4F21A

Crystal structure of carboxylesterase/phospholipase family protein from francisella tularensis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
217
Chain Sequence
NAMNYELMEPAKQARFCVIWLHGADGHDFVDIVNYFDVSLDEIRFIFPHADIIPVTINMGMQMRAWYDIKSLSLNRVVDVEINSSIAKVNKLIDSQVNQIASENIILAGFSQGGIIATYTAITSQRKLGGIMALSTYLPAWDNFKGKITSINKGLPILVCHGTDDQVLPEVLGHDLSDKLKVSGFANEYKHYVGMQHSVCMEEIKDISNFIAKTFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large scale structural rearrangement of a serine hydrolase from Francisella tularensis facilitates catalysis.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Carboxylesterase/phospholipase family protein
total genus 58
structure length 217
sequence length 224
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f21A00
1D07A 2ZJ7A 3VDXA 5JAHA 3I6MA 1PFQA 2PSJA 3C6BA 3BJRA 5CRIA 4QDXA 3ILSA 4UHFA 4ZV7A 1JI3A 1G66A 1ZJ5A 4IH1A 3VISA 1E8DA 3ESDA 3DQZA 3D7RA 5ALFA 4OPMA 3WL8A 1H2XA 3I2FA 2H7CA 3O9VA 5AM0A 3M82A 4PO3X 2WUEA 4CCYB 2VAXA 1QJ4A 3IULA 1TCAA 1H22A 5BOVA 1ZGBA 4U2BA 1ACLA 1CQWA 3O4HA 1IUNA 5KWIA 3IVMA 4O08A 2WG1A 3C8HA 3BIXA 4UFNA 5ALZA 1DTEA 3TRDA 2OLEA 4N5IX 3WKEA 2WIJA 1FFCA 1ISPA 1TQHA 1BCRA 5JZ9A 1GPKA 4QWWA 4X3CA 5E4JA 5C81A 2JGFA 3AIKA 5ALRA 1R4ZA 1RYYA 1VKHA 4RPCA 5FOQA 2XQFA 3CXUA 3WZMA 5DYWA 4LXHA 1HL7A 3GUUA 5ISMA 2ACKA 4Q05A 3KSRA 5AKLA 2OGTA 4FNGA 1GGVA 3VKFA 3D2CA 1MX1A 1YB6A 3KWFA 4PSCA 4C88A 1QIIA 4BE9A 2CMFA 5BWCA 3DDUA 1XZEA 3G02A 2GBFA 4J3JA 1UK7A 4J0HA 1FFEA 1XRRA 4G8BA 3HZOA 3C5WP 3TJMA 5D7BA 1QIMA 1C7JA 4WDRA 4F21A 3FLAA 4Y7DA 3H1BA 3ZLTA 2OCGA 5A62A 1CEXA 3CCCA 3FYUA 4V2IA 4KAJA 2ZYSA 4WY5A 2RHWA 2PKYX 5DLPA 3AZOA 3VXKA 2Z8XA 4B84A 3C6XA 4PW0A 2Y1KA 1W76A 5K3AA 1CRLA 3EBLA 3R3YA 4GWLA 3ZI7A 3G0DA 1FJ2A 2OCLA 1BEZA 2QVBA 2HHAA 3D0KA 4KR0A 1K5PA 5LZ2A 1H23A 4YK7A 2GYUA 2VT6A 3VJKA 1BN6A 3DCNA 4EZIA 1UK6A 3M3DA 1J07A 3WWDA 2WQZA 3OC0A 3N0TA 3AZQA 3H1AA 1E5TA 4B83A 2D0DA 1EA5A 1XZFA 4UUQA 4Y2RA 3WWEA 1SFRA 5JZSA 2VEOA 4KRYA 4A23A 5C7YA 4AXBA 1EI9A 5FPQA 2XUHA 5ALNA 3IUJA 3I28A 5ALYA 4EB0A 5HF9A 1CUJA 2O2GA 4GBGA 2CB9A 1ODTC 3ZPXA 4INZA 1MU0A 4BDTA 2IIVA 3WL7A 1YB7A 4Q3OA 1SCQA 5AK4A 3OTQA 1ZD3A 1QTRA 1UKAA 3C5VA 3H2KA 4WY8A 4LYEA 3T4UA 1QIGA 2ES4A 4M0MA 1UWCA 1XZGA 2HA7A 1CUZA 1IUPA 4OCZA 3HRHA 4DMHA 2B61A 2C4HA 4N8SA 2B9VA 1YSCA 2AJBA 1QONA 4HS9A 1DWPA 1T4MA 2XUKA 7YASA 3DJYA 4BRZA 1YS2X 1JJIA 5JZBA 5AI0A 1FSSA 2AJ8A 1GXSA 4BVJA 5T4FA 3EQ8A 2XQJA 2G5TA 4UHBA 5AH0A 4FFWA 2WU3A 3ZLUA 2HADA 5AI8A 3QPAA 3G8YA 3DYVA 5IVDA 4BCBA 2PSDA 1XKTA 2WUFA 3WMRA 1WB6A 3BE8A 2WJ4A 2B4KA 1CUBA 4YASA 4OB6A 4RGYA 4M0FA 3EIOA 4Z49A 3I6YA 3BDVA 1ZI6A 4B6GA 3PDCA 2WLSA 1VE7A 3U1TA 2EDAA 4XWGA 1EX9A 4NVRA 4Y2UA 3N2ZB 5CT4A 3FVRA 3STWA 1R1DA 2QT9A 5ALWA 4BATA 4ARAA 4EY6A 1LGYA 1FFAA 4LHEA 3WK4A 1UT6A 5A7GA 2ZSIA 3I2KA 1EHYA 2GBGA 3ZLVA 3JWEA 1CUSA 1A7UA 1F0NA 1UOPA 4CG2A 4MQMA 3WZLA 4GECA 3OOSA 4CG1A 4OD0A 1E66A 2AXEA 4N8EA 2WHQA 3IDAA 3W06A 4X97A 5YASA 4E46A 2PM8A 3IURA 2QUAA 1TKRA 1MAAA 3AINA 2XE4A 1J1IA 3L1IA 1ZIYA 4G9EA 4A5SA 2VJBA 5LZ5A 1UOOA 2GZSA 2HU5A 4QDZA 5JIBA 1QIJA 1YAHA 5EFZA 3FLBA 2D5LA 4K6HA 2WG0A 5ALKA 4X71A 1XRPA 3Q0TA 1ZGCA 2GBIA 4UHDA 4HVTA 4Y2TA 1TCCA 4IQ4A 3PI6A 2PX6A 3CCBA 2JGMA 5I7UA 4X95A 4LKOA 2JIDA 4BC1A 3G9XA 5JANA 2X5XA 3C87A 5ALJA 4X6YA 4OU4A 4GDMA 4UHCA 5SYMA 4X94A 3DLTA 5I9IA 2BUAA 1AGYA 2V9ZA 1Y37A 4I19A 2ZJ6A 5CW2A 3JYHA 5ALTA 4MJ3A 2XMDA 3OPMA 5IH7A 5EIHA 3PUHA 3GZJA 2XUGA 2I03A 3A2LA 3D5EA 1TAHA 1UK9A 1P0IA 3DOHA 1QIKA 4KACA 4X91A 1CUIA 1E89A 5HZGA 5E2IA 3VVMA 2QZPA 1NU8A 3BDIA 5IKXA 4OB8A 5AOBA 3TGLA 1KU0A 1XKLA 1CV2A 4PQEA 1QFMA 4S0XA 2XMQA 4KYVA 2BJHA 3O4IA 1A8QA 1AUOA 5CT9A 4C01A 5CH5A 4ITVA 1BS9A 3H18A 3B5EA 3OURA 2QXUA 5KREA 5EIAA 1XFDA 2VTVA 5FLKA 4P93A 1XRQA 5BV7A 3IIIA 4MQLA 3C43A 1HKHA 4FWBA 4BP9A 1B6GA 1VA4A 1MNAA 2VT7A 3FOBA 3GFFA 5DNUA 1ZD2P 3R3VA 5CH3A 2WG2A 3IBTA 4DMKA 4QZVA 1OILA 3BF8A 5AM3A 3W9UA 4UBNA 4Y2PA 1Y7HA 4ZREA 3FSGA 2GBCA 5LZ8A 5AI6A 4JEIA 4AB1A 3FYUC 3BXPA 2PSFA 2WFLB 4FLEA 2Y6VA 4EY8A 3DL7A 1EDDA 1S8OA 2HA4A 3I2IA 1AMNA 1EINA 5K3CA 5JAOA 5K5EA 4BB0A 2OGZA 1CFJA 1LPBB 3FNBA 4G4JA 1LPMA 1GKLA 4QDOA 1DQYA 3GROA 4KE7A 3D59A 3WWCA 1XZCA 1WM1A 4UBLA 5JADA 1XRLA 4WFJA 4Y2XA 4TPKA 2CUTA 1ZD5A 2XQIA 4L3WA 2PSHA 4H35A 4P9NA 1X70A 1WHTA 1UFOA 3SX4A 4F0JA 4DMCA 3DKKA 1VZ3A 4BZWA 1IZ8A 3WKCA 4FOLA 3STVA 1CUGA 2WJ6A 2VA9A 2QMQA 2ZJFA 1W75A 2QTBA 4AX4A 1DWOA 2DQYA 4AQDA 2ACEA 3E3AA 4ZWNA 4LXIA 1ZIXA 3D2AA 1XLVA 4QDTA 1YS1X 2Z3WA 5H3HA 1HDEA 2JGIA 4IH4A 4NMWA 3R41A 5ESRA 2YYSA 2ORYA 1LZLA 1X2EA 3H17A 1MTZA 3A2MA 4GLBA 3Q8WA 5JD4A 2JGLA 2ZYHA 2WIKA 4QE3A 1XQWA 1AKNA 5AOCA 2WIGA 4KE8A 5LYYA 2HA6A 3W9BA 2XQGA 4B9AA 4DNPA 2BUBA 2J4CA 2WM2A 4QDUA 2OAGA 4MYDA 3H2JA 4FMPA 4ZGBA 1ZI9A 4H7KA 5K3FA 2HA3A 3C70A 1QIHA 1H2WA 4MXDA 4M0EA 4QA9A 1XZDA 3MVEA 5HF5A 1ETHA 2Z8ZA 2WHPB 1SCKA 2O7VA 4RE6A 4X6XA 3YASA 2GZRA 5JALA 2XMZA 4H7JA 3M83A 5K3FB 2WFLA 1JMYA 4E11A 4GEGA 3MUOA 4Q34A 4KAFA 3WYNA 1X2BA 1HQDA 3L1JA 4G5XA 3I2JA 1Y7IA 3NWOA 5D3ZA 5LP1A 3A6ZA 4G9GA 4BBZA 2XUPA 3KWJA 3FVTA 4U2EA 