEIA 1A76A 2B20A 2JIMA 1TF2A 1KOFA 1RSZA 3VZPA 4M6WB 1J9ZA 4A92A 5IWAB 2PSDA 3UH0A 1Z0JA 4ZEMA 3SP1A 4KG7A 1ILEA 3A6KA 1FPMA 3LQRA 5L3RA 4F3YA 1IM8A 2EZ9A 1ZH6A 3T7KA 5FLXA 1XQ6A 1K4YA 1W30A 1JXQA 1PN3A 3KTOA 3O1IC 1G9TA 4QM7A 3ISJA 1OWMA 5BT9A 3KG2A 3ECAA 2VDUE 4J6FA 1E99A 1IHXA 3HV2A 4BXOA 4B33A 2FPLA 2WHQA 3HBFA 4WASA 1C8BA 2BMVA 3BMNB 2JHFA 5L9AA 1W0CA 4P4TA 4HFNA 3S5UA 3U44B 5LU9A 3O91A 4BWYA 4RE5A 2BKUA 5DBIA 1V5IA 3MELA 1GA4A 1MRSA 2ERCA 4GKAA 5AOVA 1V3QE 1WBBA 2A59A 1IOWA 3CRMA 2IIBA 3GW8A 3IQIX 4IMJB 4BZZA 1BOOA 5E7JA 2LWIA 3T7DA 5KYUB 4P4UA 5CB8A 2CZQA 4AJEA 3TOXA 4PG4A 3CLVA 1PTJC 4QUEA 3RC9A 1Z4LA 2VAWA 5AKLA 3T41A 4EG4A 1HE3A 3CRVA 1QE0A 4ZRNA 4EH1A 1DFIA 2OCKA 1HEIA 1QKJA 1SBQA 2CVFA 3T5BA 3W3AH 3COZA 4XQ0A 3T34A 4WBNA 4YCCA 1JI3A 3TM4A 1X74A 1QGDA 2G6BA 2JIBA 2NADA 3KYBA 2GAJA 3L8GA 4HDMB 4IZHA 5T4BA 5JRDS 4D9EA 3DZHA 1NXSA 4FEGA 3LVQE 5ALUA 1Y9ZA 4O1MA 5DM1A 1TLFA 3FGOA 4MKXA 2XI4A 3Q85A 2BFCB 4QNMA 2I71A 4ZO8A 2HFJA 3OCZA 4KTVE 1AUXA 1N1EA 3D31A 2FXIA 5I7OA 4ARAA 3DUFB 1FVOA 3HR4A 2YC2C 4L6CA 3N59A 4RA6B 3GLQA 1FYDA 4G4JA 3AHGA 1E3WB 4WLNA 5KNDA 1EXVA 1HDXA 5AO9A 2PGLA 2VYFA 4YV0A 3L8HA 1JILA 2IUFA 1SZDA 3G17A 4YRIA 3VPHA 4S1WA 1YR2A 3G49A 4D99A 1KYQA 2P78A 2P4SA 3VVCA 4ENUA 1I4DD 5F2EA 1Z06A 1CZRA 1TW3A 2PBZA 2O8EB 5IBPA 3QENA 3W5CA 1U8FO 1TVCA 2DFTA 3B3GA 1OAAA 3CNBA 3NS7A 3PXEA 4JJ4A 4UNSA 5JH7B 5LFAA 2IYWA 4A1OA 3I9V1 3VZBA 3A7EA 4MUGA 1QM5A 2UXDB 5HIMA 2QT0A 2Q0HA 4EB3A 4ZJZA 1T0UA 4REOA 3O4IA 3PNKA 2HPHA 1R6DA 3H5TA 4QDXA 4INOA 1JE1A 1OFTA 1E3JA 3WK6A 4F5YA 1X92A 2HD4A 3L7AA 4QJ4A 1JMVA 1TL7C 4NX2A 2C3OA 1ONOA 3IOEA 1FNMA 4P84A 1OFVA 5K3FA 3PENA 5JROA 3CU5A 1T5SA 1BE8A 1V8BA 3QU5A 3IOMA 3O31A 4J0QA 4Y1FA 3U9LA 2N46A 3IOCA 3LQYA 5ALFA 1MX3A 4A16A 1GCGA 4DCGA 3PFIA 1N8NA 1XLTA 1UXJA 5C35A 5J4YA 2ZJAA 3T5MA 3L0CA 1H4TA 2IKSA 1G5RA 1CUZA 3QMPA 5DX0A 4RETA 5AJZA 4Z4EA 5HIKA 2EFYA 2B1JA 4FT2A 1DQYA 3E2PA 5TS3A 1KI9A 3CB2A 4EW3A 5L6LB 5L4LA 5A5FA 4YAGA 3LYHA 4TTQA 2HA6A 4L95C 1QG6A 1R37A 3R6DA 1JIQA 4WD3A 3CPEA 1DXHA 2YL2A 4EYQA 1V16B 2A30A 2CXRA 2PV0A 3GCXA 3LD9A 3LDFA 4RU1A 1N2CB 4NBKA 1UM9B 5DI3A 5HOEA 4RYLA 2F9FA 4FDVA 1OV4A 4FMCF 4JXJA 1MPTA 1HZZC 4Q15A 4P4LA 1NF3A 4KMMA 2AMFA 2OFPA 4WJLA 1RZRD 3EUEA 3R0VA 1CZHA 1BA2A 4CGYA 2ZYDA 5ICGA 2B92A 3ZQJA 3ISVA 4GG1A 5C8VA 2FPIA 2I8CA 2V5AA 3OFSA 1QH8B 4Z0PA 3KELA 1E1CB 2JZNA 3SOZA 1C7EA 1W5BA 3W9YA 3NMUF 2DCMA 3LO8A 4KOAA 5B12A 4R41A 3GLGA 1C1XA 4TXNA 3GK3A 4OI4A 2X0KA 4R1NA 3TYXA 5HM6A 4XYBA 4BRZA 1U63A 3D7SA 3VOSA 4CTNA 2RI6A 5KSWB 4JHXA 4PPNA 1BJTA 3JPWA 4C4SA 4EB6B 2X86A 2Z8XA 5JO0A 4M98A 1CHDA 3DJYA 4B7UA 2JF0A 3RS4A 5C46F 4RH0A 2Q6TA 2JK1A 2YIMA 5KHLB 5KQRA 2YXEA 3EBLA 5DF1A 1R15A 1BTOA 4AS1A 5AW2A 4GPEA 2QR3A 2JIZA 3F49S 3QWAA 1YR1A 4F3KA 4LWZA 