4F21A

Crystal structure of carboxylesterase/phospholipase family protein from francisella tularensis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
217
Chain Sequence
b'NAMNYELMEPAKQARFCVIWLHGADGHDFVDIVNYFDVSLDEIRFIFPHADIIPVTINMGMQMRAWYDIKSLSLNRVVDVEINSSIAKVNKLIDSQVNQIASENIILAGFSQGGIIATYTAITSQRKLGGIMALSTYLPAWDNFKGKITSINKGLPILVCHGTDDQVLPEVLGHDLSDKLKVSGFANEYKHYVGMQHSVCMEEIKDISNFIAKTFKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase/phospholipase family protein
molecule tags Hydrolase/hydrolase inhibitor
source organism Francisella tularensis subsp. tularensis
publication title Large scale structural rearrangement of a serine hydrolase from Francisella tularensis facilitates catalysis.
pubmed doi rcsb
total genus 58
structure length 217
sequence length 224
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f21A00
2WSLA 5K5EA 2GYWA 5EIHA 1VKHA 2OG1A 2OCKA 3HEAA 1T2NA 5HF6A 5ALTA 3HXKA 3IUQA 4UBJA 4K6GA 3STUA 2OPHA 1EB8A 2FJPA 5AICA 4MYDA 2XMDA 1VOTA 4WFIA 2X76A 4IHAA 4EY6A 3ED1A 5IVHA 3JWEA 1BROA 4TGLA 1P0MA 3HRHA 4KR0A 4QDTA 3ZLVA 3AIOA 5LZ4A 5A62A 2QJRA 3QPAA 2QM0A 3ZLUA 4DMHA 4QDOA 2DHCA 1H22A 3FBWA 1JT2A 3H18A 3T4UA 3NUZA 1E8MA 5JZBA 1CLEA 3LCRA 4MJ3A 4EBBA 4IO0A 2W6CX 3WKAA 5DYTA 1DQZA 1WB6A 4BC0A 1YR2A 1QIFA 3FSGA 1QTIA 5AO9A 4LYEA 1QIDA 3QVMA 4WCVA 4AXBA 5FDFA 4OB8A 5A71A 3WL5A 1QGED 1SCIA 2C4HA 2GBGA 4G4IA 1CUFA 2QXUA 4N5HX 5LZ8A 5CMLA 1ZI8A 2J3DA 5C81A 3HABA 5ALHA 3YASA 1HKHA 1DX4A 2DCMA 3EQ9A 5CBKA 1XLVA 2UZ0A 3I6MA 4J3JA 5AKIA 4G1FA 1QIIA 4W1QA 2WUEA 3I1YA 4BYMA 2C7BA 3H17A 3W9UA 2XLCA 4FKBA 1CVLA 4C4ZA 2Z8XA 2ZSHA 5AM3A 1JMKC 4QDUA 2GBCA 1BEEA 1XRQA 2V9ZA 1XKTA 4Y2JA 1CIJA 3C6XA 2HHAA 4GBGA 3I2JA 5D7BA 5AM2A 2XMQA 4C87A 4CG2A 1JJBA 1ZI6A 4MQMA 1VZ2A 4DSZA 3W9BA 5CRIA 1YA8A 4OU4A 1K6EA 3T52A 4AX4A 2DFPA 1MX5A 1PV1A 3AILA 1DWQA 2WUGA 1LBTA 4B84A 2ZJ7A 3F96A 4U2DA 4DNQA 3PE6A 4K6HA 2AJCA 2HA4A 2JEZA 5CT6A 1MU0A 3LIIA 1W4LA 2ZYRA 4UHEA 1J07A 3VISA 4E46A 1J06A 5ALDA 5K3BA 4WFKA 1DU4A 4P92A 2B20A 4X91A 1A88A 3VVLA 5IH7A 2BAGA 4GLBA 5BWCA 4EY5A 5LZ9A 4X93A 2EDCA 4WDQA 1UOQA 4W1RA 3SX4A 4BB0A 2JGFA 2GZSA 2YXPX 5JD4A 1Q0ZA 4Q3KA 1HBJA 4L72A 5JALA 3EF3A 1YS1X 3C70A 1CQZA 4CCWA 1ISPA 3WJ1A 2CKMA 1BS9A 5AKZA 3DS8A 3DL4A 4UHDA 2I3DA 4XWGA 1X2BA 5AOBA 1UK7A 2OGSA 5FUMA 4Q82A 3A6ZA 1MAAA 4E14A 4J0KA 4V2IA 4Q34A 1IZ8A 4YPVA 4MQLA 4BRSA 5DNUA 2OLEA 2PVSA 4X6XA 3IVMA 4Z49A 4KRXA 4O08A 4WY5A 4X85A 4X00A 4TPKA 4JYMA 2JGLA 2ROQA 3QYJA 5JZ9A 3VJLA 1QFMA 4KE6A 2VA9A 1EXWA 3BDIA 4B83A 2GBFA 3OOSA 4F60A 1X70A 2G5TA 3WK6A 2XUAA 1BEZA 3M83A 4YASA 3H2IA 3GBSA 2PUJA 5JATA 1QIEA 5ALIA 5AM5A 1H2YA 1OXMA 1LPMA 4UHCA 1XROA 2AXEA 1CUIA 3BXPA 2BGRA 4GECA 1DT3A 3PF9A 4I19A 1EDBA 5HQ3B 3WKBA 3DDUA 4UBKA 4B0PA 5LP1A 4HVTA 3M3DA 1L7AA 3Q0TA 4W9RA 2XQJA 1RP1A 1FSSA 2OGTA 3JW8A 2J3QA 5K3AA 5JAPA 1A7UA 1DINA 1HLGA 4AMYA 2PX6A 1EVQA 1AMNA 2VTVA 3W05A 6YASA 2PU5A 1DX6A 4AB1A 3TRDA 2ORYA 1ZICA 3E1GA 3F9CA 1BU8A 4KJXA 4QE3A 2PKYX 3UMJA 4LXHA 2ACKA 3C6BA 4KAFA 4CG1A 1Q83A 2GZRA 4IH4A 4QWMA 4EA6A 1CUYA 1JMYA 2WLSA 1JJFA 2PUHA 4GI1A 3AJAA 2BUAA 3E0XA 4OCZA 3HACA 4OSEA 5CT8A 4FMPA 2FUKA 5AI6A 1CUXA 5AKEA 4ROTA 4FWBA 1XZHA 3R3ZA 1ODTC 3GFFA 4X92A 4YK7A 3WK5A 1UZAA 1CUWA 1CEXA 5E4TA 3QITA 5HKAA 4G4JA 5HF9A 3BE8A 4HTAA 2GYUA 5A7GA 4FLMA 5AK4A 1UOPA 1UT6A 3PUHA 4OPMA 4PSUA 1XRMA 2HU8A 1IVYA 4X94A 2WM2A 1EINA 2QS9A 2DQYA 3R0VA 5C8XA 2CMFA 5D3ZA 5SYMA 1MJ5A 2ACEA 2ECFA 3HI4A 2XE4A 1QFSA 5T4EA 3I2FA 4G8DA 2O7VA 5JD5A 4Y2YA 3PDCA 2PSHA 1LBSA 3ZPXA 1N5MA 3FYUA 5AI0A 3C6ZA 4DIUA 5K3EA 3I28A 4OUKX 3ZI7A 4KYVA 4WDRA 5JYCA 3WLAA 5DYWA 1ZGBA 3VKFA 2H9YA 3BDVA 2HA2A 5JAHA 1AURA 4UBNA 1BRTA 5HFNA 5ESRA 3EQ7A 1EHYA 4L9AA 4H35A 1QLWA 5I7UA 2XQIA 4NVRA 3IUMA 4IH1A 3H19A 3C5VA 1LPPA 4B7ZA 4N8SA 4LHEA 3AZOA 3DCNA 1FJ2A 3VVMA 2IITA 4KE7A 4W63A 1N8SA 2FJ0A 3V1NA 1O6GA 4NZZA 1VJ5A 2RI6A 4Y2VA 1M33A 4FDMA 1E8DA 4G9GA 2HU7A 3F98A 3D59A 2ZJ6A 2PL5A 5AKYA 1QZ3A 5CH5A 1T4MA 2CEKA 2K2QB 3WA7A 3QPCA 2HIHA 4DNPA 3BIXA 1BN7A 4XVCA 1K63A 2PU7A 3LIPA 2OXEA 1WPRA 5AKHA 5AHXA 3D4LA 4C4YA 3I1IA 2XMCA 2HRQA 4Y2TA 4Y2XA 1IZ7A 4J03A 2ZVDA 2WILA 4RNCA 4C89A 2XUDA 2XUPA 3BJMA 3WIBA 3H2KA 4KAAA 1EDDA 3WQHA 1CUVA 2VJDA 2Y2VA 4H77A 5AH0A 3QM1A 1RYYA 3ZLTA 1XZFA 2IX9A 5CXUA 1NU8A 3AINA 4UBIA 1B41A 4BCDA 2WFLB 2B61A 4PF1A 4AN0A 1QIJA 1TKRA 1QIHA 3O9VA 3WZLA 4BTVA 3OM8A 2CJPA 1GQRA 1E8NA 4WJLA 3ESCA 4DLNA 1TIBA 3OPMA 2G4LA 5LZ5A 2WFMA 2I03A 3C8DA 3V9AA 1TCAA 4OU5A 3AFIA 5J3JA 1XZBA 3QMVA 1ACJA 3CN9A 3ICWA 4DYHA 3D3NA 3MUOA 2B9VA 2ZJFA 5EIEA 2QXTA 2WQZA 3AIMA 4MEAA 2W22A 3PICA 4F21A 5I9IA 2QT9A 2JGIA 5CW2A 5HK9A 4OB6A 2JGEA 3H2GA 1XRRA 1CUJA 4H0CA 4HRYA 4N8EA 5CT4A 1P0IA 1BE0A 1HL7A 1LLFA 1Q0RA 1USWA 1TCCA 4JYPA 3WK9A 4F5ZA 5LZ2A 5ALJA 4FBMA 1I6WA 3C87A 2QUBA 4DNOA 5AK3A 1DWPA 3G0CA 3VDXA 1ZD2P 4W1PA 5ALPA 3ILSA 5FRDA 2XMGA 3OURA 1CUCA 4RE6A 5AKJA 3S2ZA 1PJAA 5DLPA 1JJIA 1C7JA 1H2XA 3PUIA 5CT9A 4EZIA 3IUJA 2ONCA 3TJMA 1XZAA 1QIMA 1VLQA 5FXMA 2YASA 2XUGA 3IIIA 3STYA 1QO9A 4GHWA 1PFQA 4BBZA 4U2FA 1Y7HA 1U65A 3KSRA 1IUPA 3ANTA 3G8YA 4BAZA 