5AO9A 4UHHA 5KBYA 3HI4A 3H0CA 3E0XA 4DSAA 5AKJA 4HAIA 3QZUA 4CCWA 4N5HX 4Q3KA 5JARA 4JUIA 1LPOA 4XIIA 1QZ3A 3HYSA 4B81A 5DTJA 4JYPA 5E4TA 2OAEA 2JEYA 4E15A 2IX9A 4DNOA 2FJPA 1GZ7A 2JGKA 5HQ3A 3E4DA 5AP9A 1EH5A 4DSZA 5AI9A 5HF6A 3HABA 1AC5A 2XDWA 2ROQA 3I2GA 4BAUA 2V97A 2XMCA 4U2DA 4UBJA 1YAJA 2XUAA 3UUEA 4GHWA 2YH2A 4DIUA 4J0DA 5JAUA 2GYWA 3ZV7A 2XMBA 5AI4A 1FFBA 1LPPA 3QM1A 5C8ZA 2H7YA 4J0CA 2WU4A 3G9TA 4EY4A 2LIPA 4J0IA 1DINA 1GPLA 3KXPA 4KE9A 1MN6A 3I6ZA 4EY5A 1XQVA 5T4BA 3V1NA 3QVMA 4UHEA 1CR6A 1ZICA 5AKXA 4U2FA 1YR2A 5AI5A 4BRSA 3WI7A 1ZJ4A 3BIWA 3JW8A 5DYTA 1CPYA 3HEAA 3BF7A 1QLWA 3V48A 1DT3A 2VJCA 2XUDA 4A16A 1VXOA 3WWPA 1XLUA 2C0QA 4CIAA 3H2GA 4KJXA 1BRTA 2AJLI 4G4IA 3WIBA 2V96A 4Q82A 5ALOA 5ALEA 5HKBA 5AKHA 1CUVA 2PU7A 2O7RA 1MAHA 5AKYA 2XB6A 2PSEA 2Y6UA 4WFIA 1ORVA 2J3QA 4UBMA 3ED1A 1K63A 1LZKA 4ETWA 1BEEA 1Q84A 1QO7A 5CURA 2PBLA 4FFVA 4E14A 4X7BA 1NX9A 4X90A 2OQVA 4H18A 1Q0ZA 4BZZA 4HZGA 1N5RA 3V1KA 1I6WA 3NUZA 3PE6A 1VLQA 3WKAA 3LCRA 4DNQA 2PL5A 1A8UA 1RP1A 3U0VA 4UBIA 4HRYA 5DNWA 4BYMA 2PU5A 1EK1A 5AM4A 3WA6A 4B85A 1A8SA 4PF1A 2WTNA 4FBMA 1KEZA 3X3HA 4Y2QA 4Y2SA 2Z5GA 4C87A 2RONA 2HFJA 3O4GA 3HLKA 5HK8A 2DHCA 3KDAA 4J03A 4H7HA 1AQLA 3ANTA 3FCXA 1ORWA 3WJ1A 3R0VA 3STXA 1DT5A 5FV4A 5ALXA 4C6HA 4ZXFA 3C6ZA 4L9AA 4LYDA 3DD5A 2OCKA 3S2ZA 1MX5A 2OGSA 2NW6A 3H2IA 4TGLA 4J7AA 2WUGA 4XVCA 5DWDA 3R3WA 4UBOA 3HC7A 1A88A 1MO2A 2WIFA 1U65A 4AO6A 1R9MA 3LS2A 1ODCA 2XT0A 3AIMA 5DYYA 5CT5A 2QXTA 1XQXA 4UPDA 4EBBA 3BL8A 1RWQA 1B41A 5FUMA 1L7RA 4QNNA 5LKRA 3SWWA 3G9UA 2VQ6A 2HA2A 1OXMA 2XMSA 4B0PA 1W1IA 4WDQA 3RARA 1MT3A 4PSDA 4QLAA 5HFNA 1P0QA 1R9NA 1TK3A 4G4GA 4BTVA 3K2IA 3H2HA 1YA8A 2HRQA 2PPLA 3WIOA 4F60A 1YCDA 2C0PA 4FNMA 5AKEA 5AOAA 4H77A 2ZYRA 4J0GA 2VJAA 5I8PA 3H04A 1P0PA 4HXGA 3D3NA 2Y2VA 2BGNA 4GXNA 2QS9A 4IHAA 3DNMA 3QPDA 1UOQA 4H7FA 1SC9A 1BN7A 1WPRA 4MEAA 4IO0A 1AURA 1GPNA 1BU8A 1XQYA 4I4CA 2O2HA 4CIBA 4U2GA 5KWJA 2DR0A 5K3DA 1Q0RA 1XZHA 2BAGA 2DCMA 4H0CA 5IVKA 5JAPA 2RIPA 1G4HA 4L72A 2VF2A 4X92A 3LP5A 1NU6A 4PNZA 1LPAB 2JGEA 2WHPA 5E4YA 1QFSA 5HQ3B 4UFOA 4QLOA 3DKRA 3TEJA 1CVLA 3K9BA 4JYMA 1BE0A 1Q83A 3G9ZA 3R40A 2OCIA 2H9YA 1F0PA 2YASA 3W2TA 3PICA 3KOOA 5IVIA 1ZI8A 1XLWA 3QMWA 4HXEB 3V9AA 1HLGA 3GBSA 2YXPX 1E8MA 1XZLA 1W52X 2HRRA 1QTIA 2JBWA 1W4LA 1N1MA 2HM7A 1HPLA 1CQZA 1CUUA 2H7XA 1CUYA 4ZV9A 1XRMA 4WCVA 1QGED 5ALIA 3UMJA 4OUKX 1JJBA 3H19A 4BVKA 5ALLA 3W05A 5LZ7A 1VE6A 1TCBA 3F8SA 2RAUA 3M81A 2XMGA 3WL6A 1EB8A 6YASA 4MWTA 2C7BA 3A2NA 4XJVA 5LKAA 5AKGA 2HU8A 3AUKA 1F6WA 5EIEA 3WLAA 3L1HA 4IH9A 1GKKA 4CG3A 4X00A 5ALPA 2J4FA 3MGAA 4EY7A 2O2IA 2UZ0A 3WYDA 3G0CA 5AKZA 4PSUA 1LLFA 1JMKC 3FCYA 2XLBA 1OCEA 2J3DA 4WFKA 3EQ9A 3C45A 5AK5A 1H2ZA 1U2EA 3C6YA 4NS4A 1L7AA 1R88A 1SCIA 1JU3A 3FYTA 2I3ZA 4X85A 1J06A 4U2CA 2PUHA 3FSGD 1J2EA 4W63A 4BC0A 2XLCA 1K6EA 2FUKA 4AZ3A 4BAGA 5FP0A 3QH4A 3I2HA 3HSSA 1JJFA 2VSQA 3VVLA 4FBLA 1FFDA 5T4HA 3F9CA 3QMMA 4BP8A 1W6RA 2H1IA 4G1FA 3AFIA 4HTAA 4ZRDA 1EXWA 2PVSA 1LBTA 2VATA 2X76A 2BUCA 3FYUB 3UUFA 2QOEA 1E3QA 3WK7A 5AM1A 1THGA 4D9JA 5SYNA 1UKCA 5BWBA 1IMJA 2EDCA 3EQ7A 3O0DA 1LNSA 1ACJA 2P8SA 3I1YA 4GI1A 1N8SA 2JF0A 4C4XA 1MPXA 3FAKA 3FWHA 4YX9A 4K6KA 4DM7A 2EEPA 1P0MA 3ICVA 4B80A 4B9EA 5FRDA 4WJLA 4DTCA 1UKBA 2G4LA 1QE3A 3PUIA 5D6OA 3IB3A 1WB4A 1USWA 2Q0XA 2DFPA 3WK5A 1WHSA 3AJAA 4BTLA 4Y2VA 4B7ZA 4W1SA 4DMFA 3HACA 4BE4A 4AMYA 3B12A 5EHXA 4K5QA 3SC2A 1E8NA 2HIHA 5CH8A 4H7DA 5JATA 1GQRA 4C89A 3MUNA 2XUOA 3G7NA 3WWOA 1QIEA 4W9RA 2HA0A 1MJ5A 5ALDA 1G5FA 1VJ5A 2WILA 2XUIA 1T2NA 1GQSA 3CN9A 2Y2UA 4H7EA 1R3DA 5HKAA 4OB7A 1K8QA 1N5MA 3KD2A 4W1PA 1LBSA 3BJMA 2FJ0A 4CCYA 4ARBA 3FLEA 1XZJA 1O6GA 4X6UA 1JFRA 5A71A 4LIPD 1EVEA 3F97A 4K6GA 5DTIA 3I1IA 3WK6A 3WK8A 1K4YA 1ZD4A 1XZBA 2QR5A 2VJDA 4P08A 4TVKA 2JEZA 5IVHA 2RI6A 1LPSA 1WOMA 4AN1A 1SOMA 1EDBA 5LZ9A 1G42A 1VOTA 3CN7A 1JU4A 4GW3A 5A7FA 4BCCA 2C5FA 5HK9A 2Z3ZA 5K3BA 1DQZA 4OYYA 3S8YA 3SK0A 1QOZA 2I3DA 4DGQA 4ROTA 2RGUA 4FHZA 4B82A 1IZ7A 1XRNA 1L7QA 3AZPA 1CLEA 2QUBA 4FLMA 3HXKA 4OU5A 5F4ZA 2DHEA 3E1GA 3ESBA 1DWQA 5FDFA 1XZIA 2HFKA 4J0JA 5JD5A 1QIDA 2C5GA 5JD6A 2RHTA 2BGRA 4HRXA 1CUXA 1VZ2A 2BKLA 1M33A 4QWMA 3R3UA 1EDEA 4AO8A 1WCYA 5AKKA 2IITA 1EVQA 5A7HA 3ICWA 3D2BA 5CT6A 1JKMA 2DHDA 4RE5A 1YA4A 1XZAA 1H2YA 1CUEA 3STUA 2HA5A 2QJWA 3IUQA 5ALGA 3DL4A 2E3JA 2HL6A 5DJ5A 5LZ4A 3F67A 2FX5A 4FLFA 3WJ2A 3VJLA 4XX1A 1WPXA 5CMLA 4RNCA 3QITA 3RK4A 4F5ZA 4I3FA 3WA7A 1DU4A 3C8DA 5LIPA 2WFMA 4W1RA 1LPNA 2XUJA 3PFBA 1GT6A 3STTA 1R50A 3IUMA 5JYCA 3PF8A 3RLIA 5AK6A 1U4NA 2CBGA 5HF8A 4KEAA 2QJRA 3VJMA 3K6KA 3AIOA 4P92A 4AO7A 5CXXA 1XZKA 1CUFA 4AN0A 1TIBA 1KU6A 1PJAA 4OYLA 2QKYA 1BCSA 2V98A 3QBJA 3WK9A 1BROA 4C4ZA 3G0GA 4BVLA 3PF9A 4BCDA 2WHRA 5HFAA 2HDWA 4DYHA 4UBKA 5CTAA 2CZQA 2HU7A 4EUSA 4Y2YA 5LLSA 2PUJA 4EA6A 4KAAA 4EHBA 3WL5A 3IA2A 5C8XA 2QRUA 2R8BA 1F8UA 1DX4A 2ONCA 2AJDA 5ALUA 5AM2A 4W1QA 3QMVA 4C4YA 2WFZA 1CIJA 4YPVA 4KE6A 3QYJA 3B3QA 3DYIA 4MWSA 3T52A 3DS8A 3G0IA 4G8CA 2CKMA 5ALMA 3WQHA 4AZ0A 3R3ZA 3WKDA 2ZSHA 4KRXA 1IVYA 5AM5A 1ZOIA 4J0KA 1JT2A 2WUDA 1CUWA 3LIIA 3IUNA 1VA5A 2AJCA 