4G2NA 4II3A 3FZGA 1ODLA 3PNMA 1R5BA 1X1AA 3SX0A 5DX8A 1VYTA 5J2UA 1X7XB 1VPTA 4BJ5A 1GYRA 3K0CA 1POXA 1HEUA 1NX6A 1P0FA 4HZIA 4UHJA 1XX6A 4KDFA 1DAPA 1B73A 4O4HF 3W2GA 1CJBA 3K72B 3NM6B 2W2LA 4ZVOA 3TW4A 4R68A 1Z3CA 1S2IA 3MJTA 2ZB4A 1G291 5ESRA 1GT91 1KVRA 1OAOA 1DIRA 3FDIA 3IUQA 4XDZA 4M9UA 1XROA 2WM3A 1K8XB 4DQXA 2HIMA 2EEPA 3FCSB 1GQFA 3U7EB 2NM0A 2K5UA 2ZS8A 1D0SA 1V3UA 2P4HX 3NOVA 4MUNA 5DM0A 3SS9X 2QE7A 1DTWB 4KUGA 1CX9B 4A10A 2OMKA 3O8QA 4DUPA 4EKIA 5IG2A 1CR1A 2B7CA 3KQLA 2A86A 3T54A 3AMVA 4PSUA 5JAIA 2HUNA 4O4LF 3TSOA 1ZM7A 1JSCA 2CHUA 4EY5A 1J8FA 2Q49A 4IW3B 3W1EA 4CR7A 4RTRA 1KDOA 3I01A 4AULA 1QDLB 2TYSB 4H0CA 4I3HA 2BFEA 3ROEA 4ZK6A 3LFHA 1QPZA 3UH1A 2I6UA 4WDQA 2ZXUA 4QSMA 3SS7X 4GVPA 5E9JA 5KKCA 4G0OA 1SM4A 1ZHOA 1DC7A 3UJHA 1KR5A 5A7GA 4IH9A 1J2JA 4PTZA 3WGYA 4M36A 5C8YF 1XAHA 3ONVA 1CUDA 1VB5A 2QMHA 2HK6A 2JBWA 2QTLA 3L82B 4DMRA 1FLDA 2HT6A 4Q3AA 3CG4A 5J2TF 1EFLA 4KKXB 1MDFA 5F3RA 3UANA 3TLBA 4A0RA 2ZIEA 3OCUA 4PNEA 5FB3A 1R66A 2ALJA 4ZI7B 1Z07A 4A8JC 5CCDA 5TF4A 3ZY3A 4YRNA 1UJNA 3K6SB 4D5EA 2A94A 4KH1A 3RS7A 2VYQA 4K6CA 3HHPA 3ENWA 4H7IA 4M1MA 1NVKA 2OYSA 3QG1A 1FFAA 3F8SA 1KEUA 1L5FA 1SD5A 1X1SA 3DOHA 3O7WA 4UEQA 4X94A 5BXYA 3ZGLA 3I5AA 2CLSA 3RF7A 1FPQA 1U7DA 3KXLA 1QQ7A 1TU4A 3WMEA 4K0KB 2WABA 4PFKA 1JA9A 2CVOA 3AEUA 3SZRA 2OD9A 5ICFA 3PE4A 4HWTA 3MYYA 3DBIA 3IUNA 4DCTA 2FFBA 5DN9A 3JVUA 1QOQB 1V5EA 5SZJA 1C30A 3ELBA 4D9MA 4HDOB 3DNMA 3H9UA 1O0CA 2BONA 3LE8A 4MRNA 4QQRA 1BWPA 1L1QA 1TPZA 1Y3HA 1H42A 4JSRA 4QELA 2QM7A 1GUBA 5CGQB 3KK0A 4Q1EA 1X7HA 3EMVA 3BBLA 1VGQA 3VSCA 3KOWA 4QVGA 5C34B 1ONNA 3TXXA 2WJPA 3BXOA 3NAQA 2XB4A 4TWRA 4H59A 3VU1A 2OLJA 2G5GX 2O7VA 2VHQA 3FX2A 4EY8A 5T8KA 4G0MA 4CLDA 3BXZA 3EZ7A 1XHFA 1J2RA 4PM4A 3TGLA 2W4IA 1JIXA 4C0AC 1ZD4A 3JSXA 3OOEA 3DF9A 4V0RA 3D43A 3TPFA 2PUBA 1DL5A 1VHWA 2BM1A 4WZ6A 3WIVA 2OHOA 3IJRA 1RJFA 1S7CA 1NFFA 4WLVA 4IGIA 4OP1A 4PNZA 4WOJA 2TMKA 5LQDA 5JBQA 3JWEA 4GC5A 3KE9A 1E7MA 4LJYA 5FJIA 3AR9A 2ZM5A 4LVNA 2ADMA 2OO5C 4P5PA 4QC2A 5GIPE 5FWXB 5FQOA 1XV5A 1W87A 1OR8A 2HHJA 2I2BA 1QIGA 1JN0A 3IDFA 2V9CA 5FUMA 2R8BA 1WPQA 4KFUA 5IXSA 1BCRA 2VJMA 3E84A 3WYDA 5JC1A 1TM7E 2WTBA 4K9MA 5ALZA 1E77A 4F6RA 3KXPA 2Y1XA 3L9XA 4Y2RA 1WMFA 2PSEA 2QRGA 3V97A 2G4VA 4GU5A 3U3RA 4P3XA 3ZV7A 2QAGB 1Z82A 1QHXA 5CM8B 4Y1RA 3OJFA 4KAAA 4HEQA 4S3MA 5CT8A 5EEGA 5CDHA 1P73A 5IT9A 1OXMA 2VQDA 1ZA2A 2VVTA 4HGQA 2WUWE 4O3FA 2YVKA 3DDWA 3IVCA 3GAFA 1C3VA 4OD0A 8ATCA 4GR5A 1MORA 2X40A 5C1BA 3JARA 2HGSA 3EQ2A 1F9AA 1U7UA 1Y7HA 1QGAA 2C78A 5F9HA 1XLWA 4REMA 3V4FA 4WCFB 1XCOA 4M6WA 2QOEA 2YWRA 5EPEA 4BNVA 1ZS9A 4LNHA 4K8RB 4PRKA 2HXSA 2GBLC 5LSAA 4DHEA 3T5DA 1P4AA 2LDXA 4LF7B 3VO2A 1PFQA 1C29B 3ZX5A 3BF7A 5LQAA 3QPUA 4NS4A 1QP0A 2XV1A 3EMBA 3RVPA 1M75A 4BLOA 1QP4A 1OYYA 4D41A 1OWPA 