4F21A

Crystal structure of carboxylesterase/phospholipase family protein from francisella tularensis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
224
structure length
217
Chain Sequence
NAMNYELMEPAKQARFCVIWLHGADGHDFVDIVNYFDVSLDEIRFIFPHADIIPVTINMGMQMRAWYDIKSLSLNRVVDVEINSSIAKVNKLIDSQVNQIASENIILAGFSQGGIIATYTAITSQRKLGGIMALSTYLPAWDNFKGKITSINKGLPILVCHGTDDQVLPEVLGHDLSDKLKVSGFANEYKHYVGMQHSVCMEEIKDISNFIAKTFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxylesterase/phospholipase family protein
publication title Large scale structural rearrangement of a serine hydrolase from Francisella tularensis facilitates catalysis.
pubmed doi rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Hydrolase/hydrolase inhibitor
total genus 58
structure length 217
sequence length 224
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.1.1.-:
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f21A00
4FLFA 5EFZA 4MYDA 1J1IA 4IH9A 2XMZA 3PF8A 3EBLA 3UMJA 1TRHA 3F98A 2UZ0A 3L1HA 5ALPA 5EIEA 2WG0A 3DLTA 4QNNA 1QIHA 1AUOA 2D5LA 3FVRA 4OU4A 1YASA 4ROTA 1BEZA 4AO7A 3V9AA 3BJRA 4QEKA 3H2HA 2WUGA 4UBJA 1SC9A 4LKOA 4X3CA 1YB6A 3E4DA 2OCIA 5AHXA 1AMNA 1WCYA 2XMRA 3D7RA 1CUGA 2G5PA 4NMWA 1GGVA 3DKRA 1DWPA 4E14A 2OQIA 1HL7A 1CUYA 1XRNA 1ORWA 1KU0A 1UKCA 5ALJA 1XFDA 3W05A 4X7BA 4BCCA 4X85A 1ZJ4A 1GPNA 5A62A 2XMGA 3I2FA 5E4TA 4B7ZA 3D0KA 3DNMA 3SX4A 3C5WP 5AKJA 1W6RA 1ZD2P 2QS9A 3C43A 2C5GA 2H1IA 1DT5A 3C8HA 2LIPA 4FKBA 2ZJFA 3C70A 1EDEA 5ALRA 4H7IA 1XLWA 3BJMA 1AC5A 5AH0A 1CRLA 5HK9A 4Y2VA 4UBMA 4Q3OA 3G02A 3D59A 5KBYA 5HKAA 2I03A 4MYSA 5FRDA 4QZVA 1IUOA 1T2NA 4CFSA 1DWOA 1IUNA 5CURA 4BZWA 1JKMA 4C89A 3WKBA 4IHAA 4MWTA 4BVJA 1UT6A 2IX9A 4QDZA 4F0JA 3LIPA 3WLAA 3WA7A 3EQ8A 2PUHA 1BS9A 3OURA 3ZLTA 1QLWA 2WHPA 2DR0A 4W9RA 1GPKA 2ORYA 3HLKA 4GHWA 1QGED 1ETHA 3G0DA 2QR5A 4ARAA 1LPMA 2OGZA 4M0MA 1ZJ5A 5AKIA 2R11A 5AOCA 4OYYA 5JD6A 4G4JA 4PO3X 2ACKA 5JAOA 1UZAA 2DQZA 2RHWA 5AKEA 4J0IA 4EY6A 4Y2XA 1XQWA 3HACA 3MUOA 2ZJ6A 5DYYA 3WKEA 2XUJA 1N8SA 3DEAA 1QIIA 2WU3A 2WJ6A 3C6XA 4BAGA 1L7QA 5C81A 4BC1A 5ALDA 2FX5A 3DL7A 1AGYA 5AK6A 4KAJA 3DDUA 3AZOA 5CT6A 3L1IA 4DSAA 2ZYHA 1XZDA 1GQSA 2DCMA 4H7DA 2R8BA 4BB0A 1MAAA 3QBJA 4UHHA 4RGYA 1YA8A 2AXEA 1TKRA 1MNQA 2QUAA 3QMMA 4J0HA 5DYWA 3VXKA 4ZRDA 1YB7A 1EDBA 4H7FA 4HXGA 4B80A 4G1FA 1E8DA 5JARA 3V1MA 1EVQA 1S8OA 4LIPD 4QDXA 4AB1A 3G0GA 3ILSA 5ALFA 3ZPXA 3DQZA 4E15A 3WK6A 1GQRA 2VJAA 5JIBA 5IVIA 1R88A 2PL5A 1A8SA 4B0OA 2XQKA 4HTAA 4QWWA 5T4HA 2J3QA 1D07A 1THTA 1R1DA 3PFBA 1QZ3A 4XVCA 4DGQA 1H2YA 1K5PA 4AMZA 2WFMA 2X76A 1MT3A 3C8DA 5JD5A 3C87A 5HQ3B 4OB8A 3VKFA 5T4EA 2D0DA 3O4GA 5C8XA 2Y6UA 5AK3A 3WZMA 4WDQA 1ZI8A 1Y7HA 3ICWA 3W9UA 1EI9A 2ZSHA 3D3NA 2HHAA 4N5IX 1HDEA 4L0CA 4OB7A 3AINA 3STXA 4Q3LA 4J7AA 1XQXA 4BZZA 4DYHA 3WL5A 1ZOIA 4BAUA 3GA7A 3WK4A 4UHDA 1JI3A 2RONA 2Z5GA 2WFLA 4Q05A 2C0QA 4BC0A 4E46A 4W1SA 1XZAA 3D4LA 3H2KA 4N5HX 4S0XA 5I8PA 4CCWA 4EY4A 4PW0A 2WUEA 4RNCA 1YS2X 4OYLA 3ESCA 4G8DA 1ZI6A 2OGTA 4QDUA 4X91A 4FLMA 1CUBA 1XLUA 4JUIA 3OC0A 5ALUA 1K6EA 5DNVA 4UBOA 1QTRA 5ALLA 3C6ZA 2W22A 5FKJA 1WB4A 4RPCA 2VF2A 1AKNA 1VA5A 2EDCA 4YK7A 1VKHA 3ESDA 1XROA 1GXSA 3H2IA 5AM0A 3I2KA 3NWOA 1ACLA 1XZCA 3JW8A 5EIAA 3VJKA 4GBGA 4EY8A 3AZQA 5A7GA 5AK5A 3CXUA 4XWGA 3G9UA 3M82A 1CUDA 4Y2JA 4B9AA 1ACJA 1RYYA 4U2CA 2XE4A 1ZICA 3O0DA 1A8QA 3I6ZA 4DIUA 4FMPA 4H7EA 4X6YA 4UFOA 5AM4A 4Y2UA 5K3CA 2B61A 2JGJA 1U4NA 2YXPX 5AKGA 2OLEA 1J07A 2OG1A 2OPHA 1LNSA 3FCXA 3W04A 5AIAA 5DTIA 5K5EA 5ALIA 3IUMA 1WHTA 4K6KA 5CXXA 4AO6A 3WWOA 3D2CA 4H7JA 2Y6VA 1XRMA 4TGLA 3H2GA 1JFRA 1UXOA 5CT8A 1JJFA 3STVA 3R3ZA 1I6WA 4BVKA 5JATA 5AM2A 1C4XA 1FJ2A 2PSEA 4OU5A 4JEIA 3WWEA 4C4XA 4GW3A 3NGMA 2GBIA 3DOIA 4GWLA 5KWIA 2PM8A 1XZFA 3Q0TA 3TEJA 4TVKA 4HAIA 1CUUA 1R3DA 1HQDA 3FYUB 2QM0A 4FFWA 1JU3A 4EA6A 4C4ZA 4HRYA 3WKDA 4KEAA 5HKBA 2XT0A 1MAHA 4AN1A 2HU7A 5CH3A 4DMKA 5CH8A 1HBJA 4BDTA 2WQZA 2P8SA 2C58A 3QPAA 1QFSA 3I1IA 3KXPA 1SCKA 3FOBA 3FLAA 4QA9A 2CZQA 1CUSA 1XKLA 5IKXA 1CVLA 2PSFA 3MVEA 2PKYX 3SC2A 4KAFA 2EEPA 3C6YA 4MEBA 4PSCA 4QLOA 3A2MA 4DMCA 2CKMA 1XZHA 5ALOA 4BBZA 1ZD3A 3FCYA 3MUNA 4EZIA 2JBWA 4C6HA 1WB5A 4I19A 2XMQA 1E89A 1TK3A 2Y2UA 5EHNA 2XUDA 4BRSA 2X8BA 1EDDA 1F6WA 3H18A 3F97A 1CUAA 1TCAA 2WLSA 3V1NA 3QVMA 2HRQA 1CUHA 5HFAA 1X2BA 4G4IA 2BJHA 1WHSA 3AFIA 4B0PA 2JGFA 3M81A 1L7AA 3WK9A 1TIBA 3KWFA 2QTBA 5AI0A 3FWHA 3E1GA 1MX5A 1UK7A 3DYVA 4UHCA 5ALEA 3P2MA 1UKBA 5CTAA 1CUIA 1JMKC 2OCGA 2Z8XA 2O2IA 1CEXA 3KDAA 3F67A 3CCCA 1J2EA 2O7RA 1QIGA 4UBKA 2OXEA 1DT3A 2JF0A 3G9TA 5AOAA 4L9AA 3BDVA 5I7UA 5ALYA 2IIVA 3L1JA 3AIMA 3K6KA 2QMQA 4K6HA 4M0EA 2QJRA 3VVLA 1UOQA 2XUKA 2RHTA 4G8BA 4MWSA 2BUAA 2XUHA 1ORVA 3OM8A 2Z8ZA 3IUJA 2V98A 1XZBA 3I1YA 4UBIA 3VISA 3BXPA 1AURA 1LBSA 1CFJA 4Y2RA 1ODCA 3IUNA 4F5ZA 3KSRA 4V2IA 4J0CA 4INZA 4UBLA 4AN0A 1R9NA 1CLEA 4HZGA 5JADA 4FDMA 5T4BA 1E8MA 2VT7A 4MEAA 1JJIA 4B9EA 2CMFA 5LLSA 1VZ3A 1H2ZA 1BCSA 1DTEA 4Z49A 3G9ZA 3OG9A 4BAZA 1AX9A 4Q1VA 1G66A 3A6ZA 3D5EA 3RKSA 5CBKA 5KWJA 3DCNA 3W2TA 4M0FA 5AI6A 1EH5A 3LP5A 3UUEA 3WYNA 3F9CA 4GI1A 1XKTA 3F8SA 3R3XA 4DNOA 4J0JA 