4F26A

Crystal structure of the second rrm domain of human pabpc1 a ph 9.0
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
GNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyadenylate-binding protein 1
publication title Interdomain Allostery Promotes Assembly of the Poly(A) mRNA Complex with PABP and eIF4G.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f26A00
1PGZA 2EVZA 2MY7A 2HZCA 3VAHA 1F9FA 3NMRA 1L3KA 1QVGR 2BZ2A 2DHSA 2X1BA 2FHOB 3L3CA 1WI8A 3H2VE 3CMES 5LSOA 3US5A 3VAMA 3Q2SC 1VQ8S 2DO0A 5GADU 1Q82T 2M9KA 1Q81T 2KH9A 1X5PA 3NNHA 2LMIA 5IQQA 3DLLQ 5GAEU 3CUNA 1Q86T 3G6ES 3CCMS 2KXNB 3CCES 1SXLA 2RQ4A 2KM8B 1YWXA 3THPA 2RRBA 4C7QA 2DNNA 5D78A 3G4SS 1M5VC 2D9OA 1FJCA 3PIOQ 2HVZA 1WHWA 4YOEA 2MSSA 2HGMA 2MY8A 1FJEB 1SJ3P 2CPJA 1O0PA 4QU6A 3ZZZA 2DGXA 5HO4A 2EK1A 1K8AT 4ED5A 2LA4A 2D9PA 2DB1A 5LSLA 3UD3P 1WF2A 2DNKA 4Y00A 3S01A 3CCVS 3VF0B 3MOJB 4QQBA 2VONA 2LXUA 1QM9A 3NS6A 1YTYA 2MHNA 4PR6A 4C4WA 3MD1A 3S6EA 1FNXH 1VQ4S 1X4AA 1KOOA 3RW7A 3VAJA 2NZ4A 4QPTA 1VC0A 3B4DA 2CQ3A 2RVJA 2MB0B 2MJUA 2CQIA 3UCUP 2CQCA 3HI9A 4WFNQ 5ITHA 4ERDA 2RS8A 5EN1A 2N82B 1H6KX 1SJRA 3MD3A 2PEHA 2L41A 4CH0S 5IM0B 1A9NB 4CH1A 2MKHA 2E5IA 2G4BA 5GAHU 2MSTA 1X4HA 2YH0A 1U1LA 1VBZA 2KI2A 4W92B 2LQ5A 4P6QA 3VAIA 2G0CA 2VOPA 2MQNA 2L08A 3DXBA 2DNZA 1OWXA 5CA5A 2ZJRQ 4IOAQ 2MZQA 1H2TZ 2FC8A 1K73T 3SDEB 3PIPQ 2JVOA 1N8RT 3SMZA 2CPHA 1VQMS 2KRRA 3CC2S 1UP1A 3CPWR 1H2UX 1WG1A 1YI2S 4UQTA 1X5TA 2F9DA 3UCGA 4LJMA 2KG0A 2KHCA 3CULA 1P27B 4BS2A 1WWHA 2KVIA 1BY9A 4PRFA 3CF5Q 3P49B 1R8PA 2ERRA 1RK8A 3CCLS 1DRZA 3I56S 1S72S 2RT3A 3BO4A 1M1KT 2LA6A 1VQKS 2CPZA 1U1QA 4A8XA 2J76E 4U67Q 1OPIA 4IO9Q 2DITA 1FT8A 1X0FA 2CJKA 4YB1P 2A3JA 2KXFA 2MZSA 2LEBA 1Q7YT 1UFWA 2DIUA 1VQPS 1U1NA 2DNRA 2G1DA 2E44A 3G8TA 1X4EA 1UW4A 2DNHA 1VQOS 1VQ5S 1ZH5A 3P6YC 