5CBKA 1CUAA 1EK2A 3OM8A 4CFSA 2WIDA 5J3JA 2GYVA 5EHZA 2DQZA 4N8DA 5K3EA 5A2GA 5AICA 3ESCA 2X8BA 4BAZA 2XQKA 5HCUA 4FDMA 1YASA 2CJPA 1MX9A 2B20A 2G5PA 3LIPA 3STYA 4H7IA 1AZWA 3D4LA 3V1MA 4LXGA 2W6CX 5D3KA 5AHXA 2JGJA 5A6VA 2VAVA 2XUQA 2BFNA 3QPCA 5AKIA 3R3XA 3O9MA 4FTWA 1C7IA 5FPPA 3LLCA 5FKJA 5EHNA 3NGMA 3F98A 5EHQA 3ANSA 4DNFA 5T4EA 2I78A 1DX6A 2OQIA 1UK8A 3O95A 5AIBA 1TRHA 2XI4A 3NOXA 4Q1VA 5C8VA 4UFPA 3FBWA 2OG1A 5EGNA 2G63A 2W22A 3EF3A 1XROA 4QEKA 3RM3A 1UZAA 1MNQA 5FXMA 1CUCA 1ODSA 3BWXA 5ALVA 4ZI5A 3HJUA 2CEKA 1VXRA 2K2QB 4DLNA 1C4XA 4AMZA 4CI9A 3O4JA 3G0BA 4JH0A 1WB5A 4NZZA 4FKBA 3OG9A 4MEBA 2WSLA 4X93A 3RKSA 5CXUA 2WTMA 2OPHA 1EB9A 4G8DA 4K2AA 4HXFB 2BCEA 1IUOA 5ALSA 3V1LA 4PV7A 1THTA 3A70A 3WKBA 4BDSA 5AIAA 1XZMA 1Z68A 3GELA 4Q3LA 3ZWQA 2WJ3A 4B0OA 5AJHA 3GA7A 3DEAA 3AILA 5AK3A 3PFCA 5CT8A 2XMRA 1HBJA 3P2MA 5ALQA 5ALHA 4Y9SA 1CUHA 2WKWA 3DOIA 1O6FA 1UXOA 2R11A 2QM0A 1QO9A 2OXEA 4JNCA 4OSEA 4L0CA 5EI5A 2DSNA 3ESAA 3F96A 1CUDA 4MYSA 2ZVDA 2ZYIA 1QIFA 2C58A 5DNVA 1PV1A 4Y2JA 5JASA 2ECFA 1U8EA 2XUFA 3W04A 1AX9A
chains in the Genus database with same CATH superfamily
4I55A 3KJFA 4EKEA 2O8CB 1GKUB 3ZKWA 4MUKA 3FM9A 2AN1A 4FR5A 1V5EA 2R6GA 1QPBA 2XH8A 3VV3A 2W6PA 3C6BA 3B2EA 3QJGA 1P6UA 2YMLA 3BJRA 4HDKA 4LVNA 5F3DA 4UHFA 1HT0A 5IFLA 2CK3A 2B3TA 2UAGA 4EB6A 1LA2A 2C2ZA 5F7XA 1JI3A 1G66A 1Z6GA 4LK2A 1J4AA 1U28A 3H8VA 4DJ5X 2ZDGA 3DQZA 3ESDA 3D7RA 2IODA 2J5BA 1E6CA 1QCYA 1LNQA 1VMEA 1JIVA 4DIMA 4OPMA 2EQ5A 3M6MD 4C7BA 1Q91A 4KK3A 4LDZA 3K53A 6LDHA 1YQ9A 2IBMA 3O90A 5REQA 3VHQA 4B4VA 1I9GA 1VJTA 4WKBA 3UGQA 2R6AA 2CLFB 2GBLA 1OWMA 2QIOA 3G7UA 4RDXA 3KKEA 1TCAA 3ROMA 1MW8X 2BTEA 5JI3E 5EAIA 1INLA 1KF0A 1OI2A 3FGPA 4XVUA 5FNZA 3R3HA 4UAUA 1RPTA 2Q1SA 4CCSA 4CMHA 3AT1A 3IVMA 1NVBA 5JC1A 4NYIR 3A04A 3C8HA 3WNCA 4UFNA 5A0FA 3L7JA 3SVTA 3ZXXA 1MH1A 2PDAA 3QP9A 5DF1A 4YP1A 3RFFA 1DTWA 2FA9A 3OCXA 1JLHA 3QE3A 1ZH2A 1FS6A 2N46A 3QLVC 4I4TF 3TQSA 4BX9A 2Z2YA 3DCYA 2ZE7A 4I66A 3WKEA 4U0KA 1SVLA 5G02A 1J23A 3R44A 1VBMA 3HWWA 3DUFA 1M74A 4LJ8A 4TXMA 5DWVA 2ZREA 4ZC1A 1GPKA 2FUG6 4F71A 3WSTA 5EJ8A 3BGWA 1SZDA 3RBXA 1AIPA 2VBGA 4QWWA 3A1TA 2QVYX 3SM9A 3NS7A 4X1KA 5EP4A 5ALRA 2PFGA 1H6DA 1LI4A 4P4SB 1VKHA 2LGJA 2J5XA 4DLSA 4OXXA 5IUKC 2EQBA 1NMXA 1QKIA 1E1DA 2PK3A 3UUEA 4EJSC 4LXHA 1HL7A 4PAGA 5K03A 2ACKA 3RT1A 3MQFA 1IPHA 4R8SA 1CLUA 2HF7A 4UUBA 4EG1A 3RS8A 3ZDEA 3QXSA 1PW7A 1MHTA 2OGTA 2BR3A 3T7RA 1IE3A 1AB6A 2FW7A 2AKYA 2TRSB 3VZPA 4BZPA 2I2AA 2UUPA 4MULA 1V25A 1GGVA 4U3JB 3WJ7A 2MTBA 2BZ0A 2VP3A 3FYSA 1A4RA 4DRYA 3D2CA 3KP1A 4BRUA 4XWWA 3PFHA 3EZ2A 4HDMB 2VHUA 3VSAA 1A5ZA 1QIIA 2QLMA 5E9JA 2E6KA 2F1KA 1RXVA 4BPRA 2CMFA 3GH3A 1XA0A 3FHOA 3DDUA 2J41A 2W37A 5IHPA 1RYMA 2YHIB 2H2GA 2Z58A 2VJMB 1VG8A 1NQAO 2AOTA 3KKZA 3GA5A 2OSBA 1XTPA 5T41A 4R40A 4KH0A 4YRBA 3ZY5A 1AV7A 3KSMA 1BKSB 4II2A 4M46A 3V1TC 2ZYGA 1NVGA 1QNFA 3FVVA 3JQ6A 3BMXA 1PKXA 2JH8A 4I5FA 1L6IA 3BXZA 4J3JA 4L15A 3K72B 1UK7A 4J0HA 3MCZA 3S70A 4I9HA 1GP2A 3W0LB 1JE0A 3ZDYB 4KXYA 3U1BA 4WBSA 1EFCA 1J2RA 4R3WA 2Z95A 2GASA 3GRFA 3NGXA 4JP8A 1T2FA 2P11A 3HZOA 1Q16A 4HATA 3UGTA 3ZJTA 1VPLA 2WFAA 3PQCA 4CIVA 5D7BA 1HFWA 5BWLA 1BH2A 3ZNQA 2D3TA 2BKVA 3MEQA 4DCOA 2ZETA 1YCGA 4F21A 1T8YA 2BJVA 1WMBA 3FWPA 4EYOA 3FY4A 2PX4A 4GKBA 3H1BA 4QD3A 4Z9XA 1SWWA 4JI2B 4CKYA 1P8JA 3ZLTA 4RH1A 2IP4A 2OCGA 4OQ4A 2L42A 4IGFA 3VR4D 4GYKA 3PIIA 3CCCA 3T5BA 3WLMA 2XDQB 3B9QA 3KEGA 2D2XA 4MW5A 4YAJA 4PR3A 4DTIA 4B2LA 3ZCSA 2BOVA 1B6SA 4Y67A 1JX6A 3P9IA 3IAM1 4OHKA 1T3ZA 2PKYX 2Z5LA 4C20A 3FUXA 1N1DA 3ZIUA 1SBCA 5DLPA 1XDWA 5EQFA 3AZOA 4H1VA 1RADA 4KC0A 1OPRA 2Q99A 2PJRA 4JC4A 1S3GA 2H9IA 3ZOKA 2Z8XA 4DQDA 3QFCA 3SXPA 4KMRA 4NDAA 4BKOA 4QUGA 4HQNA 3ZJ5A 5K3AA 1ZK0A 2PIDA 5AJVB 3X2EA 1CULC 1FP4B 3GMTA 3H1FA 4CEHB 3TUZC 2RG1A 4JVSB 5C46F 2I91A 4JITA 5D01A 4FT2A 5E3IA 1BEZA 3IAS1 3HBLA 4FKMA 2YYYA 2AD5A 3P2IA 4JUBA 4GOMD 4EQ6A 2BGKA 5EUMA 1PGQA 1E2GA 3K7EA 1A97A 3JYPA 1YZUA 2VDLB 1M83A 1H23A 1NP6A 1NRXA 1PK7A 1R6AA 4G07A 2XKAA 1MG0A 1MO3A 1BN6A 4P5PA 4RGQA 4YQEA 3OZAA 3T5DA 1NG1A 4GOJA 1AKMA 1DBQA 1K7SN 3WLLA 4EZIA 1WDWB 2PEYA 2ZKLA 2H48A 3R4CA 2JLZA 1K75A 5KCMA 1W581 1WNTA 2EP7A 3IHKA 4LHSA 4EGQA 5F7OA 3W1EA 1Y9ZA 3IAEA 3WWDA 1IOLA 2WQZA 3F6BX 2O06A 3OC0A 2WJAA 2F7SA 4LN1A 1XU4A 5IC5A 3SSOA 1PS0A 2X40A 3OFKA 2PV7A 2UUCB 4J4TA 1E5TA 3DAHA 4B83A 3E82A 5D5PA 5IYZA 2FWPA 4CMIB 1SZCA 3C5EA 2D0DA 2J32A 3LJKA 3GRZA 4UUQA 5C8YB 1T26A 1MV8A 3RRMA 3T5TA 4DMLA 3WWEA 2PE5A 1SFRA 1JKXA 3RHFA 3KB1A 4OREX 3VX3A 2VEOA 3DBLB 2P9EA 3P7MA 4C0QC 2H1CA 1JQAA 2ZROA 4BGUA 1QP0A 1HRDA 3LVBA 4ALKA 4LFCB 2BCGY 3F74A 4LZJA 5ICGA 4GL4A 1P2BA 5FR2A 3MGGA 5E7JA 2GZ2A 3JALA 3LNTA 2ZR8A 3VYUB 5H02A 3ERCA 4XOUA 5ALYA 1V37A 4EB0A 3WLFA 5HF9A 9ATCA 1CUJA 1V3QE 3U7QB 3Q11A 3W6ZA 3UHOA 5K7SA 5HCIA 4YA6A 4UPVA 4EATA 3UJ6A 4HPWA 4D26A 3HFJA 3LW8A 3EDQA 5ERXA 4DL9A 1V7PC 2IIVA 3OF2A 4ZMSA 3IEVA 4Q3OA 5EVJA 1S1CA 2DU8A 1Z4LA 3L05A 1N92A 4TRRA 3ZZMA 3R7SA 1ENPA 2ZS8A 1M2VB 4J94A 1UJCA 1XEFA 4N0MA 3ZNPA 1RM0A 1JFVA 2I9PA 2G9VA 3EA5A 5JZOA 4WY8A 3BOSA 4GR5A 4IQ0A 5EWJB 5EXDA 3ZHBA 