5BWBA 1LPOA 1VE6A 1H2WA 2JGIA 4N8SA 4X6XA 3U0VA 5JAHA 3B5EA 1QIMA 3ZV7A 5C8VA 3HSSA 3STWA 3WL8A 1P0IA 4OD0A 2JGMA 2GYUA 2GYVA 5AI9A 1ZI9A 1VOTA 4LXHA 2VJCA 5LKRA 1MU0A 5AICA 4ZV9A 3ICVA 1LPNA 4Y9SA 1CUZA 4OPMA 2E3JA 1EXWA 1FFCA 1QIFA 4YPVA 2IITA 5DNWA 1SFRA 2ROQA 1HPLA 4CG3A 2FJ0A 3G0BA 1P0QA 3CN7A 4X71A 3RK4A 5ALQA 4OB6A 5AO9A 2JEZA 2HU8A 3LLCA 4UUQA 1CUWA 3WIOA 1H22A 4QDTA 2XUGA 1GKLA 4XX1A 4BYMA 2OCLA 2XMDA 2AJLI 4UHFA 1MX1A 1XRRA 2O2HA 2WIJA 1JMYA 5ALSA 4B82A 1DWQA 3B12A 1HKHA 2DHEA 2PU5A 5SYMA 4DTCA 2XQGA 4ZXFA 1TCCA 5DNUA 2YASA 3HRHA 4JNCA 1LGYA 5FXMA 3VJLA 2ECFA 3GBSA 2PVSA 1BEEA 1E3QA 1FFAA 2RAUA 7YASA 3FYUA 2HA7A 3DS8A 4PV7A 3HI4A 4WFIA 1OILA 3NOXA 4EUSA 1Q83A 4DLNA 4KR0A 2JGLA 1SCQA 2ZYSA 3WKAA 5ALZA 5H3HA 2WIGA 2VSQA 4DM7A 5ALXA 3Q8WA 3WYDA 1UOOA 1NU6A 3C45A 2XUOA 1ZGCA 4ZGBA 3WWCA 1EA5A 3W06A 3ZLVA 2VATA 1GPLA 2VAVA 4HVTA 3IA2A 1DQZA 2WIFA 1FFEA 2WHQA 2I3ZA 3QMVA 3T52A 3GROA 1PJAA 3GELA 2I78A 1IVYA 4QWMA 5FDFA 3TGLA 2VTVA 3QITA 2H7XA 1WPXA 1VLQA 1QIKA 3G0IA 3PDCA 2XQFA 3WA6A 5ALGA 5CRIA 5AM1A 5AI4A 4X94A 5K3DA 2BKLA 5LZ5A 2ZSIA 4KYVA 3O4HA 3DYIA 4U2EA 3O4IA 4WFKA 3VVMA 2BFNA 4BVLA 3I6YA 2OAEA 3I28A 5JZSA 1CUJA 5ALWA 4X90A 2AJ8A 1U2EA 5EHZA 3I2GA 1MN6A 2ZYIA 2XLBA 3QPCA 5YASA 2Z3WA 5IVKA 4FHZA 3AILA 1WM1A 2VEOA 2WFZA 5AKKA 4EY5A 2Q0XA 2JGEA 4N8DA 4XJVA 1CUVA 3AZPA 5CT9A 1P0PA 2ACEA 5BOVA 2QUBA 2CUTA 1EB9A 3A2NA 2BGRA 4UFPA 1UK6A 1W75A 4X93A 2XQJA 4AZ0A 2ONCA 1G4HA 4AXBA 2BAGA 2WHRA 4ZREA 3R3UA 2ZJ7A 4QE3A 3D2AA 3AIKA 2WKWA 4CCYB 1YS1X 3STTA 1PV1A 1XRPA 1WPRA 4Y2QA 3WQHA 4JH0A 2DQYA 4FWBA 2VJBA 3R3YA 5A71A 1XQVA 5F4ZA 2V9ZA 1QIDA 1DQYA 2YH2A 1ODSA 4AMYA 3KWJA 2Y1KA 1WOMA 3DD5A 5LZ8A 1DX4A 3ZWQA 1MNAA 4K6GA 3RM3A 5HF6A 1Q0RA 3HZOA 4ITVA 4E11A 2C4HA 4BTLA 2PSDA 1LPBB 2XMBA 5AK4A 1XZIA 4Y7DA 3BDIA 4XIIA 4AQDA 3QM1A 5SYNA 1R9MA 3FNBA 1BRTA 5EHXA 2QJWA 5HFNA 3WIBA 2HA5A 3O9MA 2HDWA 2GBGA 4MQLA 3O9VA 4I4CA 4OCZA 2WIDA 5HK8A 4UFNA 2O2GA 4CG1A 3M83A 1J06A 4X00A 5JAUA 4U2DA 3WL7A 4DMHA 2WUFA 3S8YA 1A7UA 2C0PA 2GYWA 1ZIYA 2XUPA 3EIOA 1YA4A 5ALNA 2HU5A 3E3AA 4BE9A 2BUBA 1ZD4A 2J4CA 4WY5A 4OSEA 1CUFA 3I2JA 1XZJA 4GLBA 1A8UA 3U1TA 2XLCA 4AO8A 5CT4A 1O6FA 1CPYA 1EVEA 4ARBA 1LBTA 5LKAA 3OPMA 3GUUA 3KD2A 5HF9A 1UFOA 3BE8A 6YASA 4QLAA 5KREA 1NU8A 1SOMA 3PE6A 2PPLA 1GZ7A 5LZ9A 2QXUA 1BCRA 1QFMA 2EDAA 4JYPA 5JZ9A 1DU4A 4ETWA 5IH7A 1B41A 5BV7A 5D3KA 2GZSA 1UKAA 4H77A 1QIJA 5FOQA 1BN7A 4BP9A 5EI5A 4A16A 4W1PA 3X3HA 1WB6A 1VZ2A 1ODTC 4EB0A 2HIHA 5IVDA 3RLIA 1XRLA 1LZKA 4A23A 4FTWA 3K2IA 2JGKA 3K9BA 4I3FA 3PFCA 3E0XA 3WK8A 1SCIA 1QO9A 5FP0A 2C5FA 3FVTA 4L72A 2J3DA 4Q82A 2PU7A 3FAKA 1MTZA 4EBBA 4U2GA 3T4UA 1A88A 5EGNA 3C6BA 1FFBA 4UPDA 3G8YA 1ZGBA 1USWA 3ESAA 2QKYA 4H18A 4PNZA 5LIPA 3TJMA 4FFVA 2HADA 2VQ6A 4HXEB 1UWCA 5K3FB 4B81A 3GZJA 5HF5A 1K8QA 5BWCA 2XB6A 4ZV7A 3DKKA 3EF3A 4IH1A 3R40A 5D6OA 4O08A 1EB8A 2H7YA 4G4GA 1JJBA 3WK7A 1C7JA 4B85A 5DJ5A 3VDXA 1E5TA 5HQ3A 1THGA 2XQIA 4L3WA 2QOEA 2QT9A 2GBFA 5CW2A 4A5SA 3N0TA 3I2IA 2AJBA 4WDRA 3ESBA 1XZLA 5HF8A 3BF7A 2PX6A 2VA9A 3IUQA 4IH4A 3CN9A 3D2BA 4EY7A 4MXDA 2B20A 4BDSA 2V96A 3JYHA 3EQ9A 5HZGA 1VE7A 4NZZA 3FYUC 5ALMA 3JWEA 1CV2A 1XQYA 1ZIXA 3B3QA 4KE6A 4B6GA 3IBTA 4KRXA 1G42A 3H1BA 2HA2A 4J03A 3WL6A 1VJ5A 3WZLA 1OXMA 1MJ5A 4F21A 4TPKA 2PUJA 5ALTA 2YYSA 1P0MA 3FYTA 4B84A 1YAJA 3R41A 2PSJA 4P08A 1TQHA 1UK9A 1Q0ZA 2GBCA 4BCDA 3KOOA 2ES4A 3LS2A 2K2QB 1XLVA 4PF1A 2OCKA 1BE0A 4WCVA 3R0VA 2WILA 4H7KA 4CCYA 3QYJA 2RIPA 2WG1A 5JASA 4BCBA 3LCRA 5EHQA 5E2IA 4UHBA 2DHDA 4CIAA 5AKZA 4FNGA 1AQLA 2CEKA 3O95A 1LZLA 5A6VA 2AJCA 2XDWA 5JZBA 4FBMA 3ANTA 1X2EA 2HFKA 4BTVA 1IZ7A 5J3JA 3PF9A 5C7YA 1M33A 4WY8A 2QZPA 3MGAA 3V1LA 4IO0A 3H1AA 3YASA 2WM2A 5AM5A 2XUAA 4C01A 4BATA 4DNPA 4F60A 4MJ3A 2ZYRA 1K4YA 3STUA 4FNMA 4KJXA 2AJDA 5A7HA 3ZLUA 3V1KA 4X92A 5FPQA 3AUKA 2XUQA 3WI7A 4DMFA 4HS9A 3DJYA 3AIOA 1IZ8A 1FSSA 4X6UA 1CQZA 2WG2A 1EHYA 3O4JA 5ESRA 3SK0A 1L7RA 3IULA 3HXKA 4U2FA 2B4KA 3W9BA 1VXOA 1F8UA 2PBLA 5FUMA 1QE3A 5E4JA 2HA4A 3H0CA 4JYMA 2WIKA 1IUPA 4NVRA 2H9YA 2VT6A 3I6MA 2WTNA 4D9JA 4EHBA 3H2JA 4Y2SA 1JT2A 2FJPA 2BGNA 4Q34A 3WJ2A 4H35A 2HM7A 5E4YA 1BROA 5ALHA 3OTQA 4G5XA 1Q84A 2HA3A 5AKXA 1LLFA 1U8EA 4WJLA 5HCUA 4KRYA 3GFFA 5LZ4A 3HC7A 4X97A 4P93A 4W1QA 1Y37A 5IVHA 4J0KA 1C7IA 1CUEA 1CUCA 3DL4A 3A2LA 5FPPA 3A70A 1N5MA 3FBWA 5I9IA 4HXFB 2RGUA 4NS4A 2G63A 3PUHA 4G9EA 3R3VA 2XUIA 2WJ4A 5ISMA 4GECA 3CCBA 4PSUA 3WWDA 2WSLA 4K5QA 1QOZA 4X95A 4U2BA 4RE6A 5K3BA 4C4YA 1PFQA 5T4FA 2Y2VA 4J0DA 2V97A 4G9GA 5CXUA 1MX9A 5EIHA 1ZD5A 3HABA 3FLEA 1HLGA 1W1IA 1EK2A 3FSGD 5LZ7A 4GXNA 1RP1A 3VJMA 5AKHA 4LXIA 2VAXA 1N5RA 3FSGA 2C7BA 3AJAA 5K3FA 1DINA 4GEGA 2RI6A 3HYSA 5FV4A 1TCBA 1Y7IA 3IIIA 1XZKA 1H2XA 1X70A 5JALA 5LZ2A 4FLEA 1W52X 4DNFA 5AI8A 3WKCA 3G9XA 2BUCA 4FBLA 3NUZA 2O7VA 1BU8A 4CG2A 1XRQA 2HRRA 4KE9A 4PSDA 3LIIA 4Q3KA 2HL6A 1YAHA 3BF8A 1YCDA 1E8NA 4FOLA 3S2ZA 2H7CA 4N8EA 4RE5A 5D3ZA 3F96A 1MO2A 4C88A 2XMSA 4LXGA 2OAGA 5AM3A 1RWQA 2HA6A 3V48A 5JANA 1NX9A 1Z68A 2W6CX 1CIJA 5LP1A 4Y2TA 2WUDA 4W1RA 3IVMA 1BN6A 3PICA 4G8CA 4J3JA 2WJ3A 5AIBA 2WHPB 5FLKA 1G5FA 5AI5A 3HJUA 4Y2PA 