2M2BA 3B4MA 1FO1A 2DHXA 1YJ9S 1X4FA 1ZZFA 1VQ7S 3IRWP 1VQNS 2MXYA 2CQ4A 2DNMA 5CXTA 2ADBA 2XS2A 2L9WA 2RUGA 2ZJQQ 1DHMA 1M5KC 2LEAA 2RS2A 2MQOA 2DNQA 1WF1A 2RQCA 2RRAA 3CMAS 3IWNC 5LJ5Y 5GAGU 3VAKA 1RKJA 2PE8A 2YKAA 1JJ2R 3TP2A 3LPYA 2DGUA 5DM7Q 2F9JA 1XN9A 2CQ2A 4Y0FA 1OO0B 2O3DA 4LIRA 1WEZA 2KYXA 2CPIA 2KN4A 1KC8T 1U1KA 1R8HA 1YHQS 1W2BR 1VQLS 3EX7B 2MQPA 1U1RA 1X4GA 3R1LA 2MGZA 2DGVA 1UAWA 2DISA 2N3LA 3MXHP 4C0OC 2DK2A 2DGWA 3VALA 3CCRS 1X4BA 3MUVP 3MUMP 3UD4P 1VQ6S 1HD1A 2CQBA 1WELA 2RNEA 4UY8T 3EGNA 4FXWA 2DHAA 5DM6Q 1WHVA 2MKSA 1A7GE 3J7YU 3EGZA 4F25A 5MLCV 1YIJS 4CQ1A 1YJNS 1JJ4A 3UCZP 1N52B 4TU7A 2U1AA 3U1MA 3S7RA 2CPYA 2MZJA 3G71S 2AYEA 4TU9A 2ZJPQ 2OSRA 4EGLA 2DIVA 2DH7A 2J0QD 1ZZNA 1DBDA 3V4MA 2MKKA 2FY1A 5GVQA 2OTLS 2OJ3A 3TYTA 2XNRA 1K9MT 1X5SA 2CPFA 2M88A 1KD1T 2E5GA 4V19X 1VBXA 3G8SA 3ZZYA 2M8DB 2DNGA 4J5OA 2DGTA 2MZRA 2J0SD 2KG1A 2LKZA 3S8SA 1G2EA 4TU8A 2MPUA 2MKCA 2QEXS 2F3JA 3VAFA 4QU7A 5HL7Q 1U6BA 1NO8A 3UWTA 2XS7A 1U1MA 3NNAA 2DH9A 4LMZA 1IQTA 1QVFR 1SJQA 2GO9A 4IUFA 4WF9Q 1P1TA 4OZ1A 2DHGA 3MDFA 1JMTA 4Z2XA 2KU7A 2YWKA 3R27A 3RW6A 2KRBA 3R1HA 2CQ1A 3CC7S 1WEYA 3VAGA 2JX2A 2HYIB 2DGOA 2HGNA 3LQVA 5JVHQ 2LCWA 1H2VZ 1WHXA 1X4DA 2JRSA 2FC9A 2MZ1A 3CCQS 3SXLA 3BS9A 4CIOA 2M52A 4TLQA 2MQQA 2E5HA 2CQGA 2M70A 2BOPA 5LXYA 2CQPA 2DGQA 4FXVA 2KT5A 1WTBA 2MGZB 3J7ZT 2KFYA 1JJHA 2MJNA 2DNLA 2M4MA 2ADCA 2AYMA 3CCSS 2U2FA 1SJ4P 3P5TL 2MKJA 1YJWS 4WCEQ 3U1LA 2LECA 2MYFA 5DDRC 3P3DA 5GMKa 3CD6S 5DETA 2N7CA 2LXIA 2NLWA 1X4CA 2V94A 2CPDA 1SJFA 3MI7X 2LYVA 3K0JA 1M90T 2I38A 1WI6A 3NNCA 1FXLA 2N3OA 1FHTA 4WFBQ 1WG4A 3FEXB 2MMYA 5LXRA 2D3OR 2AYGA 3BEGB 2M8HA 4M5DB 2Q79A 4WIIA 1VQ9S 2XNQA 2JVRA 4IOCQ 2EK6A 2OTJS 1U2FA 3JB9k 1D8ZA 2XSFA 2E5JA 3ULHA 2DH8A 3N9UC 2AYBA 2DGSA 2QA4S 4WFAQ 3CCJS 4RU2A 1CVJA 2JWNA 2OSQA 4PKDB 1N88A 