2HL6A 4FFVA 3X3HA 5AIBA 1ODSA 2WU4A 5JADA 2JGMA 4C01A 3DYIA 1EX9A 2E3JA 4GWLA 3W04A 3JYHA 4OYYA 1JU3A 2HDWA 3G0DA 2HA6A 1LPAB 2DR0A 3ANSA 1YASA 3EBLA 4QLAA 5AI5A 4G8CA 5EHZA 3KD2A 3WL8A 2WJ4A 1LPSA 4DMCA 1GQSA 2XUQA 4J0CA 1JI3A 1UKCA 2XQGA 1DWOA 3WKEA 4X3CA 1K5PA 4MXDA 5ALMA 1DTEA 2H7CA 3C45A 1LPBB 2EDAA 3STTA 1UK6A 3E3AA 4NS4A 1ZI9A 4FBLA 2PSFA 2RHWA 3V48A 4B0OA 3B12A 1AZWA 2O2HA 2R11A 3WK7A 1XZJA 1YB6A 4HZGA 4X71A 3N0TA 4CCYA 1KEZA 1XZIA 1BCRA 3PFBA 1H23A 5H3HA 4DMFA 5K3FB 5HFAA 3H2JA 4WY8A 3Q8WA 1R9NA 5ALNA 4P93A 4WFJA 2X8BA 4LIPD 2PSEA 1XLWA 4DMKA 2RHTA 4Y2QA 1LZLA 1U2EA 4EY7A 2QJWA 5HCUA 5SYNA 4AN1A 4Y9SA 2J4CA 2ES4A 3FAKA 5AK5A 3G9ZA 2OAGA 3WKCA 4M0EA 4XJVA 5A6VA 1ZJ4A 5KBYA 3WYDA 1GKLA 4BAUA 1N5RA 1IUOA 2XUHA 5ALEA 5A2GA 3HJUA 1E5TA 1JFRA 2XMRA 1MAHA 2XI4A 2YYSA 2HADA 3E4DA 3C8HA 2JBWA 3K6KA 3IB3A 2WFLA 3G0GA 4L3WA 2VEOA 2RONA 1VA5A 2XT0A 5DWDA 1CUEA 1LPNA 2WIDA 4MYSA 4CG3A 2Z3ZA 1H2WA 4TVKA 1QO7A 1FFDA 5K3CA 3WWDA 4XIIA 1G4HA 1SOMA 3WKDA 4HXFB 1TAHA 2VATA 1S8OA 3LP5A 1FFAA 3U1TA 3IULA 2XMSA 3AZQA 4FFWA 4LXGA 1GGVA 2VF2A 5ALVA 5HQ3A 4BRZA 3BF8A 5FOQA 5ALFA 2WHQA 3IDAA 4X90A 2WTNA 3IUNA 4H7HA 5ALZA 3U0VA 3DKKA 3OTQA 4FHZA 1GPKA 4B80A 5ALUA 5ALYA 4A5SA 4CI9A 4CIAA 1R9MA 3BF7A 3QPDA 4IH9A 1BN6A 1FFCA 4OD0A 2WIGA 1AUOA 1CUSA 2OCIA 3DOHA 1OCEA 4DGQA 2WU3A 4RPCA 1BCSA 1CUZA 4AQDA 5EI5A 3R3YA 4UUQA 2QOEA 2WTMA 4QWWA 5A7HA 5KREA 2JIDA 3FLBA 5T4HA 3G7NA 4ZREA 4UFOA 1CV2A 3DNMA 1K8QA 4HAIA 5LIPA 1ZGCA 1MTZA 1G5FA 2VJAA 2ZYIA 4KACA 4KE8A 1L7RA 2BFNA 4BE9A 3P2MA 4UPDA 4Y2RA 5CXXA 2BGNA 4B82A 3R3UA 4J0HA 1TCBA 1TRHA 2QVBA 1UXOA 4PW0A 1ACLA 2QZPA 5IVDA 4Q3OA 4B81A 1MO2A 5BV7A 4E15A 4E11A 1IMJA 2HRRA 4CCYB 4BCCA 2OGZA 3FSGD 1CR6A 3RM3A 3WZMA 3MUNA 5KWIA 4DTCA 1NU6A 2HM7A 4EHBA 3RLIA 2HA7A 4QEKA 5KWJA 5ALOA 4EY8A 5LYYA 4BAGA 4U2CA 4BZWA 1E66A 4PSCA 1XFDA 5JIBA 3MVEA 1SCKA 4RGYA 4QDXA 4FNGA 3WIOA 5FV4A 1VE7A 3A2MA 4ZV7A 1HPLA 3D2CA 3ICVA 1UOOA 3WJ2A 3WYNA 4FOLA 3ESDA 1QIKA 2JEYA 2D5LA 4BTLA 5AKKA 1X2EA 5EHQA 4ZWNA 4J0GA 2CBGA 4HRXA 4ZGBA 3HSSA 3M81A 2CZQA 3CN7A 1GKKA 1GXSA 3C6YA 2BCEA 5AP9A 1VXRA 2H1IA 3FOBA 2QKYA 2R8BA 3A2LA 4LYDA 2RIPA 3FYTA 3WWOA 3O4GA 3WWPA 4DSAA 4QDZA 5IVIA 4ARBA 4L0CA 3HC7A 4QLOA 4C88A 1CUUA 3O95A 4H7EA 4X7BA 3FNBA 1MNAA 1WM1A 1XQYA 2Y6VA 1MPXA 2HA3A 1OILA 3KDAA 2OAEA 1UFOA 5FPQA 4H7KA 4BP8A 2JF0A 2HFJA 1FFEA 1GPNA 5AK6A 4BVJA 1U4NA 1MX1A 1WOMA 4J0DA 4QA9A 4JH0A 1XRLA 1AGYA 3R41A 3WL6A 5D3KA 4D9JA 4N8DA 2WG2A 2BUCA 1UK9A 4PO3X 3FYUC 1DT5A 2Y2UA 3PF8A 1W75A 4N5IX 1WHSA 4J7AA 3G9UA 2WUFA 1QE3A 2QTBA 3WWEA 2O2IA 1YAHA 3FCXA 1ZD4A 3UUFA 2WJ6A 2V97A 4GEGA 2WHRA 5LZ7A 4B85A 3DKRA 1YA4A 5CT5A 5IKXA 2QRUA 2WG1A 1VE6A 2WJ3A 5JANA 2HA0A 4GW3A 4AO7A 3B5EA 1CUDA 2PSJA 3V1MA 1YB7A 5IVKA 5BWBA 2Q0XA 2DHEA 4HXEB 3N2ZB 3KWFA 3AUKA 1GT6A 1UWCA 4P9NA 4GXNA 5EGNA 1XZMA 1QJ4A 4H7IA 5E4YA 2XUIA 2VJCA 4KAJA 1YS2X 4BP9A 4I4CA 5AKLA 1ORVA 4Q1VA 3TEJA 4U2BA 4KEAA 3QMWA 5E2IA 1F0PA 1ZJ5A 1XZKA 4X95A 3AZPA 1QOZA 2G5PA 1N1MA 3ESAA 2XMBA 3I2GA 3EIOA 1K4YA 3EQ8A 2B4KA 3QBJA 4MWSA 1EDEA 5EHNA 3BJRA 4BVKA 4C4XA 3FCYA 1GPLA 7YASA 3O9MA 1THGA 1TK3A 2D0DA 4K6KA 4HXGA 4JEIA 4X6UA 5CURA 4U2EA 5YASA 1E89A 1W52X 5C8VA 1R50A 3DYVA 4OB7A 5ALQA 4S0XA 1FFBA 4G4GA 1XRNA 5T4FA 1EK1A 5K3FA 1EA5A 5LLSA 3L1JA 3HLKA 3KWJA 4KE9A 1O6FA 4B6GA 2CUTA 5ALWA 2HFKA 5ALGA 4Y7DA 5HF8A 3ZWQA 4LXIA 5JASA 3W2TA 3PI6A 2FX5A 2P8SA 1B6GA 3BIWA 1XZGA 3V1LA 5AOCA 1QIGA 3A2NA 3S8YA 4AMZA 1VZ3A 4K2AA 5DJ5A 1ZIYA 3STVA 1EI9A 1C4XA 3V1KA 2IIVA 1MX9A 1CPYA 2WUDA 1ZOIA 3IA2A 2X5XA 3BWXA 1ZD3A 3H04A 4X6YA 3R3WA 2OCLA 1P0PA 3R40A 2XQFA 3I2KA 1KU6A 3RKSA 3C5WP 2PBLA 3IURA 2QR5A 1H2ZA 2AJDA 4P08A 1J1IA 4J0IA 2PPLA 4NMWA 4DNFA 2GYVA 4BC1A 4U2GA 1KU0A 4UBMA 4BVLA 3DD5A 1IUNA 4Y2SA 3WK4A 4H7JA 5AOAA 5AM0A 2VQ6A 3L1IA 2VT6A 1U8EA 3WI7A 1VXOA 3NGMA 3DOIA 3O0DA 3QZUA 4PQEA 4UHFA 1SCQA 2Z3WA 4I3FA 2I78A 3O4JA 4RE5A 4UFPA 1G42A 3GELA 3OC0A 3KOOA 3PFCA 1WCYA 2XUJA 2WFZA 3B3QA 3G0IA 1A8SA 1F8UA 2V96A 1EVEA 2BJHA 5AKGA 4A16A 1XQXA 5BOVA 2VAVA 4UBLA 5F4ZA 1YAJA 3I6YA 4ZI5A 4ETWA 5A7FA 5ALKA 1R88A 2C0QA 3O4IA 3RARA 2O2GA 2WIFA 3SWWA 2OQIA 3QH4A 2XQKA 3NWOA 2WIJA 2ZYSA 4ZXFA 1W6RA 5ALXA 4MWTA 5JD6A 3ZV7A 2BKLA 2WHPB 4UHBA 4UBOA 4INZA 2QMQA 2AJBA 4M0FA 2C5GA 4J0JA 5FP0A 4ZV9A 1YCDA 4KRYA 3CCBA 3RK4A 5JAUA 1XZDA 3MGAA 1F0NA 1ZIXA 1RWQA 3FYUB 4A23A 2XMZA 3WL7A 3GUUA 1UK8A 2O7RA 5D6OA 3W06A 1E3QA 1EH5A 1LPOA 2Y1KA 3KXPA 5HF5A 5FLKA 4W1SA 5JARA 1P0QA 1R4ZA 1LNSA 2BUBA 3F8SA 1Q84A 1AX9A 2XUOA 1NX9A 2YH2A 3FLAA 3VJKA 1XLUA 3GA7A 3I2IA 3M82A 3I2HA 4MEBA 2AJ8A 4UFNA 3SC2A 1XZLA 3UUEA 2XUFA 1LGYA 1R1DA 4CFSA 3A70A 2QUAA 4PNZA 3F67A 5I8PA 3DJYA 3WA6A 3SK0A 1HDEA 3STWA 2GBIA 4PV7A 1TQHA 5LKRA 3WWCA 3CXUA 4F0JA 1YSCA 4UHHA 3G0BA 3G02A 2XLBA 2XB6A 3D5EA 4Q05A 3O4HA 3BL8A 5AJHA 1QONA 5DTIA 4EUSA 5E4JA 4EB0A 1A8QA 3G9XA 1CUBA 3R3VA 4C6HA 3R3XA 1ETHA 3FLEA 2Z8ZA 4BE4A 2H7YA 1EK2A 3D2BA 1UKAA 4IQ4A 2PM8A 1SC9A 5DNWA 1JU4A 3DLTA 4PSDA 3H2HA 1MNQA 5DNVA 2VT7A 3VJMA 2WKWA 1VA4A 4FTWA 1CQWA 1D07A 1XQVA 2OCGA 5HZGA 2DSNA 2C0PA 1Z68A 4ZRDA 3F97A 4AZ3A 4CIBA 5EHXA 