4L9RA 4PZDA 3ORQA 1NF8A 5CW2A 2NUTB 3VNSA 1NN1A 5K0ZA 2NXJA 4GBGA 4GNRA 4WKBA 5FFMA 1AM4D 2H51A 4ID3A 4RS4A 1WHSB 5K0BA 3CVXA 1KNXA 4OHRA 4TTTS 2GPSA 3HUDA 5EGNA 3L0OA 4LQLA 4WRRA 2WAMA 3BMNA 4CM9A 4X62B 4FEAA 4RS3A 3R7FA 1ZU5A 2EKZA 4HH1A 3VH2A 2CBXA 4Y6QA 1ZNWA 3IB3A 3U44A 4Q9DA 1E2HA 5U1PA 3ZZUA 1EFHA 2YXPX 3IO5A 3IR7A 3KUXA 5DX1A 1KZ9A 2NQ2C 3SE0A 2V6FA 4K3UA 3RIHA 3WBBA 1Q2UA 3LOUA 1DWUA 2PRJA 2CL0X 1FP6A 2KMLA 2WJ6A 3PVCA 5KYUA 1RAHA 1SU7A 4NP6A 4OGWA 3GD5A 1RIIA 2Z1DA 3AY6A 4HVAA 3OLCX 2AMLA 5EESA 4ZWNA 1JMKC 2QVZX 3LDHA 5JWOA 1C9YA 2FPPB 1PNOA 4KSBA 4B2PA 3S2YA 3WAJA 2C5AA 1NI3A 2WE7A 1ZG3A 5DIZA 3LJKA 4XX1A 3FFWA 4HDMA 5AIBA 5IJ9B 2CMFA 5C1IA 2CDRA 1X1BA 2OO3A 3N28A 1KPGA 4UOZA 3KDAA 4F93B 2BFCA 4EATA 1NM5A 1HI9A 3GJ8A 3QHPA 4H7DA 5LQNA 1Y8AA 2H5IA 4NZNA 2AD5A 5HW0A 2ZUBA 1Q21A 1UF9A 3G0BA 4GX5A 2AN3A 4TRJA 3EGWA 5IJZA 3QP9A 5J9FA 3DUFA 2Q8PA 3OCXA 5LOVF 1VPVA 3AY7A 3O3CA 3OM8A 5IUKC 4AJKA 4RA6A 3DFUA 3KQUA 1I7SB 1NJ2A 1E3WA 2FUEA 3I30X 1EVQA 3K8QA 1C3LA 1V2HE 3IQGX 5F1PA 5DHQA 3NP7A 5L7WA 1M34B 1NVWQ 2OWDA 3OBBA 3PXXA 1VKZA 4Q9NA 3ZCUA 2XZOA 1DUVG 3IKTA 4B3FX 2QUIA 3NDPA 1O6GA 2M6RA 4KV9A 4MA5A 3JQBA 2ACEA 4X60A 5JAUA 3GN1A 2O8EA 1VE9A 4BY9E 1TYDE 3COYA 4DANA 4OHVA 3U4QB 2AQHA 4RIIA 1A4XA 5JH7A 2QBYB 2Y1OA 1G7CA 2WSIA 4KN6A 5ICSA 2ZCJA 1NBIA 3CCBA 2PANA 3CSDA 3FWZA 4HEHA 1YXMA 3WXBA 4F7WA 3IPRA 3BPSA 3NRBA 2JDID 3SHWA 2QP9X 3DXYA 3ZKAA 3KOOA 4RHFA 4IMRA 1GPLA 3HB7A 4OGLA 3S1LA 1UBLS 3OM9A 4I5FA 1ZD9A 2WAAA 4ADSG 5KUTA 2ZS9A 5GJCA 2IV2X 2W6ZA 2C0QA 1YGPA 1SIUA 4L75A 5TF0A 3WSWA 4YR9A 4FTWA 3NPMA 1PQPA 3G9TA 3LOQA 2BHRA 1G66A 3MUOA 1BO6A 1FXWA 1T91A 3Q11A 1FFCA 4X7PA 2LV8A 3THOA 4A7PA 2VZ9A 1AS0A 3RR2A 4M8NE 3T5TA 1QV6A 3LVRE 1UBCA 1Z73A 2Q2WA 3HUEA 5IVDA 2A3RA 2VN8A 3FZYA 1Y5IA 3M83A 5JIBA 4ILKA 1JH9A 2Q3EA 5F7OA 1VLHA 3RVJA 4A8TA 1YS9A 1X8KA 1KEEB 1QF9A 1QUEA 1CPYA 1CIVA 2Y92A 4YCBA 4GVXA 1L7EA 3EYAA 3VPGA 3ROXA 4EMSA 2H2DA 2WU4A 3KKEA 4HI0E 4B4KA 4AN1A 4CI9A 3IUSA 1G8YA 1SUCA 4Y3UA 1V16A 3GAMA 3GJYA 5FOTA 4FFSA 1N2CA 3LL7A 1UM9A 3O9ZA 4XQCA 5LB4A 1ZGHA 4P7KA 5ANRB 5FI5A 2E4AA 1RYFA 1RIFA 3GD7A 3PFBA 2CE7A 2ZJBA 5LLDA 4JWTA 1Y34E 5IBRA 3WV4A 2ZVPX 4XLLA 4E32A 2RHJA 4F11A 2ZANA 2FUNB 3G2JA 5KTMA 3N53A 4AWBA 1JR2A 1QH8A 3SBDA 1E1CA 5AK3A 2HHAA 2XKBA 5ARCA 1QX3A 3SHTA 1T5DX 3MMPA 5B57C 3L43A 1UBKS 4KWTA 4TV8B 4C21A 3P2JA 4AC9A 1EZZA 5CVEA 3WBFA 1CDEA 2OB2A 3JWJA 3WRXC 4LSWA 2L42A 1UPTA 3ESDA 4W5TA 1E8NA 1Z5WA 2B1IA 4KE7A 3F6RA 4PIPA 3W5IA 1XRQA 5DHRA 4N7MA 4EB6A 5B6PA 2NP6A 4EHIA 1O5IA 3HXMA 5DNEA 4FGZA 1IIRA 3L8FA 5KVAA 4L08A 2ZDHA 3OSUA 1L6IA 5HJ5A 1OXKB 1U9ZA 3DS8A 4R3WA 4FXPA 4RQAA 3TINA 1B00A 3HLKA 3PFCA 4Z9XA 5JS2A 5LMUB 4AY6A 4KTTE 3CLUC 5CH8A 4D3DA 4DR4B 2G5PA 1ZI8A 2GLXA 1VBMA 3O93A 4MINA 4QL3A 4KPUB 