1U65A 4AZ3A 2VJDA 3H04A 4Y2YA 2ZVDA 3TRDA 2XMCA 1FFDA 3BWXA 4ZI5A 1EX9A 2BCEA 2B9VA 1H23A 1EINA 3EQ7A 5JD4A 1YR2A 1LPPA 1B6GA 2XI4A 1O6GA 1IMJA 5ALKA 5CMLA 2G4LA 1CR6A 4YX9A 5AP9A 1VXRA 4AX4A 5DTJA 3WMRA 3BIXA 4DSZA 4ZWNA 1LPSA 2Z3ZA 3WK5A 3STYA 1QIEA 1T4MA 3ED1A 4K2AA 5AOBA 2WU4A 2JEYA 5A2GA 2QXTA 1XZGA 2DFPA 3H19A 4YASA 4QDOA 5AKYA 5LYYA 3RARA 4BP8A 4LYDA 1CQWA 1QO7A 5CT5A 4H7HA 3M3DA 4UBNA 2HFJA 2I3DA 2CB9A 3WJ1A 2QVBA 3HEAA 4UHEA 3DOHA 4P9NA 2NW6A 4DNQA 1UOPA 1E66A 3IB3A 1QJ4A 3G7NA 5K3EA 4B83A 3N2ZB 3BIWA 1R4ZA 1F0NA 1CUXA 2QRUA 4OUKX 4LHEA 1LPAB 2WTMA 3R3WA 4WFJA 3H17A 4MQMA 3OOSA 3I2HA 2CBGA 1W4LA 2GZRA 1JU4A 5CH5A 1EK1A 4KACA 5A7FA 5DYTA 4BE4A 3PUIA 3QMWA 2X5XA 4CI9A 3IURA 1QTIA 3BL8A 3FLBA 5JAPA 3QPDA 3QZUA 4PQEA 4LYEA 4KAAA 3G0CA 2DHCA 1KU6A 2FUKA 3C5VA 5D7BA 4KE8A 3UUFA 4KE7A 1QONA 4P92A 2XUFA 3SWWA 5JYCA 1UK8A 4C87A 3PI6A 3IDAA 4HRXA 1XZMA 2OQVA 1K63A 1N1MA 1DX6A 1R50A 3WWPA 1AZWA 2J4FA 1MPXA 1GT6A 1OCEA 2OGSA 2DSNA 4BRZA 1W76A 2CJPA 5DLPA 2G5TA 1ISPA 1GKKA 4IQ4A 2HA0A 3ZI7A 1KEZA 4GDMA 5AKLA 4J0GA 1TAHA 2PSHA 4W63A 4H0CA 5K3AA 5ALVA 1F0PA 1VA4A 4CIBA 2WFLB 5DWDA 5AJHA 3QH4A 1YSCA 3ANSA 2JIDA 5C8ZA 1XZEA
chains in the Genus database with same CATH superfamily
4LJ8A 4XSHA 4P3NA 1FSPA 3FI0A 3GI1A 1IWBB 1OC4A 1BXZA 1N92A 2ZSAA 4OK6A 3EBLA 3UMJA 4D81A 4EB6A 2VJLA 4PSVA 2Y99A 3NS7A 2UZ0A 2HBYA 3L1HA 5ALPA 3R3SA 4ZMRA 3DL0A 3LM8A 4FXPA 4GP7A 4Z4EA 2J3HA 2FP3A 1FX0B 1P6XA 2HO4A 3RAPR 3B8EA 3ROFA 5AVRA 1YV9A 4GRAA 1FFXA 3S28A 1ZKDA 1DJPA 2WG0A 2KQUA 3DLTA 3NTXA 1SC6A 1QIHA 1ZMRA 3MA0A 3P9IA 4M6WA 2F62A 1AUOA 3PEWA 2QAIA 3ZBTA 2FRDA 2X2OA 4ZOLF 2QU7A 1O9GA 5HEKA 1PJSA 1EPUA 3S8MA 3JZIA 2P0EA 2TMKA 3ICOA 4KKXB 4AO7A 1EGMB 3RR2A 3JQ6A 1WBBA 3CNEA 3IRUA 1RADA 4HDRA 1X7YB 1ZQ1A 3OHPA 4YRTA 3WSTA 5KNDA 3M0EA 1M75A 2O8DA 5A3JA 2EZ8A 4MCIA 4X3CA 2X5OA 5E9JA 1RBZA 2Q4EA 1T34A 3GBPA 2P35A 5TB5A 2C88A 2OCIA 1GXSB 2Q5HA 4BFWA 1W85A 3AR8A 1U28A 2QROA 1YD7A 2RH4A 2XMRA 4D80A 2J7KA 1KFBB 2PK3A 1N3LA 2OMEA 5EC8A 2FRVA 3RU9A 1J0EA 1JXAA 2DUNA 3R5HA 1EVJA 1RWWA 3UNXA 2O19A 1U1EA 1XRNA 4ZU6X 2F3QA 1RPAA 2X77A 3IUBA 4X1IA 1RE1A 4CT0A 1ORWA 3PQEA 1L7EA 4E3ZA 2G8LA 1KU0A 4EVSA 1K66A 4O4JB 3OF3A 2QTZA 3VPGA 1TC2A 1RCFA 1F20A 3K2BA 3SSNA 1YMQA 1JQ3A 1U0GA 1CULC 3I8XA 1DDGA 1GPNA 4YRJA 4AD8A 3RWBA 2D0OB 2G40A 1LK5A 4WRRA 3I2FA 1PW7A 2EKLA 4IOJA 5G4KA 3W78A 4B6EA 4BPRA 4G0NA 1BMTA 1Y4SA 4OXYA 3OOWA 4U2KA 1L6IA 3L7KA 3CCFA 4E5VA 1A2QA 1WEHA 3HEMA 2IYUA 3OPQA 3ICPA 1TF7A 2WJWA 3UK1A 2BBOA 2YR0A 1SBHA 1U99A 2CLEB 4MLPA 5KPDA 1CHDA 4X7MA 5FT9A 1PZEA 1KJ8A 4LPSA 1A95A 4P3YA 2DKOA 3Q8XB 1AGXA 2GMWA 3LVFO 4QOIA 1KYYA 1P73A 5K0BA 4FKBA 2E37A 2QLTA 3EXEA 4GQAA 3T0IA 5HTOA 5FTKA 4DV1B 2ZJFA 2CCKA 3FY4A 1EDEA 3JX9A 4FJ1A 2YWHA 4J3NA 3BB3A 4CQLA 5L3SB 3UQYS 4H7IA 1RWPA 1NJSA 1XTSA 1AC5A 3W4KA 3JZFA 4IRXA 2A5DA 3G2IA 1B2LA 3WLMA 3G02A 1IONA 1KC1A 3FIUA 4PC6A 5E1MA 3ZXIA 3SFTA 2HSDA 4ZVLA 1YL6A 5F9FA 3KLPX 4IY1A 1T2NA 3DJFA 4F96A 1DWOA 2FQQA 3KOYA 3GLGA 3CNBA 2ZATA 4R71A 1SEVA 3QV2A 1PL8A 2ZLBA 3F73A 1U9YA 5U9CA 2UZ4A 3HRIA 4TKLA 4IHAA 4MWTA 1PGPA 2C99A 2BEJA 3ZHVA 3ZD7A 4FX2A 1D3AA 4JC0A 4PLYA 4BJHB 2CY0A 2J48A 2C61A 3FTFA 1ORDA 4NXNB 1XEXB 1PSWA 4UCXA 1T43A 4NEGA 3EQ8A 3W6NA 4E5NA 1G18A 2I54A 1GUAA 2O20A 2IS6A 2BZ1A 2PUHA 3H1FA 2UYOA 4UHKA 3ZD9A 3ZLTA 1L7MA 3L8GA 2C95A 1PGJA 4NH4A 5FWYB 1M1NB 2Y77A 2A3NA 3SM3A 2WMNB 1NXPA 1FW6A 3NWBA 2ONJA 3RYCA 2QRVA 5AVZA 3G2LA 4IIJB 1R5OA 4WSOA 4BB9A 3A9RA 2J3LA 4Z4IA 1MLDA 4QD3A 10MHA 3WHIA 4GHWA 1Z26A 3N8IA 2ZJ5A 4JAVC 5IJZA 1ZXXA 1LPMA 2X4GA 3NC1C 5E1BA 1WF3A 4N5NA 2HIGA 4EG3A 3TNJA 1CR2A 2I66A 2IF0A 2R11A 2GPYA 3BM5A 3EA5A 3HE3A 3EZFA 4KQXA 3S7ZA 4GMKA 4BEBA 4H60A 1FS4A 1THZA 2H4WA 2LWIA 4LHXA 3U3MA 4BNZA 4F8EA 4N18A 3AC0A 1GA6A 5CLIA 4ALLA 3FYHA 3KJEA 1WUYA 4Y2XA 1XQWA 2VZLA 5BNWA 5BR8B 2ZJ6A 3CLTD 3BCRA 2NTEA 2BEWA 3T4EA 2H2FA 4EAAA 1NVEA 1QZUA 1XK6A 3LC0A 1W1UA 4BQEA 4YLYA 2JASA 2MYUA 1HETA 1GN9A 2NVUB 1L5SA 4EZBA 1BXGA 3A9WA 4M54A 4TZKA 5K7SA 1KYXA 1LLUA 5I9MA 2QG4A 5AVXA 1U7UA 3BDAA 2H1VA 3U9TA 4JBIA 1EFUA 4AG5A 3TDNA 3HADA 3QA3E 3FUCA 5C81A 3F7MA 4ALKA 4CLDA 4F9TA 1E2PA 1CB7A 1QYIA 5FIUA 4D9GA 2FX5A 4JJGA 1AGYA 3E22B 3N87A 3ND8A 3PTZA 3V8VA 3WQSB 1HE8B 5AK6A 4KAJA 1L2TA 2J9XB 2VKQA 4EI8A 1E0KA 1UWLA 2VNKA 4YBZA 4R6XA 3NAZA 5CT6A 2EF0A 5CD9A 3CZQA 3NT5A 4TMKA 3SQOA 3ADDA 4B47A 1CEQA 3DXYA 1E5DA 2DCMA 1TF2A 2OQRA 2QU8A 4H7DA 1K3UB 4A0FA 1PFWA 3H86A 3NATA 1C3OA 4UHHA 4RGYA 4Z1OA 1YA8A 3BXOA 2CNOA 3DT8A 1KO8A 3IFSA 4HLNA 4NYJR 4A1FA 4BJ5A 3O2QB 5GOTA 2JLUA 2BM8A 2IYNA 3ACCA 1NNI1 3DE3X 2QB5A 4GKJB 4G0WA 2QUAA 3GRYA 1W5SA 4RL4A 4A9AA 3IIMA 1BHJA 3V42A 3ADOA 1QGAA 4ZQHA 1M2NA 1GKUB 3HHPA 5HXAA 3MM4A 4B8YA 4HGRA 4E2FA 5KSPA 1G4AE 1YB7A 3K05A 4MMYB 4G5YA 1C8LA 1D8AA 1WEKA 3ZQ4A 4LUCA 1WXWA 2D7DA 3T7SA 2WZCA 5FNVF 4LC0A 1G8YA 4B80A 3FF4A 2JFYA 4RH1A 4HUQB 3QYPA 1FNCA 1G38A 3DSRA 3X1MA 3L4EA 4L8LA 3LK7A 4JODA 4L0MA 5IDYA 1S2GA 4DDWA 1IMOA 1DZIA 4FBGA 3KSAC 1L3BA 1Y3DE 2MDTA 5IK2D 4NYMR 4PPGA 1A4XA 4PIVA 4AICA 4GL2A 3ZNPA 2J5BA 3HFGA 3VHLB 1ACMA 4DPLA 4YMGA 3DQZA 