3HYSA 3VXKA 2LIPA 3AIKA 3GZJA 3H1AA 4AZ0A 5AKXA 4JNCA 5K3DA 1XKLA 5FPPA 1EB9A 4HS9A 5ALSA 4YX9A 1MN6A 4BZZA 2JGJA 5HKBA 3NOXA 3TGLA 4XX1A 2NW6A 1QTRA 4M0MA 1WHTA 3H0CA 3D2AA 3DQZA 1ODCA 3L1HA 1XZEA 4QNNA 2H7XA 1DQYA 1CUHA 3D7RA 3K9BA 1THTA 4ARAA 5EFZA 2HU5A 5C8ZA 2ZSIA 2WIKA 1A8UA 1XQWA 5AM4A 1WB4A 2XDWA 4H7FA 2JGKA 1UKBA 5T4BA 4OYLA 4AO8A 2AJLI 3CCCA 1WPXA 4JUIA 5JAOA 4AO6A 4BCBA 1J2EA 4Q3LA 1CFJA 2V98A 3WK8A 2PSDA 5ALLA 3D0KA 1AKNA 2DHDA 3OG9A 4FNMA 3HZOA 3DL7A 2XUKA 4FLEA 5CH8A 5DTJA 2DQZA 1Y7IA 4Y2PA 2VJBA 2OQVA 3STXA 4G5XA 5EIAA 3QMMA 5AM1A 4B9AA 4H18A 5LKAA 3IBTA 1F6WA 4BATA 1W1IA 3LLCA 5ALRA 3I6ZA 3WMRA 2Y6UA 2G63A 3LS2A 5JZSA 1LZKA 5C7YA 3G9TA 4G9EA 4ITVA 1ORWA 3ESBA 1ZD5A 4X97A 3C43A 3DEAA 1G66A 1Y37A 1XZCA 2RGUA 2C5FA 4G8BA 1MT3A 5CH3A 4FLFA 3FWHA 2I3ZA 4B9EA 4BDSA 2ZYHA 5ISMA 4K5QA 1R3DA 4LKOA 2WHPA 4DM7A 1C7IA 1XRPA 2VAXA 5AI9A 1SFRA 2CB9A 5DYYA 1CRLA 4GDMA 4Y2UA 4H7DA 2HA5A 5HK8A 2RAUA 1AQLA 1HQDA 1L7QA 5AI8A 3K2IA 3H1BA 1AC5A 5FKJA 1CUGA 1W76A 5AIAA 2C58A 3GROA 2WG0A 1WB5A 1GZ7A 4QZVA 1JKMA 3FVTA 2VSQA 2Z5GA 5CTAA 5AI4A 1CUAA 4EY4A 4BDTA 2EEPA 3FVRA 2J4FA
chains in the Genus database with same CATH superfamily
1BFDA 1WSDA 2GEBA 1TIKA 2NAPA 1WBDA 1F60A 4BFSA 3H3XA 4Q9IA 1ZJYA 1N6LA 1GKIA 3OEEA 2OG1A 3KE9A 4LDQA 2C29D 3EH2A 4JDPA 3CVYA 3HEAA 5ALTA 3QKIA 4UBJA 2PXAA 3I9LA 4QU8A 4H60A 4OHKA 5DI9A 4K6GA 4DXAA 2HTEA 3V4ZA 1EB8A 2I6GA 4GLLA 4WCFB 1L1RA 4Y6PA 3U4GA 3UYLA 4AS2A 1JFVA 4AZ3B 5DRTA 3UMSA 2UVPB 1GUZA 4YCCA 4WFIA 3ZZTA 3B2QA 4IHAA 4NCKA 3KQLA 1TU3A 4B3MB 3DV2A 1Z0JA 3VC2A 3PK0A 3DFIA 2YZMA 1RRMA 1XF1A 4MV3A 4QTZA 3SKVA 4DOMA 1I10A 5KI6A 3RHSA 1YE3A 1BROA 2JC3A 3I4FA 1VPTA 1OLUA 1U2QA 1ZW1A 3P94A 1QK3A 4C05A 3UJ8A 1E1CA 1L5SA 1S2IA 4IJUA 1DZ3A 3AIOA 3UHJA 3HB1A 5LZ4A 1J23A 1T6YA 3PXEA 3PYXA 5A3SA 2OSBA 3R9XB 5JPDA 4I81A 3KPJA 5IAGA 3LV8A 2EHJA 4P82A 4QDOA 1QRSA 1HLPA 5H5JA 4Q7MB 1DBSA 1YK0A 1Z2CA 5CB4B 4YR7A 3LHFA 1ZLYA 3NWPA 2DXIA 1TUIA 2WZCA 2NADA 3AESA 1KKMA 4Z4EA 5FULA 5JNRA 2H2DA 3ND6A 1FMTA 3DDCA 3NTQA 4LJSA 4MOWA 5LR6A 1E8MA 2PWYA 1OTXA 1OXBB 3KR9A 2CXUA 2Y1DA 3C1UA 3TRHA 2J3IA 2XHZA 3MJFA 1ISIA 4RABA 4UW9A 3IYLW 1T4GA 4PGHA 3EA0A 2EJCA 2QTMA 2Z5FA 3WKAA 5DYTA 1DQZA 2AK2A 1NSYA 3UPDA 4DR2B 2WWGA 4DMUB 4U8GA 4W7HA 4E5PA 4MWGA 3R7WA 4L51A 1I80A 3F6PA 2KLHA 4MGHA 2CK3D 1F8FA 4MIYA 5LWQA 1Z7YA 5FR2A 1Z2PX 4HQ6A 5FPTA 1TLTA 5JTTA 2D2XA 1OLSB 1W4BA 1O0SA 5FDFA 5A71A 3C5EA 3QVXA 1QTQA 4TLBA 1SBYA 2C4HA 2QN1A 2HZBA 4M6WB 3UPTA 1YB4A 2ZB8A 3CM0A 5TGTA 3MAAC 1KJIA 4Q1AA 3RWOA 1UODA 2F9LA 2P30A 5LZ8A 3BIOA 5CMLA 3PTAA 1W25A 2CNOA 1U7OA 1ZI8A 3JWGA 1LQUA 4JGBA 2ZIXA 4FR2A 4MGKR 5DFAA 3T7AA 4HGNA 5ALHA 2M98A 3TJRA 4TKVA 4CQMA 1JQDA 3CZRA 4R8KA 2V8OA 2PUCA 5B4VA 1HOXA 1U4SA 3EQ9A 1WU8A 5A9SA 4QQNA 1NC3A 2OHGA 4F96A 3PTZA 1K7CA 3OPVA 1TIPA 1IY0A 1U2RA 4E3WA 5C53B 4LXTA 3CEHA 2J3JA 3MJVA 4FFLA 2BEUB 3UAOA 2GNPA 2QAGA 1AUXA 1NPYA 4CTMA 2VI5A 3JD3A 2HMSA 1OXVA 4X1IA 3DBLA 4E5NA 5M3BA 4BYMA 3BE5A 4ZEMA 1BSVA 5I4CA 2P3SA 3TS1A 2C7BA 2GOYA 4MVJI 5JT1A 2OO5A 4UARA 4AY2A 5K0BA 2XCLA 3AVYA 4KL8S 3CY6A 3I4LA 3GX1A 4AZWA 3OCJA 1ZA2A 1EE2A 4GGOA 2MMCA 2PMCA 4EG3A 5JC8A 4M53A 1Y4ZA 2YFYA 4DRXA 3PBKA 1C3OB 3H1TA 5A0TA 2IZZA 4JYZA 2AB0A 4QDUA 1PBNA 1TJPB 2NUTB 3EDYA 4URFA 3OOYA 4AS1A 4BMXA 1XKTA 5CAEB 4B3IA 3DVQX 4XFDA 2FPSA 2E5WA 2WE8A 3GO4A 4Y2JA 5DWVA 2H9IA 4CT4B 3NIGB 4D9CA 2ECPA 3UCEA 4V2UA 3FYHA 4FGZA 1RI5A 4JQZA 1VKOA 4YXWA 3VNRA 3FTFA 4GBGA 3TLXA 4ZANA 4OHXA 1DE0A 1XXHE 3ZW7A 5KQSA 4D9FA 3EIWA 1EUDA 1E0AA 1I4LD 3K8YA 4MVWA 3NDPA 1R5JA 3AJEA 4N6NA 4N6OA 1IRIA 2EKDA 2JHAA 3FMOB 3FN4A 4QBTA 1SKBA 3UT5B 1E9AA 3HCOA 3MAJA 2G0AA 4BLVA 1N2OA 3OZRA 4XLLA 1F0YA 4Z8YA 3VYTB 5AW4A 1PIWA 3QVKA 1KIAA 5HKKA 3UHOA 2WZQA 4MV6A 5DBGA 1DARA 2ZIAA 3M4NA 1JJBA 4OMFG 3VMFA 3AC0A 3LYHA 5U1PA 3VQTA 3D5TA 2QG9A 4UULA 1T34A 3CJRA 4YTEA 3VX4A 4Q7QA 3FOEC 1MB4A 3A6FA 5BPHA 1EM6A 2QQ5A 5TS2A 2PY6A 2XVYA 3CHYA 4OU4A 1K6EA 3AUFA 1OFHA 1Y42X 1D0SA 4RV5A 4DXDA 1RZRA 2IOFK 2YY7A 4AJJA 4D80A 1QPZA 1Y6ZA 5JAIA 5AI9A 4EUEA 2HRZA 4M9CA 5DHUA 1GZVA 1NR7A 2OFXA 3I23A 1NFFA 4KAXA 5EEGA 3UJBA 2HMTA 4ZK2A 2IH4A 4JYBA 3WGHA 1EUDB 3BAFA 1WD5A 2NGRA 1KORA 3DWIA 3PNLA 3T9AA 4LS3A 1QAQA 4XQ9A 3ZE8A 4Z3OA 2DMRA 4U2DA 5L3RA 1P1FA 1UJBA 1WS6A 3OC6A 5U4QA 4C06A 4CLHA 4JT4A 5BNTA 5I7HA 4GL2A 5JJBA 1GOTA 4Q9JA 5AW1A 4D0RA 2JEZA 3TL3A 4EA9A 2CJXA 4ZVNA 1D7AA 3K9HA 3HR4A 5CT6A 4W1QA 2NXEA 1M7HA 1Y5LA 3SE0A 3GVXA 3SXPA 3SJBA 2I2DA 2B2NA 3AFOA 3NM5A 2Y1LA 4H7PA 4D8TA 2D1YA 2EU8A 3MTGA 2QVZX 1IPEA 2IP1A 3LM8A 1RLJA 4M60A 3TPFA 2OD7A 4UHEA 4FHCA 2XTJA 3L0SA 1SBHA 1XCJA 3C5CA 4FOPA 2XIQA 4OP1A 4EUFA 1SHTX 3DMHA 5ALDA 5EWLA 1GU0A 3Q7PA 3WDKA 1T0IA 2EIXA 4B5LA 1ZXLA 1WUYA 4ZVVA 3VH2A 4G3XA 2IPNA 1GTZA 5IDQA 1USKA 4XIJA 5JY1A 1QQ5A 1NV8A 3VSBA 3ZQ6A 4GSYA 2QAGB 1PVOA 1KAGA 3HJRA 2DKNA 1A88A 4IDQA 3MBIA 5IH7A 3EUFA 3PJRA 1OLUB 2IS4A 4Q1CA 1EWYA 4CXMA 4X93A 2H3HA 3ED5A 4Z4QA 4ZPJA 4C20A 5IM4F 2JGNA 2NZYA 1GUYA 4OHMA 2W8ZA 1C1DB 4YFYA 1QJCA 1UOQA 2Q5OA 5FI0B 3PFGA 1H4SA 2YXBA 4KPYA 3OAAA 3F3SA 3L6BA 3P27A 4CCAA 3B6KA 2Q1SA 