1APBA 3SVLA 1QVRA 3T3NA 1X7XA 3GUVA 2NP7A 4XQ9A 1Q0HA 3N7UA 3QUSA 1SHZA 2ZLBA 5G1OA 2IP1A 4FHEA 3VPBA 2C03A 1GAXA 1GU1A 1UP7A 2TECE 3C70A 3WR5A 2ORED 5BUQA 3B48A 3U3JA 3UWKA 1Z36A 3CPJB 1NU8A 3JQ9C 4BVBA 3VV3A 4QO8A 1G6KA 1P2UA 1MH1A 2VL7A 3PCTA 2E4WA 3GFFA 3UAGA 4LRYA 4E1AA 1WCYA 2XMPA 1UH5A 1LF5A 4QQNA 3L7CA 5E7IA 4KVAA 2A84A 5HQ3B 5LP1A 1RBMA 1YQUA 3R09A 1DTWA 1K6JA 1OI4A 4ZMBA 2AT1A 3EQ8A 1GAEO 4BO8A 4K9QA 3V4PB 1N3YA 1J06A 1EUCB 1ZX1A 1DG3A 1XEWX 4JJAA 4UEJA 5KO2A 3LQ2A 2C5FA 4DY6A 4ZYXA 4M1QA 3PQ5A 2B5VA 3AEYA 3A2LA 5JMOA 3DBOB 5KJ6A 4TMVA 4PTLA 4L4UA 2DPGA 3KB2A 1P9LA 1IWBB 1KJYA 4XEHA 2X3FA 1FYFA 3HO6A 1A5BB 1JBQA 4MOWA 4D7AA 1DC8A 5SZHB 2W37A 1HLPA 3PC4A 1E9DA 4OHMA 3ZY2A 1Y4UA 2XZTA 2R1ZA 3I1FA 3SFTA 1HE5A 4EAAA 3OE7D 4RVCA 1KMCA 1ZH4A 4LHEA 2OAQ1 3NBUA 4I1VA 5H4HA 4PCVA 1D9ZA 3ZGZA 2R6DA 3IURA 3OOWA 3B3QA 3C6KA 4M0EA 1NA5A 1YUMA 2I2FA 1M8JA 2EX4A 3OPMA 4NBVA 4HH0A 3G9QA 4BNIA 3I8OA 3GJ6A 2G04A 3CS3A 3BH7A 3LPLA 1LY1A 3QE9Y 5ECDA 1EM8B 4L76A 1SU4A 4ZI7A 5C32A 1CD5A 4QPJC 5AFSA 5DRYA 1NHWA 2ZBVA 1ENOA 3JQAD 1ACLA 1LPOA 2AG8A 5IAAA 2Q3MA 4ID9A 3K6SA 2AOWA 1XYYA 3HC7A 3TG2A 4WKNA 3EPJA 4LDPA 4C88A 2IT1A 2PXAA 3FPAA 1VE3A 4G9BA 5HQJA 1JHMA 2XQGA 4PG5A 3FSEA 5EJ6A 4QBHA 2RB5A 1P2TA 1O8BA 3MBIA 3NM4A 4AX8A 5A4DA 1QONA 1X6VA 4FWIB 4NCKA 1FDWA 4FE3A 3ONNA 1S01A 3PDIB 1S0UA 5BNZA 1N6LA 2J67A 2MWMA 4NKRA 1QTNA 4OAPA 1QVWA 4Q6WA 4QG7A 2QHXA 3SX2A 3ZNNA 2OCAA 3ZE7A 3RPEA 1B23P 3DGFC 2FCAA 3E70C 3LGAA 3STXA 1CQJA 3TAHA 4EG8A 3HJHA 1G8MA 4XAQA 4XM0A 4YFYA 1E2EA 3NGLA 1QYDA 1U28A 2BCEA 2OCGA 4YP7A 3OCCA 1XDWA 2YFHA 3PD7A 4ZU6X 3RAPR 1KQFA 4D4LA 2J5RA 2PLRA 3K5IA 1XCMA 3ZY6A 4ZVNA 4JOQA 5ALMA 2IUTA 1PNTA 1PR4A 2GCOB 4OHZA 3UJCA 3VHXB 3R3JA 1T15A 3FRHA 3KOYA 3OJLA 2BGWA 2GJ9A 2ZIGA 4LV8B 3GIDA 4DXHA 3KQNA 2H29A 4DDUA 1ECJA 4TXMA 1JEQB 3B7PA 4JN6B 3UF0A 2C4MA 4DIDA 2BPOA 5EIBC 4BMNA 1SC3A 5F73A 1DWPA 4WPGA 4ARZB 1DZIA 2A0FA 1SG0A 5DEIA 3OKAA 3JVDA 3AUUA 3G68A 3U48A 3U60B 1P8AA 2XRYA 4X71A 1Z6YA 4DC0A 2YW2A 1HYEA 5FWXA 4JUDX 3IYLW 2CZCA 5HHTA 4ESVA 1SFRA 1H2WA 4NCBA 4I9HA 2CNLA 5CA1F 2GCNA 3BE6A 4G89A 5GZ6A 2LRHA 2JIQA 2JI4A 4JB3A 4LE1A 3L0IB 2HCFA 3FJ1A 3N70A 4QPDA 5KTOA 2YWFA 1F2TB 3IQEA 5DYYA 4C06A 2JGDB 2QAGA 1KMQA 4Z1MD 1IM5A 2BEKA 1ZNZA 2GNAA 5JRJA 4HXGA 3TDMA 2J09A 3PDUA 3MTJA 4JBGA 1Y6GA 2B1GA 4XUDA 5FBRB 1KGSA 1WNFA 3WA7A 4BNHA 4MMYB 4PZAA 5K0CA 3E8XA 4FCWA 1F2DA 4MW9A 4HRYA 1P75A 5LMNB 3FSGA 2XCUA 2GFQA 3T3IA 4D0LB 5A4JA 2PUDA 1CVLA 5KJCA 5H0IA 3S81A 1LX6A 3QE4A 1M6EX 3G2QA 3QLUC 3D7LA 3EZ6A 4WCFA 4TYYA 5HTOA 3I92A 4OBEA 1IB0A 5F35A 1PJ3A 3O2NA 1PEAA 3WGHA 2GRJA 4BNKA 4FU0A 1QFJA 1YDGA 2G3YA 2HFKA 5JRZA 3W5DA 4OIMA 3TM5A 3FWPA 2F3TA 1ZY2A 4X8OA 1SWWA 2QYSA 5B1EA 5KYKA 1WDKA 2A4KA 1E1MA 1J39A 2X1MA 2HCTA 1P74A 3FNEA 