4W8GA 5BPFA 3R7FA 2ZTSA 3QBVA 3WK6A 4YIHA 4GKKB 4KNYA 1Z2NX 4ND5A 3QFRA 4EHNA 5JRZA 2JIBA 2QM3A 3K73O 1RQ2A 5FD8A 2NZ2A 5L4NA 4M53A 5T4HA 1ZCJA 4BWGA 4PYKA 1GZDA 3L7BA 3WDSA 5CITA 1UBUS 4IZOA 4DC9A 1U2RA 2IHTA 3O1JC 1UFQA 3N1UA 5FI3A 3WGMA 5JI2E 1RQRA 4XVQA 5BT8A 3EC1A 1TA4A 1JR3E 4MV6A 1H2YA 1K5PA 2PKRA 4AMZA 2GBPA 4S1WA 4TMZA 4N7JA 2WFMA 3DPUA 4IZIA 1KPIA 1L5NA 4F71A 4GIBA 1BD3A 2CGEA 4KDEA 5AVQA 4GM1A 5HQ3B 1MT0A 5F33A 4V0NA 2GK6A 3ZIUA 4CMGA 4LDZA 2Y1OA 3V8MA 3VKFA 5T4EA 5DFAA 3QWIA 2GCOB 3KPWA 4DUGD 1PX2A 5JCPA 1NUQA 4CCAA 4M0UA 4Y67A 3GFQA 4D9HA 2AR7A 4YALA 3RSGA 4N9WA 4NJEA 1GARA 3L40A 3OFND 3WZMA 1YO6A 3HA2A 4RC9A 1GDTA 3KQKA 1P9RA 1Y7HA 2PKCA 1YBMA 2FFJA 4XJTA 4DUGA 4DV3B 3PC8A 3EXIA 2GPTA 4Q7MB 1NMXA 1W4ZA 2ZYWX 3OFNA 2QX9A 4G97A 2XTAA 3MGGA 2MYPA 3LKVA 2C9DA 4YT5A 5LXTB 1QVRA 2FX3A 2H07A 3KCNA 4N48A 2ECOA 4D9IA 3RD5A 1QKKA 2D4AA 4NEQA 5B6IA 1YCFA 4E2WA 5ITWA 5IU6A 4DAEA 5IJWA 2NU9B 2HJ9A 3RC7A 3WY9A 1YHZA 4KLAA 1B7GO 3IHTA 2IIQA 2ZTUA 3MFYA 1KH3A 4NE2A 1CZOA 4QX6A 3STXA 4TMVA 4J7AA 1NWHA 1XQXA 4IV8A 1K8RA 1LVHA 2B8WA 2VXCA 1YUBA 2X0NA 3KXLA 3LQQA 4D57A 3UJCA 3ELBA 3WL5A 2JI4A 1QAQA 3L07A 1LTQA 2I4MA 2YYYA 3M4ZA 1O58A 1O5OA 2IXAA 2X2EA 5KYUA 5T6BA 2XNDD 5FFNA 4F5EA 1SD2A 3CNOA 4X9XA 2C0QA 5BUZA 2XSZD 3T9CA 2YV2A 2W2KA 4OLBA 1U7ZA 4M9SA 1BH2A 4LHSA 1NLFA 4XEHA 4Y1FA 3OKAA 2JZNA 1RWMA 5LB2A 4W1SA 4MRAA 1E6WA 1XAIA 1M8GA 2XNDA 3RUIA 3KYJB 3H1PA 1B2RA 2JLXA 4XWWA 1XTIA 3RTCA 1N6HA 3SKXA 3CRVA 4Y6PA 2JFPA 3OP4A 1UUFA 1XA4A 4WKGA 3SXPA 3N0RA 3HL0A 4K46A 3CZPA 4G65A 2ODAA 3JQBA 3KPJA 3P2KA 3G68A 4MRPA 1Q44A 1TW2A 1U5AA 4GI2A 3UMSA 4DDUA 1JNYA 3FVVA 1Z5OA 4RZ3A 3NANA 4MQBA 1S1MA 1BCSB 2R4UA 2X2FA 4JZYA 4QUIA 5FI1B 4LBVA 3C74A 2BRUA 4KXUA 1LW7A 1CF4A 3OIYA 2C42A 3DTVB 1RHRA 4DSNA 2K2WA 3ZGLA 1CUBA 2KJQA 3UT6A 1VL6A 4EJ0A 1PP4A 3PEEA 3JQQA 5KAPA 3LC2O 3PV0A 5ALUA 4OHKA 1IIRA 3A0UA 2WDPA 1SPBS 4GWGA 2NACA 2JS7A 4Q48A 1QRAA 2W98A 3BFJA 1VTKA 2W22A 3N74A 1KAGA 3BH7A 1Z82A 1YACA 1YQWA 1TYEB 5FKJA 2FF7A 4U9IS 3L8YA 1SNYA 2ZM6B 3FNHA 1XF1A 5A6SA 5GQSA 2Y9MB 4DAOA 2VF2A 4ZMBA 1QWSA 2X13A 4YK7A 3B5IA 4NFHA 1L4HA 4PYLA 4R31A 4WCFB 4D4JA 1B8PA 3GLTA 4DQDA 1OX6A 4ZODA 5GZ3A 3DEJA 3KVNA 4ND7A 2ZIXB 4H4EA 1BMQA 2HDNB 4NU6A 1YZGA 2PVPA 4XQCA 5I4KA 1W29A 1XROA 2FB9A 1QO0D 2WWVD 2FKAA 3R5SA 4H17A 3AL2A 1SULA 2GPNA 2W2PA 3PTLA 4DKXA 1RPTA 1SRQA 4ZDWA 3X1DA 4NK4A 1KBQA 1F2UA 4AK9A 3UJ8A 2HF8A 3LRPA 1SZJG 1RYEA 1QGOA 4EYOA 1L5MA 5DX0A 1QO0A 3CVWA 5ICFA 2O3SA 5KU7A 3AVUA 3G2NA 4GBGA 1LI7A 3ZU4A 5EXTA 2C8LA 1HFJA 1P4HA 2Q0QA 4OYHA 3UHPA 1GGHA 1MW9X 3ZXXA 4NECA 2P4HX 1U7PA 1WCXA 5AK5A 4EPWA 1EFHA 1CJTC 1WXGA 4C4AA 3X1XA 4XWGA 1AKYA 3EXFA 1H69A 4RA6A 4ITUA 1CUDA 1U0LA 2WAYA 2LBPA 3Q4GA 1KFEB 1J99A 2H48A 3WFJA 5B3AA 1ACJA 4IOLA 1RYYA 4ZAGA 5JBNA 3ABOB 2RI0A 3DHVA 1N57A 3EC7A 1JEYA 1JHZA 4HQNA 3S7TA 1GTRA 4V0MA 1GU1A 4QT4A 3KM0A 2QI9C 4HEA6 2JGNA 3CH4B 5LIPA 4JHXA 5FBZA 1ZP6A 1D0VA 1KQGA 2F1HA 3OSUA 2VHVA 4JLOA 4UE3S 3OLYA 2ZJBA 4Y2UA 2W00A 5K3CA 6REQB 1ZIDA 3A1TA 4EHIA 1B73A 1TVCA 4MV7A 2IU3A 4KK3A 3SY8A 4OHRA 2I2CA 3VR5H 3ZE0B 1HLPA 3NEPX 2PRIA 1FUEA 4H3HB 2Z9CA 4LHZA 2QNRA 4I50B 3VR6A 5AJWA 5D51S 4L5IA 1LNSA 4I5GA 2Q99A 3OU7A 1LTHR 2RB4A 1N5DA 2HHJA 2PGAA 1YZVA 4NJOA 4MV3A 2YV4A 2C8KA 3A11A 4OHVA 1JSLA 1IOLA 4P4SA 4XW2A 5D00A 4AJLA 1MFPA 3GRFA 1OV6A 3NOQA 1T1RA 2FXVA 4GP6A 3SYMA 4BFUA 1ILWA 1V43A 1EJBA 5K5EA 2NSHA 5ALIA 4OHZA 1G2QA 4ZC8A 4B4DA 3UAVA 3S8EA 2PZKA 4K6KA 2PUVA 1LEHA 3WWOA 2KW5A 1Z4MA 2QL9A 1EFRD 4BY9E 3N8DA 1P72A 3FXAA 4KJZA 2BP7A 4QECA 3P4UA 3IKMB 1FYDA 2HO5A 3OAAA 2AEEA 2WLTA 4L8VA 5CNKA 1GAEO 2G70A 3JTEA 1JJFA 3R3ZA 1EFRA 4R69A 1I6WA 3E03A 4ZJZA 1N5LA 1VMAA 2Z56A 4BVKA 3FDFA 1JN0A 1L5KA 2BJVA 3L4KA 1CNMA 1NVWQ 1C4XA 1VL8A 1CCWA 1QF9A 1U28C 2PSEA 2WB4A 3AYXB 3GL9A 3UJ6A 2UVPB 2A4MA 2HJHA 2Y76A 2YHIA 3QMPA 1Q1QA 4J90A 4L08A 2JFFA 4WMLA 2NN3C 3BREA 1N0WA 3NGMA 3TBFA 3BK7A 1RYFA 1XQ1A 4OXRA 3QOYA 5KWIA 1J56A 2B4TO 1XZFA 2IEZA 2PR7A 3AWDA 4GBED 3RTDA 4CFYA 1V2HE 1QS0B 3TEJA 1V45E 2CXOA 3R76A 1LQUA 1IJEA 3HU3A 3QVWA 3ZWOA 4B2LA 2RB5A 3CF4A 2FW6A 1T9CA 2L69A 2WINI 3FYUB 4G5SA 5TEVA 5MN6A 3RFUA 3AFGA 3O83A 3ILVA 4EA6A 2VZ9A 4YJ3F 2ONZA 4WAUA 5TQ2B 1XEWY 4YRDA 2XT0A 3E0QA 5HX7A 1MAHA 2PZBA 3L0OA 1NA5A 4AN1A 3PTAA 2FHSA 2HU7A 4JWKA 4LPKA 2GK3A 5JSFA 4GGMX 2W93A 1X39A 4JJKA 3RS0A 1P91A 3EZ9A 2H65A 4H0NA 4FNAA 4YCBA 1EMDA 2XYRA 2RAVA 3EBPA 4E5YA 1QQAA 2BMWA 1QFSA 5K8TA 1Z4JA 3I1IA 3WB0A 4CLRB 3Q7EA 3V2HA 1R4NA 1MORA 2EQBA 1PL6A 2GKSA 3FOBA 2JVKA 3AUAA 4QA9A 3J81k 4DR3B 4WY2A 2RGNA 1Q11A 3EVDA 1CVLA 1NGSA 3OZIA 4XQEA 4IIHA 3T7KA 4MQEB 3CO0S 3HCRA 4QREA 4AJOA 3M33A 5AUOB 1I7SB 1BRMA 3MTEA 3NYWA 2C2GA 3SC2A 2BEVB 2WTEA 1N6PA 4DQVA 3DBIA 1CVRA 2QJFA 4B7UA 4B74A 2EEPA 4FN5A 5KNDH 4QLOA 4AJEA 2CSXA 3EPHA 1BVUA 1KORA 1QAMA 2QT1A 3SDZA 1MTOA 5EWLA 1G9XA 4HUTA 1EG7A 2ZOSA 4DMCA 2CKMA 1H1LA 3N2KB 1N77A 1E61A 1WSDA 4Q6BA 1VPLA 4PNEA 1SU8A 1G19A 4L9RA 2PYDA 3MUNA 1ZGAA 4MV0A 4LX8A 3QU2A 3OMLA 1Y3CE 4WXMA 2JBWA 4IGEA 1CP2A 2BHSA 3N2EA 3OKPA 3A6PC 2ZRGA 3T3IA 2PVCA 5HR5A 1K1EA 4UPVA 3J7AC 1AGNA 2Q2QA 