4CKWB 3I5AA 4LWQA 2QVCA 3GQBA 2GT1A 4DZZA 2FE1A 3DMRA 1NF3A 1NVXQ 3ZU4A 2X8JA 1K6IA 2XAAA 3H13A 3LG2A 5BSGA 1JL3A 3G1WA 2NZ2A 3CLTD 4ZP1A 3TO5A 3AI2A 2FSVA 3M34A 1M1XB 2XXJA 1HBJA 1NG1A 3BB3A 4TQGA 3C6QA 1CY8A 1ZVQA 3P71T 5CVJA 4ITRC 2I22A 3T9DA 2R6HA 1K4KA 3MMSA 3C70A 4PVDA 3ZWVA 1N3YA 3KKZA 4WASA 4EI9A 4EH1A 3N8KA 2ZIVB 4YR9A 4CCWA 2ZRHA 3PC8A 1Q50A 2CKMA 1D6JA 1BS9A 3BQNB 1J7KA 1SKQA 5C46F 2G9VA 2I80A 2OK8A 3GUZA 3QFRA 3IEXA 3X0DA 4GMHA 3D3EA 3IPYA 1ILWA 4BVAA 2BPOA 1GYPA 2GKOA 2PAFA 3LKZA 4L85A 3R09A 4FFNA 5CR9A 1T1EA 1QYWA 3CSDA 3K16A 2FPMA 2RHGB 4Z9BA 1E0JA 1CR2A 3KUXA 2RHRA 5FAXA 4Y0VA 2HQSA 3K1AB 4E5MA 3CZ5A 5FUMA 2QT0A 1IY2A 1S4QA 4L4XA 4OHPA 2EGGA 3JYPA 3N75A 4O2LA 2AIRA 5KVCA 3LTNC 3L0IB 4J0KA 2VCYA 1ODJA 3LUFA 2GCPA 3OZIA 4R2HA 4RVDA 4WZZA 1OI4A 1P18A 2PHZA 2AX3A 4Q34A 1BQ3A 1LK7A 4YPVA 3FM9A 3R6GA 4BQNA 1N7GA 3M3HA 4MQLA 4YT8A 2IS2A 3AEUB 3H9QA 1OZHA 5DNUA 1OH8A 4Z7JA 1TECE 2HSWA 2VJMA 1B23P 4NU5A 4CKBB 1D2HA 2G40A 4M9RA 4BU1A 4GMGA 4ZQEA 4X6XA 2B35A 2FMHA 1O9BA 5E9AA 2C9YA 5HIMA 4CLRA 2GPTA 3BK1A 1L5GB 2KE5A 5TQ0B 3IVMA 1RW4A 5BSWA 5BOSB 4O08A 1AU9A 3B9RA 4TMYA 3TX2A 4X85A 4U5QA 3UMCA 2AI3A 2QTCA 1JV2B 5JMPA 3FKSA 4TPKA 3REOA 1PJZA 5BQ3A 2OAP1 4N7MA 2X42A 2QNBA 3TIVA 3NHUA 4KIJA 4RO0A 2AHRA 3HA2A 1OKKD 2EV9A 1U2DC 2JGLA 2ODWA 2PRYA 2ROQA 3QYJA 5EKTA 4BVHA 5KJ6A 2W43A 2XYGA 5EJMA 3LJKA 5J2UB 2XQVA 3T9EA 1HDOA 5BN5B 4NBRA 1L5VA 1NBMD 2BDUA 2HSGA 2A92A 1DAFA 3DMFA 3MWDA 4MW2A 1IJKA 3DLIA 4PO9A 3CZQA 4X7MA 1M3SA 2ZULA 3ZIAD 2KB0A 2QLBA 1ODFA 1EXWA 2O2JA 1RABA 4R9SA 3IUYA 4B83A 3NEPX 5D6NA 3TOVA 2OZLB 3K1AA 4B76A 2CJWB 2O8EA 3OBBA 1DAKA 3F6SA 3EXG2 1U6KA 1V16A 4R1UA 1SZDA 3JQRA 3AEKA 5JFGA 3C3MA 3M83A 4YASA 4JUBA 4PE5B 3GBSA 2WOJA 4KR6A 2PUJA 1UDWA 2V65A 4EMBA 2CLLB 2G9NA 4JSYA 5FB3A 4HJRA 2IVZA 3A3NA 3DMPA 4US0R 4WK0B 3SZGA 3WFJA 2XYVA 1GT91 4NMLA 1X7ZA 2F1HA 2VEDA 5AM5A 3SM9A 4AJOA 1B76A 5HM8A 4W5JA 4NATA 4O4LF 4MGZR 3S1AA 3NR2A 2ZPUA 3I0NA 8MHTA 4FIZA 1J9EA 1JTFA 4C3OB 2FMXA 3M2PA 3OZUA 5FUQA 1KPIA 2O6HA 1NX6A 2F3RA 2W98A 3BXPA 2GHQA 1Z56C 3D1LA 1QORA 3KUUA 4LI3X 4PWYA 4RF2A 3GPLA 2BGRA 3NTXA 4GECA 4DKXA 1DT3A 3EB9A 4P34A 2ZT6A 2PANA 2GWRA 4ESOA 5M2QA 4JCCA 2H18A 5E1DA 3OZ7A 3BJIC 4Q7JB 5BT8A 4UBKA 3LHSA 1RLMA 1Y8RB 5FWXA 5IFLA 4BMCA 4CTJA 2ZJ1A 5D84A 4W5NA 4JBGA 3M3DA 3ILVA 1L7AA 3Q0TA 2DT5A 2RH8A 3QV2A 2BFEB 2CHQA 4ZV4A 4C4SA 5JSZA 2MWMA 1SXJE 2P3LA 3NNNA 4DJFC 5JEEA 3PGVA 4YBZA 4QO7A 4ICIA 1XHFA 1Z0KA 2XOEA 4Y1GA 3D4PA 5DBHX 2E82A 5JXHA 5DGHA 1RBYA 1HNNA 2Q2QA 4E21A 2Q1YA 5FOVA 1A7UA 1Y5IA 4HAXA 4XVQA 1L7NA 1V5FA 4B4DA 3KZMA 3R5FA 2PX6A 2EP7A 1EVQA 2YOHA 1GTRA 2WK1A 1TF2A 1PDVA 2VDMB 4JN6B 5J4LA 2X0RA 4TS1A 3W05A 1Z88A 2YYAA 3AEQA 4BEWA 6YASA 2NP7A 2PU5A 4ME6A 4E94A 3HGQA 3CRW1 3WHIA 5FWDA 4YMLA 3NJRA 3T41A 1H6AA 3DJFA 3W5JA 4A5OA 5HKOA 4JHXA 4TX1A 4OK6A 1RJFA 3ZZNA 4IMIB 5E2AA 3EVGA 4OF4A 4HMOA 1BU8A 1O94C 3QIVA 2OXCA 4J7XA 3CLSD 4WBSA 1KRXA 1XTIA 2WSBA 3NKLA 1JVBA 2LXNA 3CW8X 1NLMA 3L0YA 1HEYA 3EZ7A 4Y98A 2QTGA 3AY0A 3GWZA 4RTKA 2VQDA 3C6BA 4JXKA 3T8YA 3ZGOA 1JEYB 1Q1GA 2C61A 3EXIA 1MJHA 5DGTA 3F3YA 3LCUA 4PN7A 3FVVA 2ZRQA 1YXMA 2ZJOA 1CB0A 1KO4A 4IH4A 1SULA 3KKMA 4RESA 3PB3A 4OK3A 4ZEOA 1TAUA 2RJOA 4HAVA 1JMYA 4LNUA 5DU2A 1NW6A 2IXGA 3KZNA 4KWIA 3IO3A 1GKUB 3IJRA 1V4BA 4XGRA 5FJJA 4V0SA 5BW5A 5IJ9A 2HYIC 1PGJA 2BHSA 2DBQA 1C0IA 3FHOA 1P5RA 2L18A 4OSEA 3GQVA 1FP4B 2RHMA 3OFND 1JHAA 1UKVY 2R47A 3OZCA 1Q2UA 3UC9A 3A3PA 3EIXA 1NHGA 4I9NA 4YLGA 2EF0A 5AKEA 4ROTA 2PS1A 2L69A 1AHPA 1YRQA 2P2ZA 5JOQA 2WJYA 2PWZA 1VMKA 2A86A 3T5CA 5EHIA 3ZWXA 2DPYA 5JSHA 1U1CA 3Q10A 4OHYA 5E4TA 1TTPB 2FG7C 3KZKA 1TVCA 3UZUA 4WBNB 4L02A 4XM1A 5L9AA 3A8TA 2BGLA 3CB4A 3H7AA 4HQNA 3PSHA 4W9NA 5LNK6 4DA7A 2NNWB 4UNSA 5DDIP 3OE7D 2H2FA 5FNVB 4WV3A 5KTTA 4IXWA 4D44A 2D5AA 1J0XO 4HSGA 3T1NA 3JD4A 5I45A 5KX5A 4H1WA 4RVUA 5IT4A 4P8RA 1Y1KE 3IE2A 3KZXA 3RSGA 2B5VA 3TPZA 2J32A 2K7FA 3D02A 4HWOA 3BD7A 4U7GA 3DFMA 2HU8A 3Q2KA 1UOEA 1KDPA 1XTRA 2A9PA 4IV0A 1Y3HA 4FKMA 3P9PA 2CLKB 1DRKA 5KNCD 1NRIA 2DQYA 1WJGA 2E4VA 5C8XA 3GH3A 2H48A 4MUHA 4EUKA 2BN4A 4JBNA 4GPTA 2FJUA 4KWCA 4LF6B 5A3JA 1YQGA 2OE2A 4MVJH 1QG0A 5EKXA 3WMXA 1NTRA 5AJVB 5IBRA 1EUCB 3AXTA 3FG9A 4G81A 2Q7DA 3P9IA 4B8ZA 2G9QA 2O7VA 3EEIA 3KSZO 4R16A 4CN9A 4Y2YA 3ZHOA 1QE0A 2HMVA 5C8DA 1SOUA 1BD4A 2PSHA 2WP8J 4EPWA 2GDJA 5JNLA 5H3LA 3CPHA 3ZLJA 3KYCB 1J8VA 4M38A 1HLDA 4MWDA 4NEGA 5K4HA 3T3OA 1N5MA 3OJCA 1HM5A 3FYUA 2OSVA 3CUWA 3L4SO 1I32A 4QUDA 3Q3EA 3U37A 5MDHA 2GN8A 3C6ZA 1GPBA 4IR7A 1JLLA 3L7AA 1TZBA 5AI0A 1WMSA 3ZWCA 2ZJ0A 3EA5A 1R8QA 3QEOA 1R12A 3MT8A 4P7BA 3MRXA 4R1PA 4AJ4A 1M6NA 1NZJA 3LFHA 4S2EA 4AZ0B 3I8OA 3ZI7A 4D5GA 2EQBA 3SYTA 1WF3A 1T4DA 2X8JB 2YJGA 5J4KA 2W6NA 4E4TA 3IP1A 1HURA 3U39A 3WLAA 1NBIA 2I2XB 3DWFA 1Y1TA 3LVRE 3COPA 1BX0A 1T3HA 3T3EA 5CITA 3VBEA 2O8CB 3FDXA 3JASA 3CISA 4I50F 2GXAA 3GFRA 3MYYA 2PLFA 1ZRMA 2KHZA 4JBYA 1AHNA 2FLVA 3UXEA 1EP2B 3MM4A 4ZO7A 3EZXA 2ZWVA 5FBHA 1ISHA 1QYIA 4UBNA 3TQRA 5ESRA 4DR5B 1SUAA 5FCDA 3V5NA 3TH5A 3JQQA 4CLEA 1UANA 2VG8A 3G0HA 3BMQB 1EHYA 3VC1A 4BPRA 4GMXA 3RT9A 4JI2B 4H35A 