3JYLA 4D8UA 2ZBDA 2NUTA 3JD4A 3VZSA 1PFUA 3QJYA 1O58A 3SBOA 4K03A 2YMMA 2WIKA 1EK5A 2H06A 1XCJA 2JKZA 3DVRX 3IP6A 1E0SA 1WHSA 2WM2A 3MGGA 2O2SA 1Q16A 4EHKA 1MUUA 2QX8A 1TK3A 5BWOA 5DXAA 3PXBA 5A7FA 3DTYA 1XPOA 1NYRA 3PJFA 1ZAKA 3WQRA 3IA7A 1PV2A 1U65A 2RE8A 1Y3AA 4QHSA 4BFUA 5AP9A 4NARA 1RRFA 2B99A 2HY7A 1D9XA 2I0FA 3PGVA 4R2JA 3TNFA 1DCKA 4BU0A 2ONCA 4X24A 4XRRA 3QWFA 3LKDA 4KU4A 4JQZA 4O1IA 5DK4A 1M2NA 4PQRA 5GONB 3WFZA 1E0DA 3HGQA 4DMCA 2QPTA 4JX8A 1Z83A 2CHQA 5LUAA 1E9EA 1MC8A 1KERA 3OEHD 2PKWA 5AKXA 2FPPA 1Q3TA 1S2NA 1DKUA 4X20B 3FR8A 4BZQA 1IY8A 1M1XB 2OBFA 4POAA 5KYWB 2EHDA 2HHHB 3QVXA 2J5KA 1NL3A 1PYDA 2FYTA 5IJ9A 3VNQA 1D5CA 1TM5E 3IJEB 4FDTA 4LRTB 1NVDA 3UJ8A 1THTA 4B31A 1CJMA 3EQ9A 4LMAA 3RYIB 4NU8X 4UCFA 3L18A 1QYRA 4J75A 3RBXA 4HF7A 5J47A 5TVGA 1RI5A 3BMOB 3D9QX 4UVEA 1ZQ1A 5C4MA 1WW3A 1S2MA 2IZ5A 4J2TA 3TIGA 4R4JA 4Y0AA 2FQQA 1TD9A 2QXTA 3GNLA 4MAMA 4ZO4A 5T57A 2J3QA 4F0JA 1IVSA 2PZ8A 4BC1A 4YRKA 5FV4A 2CV0A 2JG3A 3TW6A 3KAKA 2JLUA 5FA6A 1PBNA 1ZSVA 1M34A 2F8MA 2RHHA 3MSCA 9ATCA 1G0NA 3QPBA 4UXJA 3HGTA 4F5WA 1BRMA 4F2DA 1D2AA 1N8SA 3K1YA 3W7BA 1H9CA 1MB2A 3L1IA 4HSEA 1V6CA 3U4QA 2QBYA 1MJHA 2B4YA 2YIVX 3DBLB 4UHBA 1E2GA 3OZ7A 4R1UA 3RSGA 3TL2A 4J91A 5CLQA 4DCVA 4EPTA 1HORA 2INGX 3I5UA 2WFMA 4H27A 3TAUA 4ZI3A 4FGKA 1OGJA 4JU9A 1UBOS 4MRMB 2RCYA 2AN5A 1AK1A 2D8AA 2Q9AA 3ZLJA 2F4NA 3LOPA 2YFYA 1D2GA 2B3DA 4B8YA 5M7EA 2Q5EA 4Q18A 4YO7A 5I8ZA 3N3AC 4ZQBA 1ZMXA 2Q5QA 4I4LA 2DSTA 1CY1A 1Q0ZA 3O74A 2LCFA 1R7RA 3QEOA 4HFRA 4ZPJA 4BN4A 1KAHA 1VYVA 5JANA 5IJAA 3UC9A 3BS4A 3REOA 5AKEA 5CVCA 3G0DA 3PJEA 3LP6A 1ZITA 5ILGA 1T4DA 3FUXA 1P8JA 2J30A 4ZYWA 2VNHA 2D5LA 3MWKA 3O83A 1GPAA 2Q5HA 5B53A 3FMOB 3WE7A 5LKRA 2QL5A 1KEEA 3KQKA 2UZ3A 4PSKA 3HO8A 3J7TA 3MS2A 4YFVA 1PL6A 2G88A 1Y7LA 3D7KA 3FM9A 4L0MA 2WWGA 3SYTA 4DQUA 4XVUA 2GVZC 5EJIA 5BN4B 4RW0A 3E81A 3VOAA 3W2EA 4GW3A 4WL0A 2EVWX 2BV3A 2Q6OA 1PG2A 2YN4A 3EF0A 2C9BA 4Q7LA 4PANA 4E21A 4OXNA 2ABWA 3JYHA 4YMHA 2HCJB 2XE6A 5DGXA 1FFGA 3HRIA 2OFWA 4KNVA 4D2IA 4EVIA 1EVLA 4JI0B 5IX8A 2BD0A 1PEKE 2WSSD 5TGDA 1L8QA 3GLIE 1H4QA 3ZS8A 4RHTA 4HAWA 3HEAA 1NXPA 3M6WA 4OSOA 4G5QA 2JK0A 4WK2B 2RGBA 4NMHA 1QUFA 5FUBA 2YIJA 4A8JB 3L40A 2XF8A 3TFWA 5DKFA 3QVLA 2JB9A 4TV8A 4AZ3B 3SC4A 1AB6A 3AVTA 1OD6A 4JBIA 4C0LA 2O8VA 1W2HA 4UBOA 3ZDZB 4C7OB 1M5UA 2FN3A 4RJLA 1ZN9A 5FTWA 5ALHA 4CMBA 3JQEA 5C5EA 4R0VA 2AVDA 4K3VA 4NNOA 3JYPA 2DTXA 1S5PA 1R6XA 3G85A 4FB5A 5IANA 3HU3A 4B9AA 3ZWYA 1KH1A 2FGKA 2VOJA 1GSOA 1JXMA 3CVYA 2VXBA 1R9NA 3GEMA 4KYUA 1LS6A 4QFCA 5F76A 4RM3A 3PGLA 3W5SA 4KQEA 2OD2A 2MIIA 2NZUG 3EGDB 4HAUA 5GPBA 1EWYA 1Q14A 4R81A 2QDKA 3UK6A 1T5LA 5FR1A 4HNQA 1MO4A 2Q45A 4JYMA 3NUZA 4Y9UA 5ESDA 5ITZB 2DUMA 1TEVA 2B98A 4GL2A 1QOZA 4LNUB 3QPDA 3UGJA 4KPUA 2I2XB 1ZOOA 4F71A 1W75A 