4I19A 4R05A 1E89A 3DBRA 3IC5A 2QE6A 4NZNA 5KC9A 1OLUB 3PIIA 3RBAA 3MB8A 5CYGA 2Q0HA 3ED5A 2C2OA 1KF0A 1SB8A 1YB2A 3IQHX 5C46F 3KS9A 2EBFX 3KZVA 5FBVB 1FIUA 4O2AB 1JDTA 1FRQA 2AKYA 4GDFA 1EDDA 4DMGA 2W42A 1F6WA 4YH1A 1A7KA 1FYEA 3F97A 5CCXA 1MC8A 4OV6B 4LRQA 1AS0A 2KYRA 4U5XA 2ZTHA 3FSRA 4HMPA 3UYKA 4RJKA 1NI3A 1CUHA 1E5VA 3VPDA 3FOEC 1ID8A 3EMBA 2BJHA 4OJTA 1WHSA 1X1EA 4B0PA 3ZVMA 1WP4A 2AOTA 3K9WA 1R5JA 1JWBB 4YJ3A 2PD6A 4BMVA 2GETA 2JGFA 3I58A 4DV2B 3WOHA 3N6RA 4LZZA 1J49A 2HRDA 1UOEA 1JKIA 4HSEA 2L2QA 3AFMA 4HYQA 1L7AA 1NG1A 1NMEA 4OM8A 2XV1A 2O8VA 4NQZA 2J6IA 1PLJA 4EYGA 3DTYA 3OE4A 4RMHA 1KQFA 1UBRS 5AI0A 1KJ9A 3FPEA 4XWKA 1EHIA 2E6KA 3SYKA 2PZFA 2A30A 2EIHA 3E1GA 3HKDB 5IULC 2RKOA 2ZUUA 4ISCA 4PVCA 4AJNA 5JWHA 1SAYA 3DYVA 2FNAA 1D8TA 5SYAA 4GZ6A 2Y1GA 4IRUB 1D0SA 3VOSA 4C7JA 3TXAA 3QPBA 3CLKA 5DK4A 3GPCA 3E84A 5I7AA 4PRZA 1VI5A 4ZAZA 2ODPA 3CEJA 1CY0A 1WDWB 2DYKA 3C3BA 3CSDA 1MA0A 1P4JA 3H84A 3LG2A 3PWKA 4MWOA 4R16A 5EVJA 1EGAA 3FPGA 3KDAA 3ZBQA 2O7RA 5KWVA 3K92A 5ARBA 4MUXA 3U37A 2V65A 4NOMA 4YRRA 3NAGA 1DT3A 1OFUA 1P0FA 1RXUA 1SUCA 2I71A 4MAAA 2IEAA 3UGTA 4C0KA 1QRSA 1E96A 4TL8A 2AZMA 2RK3A 2Y67A 1LJUA 2HLDD 1G3UA 2YN4A 3EIUA 4I1UA 4MKXA 4QELA 5ERGB 5M04A 5LD2B 3RANA 2VJPA 2IIVA 3L1JA 4MIEA 2IYQA 4JC8A 4QFCA 3WBBA 4QBIA 3AKEA 3HMQA 4F21A 2COEA 5B1EA 1AUVA 2QNBA 3DT9A 5FLXA 3E9YA 1JHYA 1GCIA 1VL5A 2HLDA 3LUPA 5D84A 5KX5F 4L51A 1NC1A 2JI7A 2NM0A 1SIUA 2GFQA 3U9LA 1ZOOA 2SECE 2WF5A 4YLEA 4FQ5A 5H4HA 3WGIA 2RGEA 2RHTA 1H2EA 4G8BA 3L6BA 2G7ZA 4I1VA 3EVFA 3IVGA 4B5KA 1Z6QA 4HH4A 4S35A 2B83A 1JIXA 3N05A 1Q12A 4O2BF 1KI9A 3JAKB 3DFZA 1CQJB 1XZBA 1SXJD 2QDXA 2C2XA 3DHNA 3I1YA 1C30A 1SA0B 1VCHA 2V8OA 3N86A 3QY9A 4UDOA 4CM4A 2GYYA 2ZRNA 4UZSA 1PV4A 2FETA 1BDHA 3BXPA 2WZQA 2NUPA 2CBZA 1E64A 4NCXA 3ROQA 3IVRA 1E9RA 4NYJQ 1YJAA 3CJRA 4OFBA 4P33A 4CMJA 5JYDA 1CFJA 3H4IA 4M55A 5DN9A 3OZGA 2NIPA 4RW0A 2GA9A 1NBEA 3K5HA 3DBHA 4V2IA 3FWNA 5F7XA 2Q8PA 3GJ5A 1JBEA 1IAVA 1ZSVA 4O63O 4RIEA 5DNAA 1NXOA 1TYBE 2UUOA 4FGZA 1FE8A 2Q5CA 4MK4A 1XOIA 3MJHA 3JVUA 5JDCA 5A05A 5MN4A 4UNQA 3O2NA 4Y6LA 1E3EA 2PS3A 5T4BA 4M38A 4D8UA 3GFTA 1ZRHA 1OLXA 1PSZA 1YFZA 1TTHA 4N40A 1C3LA 1WULS 4ND1A 4EFKA 4ND2A 3B6JA 3H05A 2G3YA 2JFOA 3NCTA 2GN0A 3TQCA 1GU7A 2YUIA 4M89A 5C5CA 3REOA 2C4KA 2CMFA 2PLNA 1RP7A 1PWHA 3MT0A 4K86A 3NIWA 3TNYA 1PR3A 2XPCA 2QP4A 2IKQA 3GUCA 1U5BA 1DTEA 3HDYA 4J29A 5LP6A 5GIPE 2BPOA 2CN1A 3DFUA 1JJVA 2FV8A 2BGUA 2EQ5A 2OE2A 4D9FA 4ZK2A 5K0JA 1QPGA 1G66A 2C20A 3A6ZA 1IE3A 1R6UA 2PGDA 2VP0A 2Y0PA 3F3MA 3I5AA 5JEEA 2O23A 2QLMA 2W83A 5KWJA 2H8GA 1JHXA 3ONFA 1UBKS 4RKYA 1M2WA 1RAIA 3PPXA 4X61A 4ZCPA 5JTUA 3WS7A 4UVIA 2QLLA 3LP5A 5ESWA 1UC9A 2DG2A 3ZNQA 3G85A 1XTVA 4P5PA 5HIJA 2CNLA 3NEJA 5FOVA 4CKEA 1S2DA 5ETJA 3F9CA 3O2SB 4WTOA 1HT0A 5LLDA 1VLJA 1XKTA 2GERA 4H3VA 3EODA 1GTG1 4HGNA 4JB2A 2YC2C 4DJAA 4OSOA 4U7PB 1UEJA 3F8SA 2O2EA 1CY7A 1OYYA 5FHRA 1JLSA 3WR5A 1E7YA 1JEQA 1D4AA 1X7DA 5DF1A 5TSDA 5I7SA 1LPOA 2WABA 2AFHB 2W6ID 4XTRA 4J2TA 5JMPA 1X1DA 2JI8A 4PG8A 1Q17A 5DNEA 4JB3A 1DCFA 1EYZA 3B6KA 1E1MA 3RRFA 3FDZB 3I3SR 2C57A 1YK1A 1E6KA 2VNHA 2FEKA 1JAHA 4O2BA 4HCJA 1R6BX 1QIMA 2I3BA 2ORVA 2MSNA 5L6MB 1DEHA 2HTEA 3RRJA 3STWA 2P75A 4GZ3A 3UK6A 1Q0HA 2B4AA 1C1XA 2VBFA 1MO3A 1CF2O 1P0IA 3AHHA 4LJ5A 4TXHA 2JBHA 5BN4B 6PFKA 4OYRA 4OD0A 2J5XA 2QWXA 2JGMA 5CDTA 1NVVR 1ZD8A 5EIOA 3RQIA 3L0SA 3FRHA 1XCBA 3DLPX 3PXBA 1BD4A 4OKNA 1VOTA 3HNPA 3IOBA 2J0UB 4L4SA 2PMWB 2ATVA 2C00A 5A5FA 2F1JA 2QP3A 4CEHB 1C1HA 1MU0A 5AICA 2WVGA 3CPSA 2JIZD 3PQFA 4LRUA 3DOEA 4MCHA 1O8BA 3A4NA 2CNWD 4E2YA 1WXDA 1Y48E 4Y9SA 5BSUA 1LI5A 2B78A 1JLHA 3KSDO 3PENA 1K4KA 1KGDA 4ZP1A 2ZR8A 5JRDS 3LQYA 2RJOA 3IHLA 1N2CB 3H5AA 3OA2A 4RV5A 2XB8A 1Q3HA 4G0XA 5DNWA 5CA0A 1HPLA 3DAHA 3FGZA 4BZQA 4CTMA 1RJEA 2EFYA 2ZJ1A 4D9CA 2Q4RA 4FGKA 4AXXA 2A7XA 4HDKA 1F0KA 1DEOA 1T4CA 2B1JA 1P0QA 2JLRA 1Z74A 2PRZA 2PZ8A 2Z04A 1DUVG 2OLKA 3VAYA 4OB6A 2D1TA 2HU8A 2JEZA 3LLCA 4I1IA 1Q1NA 1ECLA 2V7QD 3OIUA 4RVGA 4XQ0A 1CUWA 2FEMA 4MICA 3DDHA 3HHEA 3OPNA 2W70A 2WT8A 3CMCO 5F73A 2YZNA 3QVJA 4IXTA 5G0WA 1ND5A 4DIEA 5DWVA 1HT2E 3NTUA 2YWDA 1P9NA 1HY3A 4IG4A 1GTVA 2V7QA 2DTXA 4G01B 2XCUA 4C20A 3HWWA 3E7XA 4RU1A 1U8UA 2FFHA 3INYA 4KIUA 5KQSA 1QH0A 3FNQA 1J21A 1U81A 1ESCA 2OD2A 1MX1A 4RIHA 3LY7A 4UHFA 2XA2A 5C80A 3C3YA 4DRXA 1X8JA 1SD5A 1UM9A 2AR0A 3BFXA 1PNOA 3VTAA 1AV7A 4KR7A 2BF7A 1TCUA 3V4VB 1ADJA 5F3WB 2X14A 4CGZA 2AGVA 1IB6A 1CE8A 1T8RA 1VBMA 3GN1A 1ABEA 3L6RA 1PBTA 3QJGA 2CYAA 4K81B 5DHFA 3C1OA 1H1DA 2Z2JA 5IUNC 5A04A 3DP9A 3USCS 4PZ9A 4BJ3A 2SBTA 5CCDA 1S3IA 1H9AA 4NMXB 3IQZA 3QW4B 3NM4A 3MRTA 4ALNA 3KU4A 1QH8A 2X9GA 5DCYA 4POAA 2N75A 3IBCA 3HRHA 4OXIA 5FXMA 3VJLA 3GBSA 4GVPA 2YY5A 4ZVRA 1N0UA 2PXAA 4ASUA 3KZCA 2ZI4A 3L84A 5CM8B 1FUYB 3N39C 4Q9NA 3J81A 3G17A 2Q5QA 1IL0A 1STOA 2A9KA 2G82A 1FFGA 1ETUA 1N0IA 2R6HA 3AUXA 3CE9A 3RPEA 2BFEA 5HRAA 1SXHA 1JWLA 1D2RA 4X54A 2ZJ4A 1ST2A 2EZ4A 4B7XA 1G8JA 1KNXA 4O2LA 1IHOA 4WFIA 5AW8A 4J75A 1TT7A 4KQGA 3O82A 4ZIRA 3U1BA 1SCQA 1AO0A 4MVJA 1VRCA 3Q7RA 2R8YA 3HDGA 1I32A 1V1RA 2P7IA 2WIGA 1OFHA 1CIPA 3OQJA 3PHGA 3Q6MA 3QI7A 