1U1PA 1WF0A 3FEYB 1HA1A 2AD9A 2X1AA 3D2WA 1S79A 2GHPA 5CYJA 2X1GA 5IFMA 2YTCA 1OIAA 3NS5A 2MQLA 2DNYA 1URNA 1FJ7A 2RU3A 2CPEA 1DZ5A 3HHNB 3Q2TC 5H1SV 3I55S 1M5OC 3MUTP 5FJ4A 1KOHA 2MZTA 4W90B 2MQMA 2WBRA 2KM8C 2DNPA 1VC6A 1WEXA 2K8GA 1VBYA 3BO3A 2UP1A 1NJIT 2VOOA 1WHYA 1YITS 2K3KA 2MKIA 4F26A 4F02A 1U6FA 2B0GA 3CCUS 2OIHA 4WKRA 2KXHA 2XB2D 1M5PC 5BJRA 5D77A 2I2YA 5DDQC 3G9CA 3MURP 2VODA 5IM0A 1KQSR 2M0GB 2XS5A 2QFJA 2DO4A 2J8AA 3THTA 2X1FA 1HL6A 3UE2A 2FPHX 2HGLA 4YUDA 3CC4S 2DNOA 1AUDA 1N54B 3H2UB 1VC5A 2CPXA 4OZ0A 2CQDA 5DDPC 3G96A 1PO6A 1B7FA 3OW2R 2SXLA 5JVGQ 1X5OA 3BO2A 2YH1A 2CQ0A 3TO8A 1NU4A 1HD0A 2M7SA 1WG5A 3SDEA 5DDOC 1U1OA 1D9AA 2CQHA 5LJ3Y 3CTRA 4ZKAA 3CXCR
chains in the Genus database with same CATH superfamily
2AX1A 1L3KA 3EMTA 3BPSP 1U0HA 3MFIA 4GMKA 2OEJA 4RW4B 1NH7A 2ASLA 2WSEC 3C6TA 1LK7A 5BYSA 2RQ4A 1WC4A 2P8IA 2EFNA 4LF2A 4Q43A 4C7QA 2JDJA 2O5DA 5D78A 2OPPA 5E3AA 4M5IA 3DN9A 5DLFA 4MTPA 2VG7B 5DG7A 2UV8G 4DR2F 1JLGB 2LXUA 2KYZA 4C4WA 3SSSA 1FNXH 2OUGA 3I4PA 2ZZNA 3ETOA 1GTHA 4WIQA 8AT1B 2J6UA 2YNGB 4BC9A 3AT1B 1OSDA 5KFCA 5D3GB 4IQXA 2DD8S 3W5XA 2AMCB 5K8MA 2MSTA 2YH0A 3I9ZA 2KI2A 2E1MC 1E6VA 2QZ8A 3TAQA 4IOAQ 3FFIB 1N34J 1YK9A 1K73T 2B3TB 2V8VA 2CXEA 4NOHA 1RTIB 2IVMA 4PG4A 1NRKA 3QBCA 1VRQC 2ZDPA 4RBVA 1R6VA 4ZPCA 4KH1B 4NMLA 3X1LB 1FWKA 1QSLA 1NZAA 3OR2A 3QT7A 4JI0J 4KQZA 4EZ6A 3T9NA 1HNWJ 5A6PA 3CIMA 2IRXA 3I31A 2F40A 5KFTA 2V2KA 5FDLA 4NXMJ 3NGRA 4NLQA 2BV3A 1XJWB 5GADI 3RR8A 3EZUA 2LEAA 4LBHA 4ZP7A 3HD2A 5KFAA 5KFFA 5A8KA 3FRZA 5EHHA 2NXUA 4CLSA 1X9WA 4MIAA 2HEKA 2EBGA 4ES2A 5HN0A 4RW8B 4CT9A 1YHQS 4MT1A 3K89A 2OO4A 3ILLA 4HACA 4KR0B 4NMXA 3T3FA 4PAAA 4WJBA 2XSJA 2IM2A 4FS1A 2VV5A 2HWHA 2IJRA 5J2PB 1KFDA 3RU0A 4JOUA 3C6UA 3NY0A 4TQRA 3M4XA 4WZQA 4UW2A 1EKSA 1YIJS 3PX0A 2OLWA 2C1EB 4B3OA 2CPYA 2HWIA 