1FP2A 5CYPA 3NU1A 1YJQA 1E61A 1VG1A 2XQIA 4B7XA 1TCUA 3PHBE 2ZTLA 4RAQA 5TARA 4KQGA 3H19A 1Z17A 4KPFC 1USIA 1KS2A 1QHNA 2DEUA 5CGQB 3ADDA 1PDOA 4B7ZA 3C3YA 5JVDB 4MIEA 1FS4A 1ZH8A 1UKEA 2DHRA 3AZOA 3DCNA 5EJ2A 4K26A 2IV3A 1TLFA 1P39A 2PV0A 2DJ5A 3KPUA 2FJ0A 1GTJ1 2PVCA 4IHQA 5LLTA 3JQ6A 3VR4D 1WUTA 2QDXA 1VJ5A 2D8MA 4WK2B 4Y2VA 1VG0B 2I91A 5D5PA 1LDGA 1D1QA 3GF4A 4G9GA 2HU7A 2IZOA 4YO8A 3TG8A 3K6SB 2NO4A 1QBKC 5K0ZA 4X8LA 5J2TB 1M6WA 3KCQA 3WGGA 3QE3A 3RSFA 2Y1XA 4EKNB 2VAWA 4LJ9A 1BYUA 2AC7A 2FVXA 2Q3CA 3IILA 1KVTA 4MCJA 1JKXA 1V16B 2CLFB 2DC1A 2GCIA 2H07A 4GPBA 4L73A 4WK6A 1E3DA 3FJ1A 3ME5A 4DNPA 1TYEB 4IEFB 3N8GA 3IQFA 1VTKA 3IDOA 1MABA 3EXHA 5GJBA 3GFPA 2XNHA 3NWEA 2J5QA 3KJGA 3TQOA 1JDBB 2WR8A 4DV2B 3ZE2B 3M33A 4XVCA 4AUKA 1HX7A 1IN4A 1D2RA 4PONA 1IN7A 2JW5A 3Q8XB 3D5QA 4RY8A 1M2WA 5H4HA 3BL6A 3V42A 3ZGLA 2G04A 1GYQA 3RW9A 3CEPB 5ARDA 5HIJA 5HUQA 3KLOA 4JR1A 5FWAA 3SI7A 1RBQA 4CLOA 2QQFA 1E3SA 2OD2A 4QOSA 5ECWA 4ESVA 2GXUA 2WDZA 1EVIA 5DGXA 2CMKA 1NXTA 3O4RA 3EODA 3OZAA 4YC7A 4E2ZA 2FV8A 1XXHB 3ZJUA 2HUPA 2WAYA 3MIZA 1T29A 2J85A 2XMCA 1Z33A 3F4LA 3EIFA 1WP4A 1JYEA 2LCFA 3MTJA 4J03A 1JKJB 2O1EA 4RNCA 5AJTA 3LT4A 3SZ3A 1KYWA 4L5YA 4OI2A 1N5OX 1DXOA 4GZ3A 4CUKA 2P68A 4GR4A 3TNDA 2CNKA 3K72B 4BB9A 4ZFNA 1ZHHA 1TPZA 1SBQA 5ICCA 3H2KA 1B8OA 2P5TB 1DKQA 3U44A 3C41J 4LXQA 1P1IA 2QW1A 3T7KA 3U6KA 2CVHA 3FFXA 1U3VA 2AWNA 3GLVA 1IZ9A 5KTOA 2QRLA 1O58A 5JH7F 4YP6A 4KMOA 2R7KA 3R24A 4NAHA 5JV5A 2VOJA 3EFBA 4PHHA 1UBSB 2Q0HA 4GLOA 2MU1A 5AH0A 4K9QA 4HP8A 4BP1A 2IX9A 3Q0EA 1KJJA 3DD1A 1B41A 4HMQA 4EPTA 1T1JA 4YLYA 4F4CA 5IVPA 1P44A 3TIIA 5LOVA 5T6BA 3LMKA 3LWNA 4PF1A 2G3YA 4AN0A 1RZUA 2R2AA 4OBXA 2HT1A 3O9VA 3H6GA 3WZLA 3QFHA 1C2YA 4MX8A 3BRCA 3FSJX 5E95A 4HX2A 4LHSA 3EPPA 1IHOA 2EJTA 2X9NA 3EUWA 3PDWA 1JDJA 4L7VA 4WJLA 3ESCA 2Q6LA 2NV6A 3AF2A 4MKIA 8GPBA 1FLDA 3BB1A 2W71A 1WUJS 1TPYA 3MN1A 3BILA 3HVKA 1VDMA 2Q5JA 2ZBRA 3N59A 4P6VF 5TR9A 3C7KA 5EKDA 3WGZA 4M0CA 3QUCA 4JI6B 4ATNA 1QDEA 5AT1A 5DW3A 1IZ0A 3EGCA 3AGQA 4XYBA 2XDQA 1P2VA 3GLHA 4U4AA 2HN9A 1KETA 1KI3A 3HKBA 4N6GA 2AH5A 5T6MA 3J80A 1Y34E 2I03A 4AZSA 5F51A 1Z4NA 5MGNA 1N6OA 1ZESA 3ND8A 3V9AA 4D79A 2OFPA 5L3VA 1M2HA 1BS2A 1TCAA 2FPIB 2XX3A 5ESWA 1L4BA 3VUEA 1XZBA 4UOZA 4MQUA 5B7PA 4YJKA 4NK4A 4PG7A 4PYKA 4B43A 4BHTA 3EWIA 1BVHA 1FTSA 2PXXA 4R7ZA 3H4IA 4DYHA 2XDQB 3EJWA 4LFBB 1L7PA 5JDCC 1NVTA 1YU9A 1II8A 3X1JA 5C31A 4OJNA 4D42A 3GG2A 1CT9A 4ZT7A 3DZCA 1QHYA 4ILEA 5KSWB 4EKEA 3UJPA 1MA0A 2ASVA 3A1UA 3W3ZB 3LBAA 4RIFA 1ISRA 4GQBA 1P4SA 1KWGA 4YJHA 4HEHA 2C20A 1N4AA 3KQPA 2DCUA 5I9IA 1XMSA 3PC8C 3OM0A 3TD2A 4GP9A 1XX6A 5JWRA 2WWVD 4HN2A 4B44A 3TFQA 1VLLA 3ZG6A 3U1BA 1JWAB 2JGEA 5AVYA 4U02A 2H08A 3D4OA 3X2EA 4CJXA 3RCBA 5JAQA 1ULHA 1G59A 2HO4A 1T25A 4Q6WA 2IPOA 4BN0A 3H5IA 1Y33E 2W0SA 2I62A 2CE7A 2QJOA 4YROA 2X40A 2YHIA 4NCHA 1HL7A 5DNEA 3DCJA 6Q21A 2ODBA 3VYWA 1CVIA 4JLNA 1IE3A 1P7ZA 3Q7IA 3NUGA 3HM9A 3JSXA 4IL5A 1XAJA 5KHOC 4O2BB 5FBVB 3UMFA 4F5ZA 3KO8A 5BN4B 1JHPA 3GRRA 4FBMA 5K0SA 5H1YA 4GMFA 4L95C 4HNSA 3I45A 4DJDC 2QUBA 2XXAA 4BNWA 2HV9A 1CJBA 2ZRFA 1A9XB 4KWEA 1DWPA 2J5RA 1LVUA 3G0CA 4GYYA 4W1PA 3EZGA 3V8BA 3W90A 4ER3A 1XELA 1N9ZA 5DYGA 1WVIA 1QH8A 4MEJA 1PJAA 2OFOA 1ONSA 2RHCA 2ZJBA 1A5TA 3IHWA 3PUIA 4G8JA 2R8OA 2QUZA 3DOCA 3H5LA 2IV2X 5KYGA 1UXJA 3FBGA 3G2MA 3GXBA 4JBHA 4UMFA 2I6TA 5ENDA 1M5UA 1YR8A 1EUQA 2P2GA 1YTUA 3DV0B 3CNQS 1JPVA 1XZAA 2ZWAA 4LYFA 1BDHA 4EP1A 2DQ4A 5FUWA 1KYYA 4G0PA 4R6WA 4QXRA 3E70C 2D5CA 1R6VA 3S8EA 3FETA 4G5RA 5F2KA 2WYVA 3AVQA 3NIWA 4C21A 3R8XA 4MV9A 3W5BA 1ZIOA 3KB6A 4TZ0A 2I66A 3STYA 2JLVA 4FYPA 1DC5A 1LK0A 3LDAA 1MEEA 1ZK2A 4ZICA 2R6ZA 4U2FA 1W9MA 4LQDA 4YCLA 4L5CA 2UUPA 2F43B 4GP7A 1N57A 2IHBA 3G8YA 1O9GA 2Z1NA 3EYWA 4XW2A 5JSUA 2RI1A 2WY2D 1T5TA 4ARIA 4TSFD 3X3HA 1C3OA 2COEA 4B2PA 1E4EB 3MQ2A 3M5CA 3K35A 3MTEA 1OPXA 4ZZ0A 2HMWA 4YYZA 3PA6A 1S01A 1V4VA 2D54A 3BWBA 5EESA 3DYIA 5JVDA 4R68A 4BKRA 2ZBUA 2QXYA 1ISFA 1DIBA 4RHTA 4YXFA 1EEHA 3G89A 1JKIA 1I9CA 1JU3A 2OY0A 2ZLBA 4OYYA 1G21A 4QBHA 5BWMA 1GZ5A 5GV7A 3G0DA 3H7IA 1X1CA 1QDLB 4GIBA 1JHDA 1AK2A 2DTEA 1MRNA 1ZMXA 2DR0A 3GI1A 5CDGA 1YASA 4Z9YA 1GGHA 3QFFA 3EBLA 3LW8A 5CJPA 5AI5A 1AG9A 1P6UA 1T9HA 4G8CA 1ST2A 3B6JA 3FDIA 2I71A 2YOFA 4UXJA 1D1TA 2Y1WA 2WJ4A 4PFSA 3IAM6 1QU3A 2LCIA 3QLVC 4KPGA 3ACDA 4K6CA 4LN1A 5EWJA 1PJSA 4GUDA 3GIWA 2XUQA 4A0HA 3GAZA 4RWZA 4CF4A 4DCPA 4EW6A 1N0WA 4X8HA 2PGNA 1RWXA 1QNFA 3NASA 1X38A 4FD2A 3TLZA 3HCWA 2I5PO 4KU4A 3VAYA 2Z4RA 3REQA 1DQPA 4PEVA 3MPOA 1R9JA 4MXDA 5LOVF 5KKNB 1WETA 4MQBA 1G2QA 4MS4B 4KPEC 2H7CA 1A7KA 3MW8A 4DV4B 1R4MA 4FQ5A 2P11A 4DVJA 3NP9A 3WYBA 2BD0A 3STTA 1EE9A 1RJ9B 1RKUA 1SN7A 3DPSA 1F2UB 2PD3A 4E5VA 2HIMA 2BKVA 3IMEA 1VE5A 1ZI9A 2OQ2A 2VYQA 3V48A 4B0OA 1V47A 4POAA 3OM1A 3WK7A 1NAIA 5JE8A 4YAEA 4YRKA 5FTJA 1WF6A 5D2CA 5AVKA 4CMKA 4O3MA 4NS1A 4X71A 4LBVA 2P90A 3H86A 3I52A 3PFFA 1BCRA 4HRAA 3PFBA 2XGMA 1OSNA 1PFVA 1W73A 2QR2A 3R7FA 3MS4A 1BHJA 2XMPA 4ZXPA 3SU8A 4PLWA 1E64A 3H2JA 5TV2A 3TVDA 3Q8WA 4J9UE 5ALNA 4CUJA 3F9IA 4HAOA 3LK6A 4P93A 4C6TB 2QD4A 5F33A 2IU0A 5CB4A 1J1UA 4IV5A 3VOTA 