1R4AA 1X38A 4EW3A 4B2IA 2JCGA 1OZAA 3SIPA 5H3LA 1CZRA 2D0PB 2X23A 4BQQA 3GLQA 4TQUS 5L3RA 1YJCA 1Y1KE 5P21A 4B83A 3C45A 2HHHB 3GRRA 2E7ZA 4NBUA 5GJBA 1OTXA 4ZMSA 1ZC3A 4RPJA 3FMGA 1A9XB 3ND6A 4RMIA 4GX5A 1T2FA 2P1ZA 3UWMA 1HLFA 2VATA 5DP2A 5HRCA 4JJ6A 1NF8A 5DLDA 1IBLB 3B7PA 2B7LA 1GPLA 3I4CA 4UZEA 1EFDN 4KXQA 5D3MB 3E5RA 4C1NA 3SSAA 1WZCA 1DFHA 1ISHA 1TJ5A 1HFKA 5B12A 4PX3A 5DT9A 4BBPA 1AK1A 5JMTA 2HREA 3L06A 1AE1A 4EEZA 4CF7A 2EYQA 1U98A 3DUFB 2CDBA 3GWGA 5EP2A 3T52A 3U48A 1PJAA 1C1DB 4WV3A 3T34A 2X1HA 1TLLA 3GELA 3O1HB 4FDVA 3WRYA 4FHFA 1RR6A 2VTVA 1QCDA 4PYJA 3C3AA 3EDRA 1JPVA 4EG6A 4EPXA 4YRSA 2R44A 5CHYA 2H2AA 2Q2WA 4IIVA 1CX9B 5IXSA 2R9VA 3O4FA 2VRCD 2WOOA 3G0IA 3PDCA 3VR2D 3ZDXB 1EXVA 3WA6A 5ALGA 5CRIA 5AM1A 3NC4A 3P0FA 1IG3A 2NO9A 3H3FA 3WYEA 2FMIA 1E6UA 3QE9Y 3PKJA 2XBMA 4CF5A 3L8EA 3QTLA 4AM8A 4DDHA 4EGSA 3T3EA 3EASA 4MGIR 3F6EX 2ZWMA 4PC2A 1SUAA 3VR2A 1SCUA 5BSRA 3WL4A 2ZSIA 1ADYA 2YZKA 3M89A 4FI3F 4MWCA 821PA 3ONVA 4HDRB 1W1WA 3H2ZA 3BZBA 5MGBA 2RAFA 3GUZA 2IY9A 3I8OA 5IANA 2BFNA 5A06A 2GT1A 1PEKE 2OAEA 4DCPA 3LT1A 5DT2A 3DZDA 3IAM6 3KSMA 4RFSA 1UEIA 4BUZA 2QAJA 4CMKA 3PXEA 4X90A 5LU8A 1G8KA 2JD2A 3KQMA 1OAOA 4FT4A 1GRQA 5EKSA 3KJFA 1U0OC 3DD1A 3PHBE 1MAWA 3RRMA 4DFDA 4TMXA 4P7FA 2ZYIA 4BOYA 2QTHA 4C2UA 4LTDA 2Z3WA 2ZT7A 4JOQA 4RGQA 2DR2A 4QTZA 1E4YA 4PO1A 3AILA 2FY8A 2VEOA 2WFZA 1J0DA 3VR6H 5KO2A 1U02A 2XZOA 3EGDA 2JHGA 3GEIA 4PX9A 1BX1A 1HSOA 1PT6A 2OLJA 1U6IA 3DWGA 4ZVMA 4MI1A 4EY5A 2B8JA 2B5WA 2EFGA 4HDNB 2RHGB 3T5AA 2HIAA 4KDCA 1UPCA 5EPUA 2JGEA 4ONEA 5FEUA 3U26A 5KNCH 4N8DA 2VJOA 2UXCB 1KDRA 3AZPA 3AT1A 1P0PA 1TU0A 3G5AA 3NHUA 2ACEA 4DWVA 2DETA 1X9IA 1W30A 3NPAA 4BL5A 4E7OA 3B36A 5MFPA 3MD9A 3MT8A 2ZYUX 4XFDA 4ZOBA 4WZAB 2OHXA 4R68A 5JTTA 2O8BA 3FTDA 1FEZA 5AJTA 2VHWA 4CE6A 3A2NA 4XCVA 1QMPA 1UK6A 1W8DA 4DCCA 1ULSA 4CETA 4F11A 1SQ0A 2GN6A 5EJ8A 5L9AA 4M8SA 2WMDA 2WU1A 3CRZA 3JQRA 1FU4A 5LQMA 4YQYA 1XVUA 4R54A 4C2BA 3E48A 2WHRA 2DKFA 4P82A 5IJ0B 3V8NA 3MQ2A 1P1JA 1EFPA 1NONA 3R3UA 4XUEA 3JVIA 2GILA 5FBKA 3EXEB 1Z2OX 2MMGA 2WKWA 1Q1BA 4HDCA 2F64A 4MWBA 3TOVA 1HZZC 1KY3A 1PV1A 1CHNA 2AFHE 3PNOA 1WPRA 4V03A 3A1UA 2JD0A 4E5SA 3NR2A 1E3WB 4M22A 2VJBA 1WIWA 4JL8A 1M7HA 3EXHB 3K6SA 2E1PA 5BMOA 3PHJA 1RYHA 2BBSA 2JFVA 2XZPA 1TYAE 1O95C 3AHCA 4DLYA 3F71A 3QJYA 3WGTA 5DKFA 5F7OA 3UATA 1NUHA 1ZHFA 1NUAA 4RANA 1IEXA 1ILEA 1IXZA 3G5TA 3AEYA 5F64A 5K8UA 1DQYA 1DELA 1K5DA 1M8FA 3IMKA 1YR7A 2QRZA 4TYNA 3VH1A 3HQ4O 3KWJA 3CT6A 4KO2S 1GPWB 1WOMA 1KJWA 1UT8A 1XTTA 1Y3FE 1F60A 2JJQA 5LZ8A 3SICE 1DX4A 3O8LA 3ZDDA 3NO4A 2H06A 3FNRA 3NZEA 5BV0A 2VDUE 1IWPB 5HF6A 2IXEA 3ZGYA 1JKFA 3IQWA 2ZUCA 4ITVA 1EX6A 1GSAA 3BBPA 1YL7A 1QV7A 2GESA 4G0QA 1SZDA 1M34B 4WD3A 3SP1A 4D4LA 1X9HA 2PSDA 5JHHB 2Y0CA 1LPBB 1XX6A 1MOPA 2XMBA 3AFHA 1SH7A 1UEXC 4Y7DA 1N2CE 3UJDA 4JC5A 3BDIA 4R0MA 1V1MA 5FO1A 5BQ5A 6Q21A 4XIIA 4YRIA 3TEFA 3IQXA 3ZDRA 3FNBA 1V8PA 2C1EA 2DHQA 1E63A 5LM3A 4DBVO 2HA5A 2O5VA 2XIQA 5HSGA 1RRVA 2ZYDA 1DBIA 2HI0A 3ZTYA 2HDWA 2C7GA 2PZJA 3IBSA 3PBKA 2I6QA 3ONWA 1VLMA 4MGKR 5DGTA 4OCZA 2WIDA 3TSCA 4UFNA 4MHSA 5GZ1A 4E6EA 1ZCAA 5LBUA 5JAUA 4U2DA 1P4AA 2HMYB 1ODJA 1U1GA 3HN6A 1IPHA 3LO5A 4ENVA 4A6EA 4KRGA 3ZJTA 2YHUA 3UMCA 1A76A 3QVTA 1J5PA 3TLCA 1BFUA 3DDCA 2KS6A 4DIKA 2CT8A 1ZIYA 4JXXA 4DSTA 1D2EA 1Z8HA 3BXXA 3A1FA 3DTNA 2BGIA 1N0HA 4KN8A 2DPGA 3K0KA 4REQA 5KCMA 4UULA 3GRPA 4WEQA 1XMJA 5G0SA 3E18A 4CM7A 1Y7LA 4EIWA 4FSXA 2COUA 2Z9BA 4Q1FA 4LK3A 1PVVA 4CR7A 1E3MA 4NJMB 2J4CA 3BHJA 3ORQA 1SVSA 1BJTA 1QNFA 1T0HB 2ZJYA 4OLFA 4GI3A 3IMFA 5EYPB 3QX9A 4V02A 1YS7A 4EUNA 3H6KA 3UT5B 4RUKA 1UMCA 3GQBA 1U94A 4BNYA 1HRDA 4TT8A 4OHUA 3W4JA 1JBQA 5T57A 4EG8A 3IEMA 3BRWD 4UAGA 5A2GA 1V37A 4OMDA 4OQEA 5JCZA 2DPHA 2XLCA 4UDYX 3F0TA 5I9NA 3Q8MA 4AO8A 2A0XA 4KW7A 1GD1O 5CT4A 3LP6A 3VO2A 3WGOA 2C92A 4IUYA 3HBLA 1AF4A 3T61A 1NXXA 2OO3A 2NUTA 1M6YA 2XF8A 4IVQA 4G5GA 1GNLA 1V8FA 3LPAA 2CDNA 1H8EA 4HEJA 3SZ3A 2GJKA 3P0RA 4QQ8A 1NN3A 5EIWA 2J3EA 4MR8A 3TJRA 1RWXA 3RC9A 5B4VA 3FCCA 1LNQA 1QHYA 3H1GA 1QVVA 2FP4A 1W2HA 2IHZA 2LIVA 1IDN1 1LK7A 5BYKA 1XJ0A 3UPUA 1I6KA 1UFOA 1NR7A 2X8WA 3ER9A 1MZVA 3BE8A 4Q15A 1CNEA 2CFSA 5GV7A 6YASA 1GRCA 3EISA 1D6NA 3TIVA 1Z33A 1PSDA 2EP5A 1C9DB 3A6EA 1ZUWA 3KZOA 5FPKA 5HM8A 2PPLA 1H0RA 5LWQA 1JH9A 1RM4A 2ZUEA 2LKDA 3PR1A 5HMLA 3VHQA 2L17A 2XE8A 2GD2A 5EN4A 1XVIA 5IH7A 1MB0A 2NWQA 2FDCA 4RZUA 1ZR2A 4JMPA 1UKAA 2FWRA 3GLVA 3OTHA 1WD7A 2JVJA 3HUEA 3PPVA 2GZAA 3Q1LA 4QJIA 1CXZA 2OBLA 1NN1A 3CX3A 3ABQB 2XBUA 1Y1PA 3B53X 3LOPA 1LNZA 2CLLB 5AESA 1Z6AA 1VMKA 1SR8A 2QUHA 3M6MD 2GDJA 4FQ7A 1UMBA 5EGSA 3QWBA 3ZBPA 4B4WA 1OH8A 2VRNA 4MKHA 3R7SA 2H1LA 1IK6A 2MSEB 3HN7A 5CEEA 1Z8NA 5JT1A 3D4PA 4XPIA 1LB1B 3ETNA 2Q1TA 3OTIA 3N3AC 5EZ6B 4Y0VA 3M5CA 3LQ2A 3U3JA 3NT4A 3DZKA 3GLHB 3ND9A 4AFNA 1VIMA 1P5ZB 4LYHA 4S2EA 4M49A 1FVXA 1QO9A 1RKQA 5FP0A 3UWKA 2EKQA 2H2WA 2P5SA 3KV1A 4BBAA 1N7HA 2C5FA 3M8KA 1S6YA 3U7HB 3ESRA 3ZZUA 1FUIA 1WLSA 3N2GB 1KZ6A 3ILHA 4QUJA 3KK0A 3L18A 3VSBA 2MSCB 3FVTA 4GQBA 4L72A 1XU4A 4A2QA 2OXCA 3D8NA 2PU7A 1NM5A 1G55A 1ZNQO 3HPQA 1BW9B 3A4YA 3BD6A 3EVGA 3G1UA 4I46A 4RJJA 