4TU9A 4PWDA 1CPZA 3TUIC 1WSVA 5E3PA 4USKA 4CO5A 1KD1T 2RH3A 3J81j 2GJIA 4HHUA 4KKOA 2C3YA 2MKCA 2W7PA 4OI3A 3PVXA 3T1HJ 1HI8A 3UWTA 3HX9A 3AD7C 3W7BA 2AJFE 2C2EA 4FVMA 1F60B 2OPQB 1JMTA 2GMJA 3D3CJ 1T8EA 4XDCA 2L9DA 3Q23A 3KLIA 3IR6B 3ZNJ1 5IWAJ 2PI5A 2HGNA 4NYZA 4U9RA 1ZM4A 4JI3J 3M2RB 3P8BB 4X84A 4ED2A 1NB7A 3VWSA 3KG1A 2KT5A 2ZH3A 3Q8YA 3GILA 4USIA 2KFYA 1MROA 3I0RA 4WCEQ 1LOUA 5DETA 5M2UA 2BACA 4X2BA 1HHTP 1M90T 5F8LA 4O0IA 4YY3J 1T3NA 3C2PA 3NOCA 4C97A 1RGVA 4YN3B 1Y11A 1VLOA 2J6SA 1SL0A 4C8KA 1BHNA 5EX3A 4W98A 1U1PA 2RDJA 1TL7A 2EWHA 1LW2B 3H59A 3GMGA 2ALZA 4URQU 3PKMA 1KOHA 3G82A 1CJUB 1VBYA 4DL0C 3J80Y 1Z4UA 4FF4A 3HD1A 4GKKF 3CCUS 4QZVB 1M5PC 4P7VA 1N0UA 5FD1A 3EZ5A 1KN6A 3THTA 2J6TA 1WOSA 3M2UB 3CC4S 2KB2A 2VQEF 1R31A 2JC0A 3OW2R 1I51B 3C14B 1X5OA 4RNMA 2QL7B 1JLAA 4TKTA 1NK6A 1MN7A 3UDCA 2BM0A 2DHSA 2FJBB 3GIIA 2C22A 1RT7B 2V8GA 2KH9A 3CMQA 1X5PA 3DLLQ 2GJFA 2JFDA 4N77A 2OH2A 2H1YA 5HMZA 2O67A 2XMKA 2APOA 1LEOA 3M8ZA 4G1QB 4RW6B 1TKDA 4EO8A 2CKWA 3GFHA 3O1LA 1N33J 4DS5A 2IM0A 1DY3A 1VJQA 2ZZTA 4AL6A 1X9MA 3MOJB 1YVFA 3OFFA 2Y1LB 2Y8YA 1N5QA 1NJYA 2UUWA 2FB0A 5IXUA 1F3VA 1DTQB 1K44A 1VHIA 3MAAB 4DWIA 4RW9A 4LF4F 3HP6A 1SC6A 1NK8A 2XCPA 2XMJA 1GNKA 4FXDA 1F1BB 5KFJA 4DUZF 4DSFA 1HWJA 1EX8A 2GGPB 3CJTA 2DXFA 3LF0A 1FK9A 4ED1A 3F44A 5LT5A 2X3DA 3AHPA 4IQMA 4DL7A 1VHFA 5L1IA 3H98A 2KHCA 1FX2A 4WFXA 2W2NP 5J1EB 2VPXB 3LP2B 2KJWA 1J5EJ 3AJDA 2ERRA 2AZ1A 2RT3A 1S6PB 1DFDA 2LVWA 1TK5A 1OPIA 3SQOP 3J81Y 3N01A 3PW0A 1TKZA 1GAOA 3R97A 2EFVA 3PYEA 2KXFA 3MEEA 4JV1A 1JLQA 1D8YA 1YJ9S 2YQ3A 3A12A 1BLUA 1GT8A 4OZ3A 5KOXA 3M32B 3NCQA 3MMBA 1P9QC 2RRAA 5ADZA 2ZHOA 2DCUB 1J2VA 4DPOA 1UPMB 1XNQJ 3DOLB 1RTHB 4JI6F 3PV8A 2CVIA 4I68A 1N4LA 1Y10A 2MGZA 2HLTA 1RAHB 2R8IA 2DRAA 2O01C 2AJ2A 1KNZA 3WBZA 2CNNB 4CYUA 3MM9A 2UVRA 3T19A 3BKTA 