1VL8A 3I09A 4EB8A 2Y0DA 2HGZA 3ELUA 1EM8B 3ZWVA 1RQLA 2ES4A 5ICCA 1UWCA 4K2HA 2VDKB 4L2IA 5B6JA 3SIPA 4KMOA 4WOPA 1WXXA 4WMLA 3K6RA 1ORHA 4J29A 1XLTA 1VPEA 2HA7A 4ERNA 3O8BA 2FZEA 4MUEA 4O4LF 1CUZA 2H5IA 4OCZA 2WIAA 3RS2A 1A96A 1DIOB 3KBOA 4BE7B 1TT5B 2BFBB 4QECA 1W0JD 1SOWA 2JAHA 2I6GA 1X1CA 2G76A 3HH8A 3RJTA 4B6FA 2I7DA 2HJGA 4OP2A 4YN3A 2AJBA 1B26A 1QONA 3PQ7A 4HS9A 3SC6A 2W2KA 2VC2B 3PQEA 2XCOA 3V4FA 3IQHX 2XE7A 7YASA 5KPJA 1N5LA 1Q7GA 4KQJA 1BXGA 1EAYA 3C74A 4FKZA 4QRDA 2CHUA 4EUFA 4Q3AA 3RRZA 4F45A 2HIMA 3CJQA 3EVBA 5TF4A 4UM9B 2M6RA 4DLVA 2COKA 4RPIA 4UM7A 3N76A 2YUIA 2BFCB 3CRMA 4MW6A 1U2PA 4L5IA 2F43B 2Q6VA 2AJ8A 1Q19A 1GXSA 1VL5A 2V58A 2AFHA 2R1ZA 3A4MA 3AY3A 5ERGB 4JI3B 3TI7A 3NHWA 5AXDA 2EOAA 5NLLA 4MGEA 3OP1A 1T5OA 2H92A 4IJKA 1G5IA 1DIRA 2G5TA 4QTYA 2H63A 1KGDA 5TGDA 2IXBA 2BVNA 2XNHA 1LK5A 5A05A 1UC5B 4UHBA 4BFLA 4MB6A 3TIGA 7REQA 3G5TA 1RQ7A 1RJEA 3OM1A 3PKZA 4QGGA 4IO1A 5E6SA 4IG4A 2C7VA 3G8YA 4NU0A 4D8YA 1L5HA 2O3QA 3R8FA 5IVDA 2QRKA 4ZOLF 1I2BA 4ZI2A 1JDUA 1R74A 1RKBA 1COZA 2BONA 3DSRA 3V2IA 3V8BA 5E3HA 1X74A 1FVHA 1KK3A 1A69A 2RHGB 1U3UA 2DPLA 3CE6A 1WQ1R 1P5HA 3P0JA 2I8CA 4ENWA 5CFOA 1O2DA 5K05A 3EDOA 4KIGA 2YZKA 4RF5A 1XZQA 4IICA 1KAHA 2ZAGA 3GYBA 2B4KA 5JSQA 3AFGA 2PQMA 3DUWA 4HWOA 1KI6A 1VMIA 4RGYA 3M9WA 2W2XA 3TLMA 3WLIA 4QEZA 1GG9A 4ECAA 2IBTA 3I01M 4DUGA 3DOEA 3LYAA 4RVFA 5DK6A 3TIVA 2C7GA 1DELA 1KJ8A 4BFSA 3QBTA 1KP9A 2J08A 3RFTA 1WXWA 2QTVB 2DEUA 2B5OA 1G9SA 3N2ZB 1SU6A 3AWDA 2KB0A 4MOWA 3STWA 3MELA 1R1DA 2A5DA 3GPBA 5CTJA 1NI4B 2XNDA 4EG8A 2I3GA 1KEWA 1G17A 4LV8B 4A6DA 2EC5A 3CC8A 1FW6A 2W5UA 3A1EA 2JGAA 4YQYA 4OQDA 1ENOA 5FOVA 1HNWB 4ZQIA 1EVLA 1P17A 3ZCXA 2ZVJA 3KSZO 1M6HA 4ND3A 4QX6A 4S1NA 2CL0X 3RS5A 5G1PA 5I01A 1NVKA 1WXDA 3F6RA 2NUTB 2YOGA 1RRCA 2UYQA 5DMXA 2GBGA 2NYUA 4QDJA 3K9FC 2BKAA 1MCZA 3CPSA 4Z0HO 3AW8A 4C2UA 4I1SA 1GPYA 1QDEA 3H5AA 4WEOA 4D7AA 2JI6A 1D4FA 4MQMA 1IL0A 1UWKA 2IYSA 4Q7LA 1VBNA 1A1SA 2PGOA 1BCSB 1RAIA 4ZGWA 5I4CA 3QI2A 1I2AA 1QYRA 4F9GA 2VTBA 2CFOA 1FNSA 2R7MA 3PC3A 3T5GA 4J9VA 2A1UA 3FF4A 4R5HA 1R9GA 2OL4A 3JR3A 3NBMA 4PR0A 2AXEA 1DSSG 2X4GA 4JLMA 2IDMA 5BSEA 1ZCZA 4EB6B 1M7HA 1NSYA 3IDAA 2ODPA 2PTHA 4C0KA 1Z4PX 3HPQA 3W06A 3HXQA 3D8SA 4EUKA 2W00A 1KO8A 4FOSA 4MIEA 3IL2A 3DBVO 3MILA 1RR6A 1GN8A 1EP2B 3R1IA 1N4DA 1Y3CE 4NECA 3W4JA 3INRA 2GD0A 2YVKA 5KNCD 3GDHA 2PM8A 2QMUA 4RCYA 5LP6F 1CY7A 1RLJA 1C8KA 1N1GA 2HJVA 2PS9A 1EVJA 3K0KA 2A4MA 4L78A 5DB4A 2JFGA 2QUAA 5ARCA 1TVCA 4QBKA 1E2NA 3FYHA 4XVRA 1P73A 2OCDA 1B8VA 4YJ3F 1F8FA 2G17A 2XE4A 3PJFA 3H9EO 5MN4A 3DH0A 1SQ0A 2EJTA 4ETIA 4G9EA 4KG7A 3KWLA 2YXBA 5GQSA 3T6KA 3C1TA 4M8SA 2W6IA 1NUHA 2NOAA 5CD9A 4QDZA 3BFVA 3GR6A 5CVDA 1QIJA 1KIMA 4XCQA 4JVMA 5FOTA 1ZO8A 4GZ3A 4R8VA 4U9IS 4PNPA 4D8UA 4H3KB 3FLBA 2D5LA 2IS6A 1JHYA 1QRUA 4MCIA 1CF4A 5G0WA 3BXXA 4BV2A 3W5BA 1XRPA 3B70A 3UWMA 3V34A 1U8YA 1X7WA 2GBIA 4KHPB 3P71T 4OOFA 4C0AC 4XD7A 1W2WB 1T0IA 3K2BA 3L8DA 1DRJA 6REQA 2BMJA 1V7QA 2VOEA 4ZIRA 1KVQA 2PX6A 2V65A 2HRBA 1A82A 1PLKA 2A78A 3E23A 4RKWA 3X1WA 1MZVA 2NO1A 3OE5A 1XMOB 3OIFA 4X95A 2CVFA 4F46A 4HT3B 4YT2A 3O83A 2PWYA 4DWVA 2ZI4A 4BC1A 1HNNA 2IDJA 2NG1A 2OHXA 4MKIA 5T67A 3G5UA 1GAQA 3AFNA 3HXLA 3HYLA 3P9QA 2ZU6A 1D0VA 2Y1DA 4I2VA 4AY5A 5ALJA 2B0CA 1JDJA 4ZZ3A 2WU1A 1W49A 3FMPB 3T95A 1Q1QA 1NBOA 4I6JA 4OU4A 3LQ1A 3ZWXA 4IXWA 5D84A 1E9SA 1N2JA 3I4LA 1XCJA 1GAJA 1M1NA 5KTRA 3OQMA 5JS2A 3FR7A 1PGPA 5CEFA 1H2HA 1HE4A 2J9XB 1PSDA 4L7QA 3OH8A 2H8GA 4ASUA 2OZEA 1NJ6A 2W0SA 3CQ9A 1SG9A 3RTGA 4X94A 4DAOA 4QUBA 2YY6A 5I9IA 1Z6AA 4R16A 4XFJA 3EMVA 2NV2B 3FTFA 4I3HA 4TYYA 1JZQA 4FSDA 3CNOA 2AXPA 4DKJA 3HXTA 3U37A 1H85A 1SKYE 3JYHA 5ITSA 2AMLA 2N42A 1PZFA 2XMDA 2O48X 3ELDA 4MJ3A 1K8RA 2XF8A 3UHJA 4RJ2A 4DLRA 3ELYA 5IH7A 1SEVA 2YV5A 2DWUA 1Y3DE 1Z82A 4FVTA 3SSNA 3ZXYA 2UU9B 2F90A 3V8MA 3PUHA 4ZYWA 2AUTA 4ZQFA 4DABA 1NVWQ 2PFSA 3PXAA 5JFGA 2J46A 2I03A 1FSGA 3GCXA 4IGAA 4PC3A 4F8EA 1GUYA 1MVLA 3O1IC 3Q9UA 3VZDA 4DCUA 4RD6A 3PEVA 4MWBA 3HPRA 2XCTB 5CBPA 3DW3X 1P0IA 3JCZA 3F9IA 4Y2HA 4KACA 2O3SA 1JP7A 2ONKA 4ZVOA 1K92A 2R84A 3CSSA 3GYGA 5E2IA 3UNXA 1ZBQA 4BX2A 4DA0A 4D9IA 3VVMA 5EIXA 4K9NA 2CVZA 1TLLA 2PN1A 5B2ZA 1NU8A 3BDIA 4ZK6A 2VCEA 4KDFA 3L4JA 4F6RA 5H80A 1TJ3A 3TGLA 3RGGA 2MSNA 1QAQA 4MRRA 1WZCA 2FOIA 1CV2A 2BI7A 2KQUA 3DE7X 5CDSA 4JB2A 4MRMB 1Q1ZA 4CT0A 1U3VA 2PYDA 4IF4A 2W8BA 3EUEA 2X19A 3M6IA 4KYVA 4RBNA 3NAGA 3WGOA 1YC2A 4E30A 1AUOA 5AW9A 4DJDC 1U81A 3OCUA 2VJMA 4MAFA 3VOSA 1XDZA 1A0OA 4FGSA 2RAVA 1RKQA 1TIPA 1V3TA 2WF8A 5F4BA 4N3BA 3T7IA 2K5UA 1P9NA 3A6JA 3AIIA 5ABPA 3CPHA 2VZ8A 3JWJA 3MUEA 5EIAA 1JA0A 3JASB 1COWA 5FLKA 3UUWA 1NVTA 4X7RA 5FL7A 2O20A 2IHKA 3EFHA 3HJHA 4OJNA 1DC3A 3ROFA 1M8KA 2CXPA 3AI2A 4BFCA 4EG6A 1EFAA 2O5CA 3IIIA 4QUJA 2XW6A 4I4TB 1YBFA 3I04M 3KHSA 2D8AA 3N0XA 3DKPA 3C43A 4WLVA 1KOJA 3FDZA 5D51S 2Z43A 1NONA 4G1CA 2H2WA 4PLFA 4MYRA 4HQ0A 1EE1A 1O95C 1BVHA 3JD4A 5HKKD 2XE6A 1YB1A 3MERA 2ZBEA 3QF4A 4K05A 2ZFUA 5DNUA 4AIRA 1ZD2P 4OK5A 2ZJZA 4CMEA 4DJEC 1IWBB 2LTAA 3MWEB 1HOTA 1JR3E 1QYDA 3R3VA 1HQCA 2WG2A 3A1VA 4LK3A 3ETHA 4WZZA 4QZVA 1QQ6A 