1CERA 1TZJA 4H3VA 2VEOA 3ZLVA 3S3TA 3C7AA 3M70A 2FPRA 1DADA 1JEJA 3BHMA 4EW2A 4EGQA 5K8LA 3O8BA 4S1PA 1B74A 3Q7SA 4G09A 3DDCA 1CRLA 1XP8A 5B6IA 3CX7A 3ANMA 3OQJA 1PZFA 2GCIA 4UVIA 1XMOB 4Z4IA 3LXUX 4GZ6A 4HWOA 3DQPA 5TSDA 1ZVVA 2M1XA 1XRMA 3OCYA 3QMMA 4DNOA 2PGXA 4IDHA 4S2UA 1RRMA 4L3WA 2CHEA 3STHA 2I9PA 1L8OA 1G98A 3NTVA 1GQOA 1K27A 1L7BA 2VUUA 2VTVA 3EQZA 4R6WA 5HQ3A 5K5EA 4U2DA 4BYMA 2C00A 1US8B 2GNOA 2MMGA 3GJTA 2FSUA 2XA1A 3G89A 3O1LA 3KQPA 2QY6A 4Y9DA 5AHOA 1EUCA 1H4VB 1MTZA 1UMKA 3LRTA 4WJKB 1DTSA 4IH1A 2QL9A 2QRZA 4MLPA 4RO0A 4AUNA 5ADHA 3GU3A 5HM8A 2FWRA 5JXGA 1EHYA 3EMDA 2D62A 1NOJA 2JJMA 2XAAA 3GFRA 3VYVA 1PR3A 5AW8A 4G4SO 1TKRA 1RQ7A 3BKXA 3HBJA 3I8XA 2GJSA 2PR7A 3CGGA 4Q02A 5K6AC 2YVQA 3F3KA 1AQYA 3NV9A 2IIVA 3DLPX 4E94A 1USWA 3IVAA 4FFWA 1KH2A 1L3IA 3IE2A 4IKEA 2VJYA 4LJLA 3U0BA 3ZE9A 4KBGA 3FNGA 5CFQA 4G4GA 2DX7A 2VAXA 2SECE 4DABA 2VRCA 1NBME 1F9EA 1NIPA 2GLUA 2NOAA 3BMXA 4WY8A 4EFDA 2CNWD 3DLAA 4EI7A 2ETXA 1VDZA 4QFBA 4FCVA 4HPJB 4FKZA 1E3TA 3UWMA 1RYZA 2GA8A 1EM8A 1AS3A 4U3JB 4B3XA 3BBPA 3RYTC 4MR8B 3LQ1A 5DMHA 2JGIA 1OJ7A 4M60A 5ILOA 2OKGA 1NSYA 1Z6ZA 1YBFA 1V1RB 1NVBA 2FDCA 5ITSA 4YREA 2NNWB 1GZ6A 1SBZA 1JU9A 2R1TB 3HB5X 4B3JA 1LI5A 1HDIA 1KOLA 3A2MA 3H2IA 3MRVA 4OB7A 4KLZA 2HSDA 4DGQA 1XPRA 2AKYA 2IY7A 1NUUA 3RRNA 4J03A 1GCAA 1Z25A 1P60A 3R6LA 1XE3A 4G01B 1VPDA 3D6VA 3QLVC 3CC8A 3IESA 3SIWA 1IVYA 3MINB 3PDIA 5M3BA 4FWTA 1F12A 1NVGA 3VR6H 4YRPA 5TGTA 5K3OA 4QXMA 4K9RA 2AXQA 4RSRA 2NO9A 3NUQA 1J1UA 4RMGA 4UUMA 1GKLA 2GZSA 4KKVA 5ALOA 4YYEA 2VP6A 5JS6A 9ABPA 3KB1A 2IF2A 2CHGA 2JGKA 1SCDA 4F84A 5EI5A 5JD5A 3ZDBA 4ZYZA 1LV7A 4E33A 1E2PA 2PL9A 1TI7A 1WLYA 2L82A 1OQAA 2GCOA 3VHXA 2FR0A 5EVJA 1DUIA 2CWWA 3WLAA 1ZMRA 2OPBA 4G6ZA 3AVVA 3WIBA 1TJPB 3CX3A 3WHIA 4DOMA 3RTGA 3UGKA 3L84A 3VYSB 2FDRA 1JEQA 4CM8B 1T9BA 4UKDA 1AGYA 2NYUA 2P6NA 5A6VA 3NEYA 5CFRA 4G2TA 1PTJA 3Q1LA 5HWSA 1VYUA 4DHWA 3LL4A 5FV7A 2BM0A 3FSRA 3HJRA 2P2SA 3NRCA 3QFFA 7ABPA 4ARZA 2WIJA 3VNVA 1YDHA 1XL1A 1U7TA 2HO4A 4BECA 3EHDA 2A4MA 5TRTA 2PMDA 3RUEA 3PC3A 4A4DA 2DBYA 3R5KA 1NUQA 4CLXA 3AUJB 2OG2A 2PUWA 2MYTA 3H5IA 5F9MA 5K3EA 1G7RA 3BIWA 4B2YA 4HV4A 2JW5A 2IS1A 1IUKA 2W9XA 4Z86A 5DCLA 2X0FA 3S6JA 7YASA 4MGEA 4RK5A 3VOBA 2GBCA 3AI3A 2I3GA 4LDQA 4WXRA 1CF4A 2FRDC 1ZNQO 2ID9A 2V0NA 5EJ5A 3W5UA 1CZKA 1F2TA 4KGDA 2QVBA 2W8ZA 4PC6A 1FYEA 2JGDA 3BILA 3OX4A 4CCWA 4XR9A 2VHVA 4L50A 1FP1D 1Y98A 1E2UA 1SK9A 1E6WA 3GRRA 5TY0A 3LLCA 3UHOA 2FI1A 3KZVA 3G23A 1BGWA 1E7SA 1F6BA 3BE8A 1W52X 4JLJA 4RIFA 5T4EA 3KB6A 1IBCA 4EJ2A 1JKFA 4CGZA 3JATB 4FYJA 1LI4A 1Z8FA 2PSJA 4OP2A 5CYGA 1PJRA 4HS4A 2PLAA 4YCLA 3HXQA 3AX6A 3Q3EA 2V7QD 2F1HA 3HB9A 4E22A 4OQNA 3LA6A 2AN1A 1QFZA 2E37A 3R0JA 1USVA 4R9VA 4DCCA 1KJ8A 1ZNYA 4C04A 2DKOA 2X7HA 5F2NA 4D9CA 1DV2A 1U7ZA 2C7BA 