1HOXA 1P7WA 2ZQYA 4U2GA 4YLGA 2XVXA 2OCAA 5DH9A 2TECE 3VNSA 5C1IA 3AG6A 1J7JA 1YZ3A 5EGNA 4OLHA 2NUAA 1C9MA 2ZREA 1L5QA 1OZ0A 1F2DA 3NGLA 2XXBA 3IVAA 4QJ5A 3RFXA 2YWXA 1BKYA 2WA1A 2B8TA 4ERNA 3E5MA 4YCNA 1KKLA 1AHNA 4FEGA 2EX1A 2I3AA 5IT0A 1J0XO 4H18A 3I0ZA 1GCUA 3JR7A 2R2AA 2BYTA 1G21B 1NVVQ 1E6MA 4BFLA 3AI7A 3E9NA 4DR2B 3VRHA 3JASA 4HXEB 2P6RA 4Z53A 3UMFA 1H4QA 3EZGA 2BFFA 3O4VA 3QLUA 1JILA 4KQ9A 4BNWA 3KL4A 3ZZNA 4YXWD 1XB2A 2WRZA 3A9UA 4GX1A 4OI1A 5PNTA 3SAJA 1ZGHA 4BZXA 3EXAA 4FMCF 1I8TA 4GWKA 5A4JA 3N2YA 3ON5A 5IYZB 3BTVA 1DG1G 2PUEA 4MRMB 1E9CA 1RAFA 2OA0A 5DTEA 2QMZA 2ZUTA 1FFWA 4RVHA 3FF1A 4CEIA 1R64A 3ZH2A 1LSUA 3O7WA 5D6OA 3S99A 1SVKA 2W2KB 4LFCB 2OFWA 4TMWA 4RS3A 2JB9A 3KLBA 3L4JA 1XCLA 3QX7A 4HDOB 2Q6KA 1XA3A 4TV8A 5DNYB 2QTNA 3CFYA 2XQIA 4OIMA 5EKUA 2OBFA 4WZAE 1K7EB 1UF9A 2H2DA 2QOEA 4ZDJA 4QXMA 3A9SA 2PXXA 1HDYA 3N7TA 3L05A 4L85A 1Y9DA 3ADPA 1GYQA 4CUKA 1XN1A 4G37A 1XAGA 2GM3A 2H8KA 5EXPA 2R65A 1O94C 5I7OA 3QVXA 2AJBA 2JIRA 4RHUA 2CNDA 4LQDA 2VAWA 2PSSA 2XGJA 3K2QA 5TJHA 1T4DA 1L1QA 2ANCA 3QEMA 2PRJA 1PL7A 3C3JA 4NH0A 3AVYA 1XCGB 1SVLA 3CRRA 2BD0A 1SK9A 1RRMA 3NP9A 2ABWA 4I4NA 3WMWA 1EUQA 1KIAA 3OTGA 4XUGB 3CN9A 5EMJA 5U1PA 5FDFA 3ETJA 1GAQA 2VH1A 5TMBA 4A91A 4BDSA 3QG1A 2ZDHA 1CY8A 5C5EA 3JYHA 4D0LB 3EQ9A 1S7CA 2RGYA 2ODWA 5C2JB 2C0CA 2H9IA 3O1IC 4PHGA 4F3RA 8ATCA 3A31A 3VNUA 3KHKA 1KBZA 4PFSA 4A1OA 3MLBA 2XQVA 4ZT6A 3ZWXA 1QFYA 1K75A 2WAXA 2QL5A 4MROA 3JWHA 4H1WA 1ZIXA 1IBMB 2C9BA 2PFSA 3OQMA 1B74A 3U09A 3FFBA 4KE6A 1SBQA 2OAQ1 2ZULA 3D64A 3LGXA 4GLOA 1JALA 4RY9A 5KTKA 1LRJA 2FG6C 2J46A 4CXMA 2I6UA 5IDXA 3NHZA 4TVOA 4Q00A 4OQQA 3KQVA 3LLMA 4FYVA 3VYTB 1RXEA 1VB3A 2QRPA 3HLYA 4W6ZA 1OIXA 1C9YA 3SFZA 2HA2A 1VDMA 4N6NA 3I01M 1CRQA 3TCNA 3X1ZA 5BSHA 4AZ3B 1C9KA 2OZLA 3HUFA 5FTLA 5I5EA 3D0QA 3OQ1A 3SS7X 2C2HA 1VJ5A 1Y7TA 3WZLA 4UVEA 4OBWA 1M34E 5I7HA 1M2OB 4TPKA 2PUJA 4OLJA 4AJIA 3IAM1 4QPJC 3HU5A 3RT7A 1CDZA 3DP7A 4N01A 4DZTA 1XTJA 2IU4A 5F5LA 3HV0A 1TGYA 2C59A 3EEYA 2PV7A 3WLKX 4ZZIA 5JQWA 1YAJA 1X9GA 4TM8A 1W59A 2PSJA 3RYHA 1DL5A 2H1RA 2RARA 1VBKA 3JRWA 4R7ZA 1PJ8A 5H3CA 1UDWA 4ZCQA 2F3UA 4WXPA 4IEIA 4TM7A 4MDFA 3NHMA 4JI4B 2YJ6A 1NDUA 3WAJA 2JCVA 3EUEA 4BNXA 1NXWA 5A4FS 4IHQA 3DMFA 1GSOA 5H81A 2EP7A 4D9BA 1I30A 3AR4A 3H0EA 3WRXC 2WFAA 4BCDA 3OZXA 2PWAA 2JA1A 1YQGA 4IDBA 1E1LA 3LS2A 4PG5A 4RQUA 1M6WA 2C3PA 3OCVA 2GARA 3WGKA 5TDHA 4AUMA 1BWPA 4C5AA 3AB7A 4C7OB 2YHSA 3P26A 2AG8A 4D9NA 3L6CA 3HK2A 4ZK6A 3BTOA 2ODBA 16PKA 2OCPA 5E1OA 1PGOA 2YVAA 3AVQA 1T5BA 4NESA 3T7AA 4YYEA 2AQKA 1HOTA 1VCMA 1TMOA 4RV4A 4YBRA 2BJWA 2UYYA 4ETIA 1KMHA 1US8A 3K4QA 5CDHA 2KLHA 1DUSA 2V7TA 1V9LA 3HCNA 3QVUA 4GOXA 5AHWA 5J5CA 5JASA 3GD7A 2BDUA 1U0HC 3LCRA 4JSYA 2IY8A 4WLEA 4HZUA 4ZO7A 5DP1A 3ERCA 4HGYA 3ADCA 2OTCA 3LXMA 2I76A 1B0UA 5E2IA 1YVDA 1X80B 2FFAA 1KP2A 5HG0A 3IPCA 1DBPA 1A69A 2FN8A 1ZUNB 1JDBC 2J3KA 1IZZA 4LG1A 2XRFA 3T5MA 1QCCA 4CIAA 5AKZA 4QOJA 2CV0A 2GHQA 3J7TA 4KMRA 4E6PA 4JQCA 3UWOA 3MNFA 1AQLA 4PXAA 4BP3A 1QG6A 4MVJH 5IPFA 4AJ9A 3RTEA 6ADHA 1K7CA 1LDNA 5FWXA 4RVCA 4RTJA 3OFVA 5A6VA 3JRNA 1ZHOA 1YBHA 3R3HA 2P8JA 3OJOA 4XDYA 1KERA 4PIMA 5SY9A 1SWWA 5DX8A 3FHJA 1O5TA 3ANTA 2OG2A 1E2EA 1YR8A 2CCJA 3H7IA 3WC4A 4NL4H 1IZ7A 4CQJA 3MXTA 9LDBA 5HVNA 4I66A 2V3CC 4YP5A 1VG0B 3PF9A 3U7JA 3VPBA 3UQZA 1I0ZA 1M33A 3QFCA 1YKGA 1KDVA 3S27A 3WG9A 1ULTA 2R6R1 1HDOA 2H6EA 3BXHA 2I87A 2OOKA 3OX1A 1JE1A 3RT9A 4D8TA 3UK0A 4AZWA 1Z0FA 1RLTA 4M7RA 1NVUQ 1XPJA 1YTLA 4BGUA 1OWMA 4N7BA 4O4HB 1JQEA 2BDTA 4QL3A 1NMZA 1VGVA 4C01A 2QQFA 4X20B 3BSFA 3I83A 1F1JA 3TKYA 2ZYRA 2NTYC 3L1KA 1DAHA 2QD4A 5FUQA 1K4YA 3G59A 2VHTA 4C6TA 2Q41A 2ZVJA 4KJXA 4N3AA 5CPBA 3MWDA 3U31A 2A2ZA 3SCZA 4FSDA 3ZY5A 3UWPA 4CM3A 3MCAA 4KFCA 4GMHA 1JECA 2KI5A 2IZ6A 3AUKA 3KQHA 5JJIA 1X7ZA 1RZ3A 1PNVA 3MMNA 4KMOA 5CU7A 3W2GA 5B3LA 3LTNC 1PBNA 3U3DA 2BSAA 2CDRA 5IBPA 2XTJA 2ARKA 3WI7A 4JLSA 3OOHA 2GWRA 1FSSA 3PGXA 2PQ0A 4RZ2A 1XBTA 3VZDA 2O2YA 5IX8A 1CQZA 2WG2A 1EHYA 3PGMA 5EJAA 3UT0A 5I51A 3CINA 3NH9A 2DWUA 3EVBA 4BV9A 1ES9A 3IULA 5IG2A 3Q2KA 4IX9A 3GLHE 3BJEA 4GX0A 4EPVA 1KR5A 3PP8A 3QVSA 3SR3A 4TT3D 5CLJA 1O8CA 3M2TA 3W9BA 1PYOA 4ZKDA 4OLAA 1GZUA 1X87A 3PITA 5GY7A 1G63A 1BQ3A 1M5TA 5EWLB 2R25B 4B4OA 5FL7A 1U7DA 2HZ7A 4FI3C 2IDZA 3EVNA 3EWNA 1W4BA 2EWMA 1V4VA 3I9OA 4TT3A 4XD2A 5CX4A 5FI0B 2KMLA 3EGXB 2IQIA 3WOVA 4BVEA 1UDBA 2EAUA 1GILA 4UMEA 2RMKA 5FFFA 5E4JA 5A0VA 4PIPA 2YFKA 1L4EA 1MB9A 5DCLA 1O1YA 1AHPA 3ZE1B 2R0QC 1A50B 1YQXA 2VHUA 5KSZA 3H0CA 1H5UA 1CEYA 3I92A 1XYYA 4U0JA 3AF6A 3M2PA 2PUGA 2ZZNA 2FPIB 1IUPA 1K8YB 3LDAA 1KJJA 1Y3BE 2H9YA 4EG4A 4I2VA 2VT6A 2ZRJA 4DR6B 3AW8A 3GCWA 3RVMA 8ADHA 4EHBA 4TYPA 3D81A 3VKHA 3H2JA 1J7KA 2XCSB 1RLMA 1JT2A 2PX2A 3JZAA 2NT3A 2BGNA 4L6IA 3NJ8A 2WYOA 3UBMA 1QZZA 4ZJPA 4ENQA 3DLHA 1AK9A 1G21E 2QUIA 5IVPA 1VG9B 1P3Y1 1J8VA 1YE8A 1NAIA 4LNUA 5GONA 4CIYA 1Q84A 4CKCB 1MJFA 1CWUA 2ATEA 3L8CA 2ODQA 3ECCA 3UGKA 3U17A 3GIWA 2GJSA 5JQGB 3X1JA 1EDZA 1P7ZA 1YVRA 1T3GA 1LLFA 2ZTMA 1KMQA 1WHSB 4NYIR 5K0SA 4WJLA 4CR6A 2V5AA 1LU9A 2G7MC 2I6SA 2ZRLA 4QUGA 5I7FA 2V1XA 2H17A 3HC7A 5CLLA 2FN7A 3TXYA 1Q7GA 