1ATZA 3FPCA 3PNKA 4MO2A 5K0ZA 2QLLA 4OHZA 4EX6A 2XMPA 4OJTA 5A5VA 4ZYYA 3W9UA 4CM6A 2XA2A 3OCVA 4UBNA 3K1ZA 4MHSA 5C34B 2GBCA 1XWFA 3DTVB 5LZ8A 4P35A 1VIDA 2X2OA 2XZPA 1ABBA 3RSOA 4JEIA 2A2ZA 4YH1A 2UXDB 3H86A 1E1LA 1P6XA 2OV8A 2WOOA 4G0PA 3T1VA 4XQ9A 3T1OA 3U7IA 4BQEA 1TEXA 5IDVA 5FD8A 4U5XA 4IZ6A 3AEZA 3F3YA 5CFZA 4KMMA 1L1FA 4OI4A 5DFAA 4XB2A 3D6UA 1TKAA 3TD9A 1N6HA 3B1YA 1IBMB 2VHCA 3FZGA 3L8ZA 1GTL1 2NU8A 3GNLA 5KQMA 4J0FA 5EE3A 2V7QA 2FZKA 2GPSA 4OBEA 4G89A 2B3DA 4O3FA 5JAOA 4RMNA 5HZMA 4BB0A 4B6SA 5FBQB 1E5VA 1JGTA 1X7DA 4M1ZA 1KERA 2CYCA 3FNBA 2QL6A 2WJVA 2I54A 2C9MA 4G4JA 1E6LA 1R5NA 3D6JA 3NEPX 2FQYA 4Q4AA 2GTIA 1VG9B 1XEXA 1PT9A 4Z9FA 4PCUA 4JLJA 4TWRA 4BOYA 5JT1A 1QE0A 1TZ2A 1MC1A 1E5QA 2JCBA 2VBIA 2JB9A 3GOHA 2A5LA 1TQ8A 2AOUA 4I1RA 4MKXA 3EDMA 5FJIA 4MGZR 4FOTA 2D54A 2FN8A 3U5TA 1LW7A 1TD1A 1XRLA 2CNNA 1POXA 4HFRA 4E2WA 5IXYA 4A82A 3M2PA 3WYEA 2Q3DA 4F12A 2BFFA 1GRCA 1X86B 1ZD5A 5K99A 2VRCD 3C3YA 1V16B 3IPAA 4OY3A 4F3RA 2P9ZA 2PXCA 1AE1A 1GZ5A 4JUDX 4MVJI 5FNVB 3OHMA 3K6SB 1DXQA 1UBMS 1WHTA 2FPIB 3CUUA 4BBPA 1T9HA 2V8BA 4CEIA 13PKA 2O07A 4ZARA 1EUZA 3RVRA 4OHPA 1OLSB 3O2QB 5B1IA 2VDJA 2V4UA 2YQ5A 1PYGA 3RODA 1CWUA 3M6XA 4TM8A 4D9FA 4DMCA 4F0JA 1ZDMA 1OHHD 3DC7A 5FHQA 3DKKA 1S2DA 4CQJA 3SYLA 3JYNA 3W2GA 2XA1A 4EK9A 1BXKA 3NBUA 1O8CA 4O4IB 3CCFA 1TGVA 4IOMA 4QBFA 4BZWA 1W5TA 3ASYA 4QUEA 3WOHA 1ZIPA 4FOLA 4A0GA 3SMVA 4KIJA 2VUTA 3KTFA 2AFIA 5GJBA 1SHUX 3AEXA 2QMQA 4LS3A 2A67A 4DUPA 1KO1A 4EHAA 3DZHA 1QYWA 4KK4A 2DQYA 2OVBA 4S12A 4X6LA 2ZDQA 3U9SA 3TZHA 3LXMA 3RUEA 2NO5A 1RQNA 1YR8A 4X66B 1Q1AA 4OP3A 1P2SA 3LU1A 4ZI7F 3HXMA 2BE7A 1KNQA 3W4IA 2J9FB 4TVOA 4OHRA 3AERA 3SXUA 3D2AA 4EJMA 4QG3A 3NMUF 2Z3WA 4TKMA 1Y8ZA 1RSZA 4B74A 5KYUA 3FPEA 3ZWPA 1ZGZA 4XW2A 1I1QB 3QU4A 3R41A 1EJBA 1JTVA 5ESRA 2KI5A 2XTMA 1EM8A 2OILA 4E5VA 1NN0A 2Q9BA 2W2TA 2ORYA 3COPA 3ITNA 4RFSA 1C30B 1ISRA 1EXDA 4M0LA 4ALLA 4BXOA 3H17A 2V55B 1IBLB 1U6IA 1MTZA 2HQRA 3FZNA 1D2EA 2JGDB 3KHTA 1SD5A 2GPTA 1QZTA 2CXOA 2VH2A 5DNDA 1NRWA 3OAAD 4LNHA 3PNMA 3IJ5A 4RLSA 3L1VA 1ZCFA 3DDHA 3EXHC 5TMDA 3CR8A 5I7FA 3N1UA 1NZFA 2J6IA 2QORA 3V80A 2R4TA 3S1LA 2IYLD 4XARA 4Z54A 5IU6A 1XQWA 3BGOS 2FE4A 4MVWA 4MI9A 3SE0A 1K66A 5LYYA 5ADVA 2F1JA 4CTMA 5I3ZA 4GPBA 4PAWA 2NO0A 3T1YB 1A7JA 3CT6A 4BX8A 5B12A 1UF9A 3JPYA 2Y9PB 3TOSA 1XCMA 1E0AA 4MIOA 2OAGA 3PNVA 2HF2A 3H5IA 4MYDA 3AONB 1V11B 3H2JA 4CDMA 3AX6A 4CG0A 1K0UA 4PXAA 2L2QA 2W6JA 3MJFA 2EKBA 4KVZA 2L82A 3SICE 1XA3A 3W3AH 4ZGBA 5FBWB 4KQFA 2H52A 1X7YB 3AUYA 1FSPA 3C70A 1ZK2A 3QQPA 721PA 2Z56A 1QIHA 3GNSA 3LG2A 4XI9A 4DBLE 4YCNA 1R6VA 3TRHA 1H2WA 4L4YA 1V9CA 4M36A 5IVPA 2RK6A 4K26A 5JJLA 4O4JA 3A3KA 5E1DA 2WD8A 1XZDA 3I37X 2H2IA 4L07A 2HGSA 4IIGA 2X4DA 5HF5A 3KPYA 3TUIC 1ETHA 4YRTA 2WHPB 1VPTA 3E6AA 4ITRC 4J1QA 3R7WB 1WKCA 4H17A 4PCAA 1LDYA 2Q3MA 3OPYB 4RE6A 2C97A 3TTSA 1UT8A 3WMEA 1U1CA 2G1JA 1EDZA 2ZI5A 1I3KA 3PXEA 4BO6A 4QFDA 3M83A 4U7WA 1JMYA 4G1UC 4CWAA 2RHBA 2PIAA 4Q4LA 4Q34A 3WYNA 1UMCB 3RHZA 2FTKE 1DO2A 2CXSA 3LO8A 3QHPA 3W4KA 2YS7A 1I13A 1X2BA 3OE7D 4OKIA 3CONA 2IV3A 4BKMA 3SNKA 1U5AA 2Q5OA 4JXXA 2WSSD 3ED5A 4OBXA 1QYCA 4EO4A 3HA7A 4LHXA 5LDGA 2R1VA 4GMDA 3VNAA 1VP3A 5D3ZA 4AL4A 3HCAA 4P0TA 3N87A 2F6RA 3WLRA 1K4MA 1CR2A 1E6UA 3DBHA 4KKXB 5FI5A 4NQRA 3A36A 4U2EA 4UHHA 4F4FA 3I42A 2ZBUA 2J67A 1Y6QA 3CVXA 2IYTA 3OJWA 4F4JA 1EK5A 2P30A 2BSAA 1HRKA 4NZMA 2IGTA 1YOBA 2AK3A 2Y1CA 4HFMA 3GLFE 1VJRA 1G7CA 3BFPA 3QZUA 3QKWA 3RVNA 3COYA 2ON6A 2DKFA 3GZTB 2PT6A 5TARA 5BSWA 2R1VB 4PYLA 4ZT3A 3L92A 5JS8A 2GHIA 3DC2A 3PGXA 3TQCA 3R0ZA 2FDXA 3SSMA 4CIDA 2ZITA 1OD6A 1JAXA 3JASA 4Q3KA 1LKZA 4AJ1A 3GPCA 1H8HD 5M7EA 3BEOA 1FTGA 5KOHB 2O2JA 2QAIA 3I6QA 3N74A 3ORQA 1JNYA 1XP8A 4DLYA 3NBFA 3PPWA 2F1IA 3BS4A 1GL6A 3QG1A 1TU3A 1VKZA 4I1VA 4Y7CA 5JHGB 1TZMA 2Z98A 3CYFA 3FSJX 4EG5A 3WY9A 3GVXA 3I9FA 2YNMC 3OTOB 4ZZ1A 5JH7A 2FUCA 1EXMA 1U8AA 2QMEA 5L40A 3DBLA 1D2AA 3PHCA 5THQA 1J2YA 3LT0A 4ND6A 2GEUA 4WFQA 2J45A 3I3SR 3LGSA 2XCSB 4ZJYA 5FWAA 2F8MA 3E4DA 5HQ3A 1X15A 3KCNA 3W34A 1L4NA 1ZL0A 2H2DA 1A9YA 4EMBA 4LC0A 2XPCA 1TO1E 3EZGA 5HF6A 1AC5A 2XTAA 3AY0A 5JNTA 3TLJA 4BASA 5C2JB 3I2GA 2BRUC 4CV1A 3B82A 1LQUA 3OZ7A 2XMCA 3HCOA 1KSHA 4Q4JB 2E82A 3AEQA 1S02A 1CY8A 3DE3X 3GLUA 2XUAA 2G4VA 2C95A 4GHWA 4DIUA 3TRJA 3K70D 1ECBA 2AWNA 1WCIA 1JDPA 3TFOA 5FNVA 3K6SA 5JAUA 3PXDA 3K6JA 4PGMA 2RCYA 3MWLA 3WGTA 3WJAA 2IHUA 3I76A 3UPDA 4RUKA 5BV0A 1FFBA 3BSSA 3QX9A 3QTTA 2B2XA 4BP3A 1CHDA 2H51A 2ID7A 2P0EA 4OBBA 2VJYA 5J5VA 1PSWA 4QGSA 3VYWA 4J4BA 1YB2A 2R8OA 3QPWA 3V7NA 4B7UA 3OLCX 3HO6A 5SY4A 1UZLA 2FSHA 4PS1A 2IOQA 2OMKA 5FLEX 5LQNA 3BCUA 4L1KA 4FYJA 3GPIA 2EJUA 1DINA 3VGPA 3KXPA 5C1DA 5DIFA 1FLDA 4M99A 3R9KA 3RAPR 3TO5A 5TT0A 3WG9A 4Q4AB 4I9GA 1O4VA 3I6ZA 1OYVA 1GUFA 4HR7A 3JRWA 2TMGA 1AJEA 3V1NA 1A9OA 1Z9BA 3F8TA 5C7YA 5EZYF 5TVGA 3VU1A 1KS2A 1ZICA 3TMYA 4WN9B 3LI2A 4LCEA 3JVUA 2PQ0A 4Y8VA 1YR2A 4GQAA 3QYFA 1DRUA 3ECAA 3WI7A 1Y6GA 3BIWA 3SF8A 1MRZA 1O5TA 1YBVA 3PCRB 3HEAA 5TLSA 4G4SP 1NW3A 3LHDA 4MLPA 1E2DA 3R9IA 2NZYA 4D46A 1SK9A 1QLWA 1AUPA 4G65A 4PYRA 1XVLA 3HN6A 1N25A 1UQTA 1X77A 