4EOGA 3OZWA 1Z15A 4G84A 2CLIB 2PWPA 1V2GA 4M8IA 3I6QA 3ZE0B 4BNNA 3FDJA 2Q3LA 2JGAA 1KH3A 1T10A 5DXFA 1MX5A 1PYOA 5LN1A 3EMKA 5FH9A 1OAKA 2GN9A 3GG2A 3H84A 2VP9A 4RD1A 1YQWA 5KNBD 1DQSA 1E0JA 5KNBA 2VP0A 1WUYA 1WXQA 1YZNA 3O3NB 3O8CA 1K7CA 3WKCA 3FKJA 4RXUA 4EFMA 1ISPA 4EARA 1K63A 2WD9A 4DBLE 3P0JA 2XZLA 3K5WA 2GEDA 2FHSA 4K26A 2WTUA 4J07A 1L5WA 1M6HA 1NFRA 1Z7WA 1BGVA 2MSKA 3G88A 1SD1A 3MVEA 1S8OA 1Q1QA 2CXXA 4TPKA 2ZETA 3D3QA 2GFIA 3HXTA 4XPIB 3CLTC 2O9JA 5DB4A 1JXOA 3F9IA 1RWQA 4IH4A 4MQ5A 4YDHB 1BW9B 2WT4A 1XZKA 4KZPA 3R3YA 5GONA 3UA4A 4PAOA 2H4HA 3QVUA 1ZR2A 2GD6A 5F51A 2VWPA 1HT2E 4N03A 4YAEA 1XRPA 1BXGB 1HZZA 4M1ZA 4AKGA 1NXQA 4X20A 1QWSA 1KQNA 2PAAA 3O1JC 3C2QA 1DIBA 2O7QA 1QX4A 1HZJA 4OHFA 5KYWA 1GL6A 1XQXA 3FN4A 3G59A 4MP6A 1YZLA 4JEIA 4ZOLF 4HNSA 3MTGA 5A02A 2J3JA 2YRWA 3R0QA 3RYIA 2QRVB 1HT3A 1ADYA 2BGUA 2XF2A 2C95A 3BMOA 2PX2A 2B78A 1PCXA 4H1TA 3FYSA 4I5GA 1JKJB 1THGA 3IULA 1AXRA 1USKA 4CKEB 5HIAA 1YS7A 5K8TA 1ZFNA 2D5BA 5JTTA 2XYRA 4TMTA 3UTCA 5BWCA 3EXHC 4PLCA 1EP3B 3INTA 4KXWA 5GM1A 4DV7B 5AI5A 2PWYA 4Q3EA 1Z4PX 2HYIC 2C04A 4X85A 3PGKA 3PFHA 3R6GA 3TTUA 2K87A 1PUXA 2WB4A 4M86A 4MCHA 3L04A 1B15A 4HDSB 3DBLA 3ZJVA 3OWOA 3CTPA 4DLAA 3S8EA 5CFZA 1W0KD 2A5FA 3INNA 1T2UA 1Z6PA 3IQFA 3KTAB 3VV2A 1TCBA 4MRMA 1JFLA 2O4CA 2WP8J 2REQB 3BMCB 3CVOA 4Y1GA 4OHWA 4YJ3B 2NZVG 4QM6A 1OTXA 4KLRA 4G1UC 2RHDA 4MWTA 1DAFA 1LNZA 3OPYB 3ECSA 2X2FA 4L7QA 5C8DA 1C8KA 3U17A 4D26A 4Y2TA 4XD7D 4OQ4A 1DEHA 1FRFS 1Y6JA 2PYZA 4JA0A 4MHSA 1IHPA 4XB6B 5H68A 2D3TA 2YV1A 3L7LA 4G0WA 3HJGA 1PZXA 1Z5VA 1GSIA 3RHFA 5LWQA 4BMPB 3NI2A 4GP6A 3HQ4O 3PC6A 1GUDA 4IUYA 4M1WA 3K31A 4MI3A 1TEHA 5FBHA 1ZMTA 1UPFA 4H7HA 3DD1A 1ICEA 4K6GA 3WJ7A 1DAHA 1RI2A 2YV3A 1XUOA 3EZYA 3H2ZA 3E4CA 4L9SA 3D6HA 2H4FA 3MOSA 2ZZKA 3INYA 4XWGA 4R01A 4CXMA 4KUEA 1NTOA 2X1HA 1XMPA 4V0NA 3ANXA 3KEMA 5BN4A 5IVHA 2DHQA 4RX1A 1K3FA 3GAZA 5L4SA 1GGKA 1NATA 1OT3A 3TH5A 4PX2A 1AKWA 1OC4A 2HK7A 1YL5A 1KC3A 3HL4A 2G25A 4UDOA 4EM6A 3B6EA 4M0CA 2HL6A 3VPFA 4Z53A 4JQOA 2XWPA 4JP2A 1LB1B 4JZKA 5JVDB 1Y48E 4XGNA 2MSWA 1TKBA 1BSVA 1DJPA 5FRDA 2YWJA 1GPDG 4O0LA 4FILA 4OB8A 5KAPA 1CFJA 4G0YA 3FAKA 4A8JA 1SQGA 2I6QA 1ST3A 1FNCA 3EFBA 1S9DA 4AZ3A 1O6FA 5DM2A 2J5XA 2QRPA 4TVSA 4C7OA 5LD2C 2VJKA 2ZRGA 3OUUA 3T1OA 1AU9A 2RIPA 3X2SA 1R00A 4Q1BA 3GBVA 1BAPA 4S04A 3UUWA 2J31A 4PWYA 3QNWA 2V6JA 1XRSB 4YP9A 4BYGA 6ADHA 2OCIA 2FFRA 1G4AE 1S9HA 5AK0A 1SKAA 3R7DA 1VLJA 1ND6A 1RBYA 1PTKA 3EGDA 4BMSA 2JI7A 3SEAA 3B5IA 2VNIA 2VNSA 3BHIA 2GVDC 1OI7A 5ITZA 1KZHA 3HLYA 2MHCA 3AB3A 1QR6A 3BHJA 4LNUA 4YP0A 5AVKA 4UUPA 1MXHA 3E6AA 1AGXA 1GZ7A 2QPOA 3I83A 4EG6A 4BVHA 3QY0A 5FNVF 2O06A 4YI5A 3T9EA 1YB5A 4BLQA 2DU8A 2X19A 3IV6A 5C1DA 1KZ1A 2X9GA 4RZXA 5EWLB 5CDFE 5BUCA 3QXCA 2FA9A 3BXHA 3EDMA 1IOLA 3H2KA 4KQ6A 