1C7RA 5A3VA 3V1TC 1NXQA 3EY9A 4HLCA 4QHSA 2RHTA 2QN2A 2UYYA 1ADFA 4NV1A 3UXHA 1LZLA 2O6LA 3OLZA 4U9IS 4Q3DA 4G5YA 3H1PA 4KITB 4KBGA 1R00A 4MWOA 4BEJA 1COZA 2QJWA 5SYNA 4XD7A 4PZPA 3CIFA 4Q7KA 1T2DA 4Y9SA 1TL7C 3DFUA 3N7UA 1XEFA 4CDGA 3IJPA 4ER6A 1EFCA 4IG4A 5AK5A 1VSUA 2CDNA 1ZMTA 1NUSA 2H8GA 1UPUA 1ZM3A 3WKCA 4ZOLB 4B4WA 5JJLA 4AY3A 2JFXA 3RT1A 2V54A 4KDFA 4CKWA 3H5NA 1RPAA 1OE0A 5FQNA 1J56A 1NMQA 1WW8A 2XODA 4IUYA 4HNHA 4LYHA 2Q4DA 2O5EA 4MWBA 1B1CA 1HFKA 1Z6XA 1GZ6A 4WCFA 3C3WA 4FFOA 3D8NA 2OVFA 5A6VA 1OD6A 3WYDA 4YRFA 1GKLA 1AB5A 1R9GA 1E3MA 2O1XA 2OORA 1N5RA 4HYEA 4I4TB 4J16A 5B2ZA 3VSCA 4CFYA 3SFTA 5KTKA 5TMDA 1OX4A 4EVIA 1E2FA 3A9UA 1TFUA 1DV2A 3ZY3A 2OCBA 1JIXA 3HJUA 2V5UA 2H0QA 4QO8A 3O1LA 3IE0A 1E1YA 2CFRA 1FQWA 2Z58A 1U28A 3OTWA 5HW0A 4GYKA 3PUKA 4ZAFA 1UFRA 5FUYA 1JA9A 3TW8B 1ZJZA 1A76A 1FYVA 4UAJA 1D4AA 3QMPA 4KXQA 2FWJA 5C7IO 3EYAA 3GYGA 2H2GA 5BUCA 4OHRA 2LDBA 4X63A 2XT0A 3L7CA 1LPNA 1PD0A 1Y8ZA 4EGCB 1RIIA 3FF1A 1PG5A 3TIGA 3SR0A 4E2XA 4F2GA 2WIDA 4RHXA 1UUFA 2GEKA 1SUDA 3MCUA 3ODPA 4LDRA 4MYSA 1G5HA 3FIUA 1TQDA 2HK8A 4FYWA 4TT3D 3OSZA 4HUTA 1TI7A 2ORIA 1GWNA 2FN4A 2PWAA 3QW2A 5CFZA 3M9WA 4I46A 4JWTA 2WV7A 1LX7A 4MR7A 3U7JA 1HR0B 3IGFA 4BNFA 4ZDIA 3E5MA 3PS9A 2YCBA 3KSAC 3G2JA 2PCLA 3QLEA 1G4HA 1UT8A 2ZSUA 1FL9A 1W0KD 1F38A 5EUCA 2I1QA 3WL3A 5ADUS 2G88A 2B1QA 1FDIA 4I1RA 4HXFB 1E1KA 3BGOS 2EQ5A 1X80A 2XCUA 3ZK8A 1KNXA 1BMFD 2YNMA 1FFAA 4F04A 4U7DA 4GC5A 4FFWA 3AZQA 2IUTA 4LXGA 2YBDA 1GGVA 2IF0A 3T0GA 5T67A 2AZTA 3UHPA 4YH1A 2XECA 2IYVA 3GP3A 4ESEA 3ELWA 4EWLA 5HQ3A 1FVOA 3AHCA 4HDAA 3EGDA 4QRHA 2J41A 5JCOA 5ALFA 3NBKA 4PWZA 5G4KB 3D8UA 1Q0TA 1NSFA 2WTNA 3PU6A 3VC7A 3VGJA 2A8YA 1MVNA 1E2NA 5ALZA 3U0VA 4TROA 2Q3FA 1YDMA 2ZRKA 3CFYA 2DTDA 2GHIA 4EVSA 2UYGA 3HB7A 4FHZA 4UASA 5ECGC 1UJ4A 5D51S 5CFNA 2W2LA 3GLGA 4URUR 2C4TA 3GGOA 1T8RA 3ABSB 4H27A 4ZVQA 3RVNA 4I6JA 3V8RA 3BD6A 4JODA 3H1FA 2X3UA 2EWVA 3BOSA 3QPDA 4WADA 1Z5WA 1BNCA 3FR7A 2XVZA 5KQRA 1RAEA 3KTAA 5CPFA 1HTTA 3TQCA 1DCMA 2IYYA 2LPMA 2WMYA 1TEHA 3TFWA 1VLZA 1XL0A 4K03A 1NVMB 2ZUDA 2IUUA 1OIXA 4NJMB 3HGTA 1S96A 3DOHA 3DT8A 4XM0A 4RIGA 5SZIA 4B3JA 3M6XA 4OMCA 4OLAA 1OCEA 3QW4B 2EIHA 3TPCA 3NDIA 3ZK9A 1OAOC 4RPCA 3CF0A 4Q48A 2QU8A 4R2LA 1X8XA 1YGPA 2Y9MB 3KDPA 3TXAA 2O0MA 4QOJA 2XIJA 3RYHA 3R3YA 1G17A 3JQPA 4XYEA 1PN3A 5IFKA 1LTKA 2EERA 1ECGA 2WTMA 3FGZA 4YT5A 4YRCA 1ZO8A 2IK8A 2Q5EA 1EA7A 2GRAA 4NDZA 5TPWB 5B1EA 5K0EA 1AJEA 1CC1S 1ZOLA 3FLBA 4MRAA 3RTDA 1K06A 1V1RA 3TSZA 4BEBA 2YHAA 1R4AA 2R5WA 1JT9A 3ASYA 4LVNA 1LX6A 1CV2A 1H1LA 1LKZA 2C42A 2TSYB 2X3YA 4NF2A 4O5OA 3DNMA 2HC9A 4P32A 1XDWA 3NHSA 4FKZA 5KU7A 4IVPA 2ZJYA 5BOSA 3NBQA 5IF3A 3I5XA 4XDZA 5LPNA 5D8DA 1KI2A 2IHUA 3KJIA 1LRKA 4HG2A 2ZYIA 1L4LA 1X74A 1ZUWA 2R25B 1YQEA 2BFNA 2Z9BA 4ARSA 5FNVF 2IYOA 4PYRA 5A5DA 2HLPA 3QJ5A 3P2MA 2FCRA 1OH5A 5G1PA 5AUOB 3B1VA 5JCJA 3H5OA 1DGQA 1EWKA 1LWNA 2QLNA 5DM1A 5TPWA 2ZBDA 3R3UA 2UUCB 4LTNA 2C5SA 5EWJB 1I5EA 1ZH2A 2VTEA 4D0LB 1UXOA 1BX1A 2F2TA 1UDBA 2QZPA 2WAAA 2XNDA 2FFHA 3O1IC 4LGYA 2I6FA 3RYFA 3WYGA 3I5YA 5EZ5A 2ZJ8A 3Q5EA 1KI6B 4LJ4A 5TEVA 4LZNA 3BRWA 4E15A 1L4KA 4E11A 1MIHA 4M1EA 4KQHA 3AEZA 4CCYB 1NFRA 3PGMA 4KI7A 2P6OA 1BWPA 2I3BA 3HKDA 1JEYA 1U9YA 2DWUA 4NXNB 1OREA 2QRKA 4RGVA 4Q1DA 4RJJA 2QBYB 3PFNA 4NK5A 3E22B 2IZ6A 4JI5B 3TBHA 1PU2A 3U31A 4D8VA 3CTPA 3PP8A 3IP8A 3DQQA 4IKOA 4JUAA 2QTTA 3NTUA 2W2VA 2RGEA 3OETA 1YQDA 2D0IA 3CZAA 3MUNA 5HJ7A 4CM4A 1U1DA 2P1RA 3KB1A 1TO1E 4C2AA 1ADBA 2VF4X 3NHMA 2DBZA 3G2NA 3NNDA 1U3CA 4LJKA 3O74A 5AW2A 1T9DA 4LV5B 3NEJA 3I37X 5DM2A 3K70C 4OQXA 4U2CA 1F17A 4RACA 4KOAA 4FGJA 3ZIDA 1NE7A 1E66A 4KUGA 5FUXA 4KN9S 1ZSVA 3QYPA 4ZODA 4B6EA 4DANA 1XRJA 4DG5A 5JIBA 1E7MA 3SZLA 2NTYC 2IYUA 3L8HA 5I5EA 1HXHA 4FMCF 4RGYA 2KW5A 4HDSA 1KARA 1YDWA 1XI2A 4KK4A 3WIOA 5EP3A 7REQB 1Q7BA 3TNJA 5F1YA 4R51A 4C7XA 5FV7A 4DPLA 3E3OA 3D2CA 3IAEA 2Z6QA 3HO6A 4NZYA 2PH7A 1RHQA 1Z8FA 3PNOA 4MKXA 4YP0A 5IDXA 1M1YB 1UOOA 3KS9A 3RTCA 2NYAA 3IQWA 2RK3A 3PR1A 1YQ9A 5AXAA 1Q22A 1SXJA 4M1SA 5EMLA 3H6HA 4MQFB 3USZA 1DPFA 1EGHA 5EZ6B 3SNHA 3U0BA 1WCIB 3CR3C 2IIBA 4KODA 4BTLA 2C9CA 2PFSA 1X2EA 2Y92A 1J99A 3ITNA 4J0GA 4YJ2B 2CBGA 3IQDB 3NWBA 4WOJA 1Q7EA 3B78A 4R8VA 1Z7BA 4ZC1A 3LGSA 2YIJA 1DC8A 1JMVA 4CTNA 4YRQA 3BWVA 2A94A 3WRWA 1GKKA 3AHFA 5CLJA 3VH4A 2MSDB 2VJKA 4KSCA 5AP9A 1CWUA 1VCHA 1VXRA 2OYRA 1OX6A 3BJEA 5JBIA 2P0EA 3QXXA 1QUFA 3O3CA 4NULA 5K8UA 2FR8A 3OQIA 4LK3A 3QF7A 4BWVA 3RUDA 3DUWA 1JG2A 2C7QA 4HO1X 3HCEA 2B21A 4IRUB 4QM6A 3RNOA 3ROZA 5CLFA 1A0OA 1M2OB 3F4KA 3L40A 4H3KB 4HN9A 2GPBA 2C31A 5AJWA 4B6SA 2VQEB 2BTEA 3N5KA 4D56A 1TJ3A 4B74A 3PDUA 3GHHA 1W5TA 4AIIA 4RHFA 5F52A 4N7JA 4KO2S 2HAEA 4HGRA 3RHTA 3JY6A 4PINA 3AL0C 2FZCA 5LQRA 1RC0A 4UMDA 4JLBA 4NI5A 3Q6IA 1DFHA 1JH8A 1XQYA 4HKTA 1MPXA 1NYTA 1NBAA 1NBOA 2D2EA 5HJEA 4EY3A 4RCVA 1GL9B 3V2GA 3PUJA 3QX9A 5JZOA 5B5SA 5BXQC 2OAEA 1JFSA 5ADWA 1T43A 1PJCA 2WD8A 4I9GA 4H7KA 1XR3A 1C7ZA 2EZ8A 5CJ2A 3GW8A 1KFCB 2QAIA 1SWVA 4FGLA 1JSLA 1ZOOA 4RLSA 4DW8A 3RVSA 4JXXA 2QI9C 3JYOA 5F1KA 5JWHA 5AK6A 4BJ1A 1VDZA 3RUHA 2PRZA 4BJ5A 1L5NA 1YR6A 5DM0A 