3CNBA 4UULA 5ADUS 3Q8KA 1D7OA 2EEZA 2ZBDA 3TAUA 2J3EA 3Q7RA 1JZSA 4P58A 3VM6A 4TTIA 4A16A 3WLEA 2OK8A 3GEEA 4UEWA 2IHYA 2VQEB 1O9GA 3OLQA 5FV7A 3TPCA 3V7FA 4R9RA 3VTAA 4G8JA 3LC0A 2NIPA 1VPWA 1X80B 2WA2A 3UG7A 3NXSA 1W73A 2DOKA 2RGCA 2Y05A 4TWBA 3IO5A 4M1YA 5CM9C 4Q00A 3I9V6 2ZIEA 3CBGA 4DCJA 2V96A 2WUVA 3CF2A 1NNSA 1ULBA 4QYTA 1X8JA 3I2YX 1RYDA 2V7UA 3C7AA 3K2EA 3M6WA 1GG2A 1P77A 1S8AA 4ND7A 2JLSA 3EXEA 3QV1A 1GQYA 4IZHA 4HHEA 1BKYA 3A0UA 4UC0A 3W78A 4B3FX 3EXAA 3K09A 1JQDA 4M2LA 4B3TB 1GU1A 2VKQA 2WD7A 4ENPA 1CUVA 1CE8A 2JS7A 2V0NA 1ESNA 4Y9RA 4M8IA 3UT6A 4DVGA 2N0SA 1GA6A 4DUYB 4PGAA 1TAUA 2RCNA 1Z35A 2A9QA 2NSDA 2BFOA 3PTZA 3TLXA 1O95A 2J3QA 4WFIA 4IIEA 1AKRA 1E3WB 3UMRA 1SOVA 4ETWA 1ZWLA 3U7GA 2PR7A 4ID3A 1Q84A 1RXUA 5TQ0A 5AT1A 3T1TA 1DS6A 1D9ZA 4JGBA 4RQBA 4YMGA 3RSFA 3T5MA 3IC5A 1MJGM 4X7BA 4IFIA 1NX9A 2NU7B 5IANA 1EBUA 4H18A 4ZVKA 2IV7A 3T5CA 4BZZA 3L3BA 1KS9A 2X8WA 1PYOA 3IMGA 3C1OA 3K31A 3ZU4A 2PL9A 4F3KA 3OF3A 4B4OA 3JSXA 1O0CA 2DLCX 5E9WA 1UR5A 3BZUA 3K09C 1XTUA 2I8AA 1RP7A 3CBQA 3NJ8A 1RPZA 1GL9B 4RMHA 1A8UA 3L04A 2VPYA 4BLUA 2ZUTA 1MAVA 2FQWA 1RP1A 2Z2JA 1X19A 4PYIA 2COEA 2H9AA 3EHEA 5KJEA 4BLPA 3QWIA 4L4SA 5A4MS 1CEEA 1JQ5A 4QHSA 4J7XA 1BDBA 2CK3D 4D43A 1YGPA 4BKPA 1SC1A 2X9NA 3G59A 5JRJA 1P1FA 4R2IA 2GZHA 3RQIA 5DM2A 3RYFA 4KYTA 4X54A 3DZ8A 4O2LA 2ZRNA 4IX1A 1P81A 5CB6A 3A3NA 2ZYTX 1GTMA 5KNDD 2CJXA 1PVOA 5ES3A 3GJSA 3M2TA 1WY7A 3RRBA 2GSWA 2WTNA 5FYQA 5FA6A 4FBMA 1AK9A 2HDNB 1ZUD1 5BSKA 2I5PO 3L1UA 3GLFB 1VYHA 3PLAE 4CMAA 4N0EA 2Z5GA 3GZNA 3OWHA 4C87A 4TVSA 2AGVA 4ANFA 4XXHA 4NBSA 1RBZA 4GYWA 4OGKA 3WR5A 3D6FA 1SKYB 4GGOA 3O4GA 1TC2A 4JGGA 4ES6A 2D7JA 4B2YA 2PMBA 1Z73A 4H7HA 2P91A 5A6SB 2Q2WA 2P5YA 4WZ6A 4WNAA 1CDDA 1J0CA 2B94A 2HUPA 2YIVX 1PR0A 4KO4S 2QUJA 4DUGD 5EJEA 3N8IA 5G0TA 3HCPA 4C6HA 1T8RA 4JN6B 1RRKA 2VA8A 3TTWA 5LYJF 2MINB 3C6ZA 2G88A 2DX7A 3LFHA 4JU8A 4PIVA 1P1RA 1SEPA 4R1QA 2YDYA 4IYJA 2Q0SA 5EUQB 5JXHA 2OCKA 3CEAA 4US0R 3O4RA 3ZD8A 3K70C 1NBME 1Y6FA 1BIFA 4R83A 2X2FA 1GU0A 1P62B 2O8NA 2RFLA 2MDTA 2Q8QA 4LF7B 4WNAB 1TU4A 2MIIA 1NPDA 2E9SA 2G28A 5LMZA 4B3GA 2VF7A 1PJRA 3ND9A 1U0JA 2BDUA 4HGOA 5FBLB 1CETA 1FLAA 4LY6A 4O5AA 1PZNA 5DWDA 4AWBA 1OH8A 1PFUA 3A4LA 4HH4A 3HC7A 4BVGA 3UATA 2D0PB 1JQBA 4MV8A 1D3AA 2WIFA 1TPZA 1QVRA 2FPKA 3NC0C 1U65A 2B99A 4Q4JA 5DYYA 3LT1A 1M6WA 1OV4A 1R16A 2AD1A 1IEQA 3G82C 3ZHCA 1O1YA 5KTPA 4BV8A 1A2BA 3WGLA 4EBBA 5FH9A 1EQ2A 4B3HA 4L8VA 1TDJA 2DFKB 4CPDA 4D3XA 3A6GA 4XB1A 5FUMA 5LKRA 2ENUA 1WBDA 3K5WA 4K1LA 1YL6A 1R0XA 1F51E 2QVCA 2HA2A 2VQ6A 4Y0AA 1ZHFA 2XMSA 2ZI3A 4B0PA 3BRSA 4B73A 2W70A 5JRDS 4F4CA 1KQFA 5FUVA 1EX6A 3MCUA 1YRAA 1BOOA 1BOFA 4UNQA 3ZE0B 1J70A 4YACA 2FCAA 3RARA 2F9FA 1LBEA 2O8DA 1O8BA 4PSDA 4QLAA 5HFNA 4BLSA 1P0QA 1FRNA 3N28A 3NHJA 2WYIA 4U4AA 4W5JA 4ZO9A 1TK3A 1TT5A 2QX8A 2XDAA 4G4GA 3K2IA 1W0KA 4HPJB 4BTVA 4F4HA 8ABPA 4CETA 2VKTA 4LJSA 2ORED 5IJAA 2YJ5A 1YA8A 3L0IB 3KEFA 3E9QA 3WIOA 4RJKA 4PEVA 3WGVA 3EGDA 2NU6B 3KJQA 3SKVA 3U4IA 3ANXA 4DS3A 1FJHA 3Q72A 4HCJA 2BTOA 3OTIA 2UVPB 5I9SA 3RFCA 2IXGA 4IUYA 2ZYRA 2CFRA 3A1CA 4KQWA 2Z04A 4FPXA 3LOQA 4J0GA 2WTUA 2VJAA 4J2HA 3M6VA 3H04A 4E2FA 4EPVA 1UODA 2QLJA 3CX4A 4HXGA 4E6PA 2ZRMA 3D3NA 1Y6ZA 1E2BA 1R0SA 1IY1A 5FT9A 4WL0A 3R6WA 3RRFA 1KPHA 4XWAA 3V46A 4LSWA 5FX2A 4QDKA 5KTMA 4TMZA 2UUAB 2FN4A 1PNVA 2AG0A 1E92A 5DGTA 5KKAA 4M1MA 3M9LA 3QGMA 1BN7A 1U9IA 1PWYE 3JQQA 1CF9A 1WPRA 2VTBB 1AURA 1GPNA 1N9KA 1HWYA 1YQWA 1Y4SA 4I4CA 1RXWA 4RO0A 1WIWA 1O54A 3U7QA 1QYXA 1R0YA 4HNAB 1HLPA 1MVNA 3KYDB 3PRHA 4UD2A 5BYKA 4NBWA 3MJCA 2O59A 4AJLA 1F4LA 1EWQA 3ICEA 1FDRA 3R74A 2WRZA 3UYKA 2OD7A 2WY2D 4LYFA 5J9FA 1L5OA 4JROA 4PQFA 1DQPA 4NQZA 2K4MA 1G4HA 4E31A 2FPLA 2IYZA 2I1QA 3G2HA 3R20A 2FP4B 4GX5A 3LP5A 1Q7EA 4YY3B 5IJXA 4F9TA 1LPAB 3DXFA 3K1AA 4FBGA 3PL5A 2ERYA 2I7CA 4ZVRA 3CZ9A 3H4IA 4WN9A 3H2SA 1QFSA 1RI5A 2RKWA 1XPJA 4N7JA 1J8VA 3OJ0A 2RGNC 3K94A 4KAXA 3OT1B 4LWPA 4UFOA 2UZ1B 5G1OA 4EARA 1VL0A 1N5OX 3DKRA 3NLLA 3NVAA 4JYMA 1EFHA 3G9ZA 3MWYW 3QVWA 5C31A 3IQWA 5I9BA 3B6ZA 2H9YA 1FDIA 5A9SB 3HO8A 1VRWA 2YASA 4GKVA 2NYAA 1DAEA 3VR6D 4LEIA 4YUVA 4LISA 1R10A 4D9EA 3HCRA 2UZIR 2ZT6A 4D2IA 3BXFA 1KJYA 1OA1A 1XZLA 1W52X 3O2NA 4BMVA 2BW0A 2HRRA 3OEED 4R05A 4TLMB 3ACBA 5SICE 1T5LA 5FI3A 2ZIFA 3WVNA 2HM7A 3OY7A 4KVFA 1N3BA 3ABQB 3KTOA 1CQZA 1CUUA 4O4HA 4RK4A 5DRTA 3VH2A 1G55A 1Y9DA 4FCWA 4QYIB 3I9JA 4GMGA 4RA9B 1R0LA 2PLFA 3AUAA 4LRXA 1JJBA 1LC3A 3BWVA 1Z2CA 4V39A 1P1CA 1I2CA 3B51X 3DZFA 4WKOA 2XB4A 5ALLA 2P79A 1E1CA 2G5GX 3AVYA 1VE6A 4OI2A 5JMTA 5KNCH 1OROA 2C61A 1TCBA 3ZR4B 2OUKA 2ZT5A 3KYJB 4LW8A 1OI3A 4HB0A 4CKBB 1H9BA 1MA3A 4YIKA 2EL9A 2ZBRA 5TPZD 3N6RA 2P67A 4OXNA 1G9XA 3GJRA 3LRPA 1Q21A 3NIBA 4X1YA 1O94C 2CLMB 3VRHA 1RJFA 1M6YA 2HHCA 2Q0HA 5JS7A 5HUHA 3G5MA 1F6WA 3AV3A 2Z8YM 5EIEA 1CJKC 2J9FA 4JEMA 3ODPA 1GPH1 1VI5A 4G5HA 2B21A 3CMCO 3PUJA 1DAIA 3ZTTA 3EDYA 4KFUA 2J4FA 3MGAA 5DT2A 3OCWA 1G18A 2O2IA 2XQVA 5CVCA 3WYDA 4L6IA 2FZWA 3D8NA 4ZCSA 4PSUA 3KSDO 1QZZA 2C8VA 1PNQA 3BXEA 1GJRA 3TMKA 3BXHA 4GUAA 1QRSA 2FXVA 3AHEA 3EW9A 3Q88A 2CL7X 3Q7TA 4X64B 1QF9A 