5HS6A 3FTPA 4BZPA 5IVHA 3EIHA 5JXWA 3H1EA 2XZDA 1CUCA 5AW4A 3GARA 1RJFA 3KEOA 3EX7C 3UYLA 1GZHB 2D1RA 3BHMA 3T99A 1CS0B 2C84A 4V24A 3IOMA 4YAUA 4FMDF 2YV3A 2P3LA 5BW6B 3CLUC 2RGUA 1UWKA 2JANA 1Q91A 4G9EA 4NBVA 4PHTA 3F4BA 3AR2A 3IDFA 4PLHA 2O2SA 1U8AA 1Q74A 1HDIA 3CEPB 3TLGB 2YFHA 3ECSA 1T15A 4I81A 3DONA 3EZLA 2P9GA 2P6OA 1F2VA 2I99A 2J08A 1IM2A 1P9WA 1W7AA 2B37A 3SOPA 4QGBA 3PC3A 1NOJA 4PPNA 1NUPA 1ULUA 5TVGA 3TUJC 4ZV4A 5LL6P 5BNZA 2Y4OA 4H3SA 2FLVA 3SKVA 1FTQA 3MLEA 5K3BA 1LTKA 3RGGA 3RNLA 3ZBUA 1ZA1A 3M9WA 3IESA 4XQGA 1V96A 5L7WA 2CMDA 3ROEA 1ML3A 3B51X 3U49A 3DUWA 4EGAA 1E69A 5JSHA 1JFFA 3DE4X 2CVPA 3QPUA 2KB0A 3UICA 3ZY6A 2C4VA 2RC6A 4G9GA 2P2SA 5CXUA 4RZHA 2H2HA 3ZK8A 3UC5A 1ZCBA 2OV4A 1SD1A 5FORA 5EWMA 3HABA 4LOAA 3FLEA 3GW8A 4HDMB 2PWYA 3MSXA 4RETA 4JC4A 1FC0A 3QI2A 4OQXA 5LA6A 2C1ZA 3UWSA 4B6OA 4DDTA 4BQPA 3EA4A 2P78A 4OF4A 5KYVA 5BMVB 1H5NA 4GXNA 1HT3A 3VJMA 3QV1A 2Y71A 4A8HA 2PJRA 1VMIA 2ZGVA 4RK5A 4LMPA 1LBQA 3W5CA 3EGIA 4XLTA 4G81A 4BNUA 1C30B 2E87A 3A7DA 2R6JA 1E98A 1HLDA 4XEUA 1PLLA 2GF2A 5K3FA 1DINA 5LOVF 1RVDA 4OHOA 4C2TA 1XZPA 2NUPB 3DLAA 3HYSA 5C1PA 1YT5A 3T15A 3D7NA 3C7KA 4K7JA 1CTQA 3LVQE 2PS1A 3WNDA 1SXJB 3S2IA 13PKA 1TA0A 2HGSA 2PKQO 1ECFA 4G4SO 4RMGA 1E0DA 5CLFA 1Y6RA 4M88A 4A6DA 3R75A 4A82A 5KYWA 3UHAA 3KQLA 3T41A 3EF1A 4RF4A 1G5RA 1GVNB 2F1RA 2IUEA 1H2XA 3W90A 1X70A 1FBNA 3HFSA 2CLKB 3ZU6A 5I8WA 1QVWA 5AVUA 1E0AA 2W6JD 4FCTA 3FOWA 3FWPA 2FPRA 3KB8A 5E8JA 1NI4A 4A73A 4TUYB 4AC9A 4OHBA 1SKYB 1JSRA 3HY4A 5AI8A 2ZJ2A 4CF4A 2XNKA 4V0ME 2JI9A 3E7PA 1XWIA 3NUZA 4GPAA 4ZYWA 4EO9A 3Q8LA 2HRBA 4LF9B 1VL1A 1QFJA 1RTKA 4O5AA 4WACA 5GZ6A 2HH9A 4PSDA 2HLHA 2XCQA 4DSOA 3LIIA 3UF0A 4K88A 1NIPA 2UVQA 4XYEA 3SZGA 4ECEA 1UKEA 4F9FA 4YV1A 1H1TA 2AZDA 4H31A 4HWGA 3MGCA 1G8MA 3BXFA 5EIFA 1YAHA 5AXBA 5ADUS 4XIFA 4YGYA 2OGUA 3RVNA 3S2ZA 1GY8A 2GAFA 4U6NA 2X3UA 1MMFB 3TNDA 1DXYA 5JXIA 2CXUA 2O3RA 5FR1A 2QVYX 3R7AA 3DFIA 1VPTA 4DT1A 5ADVA 5TMPA 2B69A 4EL5A 3KUXA 3MFQA 1ESEA 1UXIA 4B6FA 1XK7A 1Y8RB 1JPNA 1T24A 3P20A 5DIFA 1YZNA 4NNOA 4LZNA 2R8ZA 1T8SA 3IUSA 4ND6A 3LD9A 3OFSA 2NV6A 3BWEA 1YDMA 1V25A 1RKVA 4EHKA 2IL1A 2PYZA 3AO0B 4LVUA 4RPKA 3DBLA 3V48A 3VC7A 1LBHA 2F3RA 2VP2A 4OQZA 2BTQB 3TGWA 3FTEA 1V4BA 1J2UA 3EEOA 4MKIA 4DV6B 1Y8AA 1Z4QA 1VHDA 3MTDA 4P3XA 4RX1A 3I9V6 1ZUD1 1G6OA 1VJDA 2VPQA 2ZRFA 5CIYA 2Q27A 2WR8A 1QK5A 2ON6A 4P3KA 1U9JA 4MUFA 1ZS9A 4G8CA 3TQRA 3W0LB 1K7YA 2D8AA 2LR0A 2VUUA 3AETB 4J3JA 2H00A 5AOVA 1Z4OA 4G5QA 5FB3A 2WJ3A 3KYDB 1MQSA 1GTSA 1Y5LA 2HSEA 1UBHS 1WMSA 1MVNA 3BJZA 4JBYA 4YCCA 5LOVA 2JJ8A 1V6CA 2VJDA 2EFCB 3GFGA 1T8WA 4Q3EA 2ZVDA 4Y2YA 1Q1GA 5KVQA 1QHGA 3W8NA 4DW8A 2GO1A 1S1CA 2XMCA 4H2DA 1FFDA 2ZIZA 4MDHA 4R0VA 5CDGA 3CGGA 7MDHA 4N82A 1G7CA 3GLFB 4XJSA 3N70A 3HR8A 3GVPA 3UUGA 4ARUA 3LMKA 4QM6A 4OQMA 2W2VA 1SBCA 4FFBA 5IYZA 2CL6X 5JD4A 4I9UA 3TFQA 4TMFA 1YJBA 1F5NA 1AB6A 1KFCB 4C30A 1DBWA 1E1QD 1YR2A 3TKAA 3IOCA 4CKZA 1SBNE 3KBBA 4XDZA 3A6JA 2FG7C 2WYUA 1W5BA 2GD6A 3ODGA 3A06A 2YXLA 1QH9A 3UOWA 4EGJA 2BCGY 1F3OA 2V6FA 4Q1CA 4ZQCB 1UM8A 3TVTA 5CA0B 2ZIGA 5CMLA 1E1QA 4JBHA 3VQTA 3MS4A 4UCQA 4EA7A 4OBEA 4NZ9A 1WQ3A 1TEZA 2O8EB 2C5AA 3KFXA 2VLIA 4KXWA 4AX4A 1VE9A 1I1OA 2QV7A 3RUDA 3O8DA 5ES3A 3WMRA 4W9NA 4JYCA 2QF7A 3D7MA 3OWXA 2HU2A 1QOQB 3ECAA 1EGQA 1YI8A 5BSMA 3FGNA 4WT7A 1MXFA 4EMTA 2VDMB 1G5PA 3BMCB 2QVXX 4N0DA 2V6JA 4ZAYA 1J1UA 2OHVA 3GRCA 3HSKA 4GAEA 2R47A 4A7PA 3AI2A 3H19A 2YJZA 4LY3A 4UTOA 4CDNA 1OBVA 1FFHA 5ARDA 3DZGA 3C4JA 1XGKA 4YASA 3TNLA 1B26A 4DVGA 5BW8A 1PZFA 3S40A 3QY0A 3JWPA 3BK1A 4DRXB 3VR4A 1QH1A 2HPAA 4ZI7F 2VLBA 1A5BB 3VC2A 8AT1A 3OCXA 2VRWA 5A0FA 1H65A 1XDUA 1BS1A 3HL4A 1CE8B 1JIKA 4MLZA 2VP6A 5DTRA 5SY6A 1YR3A 3T0FA 4UBNA 3NALA 4JV5B 1EESA 2I3DA 2CB9A 3WJ1A 2WW8A 4OUDB 5DGXA 1N9ZA 2WAMA 4RCZA 2QVBA 4UHEA 3QRWA 3B1KA 4Q9LA 3ZIAD 4Y1RB 1HH4A 3G23A 5CB0A 3PUJA 1M6HA 4FE7A 4M46A 4OHXA 3FRJA 1Q3KA 3K09A 2QAGA 4JOCA 1XALA 1NZFA 4JQYA 3G3EA 1SJ9A 3NI2A 4DA6A 3IB3A 5KTMA 2O48X 5DSXA 4RESA 3RI3A 1SELA 1SIBE 2JFBA 3BIWA 3I2YX 2GJ8A 4JITA 5TF0A 5B5SA 3DPIA 3A37A 2M1XA 2WV9A 3U60B 5IT9A 3AVXA 2FPPB 5CX1A 3A26A 3J80A 4LY6A 1A9QA 2FMHA 1ZCFA 3GWZA 3KELA 1NVGA 3ANXA 4RD6A 2WTMA 2FWBA 5AQEA 4KIFA 2BFEB 2R1VB 5LBTA 2Q9CA 1HZJA 4WFJA 4HY3A 2QRGA 4TZTA 3HA5A 4ENUA 4MV4A 4F56A 2PDAA 1DKOA 4MQMA 1L1FA 3OOEA 3OOSA 2ONYA 2AIRA 4QYIA 4HF7A 3W7BA 3QEAZ 3S2GA 1YMVA 4YP6A 3QBEA 3DAYA 4R5HA 4ZFNA 4QBFA 3V1YA 1FNMA 1KK0A 2HJSA 3TPCA 1DEKA 2JL1A 2AR9A 2BKEA 1P77A 2GZRA 4X1YB 5CH5A 1T3LA 1WCIB 1Y33E 2GQ0A 4R2IA 5C5IA 4BE4A 4CKWA 3U7FB 2F8MA 1SHZA 1JA9A 3H8VA 1JG7A 4FHGA 4FYWA 4GUAA 4NMMA 3D8BA 4QPPA 4AS3A 2EFDB 5JJ5A 3IURA 3OCYA 3FLBA 3GR6A 1FLDA 5BXQC 1BDBA 1YRHA 3OLQA 4ZVVA 1KQ3A 1FYXA 1YS9A 3B6MA 1GNQA 4Y2HA 5E6SB 3TWOA 3LO8A 3LWDA 3QUTA 4LYEA 3V1UA 1KVRA 5ADHA 4JGGA 3AI1A 4KQMA 4MUKA 4KAAA 1Z73A 1GHTA 1P19A 2BEUA 4WUVA 4JEUA 3V7FA 3C5VA 6ABPA 4MUIA 5HFJA 3TM4A 3L92A 2YCLA 2QZ9A 3B70A 5LYJB 3FFXA 3FG9A 4UAVA 3RSCA 1N6RA 4LF7B 3ZI4A 1U2SA 1W0JD 1O95D 4P92A 4W7SA 3ABZA 3DEIA 3FTQA 1CERA 1SU7A 3IR6A 1R37A 2PT7A 1D2NA 3HG7A 4R9NA 3SU8A 2G67A 3T7TA 4AMGA