1IJFA 4Q9LA 3K1TA 1MX1A 3WLMA 1J39A 1WOMA 4QA9A 5JUWA 1LWOA 2VQSA 2WJJA 3HLTA 3PUYA 4AWBA 3A6EA 3VPDA 3KTOA 2BDTA 2QPAA 4EYQA 1AGYA 3DXZA 2JFVA 4G23A 4ASUA 1MDFA 2IDMA 4KLZA 4TLAA 3HSKA 4RVHA 4V0OA 2IFTA 2OV3A 2VP0A 3ZQUA 1JDTA 4EB3A 2NUBA 5BRJA 5CCBA 2F55A 5K4GA 3DEIA 3KHKA 1TA4A 3OOEA 4HZUB 5SY6A 3TL6A 3ZN2A 1ABEA 1DLIA 1KGDA 3OJLA 4ND3A 4JY7A 3U3DA 2H1OA 1R8SA 2Y2UA 3TRIA 4DDMA 1JBQA 3OQ1A 3V4LA 5CVVA 3V7WA 1FMFA 4PHFA 1G1MA 4RSRA 5GOTA 3HKCA 4YJ3F 1TVKA 2E4UA 2ZZKA 4C0AC 1QE3A 3OOJA 5FO1A 1WXGA 2ZANA 3ZK7A 2QTBA 4A3SA 3OT1A 1I3NA 1HY3A 3G7SA 4NMHA 2CSXA 3ENQA 4JI4B 3TL2A 4HZIA 2AUNA 3QPBA 3FNIA 2EG9A 2P2SA 4IICA 1Y1LA 1W4CA 3HU1A 4B09A 3U60B 2EZ9A 2SICE 1PFKA 4TKVB 2H4ZA 3RJTA 1NJ8A 2EEZA 2WJ6A 1FCJA 4F45A 3QI7A 4MR8A 4G56A 1DCKA 3G23A 1QV6A 5FPSA 4IRMA 3X1MA 4DSTA 1U0JA 2O50A 3M4JA 1NJ6A 2ZBVA 3IOYA 4GEGA 4Q16A 5LZ7A 2XB8A 3UWPA 2BFBA 5A3RA 4CR7A 3DKRA 4LZPA 4Q1FA 5DHRA 1YA4A 1SPBS 2R1VB 4JLWA 1E2EA 5CT5A 3X2SA 5C51B 1AS2A 3ZBTA 1UEJA 2JZOA 1K98A 1VE6A 2FSIA 3KEMA 3C7CB 2BHTA 3L7KA 4GW3A 1JYFA 3UAVA 4AO7A 1UAGA 1O7JA 1M2KA 2XJ4A 4JBXA 4OYHA 1N5JA 3TRKA 3ZGVA 3JAKA 1H42A 5A4KA 1CUDA 2F3SA 3BUSA 4JJEA 1P31A 5JNUA 1G60A 4WVLA 3AM1A 1YB7A 2Y1OA 1A96A 3JQBC 4TSFA 5F76A 3UHFA 2DHEA 5A4IS 3OZFA 2H92A 1Q7RA 1T0PA 4D9EA 3GPDG 3RD5A 3KWFA 2XT9A 4FCWA 1RJEA 4FYIA 4K6OA 3KDSE 2PLNA 2E18A 3H8WA 1M1NB 1Q19A 2DYKA 4EHIA 4PBTA 1PNVA 2WA1A 5EUQB 3HKEA 2GD6A 1ZRHA 3KZCA 2VSXA 4PSKA 2JI8A 5F35A 4L3VA 3KTFA 1ZS9A 4YMSA 5H80A 3ZX5A 5IJ9B 1YCFA 1IN5A 1XJCA 3QFSA 4FFDA 1NRWA 5EGNA 1KEPA 1NY5A 3I12A 4ZCQA 1XZMA 5JO0A 2Q8NA 2UYCA 4CTOA 4XUCA 4ZIRA 4G86A 2ZCJA 5FTMA 1YS2X 3IUBA 3JS5A 3QUAA 1E2DA 1A71A 1EK5A 1VLMA 1YOBA 2VPXA 3R77A 4I4CA 1KSGA 5A5GA 2GCGA 4MQ6A 1ORVA 4Q1VA 1X1EA 5CU7A 4ZYTA 3H0KA 1G6KA 2H1RA 1D6NA 1TC1A 1PTJC 2B78A 2O3UA 1J8FA 1DOZA 5DLDA 4JZKA 1XZKA 1Z35A 3LWZA 3UV6A 2G5PA 2R7MA 3E2MA 3QENA 4IOKA 3UAYA 1RLIA 3S99A 2BLNA 1VPLA 1FP1D 3EZ2A 4IIBA 3I39X 3PQFA 4JS0A 4UTVA 2VT2A 3EXFB 4DLYA 1C41A 3A4VA 4NXMB 4NHOA 2MOKA 4NCAA 3AVXA 3BK7A 1DQRA 3EQ8A 3QPVA 4QOHA 3QBJA 3ACBA 3BSYA 1PJLA 2HYDA 2XA1A 3KRTA 5TF0A 5G4KA 5I6DA 2WSSD 4BWGA 2POCA 3O7MA 2R87A 5EHNA 1HOTA 3CUVA 3PIIA 1HYQA 4WNAB 4FYMA 4TMKA 3U7HB 4K9SA 4I8XA 4GOLD 2P2DA 2O2SA 1CDEA 2EFHB 4Y2GA 1GPLA 4J4BA 4IHJF 5MN5A 5AD1A 4OXKA 3DE3X 1P2BA 4EHFA 4PS1A 4G37A 3IDSA 4E1BA 4MVXA 3OIDA 1OVGA 4I1SA 1THGA 1DC4A 4X1YB 4R41A 2NU6B 5DN6D 1OB5A 2R6AA 2AOUA 3U7QA 5CA0F 2C94A 2VHCA 3JARB 4IVQA 1JB9A 4GLJA 5K0NA 1I0ZA 1CY6A 3LVBA 3LQFA 5IC5A 1WVGA 3OQIB 5ICMA 1OFGA 1E6MA 1E89A 3ENZA 2JFUA 4MR7B 1E9EA 1W52X 3WMGA 4B7CA 3ZLBA 2ID4A 5DBIA 1R50A 2FPWA 3NHJA 4L4UA 2B69A 4I9HA 1XA0A 1P45A 1Q21A 1FFBA 3AIIA 1XRNA 3E84A 4ZYVA 5F9HA 2QA5A 4LHWA 3FCEA 2CE2X 3DEFA 3MMNA 4PQRA 4PXAA 2WKQA 3U3XA 5FYDA 5K3FA 1Z47A 4J1TA 4I6EA 3QHPA 4BASA 4GNKA 2BGJA 4CQMD 4DBVO 2GAIA 1Q1ZA 4BV8A 4KE9A 4XDYA 7MDHA 2GD2A 4RZIA 3RC9A 5EOVA 4DJJA 4Q4LA 4MPPA 3IVAA 3M6AA 3I32A 4YA6A 1TJYA 2IGBA 3FFTA 3H3FA 3K0AA 1VE9A 2F8TA 2AVNA 1W5BA 4Q4JA 3EF1A 3KQHA 5JNWA 4YJHB 2SBTA 1T4CA 3SIWA 3EVNA 2YRWA 3OX2A 1GPAA 1RKQA 4MA5A 4Z54A 1ZFNA 1P9NA 4BNTA 5EKUA 1ZVJA 2GPAA 3DF9A 1YFLA 2Q5FA 1A69A 5KTSA 3FUCA 1Z16A 5BSMA 1XZGA 2PIDA 3BTVA 4XM2A 1UIMA 2GAOA 2W6JD 3CT6A 1AQIA 1RQNA 3X1XA 2IE8A 5HS6A 5AOCA 4QOFA 3NX4A 4MP8A 4XIGS 3VC3A 3RBVA 2QE7D 3UFBA 3CB2A 3HVUA 3N8IA 5DJ5A 3STVA 1ZM7A 1EI9A 1O54A 3OT4A 2F1JA 4ZPXA 2IIVA 1GQYA 1M2GA 3GYBA 4FBGA 4DIUA 1MX9A 1CPYA 1D4ZA 4CZ2A 4QECA 3IV7A 4A2WA 3DFZA 2X5XA 3NVAA 1Q0PA 3R3WA 1M2JA 2G07A 1PNRA 2CVPA 3HBFA 1GDTA 2IXFA 4E22A 1P0PA 2BI8A 2ODNA 3WLEA 2GN4A 4QVIA 3EF0A 4BO6A 3CKMA 3QBTA 4FEYA 3C5WP 3IURA 2QR5A 1SUIA 2QMEA 1XZQA 3M5WA 4KXVA 1BWRA 1LTQA 1OYYA 5JFOA 5LVAA 1V37A 4M99A 3B9BA 1R66A 1ZWLA 5KINB 3HCNA 2BMEA 3KAQA 2YY5A 2YVLA 4XPZA 3AVVA 4NBVA 1Q7TA 1U1FA 2IU6A 2VHZA 3L7NA 1QCZA 4JIMA 4QATA 2AKAB 3S44A 3L4JA 3RFTA 1JPUA 4PO1A 1W88B 3WISA 1ISSA 2Q27A 4FNAA 4Z4IA 1INLA 1BXGA 1UC4B 4XJXA 1PBTA 3TAXA 2WMOB 1E2GA 4H17A 2JIZA 2NO6A 3R0XA 1C8BA 1NXOA 4BX0A 3Q7TA 2XITA 4XB6B 3DD5A 4NEHB 1O5OA 2OHVA 1OGIA 2XJ9A 3EDQA 3M70A 1U8CB 1DO8A 1WLYA 4HGPA 3GFBA 1I24A 1FNCA 3OH8A 1J6UA 4LVCA 4BLRA 1EYZA 1Z83A 4CEJA 4WOPA 4Y2SA 3K9QO 5AOAA 3OE4A 2I34A 3W7VA 4BZQA 2RDMA 2AD5A 3EZNA 3ISVA 3HB4X 1GSIA 4A7PA 5HZHA 3TQIA 4BOYA 5A9SB 4Z99A 1IY9A 4K28A 1M1YE 3NGMA 2C07A 3O0DA 5AOVA 3HN2A 1RT9A 3OIFA 4N5DA 2Z3WA 1ISGA 4OQNA 2ODEA 2VTBA 4RE5A 5CB8A 1TM4E 3B8EA 3GELA 2W2KB 2H11A 4D6YA 3KL2A 3F8TA 5E1BA 1YONA 3U49A 1TYCA 4OQYA 3MD9A 1FDVA 4PGFA 4U7HA 2L42A 3W34A 1GPDG 2X9VA 1FRVA 4U39A 4UCXA 1U80A 1ZPDA 3HPQA 5GJCA 4F12A 3O8RA 4HLDA 1PE0A 2H51A 1E2KA 3TOXA 4BJHB 3E9CA 1WCYA 2RBGA 2Z09A 3R2JA 2AQKA 3O8LA 4LXXA 4J4TA 4CNQA 1H2EA 4F46A 1IOLA 3TTTA 3B3QA 1H0HA 4LEIA 3T3MB 5HEKA 3R9IA 4AT1A 3QEMB 5G1OA 3SMVA 1VYTA 3BA6A 1CR1A 3JQFC 4K6MA 1A8SA 1UPFA 2YW2A 3OUZA 3Q9SA 1T13A 4MR9A 4MDFA 1X9IA 1MEJA 4Y9RA 3F8WA 3O1HB 3RABA 1EVEA 2AE1A 2QG4A 3V7YA 4QYTA 2CVQA 2FVYA 1Q92A 4RY2A 1NP7A 3PXDA 3HTXA 2RHBA 3UYKA 3OKPA 4DF3A 2GVDC 3AKZA 5FL3A 4A16A 2OBYA 4MW4A 3IAS1 2ZRNA 1UT5A 