1O6XA 3KLHB 1H98A 1A7GE 5HMWA 1T9TA 4QIFA 2J0QD 3AD8C 3CNQP 3F41A 4MKVA 1I6JA 2B9XA 2H48B 4O3RA 2XNRA 1PJ6A 3IG1A 3BJYA 1S97A 1U0HB 4J9NA 1LQ9A 4B3MJ 2C2MB 3OR1A 3DGVA 1SJQA 1EETA 4WF9Q 1S9GB 2EI5A 4KIAA 4JI4F 3ZTPA 3OQ2A 3QPIA 4NLRA 2JRSA 3K7RA 3WC2A 4K59A 4A8FA 1NEEA 2LDIA 4G65A 2QYCA 2FZGB 4NASA 5GAEI 3MMJA 4USJC 3GU0A 4DV3J 2CJYB 2V34A 4X62J 1WKLA 8ATCB 3UFCX 4RNNA 2VBWA 4LF8J 2PEBA 5D4OA 3E8OA 5DJBA 2IJNA 3DRYA 3GZ7A 3MF5A 3K0JA 2QIFA 1RWVB 2R8KA 1TV6A 2G2YA 3NNCA 3N6MA 5CYMA 4WFBQ 4P72A 4ECTA 1ROFA 2M8HA 3OUYA 2DR6A 3V6HA 1ZA2B 2VQFJ 1NHUA 3MCMA 5KT6A 4WP3A 2ACMA 1VRTB 3AXKA 1T9XA 1RU2A 2E5JA 3OHBA 1HNXJ 3BYPA 2OI2A 2DGSA 1HBUA 5HMXA 1F6TA 1UVMA 3FBEA 5KFHA 1TK0A 1N88A 1IKXB 2OPSA 5I3PA 4DR1F 2GQQA 4ANDA 1WACA 4CTAB 3BZQA 3T9ZA 2WOMA 2CPEA 4Q45A 3KK1A 2VA3A 1UJ5A 2H5IB 1M0SA 4DSLA 1VGYA 3OR2B 3GIKA 3BQ1A 4GC6A 1Q95G 2RKIB 4F02A 4HVZA 4HTJA 3MURP 2W9CB 4NL5A 2FVRA 3MMCA 3BF4A 2Q43A 3OLAA 4LSLB 4JV2A 2YX4A 3W60A 4UQGA 3M8YA 3BO2A 2YH1A 1YBUA 4NZ6A 3C15B 3HSJA 3VCDA 2MY7A 4HH0A 3J81U 4C3MA 4QR0A 2BZ2A 2F4VJ 3DI6A 2LLZA 2ZKTA 1KEKA 1JLFA 2ZBIA 4OZ5A 3NKYA 3VTIA 3EE3A 1NH8A 3CCMS 3L7UA 5C25A 4KHPF 1SKUB 1WC0A 3MWBA 1RHJB 4TQSA 1JLEB 2B7BB 4NZ0A 1X31C 2YQ0A 3ISNC 4CCHA 1TMMA 2WK4A 1P8GA 1N34F 4EU0A 2XZDB 4YQWA 2FD2A 2MY8A 3HVRA 3CCZA 3DCAA 1R89A 2FHMA 1O0PA 4NRUA 4CO3A 1DTTB 3R5GA 2AKWB 1LWFB 2QLBB 3D68A 1YDLA 5CAAA 5K8PA 1RI7A 4GVBB 1F2HA 4A4JA 4JI0F 4ZP8A 1VK8A 3ILJA 1S5ZA 1TL3A 1JLCB 1TU0B 2GV1A 4NXMF 4CH1A 3L09A 3M2VA 4MKBA 2RUSA 1N6QB 5KFMA 3TAPA 4AL5A 1OS5A 2QSWA 4ZIVA 1YI2S 4UQTA 2N7YA 2BRKA 3V5RA 4X65J 4OQJA 4OJ1A 3RAXA 1RT5A 5J2QA 2H5EA 2EC0A 1RK8A 3D28A 5I4MA 2CJ9A 2WW8A 4I67A 1M5HA 2LQJA 1IM6A 5HQ8A 2ZH1A 1REVB 2Q3PA 1V5IB 3UR3C 3W63A 3I0RB 4YB1P 3W2VA 2ZC3A 1S0NA 3MAQA 3HVTB 3GIJA 3BGFA 4O4GB 2DNHA 2FIUA 4KV8A 