2YRXA 1GGEA 3OSUA 3H2YA 1EFUA 4Q9NA 3UKDA 2J3DA 1Y0BA 2HMUA 3L2OB 4HWKA 5AK5A 3LOPA 3ENKA 5BYAA 1DKOA 1O94A 1L7BA 3D8HA 3C6YA 1STOA 2A86A 2VDVE 4O4IA 2C8LA 1LJUA 2ETXA 3LRXA 1UBRS 3KLNA 4O1MA 4AT1A 1JIJA 3UMFA 4DRXB 3MD0A 5C1PA 3O75A 1Z5UA 2PBRA 1DAMA 1Z4IA 1MC4A 4CI0B 1LW6E 4WOJA 3B20A 2K2WA 3ND6A 4KJZA 4Z7NB 1KSGA 3QE4A 3OX2A 2PGJA 3HUTA 3R9WA 1J2EA 1V4NA 4X7PA 2Z57A 3EQ6A 4D41A 2XYGA 4LNAA 1E9VA 1WHTB 4E5DA 2FVYA 4ALNA 3KBBA 5KYYB 2JHPA 1E3TA 3VR0A 1MGOA 4JLNA 2Q4BA 2AUMA 4Y30A 3VDNB 3N2KB 3LTNC 1DARA 5JPDA 1PGOA 1G6Q1 1XWIA 4WI1A 5LL6P 3MTBA 2O7NA 2AMFA 3HCCA 4AMBA 2GVDC 3FTCA 1AY0A 1J5PA 5DOZA 3K9GA 3TSYA 1H9CA 1P3DA 3RVPA 3ZVNA 2ADOA 2I66A 4LC1A 4PG5A 2VH1A 1NW5A 3K8YA 3QMMA 4BP8A 1E3EA 3G17A 2XKKA 1T3HA 1OU4A 3NHKA 2AK2A 3FLMA 5ITZA 1QZUA 4TZKA 4AECA 1BD3A 5MN5A 4MRNA 1WKBA 1I4EB 4JI0B 4R69A 4YAOA 2VF8A 4G1FA 5K0NA 3CG4A 4HDNA 4DIFA 4QAJA 4HTAA 3PQDA 3ZDRA 1IJBA 4D57A 1XMQB 2WJYA 1GNPA 2G04A 1YKSA 1LBTA 4M21A 1SB9A 1U3FA 5BWOA 3OJOA 1NHGA 1P9RA 4D8WA 1O3YA 1Z0UA 2BUCA 2QE6A 4YP6A 1XD9A 4BFTA 4RTMA 4RY0A 1SUDA 1E1QD 2EWMA 1US8B 4D92A 1C1XB 2R7KA 2WC1A 3DOCA 4R51A 4TS4A 1ZKDA 1ZLYA 3VNSA 2XRZA 3FKJA 4G5QA 2W2KB 3A4VA 2R2GA 1F8XA 2WWHA 3E5MA 5SYNA 2HF8A 1UKCA 2AE2A 4YPFA 3H65A 1ZVVA 1TUBB 2QYSA 3F90A 3OKFA 3TQHA 3K5PA 4X41A 3KZMA 5JUWA 3P0FA 1DADA 2W4QA 2OG2A 3O0DA 1W0CA 1LNSA 4GI1A 3ZHOA 2IH5A 2JF0A 5TRTA 2JI9A 1ZJYA 3LCMA 3PVSA 4YQZA 5F5LA 5A5GA 4HNAA 1G1AA 5KOJB 1ZM4A 3FAKA 3RT9A 4RDHA 3WLPA 1V47A 4DM7A 3HKBB 3OBIA 2H1FA 5DM0A 1EFVA 3SVLA 4RV5A 1SC3A 1NQUA 2GCGA 2IHBA 1TTHA 4PNEA 3M9XA 5IEBA 2NO7A 1YDGA 3Q3VA 2DM6A 1NXSA 2IPNA 3USES 3WGZA 1R8SA 3NG1A 5FRDA 4YLEA 2B34A 3VYTB 1IHUA 1M75A 5LDDC 1UKBA 2BBTA 2G4LA 2PYIA 2I80A 4MDEA 1BHO1 3HLYA 3RBVA 1H4VB 5COBA 4B2IA 4G1BA 1NF8A 1NUUA 1JHOA 3MFYA 2DFPA 2IEIA 4N5DA 4S1VA 5IK2D 3HB1A 4DV2B 1OXXK 2XDQA 1PI3A 3AUTA 1WHSA 3AJAA 3L0CA 5FTWA 3RF7A 4Y2VA 4AD8A 1YFLA 2NU6A 1KAGA 3BGVA 3O47A 3P0HA 4O2AF 1WLSA 1NMYA 5BYBA 2OHHA 2WWVD 2O0MA 3ZNNA 3V9PA 1M54A 2ZS9A 4LZZA 1OFHA 4W9NA 3TEMA 1PZEA 3VYVA 3J7TA 3RASA 4HDSA 5JECA 3FSRA 4C6SA 4YMUA 4KSCA 1R6TA 2QPLA 4EENA 2WMNB 3BSFA 3DDSA 3H5NA 2GUGA 3OOWA 4FD3A 3SC2A 4BVFA 3M4XA 1YZTA 4N18A 3TTTA 1G4AE 1E8NA 2HIHA 3DZKA 1V6AA 5CH8A 1KL7A 2CEAA 3F6YA 1OWNA 1Y5LA 2GEDA 4H7DA 3VPFA 4C89A 3C5HA 2DCUA 3H4VA 1CZLA 1HYQA 1IONA 1NVXQ 3GEIA 5JS6A 1TYZA 1T10A 5D7NA 5BW5A 3KL4A 5AUQA 2ZUSA 2P4SA 4MKHA 4JBGA 4NV0A 2L17A 1G5FA 2C82A 5ALDA 5BT9A 1PEDA 3HYCA 3RSLA 4UQPA 1MLDA 1ZS9A 4NOLA 4F1WA 1F7UA 3LHFA 3LQKA 4RD0A 1CB0A 4BNDB 4PPFA 5LQMA 1TEHA 1GQSA 2X5OA 5EFOA 1LLQA 2A9JA 2ZZMA 1W5BA 3LUDA 1BQEA 1Q3KA 1WWKA 3AM5A 3CN9A 5E9AA 3SSAA 4AJIA 3KZCA 2AQHA 4I6GA 4MS4A 2Y2UA 4W8GA 7GPBA 1JZTA 1R3DA 3KRTA 3DAFA 2MMCA 2YV3A 5JI2E 4HAXA 1ZUIA 3FF1A 3KD2A 1JWBB 4RAOA 1WEHA 4WW0A 5GONB 5I8WA 3TQOA 1U2QA 5JMOA 1RLTA 3LLUA 5LU8A 1HDRA 2GN4A 2PUAA 3EDRA 3T4XA 1RMYA 1XZJA 2Q5JA 1N0WA 4HYYA 1QHIA 2D8MA 2EWVA 1C7EA 1AHIA 2Y1XA 2XBLA 4ZU1X 1TE2A 4FP9A 4XM1A 3VPBA 3I1IA 1BE8A 3WK6A 3V7WA 4Y0NA 4D9NA 2J9YB 3LBHA 5AJWA 3MTEA 4YB8A 2YQ4A 4EABA 4RANA 3ZWMA 2XCRB 3PB3A 5A4IS 1Z56C 3WHIA 1T6YA 1BS2A 1TVKB 4MRSA 1EP1B 1M8GA 4N39A 4K9KA 4TUYF 4XIGS 4QO8A 1XEXB 4D0GA 1KOGA 1LPSA 4NCAA 2QIPA 2A0YA 1RZUA 1WOMA 1ZMXA 1NMQA 1SU7A 1SNYA 1GITA 2Y9MB 3TXYA 5I7OA 1IWOA 2X0KA 4EA8A 1OJLA 3NBYC 1FSZA 5JQGF 4LBWA 1YUNA 2PYZA 2NXWA 3SQOA 3L4BC 2BM1A 4ZRMA 3CN7A 1JU4A 1YTUA 1NMSA 2GDJA 4IW3B 2V7EA 5HYVA 1Z5PA 1LSOA 3P2JA 4DWWA 4BCCA 1BW9B 1TTQB 5L53A 2CE2X 2JDID 2XA9A 4MYCA 2FWNA 3RFXA 3ZZ1A 3U9LA 1WS6A 4J3FA 5KAPA 4OSOA 5AVKA 2NZUG 4H27A 3Q0IA 4FFMA 4HC4A 3RJ9A 4PTZA 3S8YA 5AW0A 1V8OA 2C94A 1RRVA 1OGYA 5EWMB 3PR3A 3BWDD 2GM4A 2QN1A 4CM1A 2BGIA 5TJ9A 3UQYS 1UBJS 1J00A 1A4IA 4P98A 2JCSA 4AJ4A 4HQLA 1II8A 1PEKE 1E2HA 1VL6A 5I7AA 4PBTA 4RYLA 1EGAA 3GFRA 4DGQA 4WOCA 4M7RA 2VL7A 2HBZA 3J80A 1FRQA 3TTUA 1WRBA 3BIOA 4LZAA 4P7FA 5CFLA 4ZAGA 4Q9DA 5TSDA 3MJ4A 3S2SA 4FNOA 4Q7JB 4B82A 4HFJA 1IZ7A 4UDXX 1D6NA 3B3AA 1EVZA 5DN9A 1L7QA 3TSOA 2J3KA 3E18A 3OU2A 3F47A 4FLMA 4FYYA 4FFSA 4G0OA 4Q9KA 3HRIA 2WKRA 3P9SA 4G67A 2ORVA 3B7WA 2NPIA 3ESBA 4PINA 4E09A 1YDFA 5B3AA 1QKJA 2PD6A 1FUUA 3NNNA 4DQXA 4ZEVA 4RKEA 1H6BA 1YL5A 3UCEA 2EWWA 1NFRA 2CFSA 2E21A 5FUYA 2O57A 3BX1A 1XMXA 1UPBA 3ACCA 4ZKEA 2BCJQ 3UAVA 2ZUFA 1WV1A 4OX9Y 1S2GA 1FDOA 2YZ2A 5D85A 2JCXA 1WLYA 1CUXA 3DHWC 1M66A 5E6RA 3CVVA 1SUPA 4URHA 3L8GA 4DV5B 3SS7X 1T5TA 4CGYA 1ZXXA 1P5JA 1RC8A 1WCYA 3IT1A 3ISJA 3N70A 2GPYA 2IITA 1VGVA 3O1LA 4QXMA 1Y33E 3AF2A 4HWGA 3JQBC 4RZ3A 4EHNA 3RYHB 5AXBA 2C59A 3CF0A 4IIDA 2ID8A 2V6BA 3KKKA 3QELB 2ATXA 1H5QA 1PCXA 5JPIA 1JKMA 4B1FA 1J8FA 3G6WA 4ER5A 3FFWA 3T12A 5DGDA 4AKEA 5IWCA 3NNDA 3JQCA 2VK1A 4X8HA 1QH1A 2PQ2A 1V1RA 1HDYA 1FYDA 2HA5A 4YV2A 3AR6A 2DBYA 3VH1A 3I9MA 3IH5A 2V6FA 3BB1A 2I2CA 4HB2A 2VAMA 3IUQA 3OFNA 3QFTA 4C4SA 2O3JA 3FNIA 2QM7A 5DKFA 3IJEB 4I1PA 1BH6A 3DL4A 4FI3C 4UCXA 2VP6A 1VSQA 4KV7A 1SRQA 2J7KA 5GV7A 4HWPA 5C37A 1OB5A 3N2GB 2ZRDA 4IJQA 4QXQA 1W85B 2IS1A 2D1RA 1EFDN 1CJBA 4TWJA 5LZ4A 2XTZA 1QLJA 3GDWA 1L1EA 4OAPA 4UQLA 2BHLA 4YMIA 