1WEKA 2VAVA 4HLNA 1YAJA 3CF4G 5C5IA 5AVWA 3HP4A 5M5BA 4UDYX 4ZI5A 3OY7A 1RCUA 2PXCA 2PGJA 4F4DA 4XWWA 4C4RA 1E69A 1NI5A 5A05A 2JJQA 3MGCA 4Q9HA 2V7GA 3EUEA 4ID3A 1P3DA 3KJHA 3RAFC 3TI7A 3RIGA 1RD4A 2XGJA 1OYVA 1SOAA 1RLTA 1CNMA 2C2XA 2VPZA 2WIFA 3QH4A 3CX4A 1D4OA 5LWHA 3NWOA 2WIJA 1HZZC 1WXWA 2ZYSA 3G8CA 1Z0IA 2O2EA 3DL0A 4I5FA 4KCGA 2QPTA 3ZCXA 2JH9A 3OX3A 3CZPA 5JD6A 3JAKB 1BMFA 2FZ5A 2JLAA 3BK2A 1NUPA 4UHBA 1HZZA 4QRDA 1ATIA 3D3QA 3DE1X 5ELLA 4FQ8A 4CMAA 3H42B 1UEXC 2L82A 3WBFA 1PJRA 4F06A 4K9PA 4R71A 1N2EA 4UBOA 1ZHOA 1CR4A 3TYXA 2Y0EA 1KI4A 3K0FA 3WRVA 2C4MA 2VCHA 3QBVA 3KPWA 1U9CA 1CK4A 4IQ0A 5TGDA 4BIMA 5AUQA 2LCQA 4L28A 2O8FB 3AQ4A 3GG9A 5FP0A 1FQJA 2V55B 3W8NA 3E9DA 2EKQA 4FGKA 3HB9A 2E21A 3CZ4A 1OYOA 3RK4A 5JC1A 4BJ3A 4GT1A 1F7UA 5CVCA 1P7VA 1ZN2A 1E7SA 3EN0A 1E94E 3FWNA 4G5OA 5B12A 4I8IA 2DKOA 1GDDA 2FPPB 3MCVA 4O4JA 5IKOA 3FYUB 4MYHA 3HZZA 3I76A 1DX9A 1ZVMA 2JGAA 2VJMB 3MUFA 1XK6A 3GUUA 4FR5A 4MO9A 2WNIA 3RS0A 1ZMOA 4EF6A 4NHEA 1E0SA 2XD4A 2V1XA 1WUKS 1Y3DE 2R00C 3A9SA 1RRGA 2O7RA 4XTRA 5AVJA 1NVEA 2IIPA 4P3OA 3WYCA 3A14A 4RXTA 2FKAA 1GILA 2A67A 4GBED 4NSNA 3FMGA 5BNZA 2F3TA 2QROA 4FB4A 4LWZA 1YBFA 2IUEA 4HLUC 2PGAA 5DP1A 3SSAA 5FLKA 1ESCA 1KFJB 4F3KA 4W1SA 2FWPA 3G2HA 3SICE 4BN4A 5JARA 4EECA 3ZHRA 3ILYA 1QMPA 4P7KA 1CD5A 3ZS8A 1N8TA 2HNBA 1BCRB 1YMQA 3F8SA 1NIJA 4XWYA 3L1VA 1H8ED 4QOIA 4JJ8A 1NX9A 3ZDYB 1A4IA 4OHOA 1EQAA 4RZ3A 1N5KA 2GHTA 3I8XA 4NBUA 3WAKA 3M82A 3JXEA 1B8UA 2IYEA 3RFFA 4N54A 5EZQA 1QQ6A 3RPEA 5KX5B 1WMFA 2GZ1A 5KNDD 3UUGA 4ZQIA 1IAQA 1GIAA 3DAFA 2EX1A 4W5TA 1VFNA 4PZDA 2PLAA 4A0SA 1OI3A 2FXIA 4KLAA 2RCYA 3SC2A 5EE5B 2CLMB 3RS8A 5AHOA 5EG5A 4CIDA 1I4TD 2RB4A 3PJFA 3UUEA 3OJEA 1V8OA 3EPRA 3S55A 1KP2A 1PFWA 5H68A 2BMFA 3HV0A 3DEKA 3NDJA 3A70A 5GONA 4BQSA 4D41A 4EPYA 2DT8A 4M1ZA 1S7CA 1C8KA 2I2AA 3HN6A 4HDRA 4LF9B 4U8HA 5JYBA 1KNQA 3ICCA 1G64A 3DJYA 4KX3A 1BTOA 1MCZA 1SBZA 1XYVA 3OAAD 4RVNA 4D6XA 3SK0A 2GAAA 3V9PA 4QNMA 3STWA 4A0RA 4BNKA 1DOHA 1MJGA 2G25A 4PV7A 4I08A 3EEQA 3BGWA 4ZAYA 2JIBA 5BY2A 1YSCA 2YCLA 3RC3A 2AZDA 1KSJA 3G0BA 2XLBA 3TSYA 8ADHA 1J09A 3DTVB 4XQ0A 2XB6A 3SJZA 4DYDA 5F23A 1A5BB 3LLUA 4N82A 4ZAVA 3LK7A 4MHSA 4I55F 1VKJA 1VKRA 2EW8A 3O4HA 5AJHA 3UH1A 1QONA 5FOXA 1U0RA 5FPYA 3RAJA 4Y30A 4UZEA 1P62B 3EEOA 5F98A 1TKBA 3GPCA 4YCJA 5KQLA 1B74A 2YQ5A 4EB0A 4Q4DA 2APJA 3PWKA 5KYWA 2BM1A 5K8JB 4C22A 1YBAA 5TDHA 3LRPA 3UAZA 3ZCUA 1ST3A 5ICSA 4YPOA 1OB2A 2GXSA 1DHTA 4L8GA 2CT8A 4Q9AA 3OPYB 5BQXA 1OZAA 3CJQA 3OQJA 1SHKA 4RHYA 5T3YA 1U9JA 2F43A 1NT4A 3UUWA 3EJ6A 4D43A 4DYVA 2UU9B 4YP5A 1EESA 4ZOBA 1N3LA 1JBEA 2HSJA 1M6EX 3W78A 1HYEA 3DZGA 4M22A 2B4QA 3PGJA 3OO1A 1PR0A 3P5SA 4IQ4A 5D00A 2XSZD 5G0UA 5JD3A 3DC7A 3TDNA 1IUKA 4PTYA 1SC9A 1GFSA 2GR9A 2QK4A 5AW9A 3VZPA 3HXMA 2VJNA 2X22A 2X4GA 1NBWB 4QGAA 2QVXX 1AIPA 1RQ2A 2A2ZA 1Y5NA 4BKOA 5DNVA 2PMFA 3AHDA 2OV1A 2CSUA 3QYAA 5K03A 1XJ0A 3JQFA 4G1VA 3ZWPA 3VJMA 1XMQB 2O54A 3AW9A 3IA7A 4A2QA 2UZ3A 2AEJA 3OO0A 1CSEE 3SS8A 4TRMA 5LYJF 5C32A 3DG9A 3VR4H 3Q6MA 4YREA 1JZQA 1CQWA 1D07A 1XQVA 4Q15A 4NX2A 3RVJA 1P4JA 5HZGA 2DSNA 3ZHUA 1RQ7A 1ADCA 4AULA 3F97A 2UV8A 5SYAA 3PVSA 2P91A 1XTKA 4QQKA 2C77A 3RVPA 4CIBA 1N92A 2QP9X 1EFPB 4IPTA 5EHXA 1SMKA 1TCVA 3DE2X 3DZDA 4HEJA 4MS3B 1IHYA 2P9FA 5DCWA 5AKXA 5E6RA 5KVQA 2QM3A 4JNCA 2G67A 2GUGA 3S1AB 2IYAA 1NULA 1RWVA 5DOVA 4E5DA 4YCMA 1ADGA 4DVGA 1QUEA 3KC2A 3OP1A 2HCRA 2VTKA 3BIFA 5ALSA 4WJZA 2X6RA 1KTIA 2WNHA 4PIVA 4WZAA 2QBYA 3F9RA 4KJZA 3NT5A 1QTRA 3LPAA 3SC6A 2JIRA 3GP8A 4B6JA 2GLXA 3NHFA 4OTZA 3F5SA 4UM9D 4D57A 1K8RA 1X1SA 3C14C 1DIOB 4MQ4A 5I51A 2GRUA 3L1HA 2YRXA 1E9VA 4QNNA 3K9BA 4E6PA 3VR6A 4DRXB 3L0ZA 3VR3A 2FRDC 4MUNA 1AQ6A 3N6XA 4GPD1 4G5GA 4X8MA 1QAMA 3KR2A 4S1PA 4YAOA 5EFZA 5C8ZA 1J0DA 1R15A 4MQ5A 5TY0A 4CU2A 2WIKA 3D64A 1W8IA 3G82C 3SCZA 3PLAE 3BMOA 1PGOA 1XQWA 2IEYA 4JKIA 3TIFA 2XBMA 3W5SA 4QX6A 5LQAA 4WUTA 1PRYA 4OYLA 5CB6A 4AO8A 4LAFA 1UCFA 3I5MA 2AJLI 5BQOA 3M6WA 1ZJWA 3CCCA 1PI3A 1OHHD 4O1IA 4E32A 1PX2A 2GPSA 5A0VA 3NANA 4BNGA 2JRLA 4F3NA 1L8QA 3BDAA 4H3HB 3RJ9A 4BO3A 4P3XA 4NABA 3P45A 2YZNA 1CDOA 4A03A 1ZK0A 3K6JA 4WESB 3CF2A 3O0TA 4AO6A 4BQPA 3E6AA 1TM7E 1J2EA 2VDQB 4TT3A 2IDJA 3GPIA 3MAGA 3WRXC 4EEXA 3CWQA 5CDFA 3AHJA 5TQ2A 2H1HA 4UUOA 1ZOPA 2PRSA 3AR7A 3FCUB 5HMLA 2PSDA 3M1IA 3O92A 3IUPA 1X1TA 2WYWA 1NLUA 4RKQA 4HQRA 4MVJD 2WF6A 3T12A 5F2NA 1WZUA 2JIPA 4FINA 3HCAA 3SSNA 2XUKA 4FLEA 4PX5A 5DTJA 1QVZA 5B57C 1HT2E 1FUIA 5GGXA 5KNCH 5L3QA 1GAXA 2F1RA 2FFBA 4Y2PA 4O4HA 1IONA 1BWSA 1WOYA 2O2CA 3JWHA 3W3AD 2FEPA 3OZDA 5J43A 1UFKA 1H4TA 3PCTA 3HPRA 2OQVA 4Z4FA 3SHFA 4NPAA 3BCHA 4QLBA 4CV2A 4AMGA 5A06A 4G63A 5EIAA 1LLCA 2R44A 4LQCA 4B9AA 1Z8HA 4J91A 4TS4A 4MDHA 1MGOA 4HMPA 2YMLA 4KUEA 2BTQB 1XVVA 4JVNA 4ZI7B 3IBTA 3ELYA 4OHCA 1MFZA 2JI9A 3LLCA 3GRYA 3PPIA 3I6ZA 4XUGB 1YB2A 3VR6D 2JD1A 4EYGA 2YVKA 3B1KA 1KFKB 2B2CA 4GQIA 1IXYA 3SJAA 4ZTBA 1GSOA 1NP3A 3LS2A 5C34B 2RSLA 5G3YA 1VPDA 4MUGA 1AQNA 4U7FA 4UREA 5HE9A 5C7YA 2ONZA 3AT1A 2G1KA 3UBTA 2J7PA 5ITVA 4CQNA 1ORWA 3ESBA 3L6EA 1KRWA 4X97A 5DXJA 3EMBA 3RC8A 4MWZA 2FXVA 3ID6C 4FSDA 2VF8A 4FYHA 4KRGA