3UI3A 5KTQA 1FDDA 1V3RA 2MQOA 4JBCA 1BGXT 1F9EB 3TP2A 2AW0A 1YRXA 2VDHA 2CWXA 3R5JB 2F9JA 4EYHB 3D66A 3TANA 2QMUB 4CLTA 1JK9B 5AXMA 3QMQA 4F7VA 3O5TB 2VUGA 4U6PA 4OHYA 2N3LA 1HNZF 1HBMA 2B4UA 4CLPA 3T1HF 1ITPA 3VALA 1NJZA 1KQGB 3NBPB 5E3RA 5A2QY 5KFQA 2OGUA 2V8HA 4USWA 1KQKA 1S1UB 3R5CA 4UY8T 4DQIA 2MKSA 4IDKA 2WONB 1N5VA 5IWAF 3L7OA 4X64F 2JEGA 5JUMA 3ILOA 4JI3F 3V4IB 2Q6CA 4EGLA 1BMQB 1TKTA 3H40A 4KO0A 2IBKA 2C2ZB 2OTLS 3VQSA 2E5GA 4NCGB 1AB8A 4KC5A 3ENQA 4PXBA 1CG2A 2I1RA 3J7AN 4LMZA 4LF9J 1P1LA 5F8GA 1IXKA 4LVNP 1IKYA 1D1UA 4DCJB 3SBMA 4EO6A 4J9KA 4N47A 1WEYA 2H65B 3IS9A 1S9EA 3RAQA 4HLBA 2ZVSA 3BKFA 3QO9B 4ZVRB 2B8QA 2GO8A 4F2RA 3I4HX 2CAJA 3I6PA 4USMA 1YGYA 2YBVA 1RTJA 2F63A 4R5PB 2DRBA 3P3DA 3MFHA 4C11B 4LF5F 1F5CA 3GSDA 4M5GA 1XMOJ 4NLYA 3HSZA 2B9EA 4ILRA 5EUHA 4RWWA 4IFYB 1SC1B 1FESA 2AGPA 4BDPA 3BEGB 1LWCB 4B08A 5J2NA 2V69A 4LIWA 1NNDA 4OV1A 3CJ4A 5JMNA 2JNJA 1F3FA 5KFGA 1AZSA 1VJWA 5HROB 4M5LA 1HLWA 1VS3A 2AD9A 4B3RJ 4ID8A 2X1AA 2P6SA 4MK9A 2X1GA 1BQXA 2R8GA 4M1KA 5HJYA 1RAIB 4UY85 4EMDA 4JI8J 4X4VA 3KHGA 2QX0A 4U7UD 2VH7A 5KFEA 2IDEA 2Z56B 4ELTA 5E5NA 4NXNJ 4ZVTB 1CLFA 1JXEA 1CC7A 3QRPA 2R7SA 1NMEB 3MECA 1NDPA 4NLOA 3FBCA 5HBMA 2CQDA 1N33F 3TJ9A 3C3LA 4JI5J 4DQRA 1HBNA 4KYZA 1WG5A 1K0TA 5LJ3Y 3PR5B 2V9KA 1GFWB 2GQ2A 3W66A 1F9FA 1WC6A 2JLFA 2X1BA 1YBAA 4QWAA 1RLCL 5KG5A 3KLEA 2LMIA 2QN6B 5GAEU 2M3DA 4MK7A 2CWKA 2WVCA 4K4XA 3VGVA 5KFXA 1Z2ZA 4M95A 1TK8A 3MM9B 3I5AA 5HLFA 4YDDB 4ZCKA 3G4SS 1EIYB 4ID5A 3OL8A 2HGMA 1SJ3P 2CPJA 1FJGJ 1Q1KA 5HO4A 1SIWB 4ED5A 2LA4A 2A10A 3V6KA 1GMWD 1EB0A 5CZVA 2FJDB 1YTYA 5K20B 4ZMMA 5F8JA 5T41A 3R2CJ 2V4RA 4YDXA 2CQIA 1PAEX 2AP6A 5C24A 5A2QU 2QFIA 1H6KX 5D6GA 2W2MP 3OHAA 4LRAA 2W7OA 2GVZA 3PR4A 3CJQA 2Y0BB 3BSOA 1NKCA 1X4HA 4O0NA 4HYKA 2RQMA 2BQRA 2DNZA 5KG0A 3K8VA 1SV5B 1QUVA 3ET6A 3TARA 