4D02A 2EIHA 1AKMA 5J1TB 1V7QA 1UADA 4W6ZA 2H6EA 4DNXA 4WXYB 4IIJB 3OM0A 1JYFA 4QGHA 2ACWA 2Q0QA 2XGGA 4X91A 3ND7A 2FX3A 3OHPA 5CVDA 1ZGGA 5EHNA 4PLWA 3RFVA 4A0GA 5KPJA 5KNDH 5SV2A 3SEFA 3SZMA 1US8A 4TXLA 1B0ZA 2KPOA 1RM0A 3V6LA 1U6JA 2IYTA 3WL6A 2MYNA 2DG2A 3GFSA 3HYLA 4LN1A 4AXBA 5GZ3A 2G09A 2WTAA 5JMPA 5L53A 1D3AA 1XZ8A 1YVEI 2OO5A 2XCLA 1CEYA 3L7YA 2AX3A 1FFEA 4HD8A 2A1TR 2BLNA 1GYQA 3ZHZA 4GVLA 5CLFA 4B48A 1YI8A 2ZATA 5AHRA 8AT1A 3QXJA 1X94A 4PZCA 3QQPA 4V24A 4Z99A 1V45E 5B4VA 3EWIA 3Q15C 2DFLA 2DWCA 3CE9A 3N2NA 3PEWA 1OW3B 3E0XA 5CA0F 5KJ1A 2Q41A 1PZGA 3MJRA 1CZUA 1P3DA 3OEWA 4TKZA 1CRWG 1OU0A 2XITA 2Q1SA 3GGSA 4IVQA 2DH5A 4KUHA 4HNVA 5I4CA 5ICMA 3BGOS 3OD1A 4MWOA 3PP8A 5TT1A 4U3JA 3MRTA 2IYAA 1YQ9A 4KQ2A 3O9MA 4MR8A 5D3QA 1JJ7A 4U2GA 5E6SB 1CEQA 2BWJA 3WMRA 1NULA 1V1RA 3PXDA 4M55A 4C0QC 3N0XA 1M83A 4DBLC 2R1TA 3UZUA 1HFKA 1NZFA 2MDTA 4GMHA 4C22A 3PNOA 2ZTHA 2EP7A 2GBLA 4MW1A 1UAAA 3VPSA 1FFSA 2Q07A 1L5HB 4GMDA 4LWOA 1GEEA 1EX1A 1N92A 1B43A 5CR9A 3I2JA 1T3ZA 4EGJA 1ESZA 1JVSA 5JASA 2W83A 1DAMA 5P8WA 2FNAA 3MINA 1XZCA 1SKBA 5IW8A 4EYEA 3KQSA 3L4KA 5EIXA 1I7LA 2FLKA 3PXUA 4KRGA 1DOZA 2ZSFA 1GTL1 1V8OA 1JR3E 3NC1C 5DNAA 2WKPA 4CFZA 1SVIA 2VSQA 2YW9A 1EWVA 2GPYA 2PX4A 3K1AB 1E2BA 1QB7A 5D87A 3E18A 1XU7A 3HA7A 1P4HA 2I2DA 3RFXA 2UUCB 4YT8A 2C2MA 4TRRA 5FORA 1P0MA 2AK2A 3EA0A 3C6XA 5G1PA 2ONZA 1Y5RA 3V00A 4A0FA 2HJHA 2PCJA 4ND7A 2VJOA 2PZGA 1KYXA 4CM8A 3EEBA 1B76A 3FVRA 4FWBA 5B1HA 2HJRA 4IPTA 3U31A 1QPGA 3RAEC 2D0DA 4FYWA 4OJKA 3THXB 2K7ZA 1NKVA 1E69A 2JKVA 3DZCA 3N0TA 1VRCA 2VHYA 1ZJZA 3LYLA 4JOBA 3MS4A 5CM9C 3UMFA 4I4NA 4PCUA 1SVOA 2D2VA 4CTKA 2EKBA 3ANLA 1CKEA 5TNXA 1WV0A 3D3NA 3HB0A 4DDWA 4MROA 1H2XA 4XVRA 3VYTB 5HUQA 1DBWA 4KDRA 4XTRA 3RE1A 5I9NA 4L4XA 2G7ZA 2XMRA 2I65A 4B71A 4UVHA 3PRYA 4JB0A 1RE0A 1SHLA 2GVNA 4MJ3A 5LMCA 1PG0A 2J6BA 4OKNA 3LT0A 3WTCA 5L3SB 3CLKA 4KQKA 1V37A 5JCJA 4IIEA 2B83A 1A8QA 1GQYA 3I4FA 3AHFA 3OQBA 4MVJI 5IJWA 1CNFA 3O4JA 3EVDA 3ESYA 2PQMA 2AB0A 1CP2A 3R4CA 4WI1A 4TKLA 2FW0A 1FMTA 4EYOA 1Z0KA 2OXEA 4P93A 3D1JA 3IAS6 3JATA 5ADVA 1KKMA 1L4FA 1OWLA 4XIJA 1UDCA 3EIFA 3CNEA 2XHEA 4H6XA 2RH4A 1T1EA 1Q50A 1U0JA 4PSCA 2FEMA 4Q7JB 4AF8A 1QK3A 2W22A 4ABTA 1M8KA 3MJSA 3K5PA 4Q4HB 4ZA2A 2ZWIA 1R16A 5TMBA 3ZYZA 4QNRA 4HLDA 3AETA 4E2YA 5CDGA 3VI4B 3IIJA 5CK4A 3R7LA 5IMSA 2Q46A 4GUDA 4I6GA 5HMLA 4BO5A 2HMVA 2XKJE 3CXRA 4J7XA 4J0DA 4DTIA 1ZIPA 1EGAA 2FVXA 2O1XA 4F91B 4AQ7A 2P1RA 3ESQA 1IZYA 2CGEA 1K89A 2YH2A 1MC4A 3DE6X 4ENSA 4ZU3A 5LYJF 4H60A 4LZWA 3RNOA 3FGPA 1GR0A 3ABQB 4F4DA 1DPFA 3ET4A 4U4AA 4KI0A 1FDVA 1Z16A 5T6MA 2A9OA 5EZQA 3F67A 4BE4A 4EZBA 5I5EA 4B81A 4OGFA 4BS9A 5DI9A 4TV9F 5AMXA 4GE0A 1HXHA 4HYQA 2WV9A 4HG2A 5AKZA 3WK9A 2IYXA 3DP7A 2RH8A 5LP6C 3H8SA 2PLWA 5JJCA 1LSOA 3Q12A 1XCBA 3JQFC 1P7CA