3ADOA 1ST2A 3T3NA 4MW1A 1U0RA 2YRWA 1WSAA 3VJLA 3MRTA 3L7NA 1D03A 4NABA 4OSPA 5DBGA 3W8DA 1JAYA 5BW4A 3WLJA 2WHYA 4JWKA 2WSIA 4LRSB 4RLQA 2CLDX 1H42A 3GRAA 1BMFD 5EPOA 3C3AA 3IP8A 1XEWY 4YJFB 5TY0A 2ZR0A 2CJWA 3AYZB 5JE8A 1OVMA 1JHXA 4BMPB 3U7FB 2P1DA 3PD0A 1SAYA 3WZ2A 4D5GA 4YRNA 4GNKA 1JMVA 5E7QA 1JW9B 4I3GA 1WDTA 2WTAA 5AHRA 1FUEA 1WX1A 1AA6A 2GRJA 3SBDA 1LPNA 2XUJA 1BZYA 3L4KA 5LD2B 2EATA 3OIDA 4RV4A 2PBZA 1W88B 3CLUD 1JIKA 3LLSA 1EBFA 2NVUB 3STTA 1G9TA 4B43A 4ZJPA 2VK2A 1GU7A 3IQZA 3IUMA 4JOQA 4NFSA 2ICAA 2GDZA 3AYXB 1HLDA 3AFOA 3RLIA 1AGNA 4J3NA 3HNPA 5F2NA 2A57A 3OTWA 2HJHA 2PR2A 1DLJA 1U4NA 2CBGA 2OBMA 2DE0X 3OUZA 2W11A 2QG9A 1P80A 1DUIA 4A1OA 4MQEB 4YFYA 2C9CA 2EFCB 3D7NA 3E2PA 3U4DA 1SIWA 3K6KA 1JIUA 2Y0CA 5FUBA 3ZE7A 3RV3A 2BBWA 5CFMA 2FAXA 3MAGA 2H08A 4P92A 3S29A 2N1MA 1B93A 3FGOA 2P9BA 3SPXA 3L7AA 2FZCA 2B92A 2CVHA 3V8VA 1JR3D 4CR7A 1CUFA 1T2CA 2VYQA 5F78A 1I7QB 5KAMA 2WZDA 3KYBA 2ZI7A 5ANRB 4G0ZA 1Y3AA 3DKVA 3QVUA 3QBJA 5JVDB 4ZHSA 4P3YA 3WK9A 4BY9E 3G0GA 4BVLA 2FPXA 4EGFA 4G01B 5AW2A 2I3BA 4LZOA 3WGHA 4OFBA 1OXKB 2A5YB 4YTEA 3C97A 4DCCA 4IIHA 4M89A 2PUBA 4UBKA 3BEDA 1VE3A 2HU7A 4UEJA 1WUJS 2O8EA 2NUAB 5BUZA 1ZKMA 3IA2A 4IXNA 1O57A 1F8UA 1YWGO 3ETJA 4G5OA 3OPQA 2FQ1A 2MCFA 3F2VA 2B4QA 2ONCA 4FN4A 4DR5B 1YI0A 5ALUA 5AM2A 4A03A 3FDXA 1GT91 2A3NA 4MP8A 1UAAA 3CNNA 5AUNB 2BI8A 1MQSA 3VAZA 4TXNA 5F5XA 4YWHA 4YPVA 4P1ZA 3PDHA 2YWDA 4KE6A 1Y8RA 2YC2C 5JYBA 3PHJA 4MWSA 3G1WA 1POWA 3EJWA 3ZDQA 1E2QA 2YKGA 3HB4X 2G0AA 3T52A 3V1UA 1PRYA 3OT4A 5G0SA 4UREA 4KLZA 1Q92A 2C2MA 1RU3A 4G8CA 4BECA 2DQKA 4D4MA 3JQ8B 3IVGA 1Y48E 4KPGA 4C2AA 5IMBA 3WSWA 4QU5A 1J6UA 1Y8AA 3ZWOA 5ALMA 3DHYA 2VP2A 3WQHA 1KAQA 3ZBTA 4DIEA 1DJMA 4MB0A 1NXOA 4AJ2A 3WKDA 4TQUS 3JARA 1PR1A 1PR3A 1XI2A 1Z06A 2X4LA 2ZSEA 1FTQA 1VCNA 4WV3A 2C1XA 3JQEA 1C2TA 1Y8QB 2BHSA 4Z3OA 3KQYA 2WNSA 3SJCA 4RVUA 1UKEA 2O1SA 1H6CA 5JTUA 3U4CA 2XD4A 5AW1A 3IKJA 2YYAA 1N34B 1AQJA 1U0HC 1WR8A 4K46A 1E59A 3L0ZA 1KFCB 1ZOIA 3CKLA 4U02A 2Q1TA 3UV7A 4XX0B 5G0UA 4XKJA 3R8XA 3SHTA 2XWSA 4C76A 1BX1A 1VB5A 1RAAA 4LV6A 2A9RA 2F8TA 2LNDA 1S2MA 3VVCA 1EK2A 3CTPA 4EEZA 5E8RA 3CLTC 3OU6A 4LZLA 1XFAA 1W7AA 1IQRA 2DPYA 4IMJB 4CFSA 3U3JA 4LJ6A 4JYBA 3MMNA 4R0NA 5J3JA 5CIYA 3UJPA 1J2UA 1O6ZA 2PO7A 3PV0A 3GFBA 5LXTA 2CJYA 2O2YA 3NKVA 1XJWA 5FPKA 5FI1B 3EXG1 4FX2A 1WCWA 2ACVA 2V5UA 1KSFX 1SXPA 2HQBA 3B85A 1TO2E 5LNK6 1Q11A 3QI7A 5CDHA 3HU2A 5K3EA 2DHRA 3GQBA 4JBYA 4CM4A 1W9HA 1J33A 2Z9DA 4FMDB 4QOIA 3VDQA 1M0EA 1IM8A 4CDNA 5JC8A 2HLNA 1JVSA 3HR7A 5DNCA 5JDIC 4N54A 4WBNF 3AHFA 3DVAB 1Y1LA 3GGDA 4FDMA 4IL5A 3L49A 3LNCA 4IMPA 4S2EA 1JG2A 4QU0A 3DXYA 3LECA 1ZRHA 2I65A 1F1BA 2G5PA 3FOAA 3HJBA 4PGHA 4JODA 2UUBB 4TL6A 4WA8A 1M5RA 3LIPA 5EGSA 2O0HA 4GOKA 5F21A 3BL6A 1NM5C 3LHIA 4H7IA 4I1UA 4O1IA 1UMBA 1XTIA 1AZWA 2AV6A 3D4LA 4KIWA 1G21B 4F8JA 3V1MA 1JEDA 3VAAA 4FFNA 4RHEA 2O8FA 4KBYA 1E2LA 1JNXX 5H9WA 5SZHB 3KVYA 3VI4B 3PENA 1PT8A 1CG6A 1UPXA 1NTOA 4UD6A 3WDKA 4QM7A 1WY5A 1ZQ1A 3PNPA 2ISCA 2G5CA 2XUQA 4ZPJA 1B8UA 4MX8A 4EF6A 5ADWA 2HT1A 1XTSA 3R5JA 4ENSA 2ZWAA 4FXPA 3G68A 5IXSA 3VNQA 1YDHA 4FTWA 4YRMA 3Q2OA 3SVZA 1P2VA 3KPVA 1NBEA 3LLCA 3NCTA 5KC8A 2KMLA 5K0LA 4GZ5A 5SZKB 2XRYA 4DBZA 2XCQA 1J20A 1XG5A 4WK4B 3L7BA 3RQSA 1FA9A 4Z7OB 1L4KA 4EI2A 1X7XA 1I6MA 4G0XA 4P54A 3CVYA 1Q0PA 3R5XA 2CVOA 1H94A 1J8MF 1SBQA 4N12A 3F98A 3TCKA 3TE6A 4EY8A 5EHQA 3PIRA 3EXHB 3C98A 5FTJA 2OV1A 4TV8A 2I78A 5T4EA 3ZNOA 4AVYA 1KVTA 5GGXA 3RNLA 4MMXB 5LB2A 3T9AA 1JEYB 2RSLA 1S5PA 2HIGA 3GJQA 3RFUA 5BURA 4XVQA 1TRHA 3WC4A 3CLTD 3HWX1 4JL8A 4TSRA 5CJ2A 4ER7A 5K8CA 2CJWB 2AMYA 1D7AA 3IHTA 1ELOA 4DSOA 3CX8A 2VLBA 2AFIB 1XHEA 3VR4H 4N3AA 5HIIA 1U1DA 5FIUA 2OG1A 3FJYA 5EGNA 4ZANA 3VOAA 3ZYCA 5IS2A 3D31A 2W22A 5BY2A 1QWOA 5IAJA 2EFEB 3EJ6A 3EQZA 4AX8A 2GTHA 2WIBA 1LV7A 2Q3FA 2R44A 5J4YA 1JHQA 1UZAA 2F00A 2YOFA 4YUXA 4LJRA 3LKVA 1U9CA 2H1HA 4FWIB 4LJLA 2EX1A 4AZSA 1QR6A 1UEIA 5CPBA 3EMBA 4YBZA 3QJYA 2IWRA 3GLHE 3RVMA 3KTDA 1VXRA 4QVIA 2WV7A 4TXHA 2BEVA 2ZRIA 5FO0A 3EEFA 4P7KA 3L02A 4HNUA 3NDBB 4AMZA 1V71A 1U9YA 3VO1A 4BBJA 4V1CA 4DV4B 3G0BA 4IHJB 4YMWA 3KQQA 4FKBA 1B2RA 1RE0A 2VUIB 4BV3A 1JPJA 5WRFA 4UTVA 2DP4E 3DM9B 4MVYA 5B6PA 5JFOA 4EMSA 1IJEA 4I50A 2O14A 4JBHA 2WTMA 2G6TA 4OX9B 3TIXB 1M1XB 2PBFA 5HSGA 3O26A 2E55A 4P3XA 2ABWA 2WWYA 4IVRA 2WF5A 4FQ5A 4B5KA 5ARBA 4UMFA 4UTNA 4PV7A 2VRBA 3NC4A 4LECA 4NJOA 1O94D 2OV3A 2QTCA 2AFHB 5T3YA 5AIAA 5P8WA 1Z68A 3GELA 1L7NA 3AH8A 5HE9A 3DLBA 2FW1A 4C43A 1OYOA 1YJBA 4I8IA 3OD5A 1N2IA 1E0KA 1KBQA 4J4HA 5EIBD 3WLNA 2HBYA 1UZNA 1UCFA 1WCV1 1PW5A 2ADMA 2B5WA 3QEMA 4DYDA 2XHEA 2ISSD 4MLCA 4B6RA 1FLNA 3JZIA 4PHGA 4UTRA 5KHOC 5B57C 2PXHA 1JHAA 3BWCA 1KFJB 3E5HA 5AK3A 5I7WA 2P2CA 3GVCA 3B78A 3TQQA 3EPHA 1KVSA 1LUAA 1RHKA 2Z08A 3OIYA 4WE3A 4KO1S 3DOIA 1Z7BA 2OO3A 2EW2A 3FYDA 1HLFA 2ID9A 2SECE 3EMKA 4KX3A 4R2WA 3RSGA 4YAGA 4NFYA 4S1PA 3DEYX 1QPZA 1QGOA 4KN9S 3UC9A 3NDIA 4DLXA 3E7PA 1BMTA 2IYWA 2D06A 2EKDA 1AXGA 3GWZA 4Q3EA 4GS5A 3ET4A 4M8KA 1C1HA 5CYFA 4RL4A 3AEKA 1L1RA 1KO4A 1ZFNA 3H7AA 4P31A 4LFBB 4LJ4A 4KV9A 1N2XA 5BRAA 1CP2A 3ANLA 4OQEA