2YPZA 4RKUC 5GMEA 3HKWA 3TW0A 5GMDA 2CZ4A 3CVKA 4N8NA 4WE1B 3GTYX 4U67Q 1C0TA 3QJJA 1AYEA 1VQPS 2ABYA 4ECSA 5ETKA 4K0KJ 4A8MP 2BYCA 1HNIA 3D0IE 3LP1A 4DV2J 3LAMA 1DHMA 2ZE2A 4I69A 3RBDA 2Z2LA 3BH7B 4OV6A 4A46A 4OYMA 3HO1A 1JJ2R 2ROPA 3D67A 5I3UB 2HNYA 4BLGA 3C19A 4WP9A 1KC8T 1XK8A 1IBCB 1U1RA 2Q6BA 4ZVEA 5LL6d 4OYZA 3N79A 4B3MF 4OYAA 3FUYA 5KFNA 2R7TA 3OTOJ 4DLEA 2HFNA 3MTJA 1JXLA 3MM5B 4AFFA 2UXDJ 1WHVA 2XEXA 3HSDA 4YR3A 4ICLB 2H4YB 3EGZA 4XPEA 1V3SA 3TQEA 4DFJA 2P6TA 4J9RA 4CLUA 1RWPB 1NDLA 4PXCA 4DV3F 1NB2A 2CPFA 4WBFA 4F0HA 4KGVB 3R6GB 3H90A 4LF8F 4ZA1A 4DXLA 3DI6B 2E1AA 5D0GA 3RTVA 1LWEB 4ZJQA 2ILZA 1U1MA 3R7NB 4AL7A 5I42A 4PZVA 4ZITA 3OSNA 3D1QA 2ZC4A 2VQFF 1JQGA 1T02A 1HNXF 2JX2A 2HYIB 1QE1B 3MPDA 4TLRA 4JP8A 1FXRA 3CCQS 1WDDA 1RT3B 2GVDA 3L7PA 5HK4A 2HW3A 2XLKA 4OYWA 1KS2A 3K5MA 1I1GA 1RA7A 3EPGA 4UZCA 2XZTB 2HHWA 3H0PA 3OXGA 3PHEA 3KUGA 3CCSS 2U2FA 2BE2A 4KAIA 4DMZA 4X4QA 3PKYA 2C28A 2LYVA 2YWGA 5CHCB 3FSXA 1FX4A 2XHCA 4WIIA 5L1KA 2IM1A 2HMIA 2HIYA 2CJXB 4C98A 2QA4S 4WFAQ 1PC4A 3MEDA 3U1NA 3C66A 2PO4A 5KFOA 1KQFB 3RRKA 1FJ7A 2RU3A 3HHNB 4DS4A 2MZTA 5K14B 2LQ9A 2ZOGA 3JQJA 3W65A 4YR2A 3I96A 2GNKA 3N28A 3DRPA 3I5BA 2OIHA 3HULA 5HQLA 4G1IA 4M5NA 4KV8B 4FBTA 3DLKA 2IC3A 3TAMA 2DY1A 3F73A 1V3ZA 2UUBF 2BJ1A 5JVGQ 4ALZA 3DGPA 1U1OA 1K0VA 5J1NA 2C3OA 3K5LA 4ZVPB 2FZCB 2P9GA 4WFZA 3SZ2A 1QVGR 2IM3A 4C8YA 5CABA 3WQPA 3BV8A 5HAOA 3RB0A 1SKWA 1JNRB 3FMWA 1N32J 1SL1A 5ETLA 1FJCA 2JH3A 1UMJA 5J2MA 3I0SA 3WHIA 9RUBA 4OZ2A 1HFEL 5KFYA 5IT9Y 4X65F 1IJEB 2H3EB 3PJWA 3EYZA 1L5UA 3VF0B 4MIWA 1RE1B 1P6TA 3HMJG 2YKNA 1X4AA 2MB0B 4TN2A 5DGAA 2I6WA 3DYAA 4ZVUB 3MPWA 1D0EA 1DJ0A 3MZIA 1BXNA 2ZH8A 4MK8A 1VRUA 3ISND 3IN5A 4H4OB 5F9NA 4IR9A 2BA9A 2KRRA 3CC2S 2OD4A 4V19J 3HHLA 3AY0A 1WDTA 2DCLA 1H74A 2UVUA 2ZHBA 3U27A 2R42A 2AJ4A 3LOUA 1U1QA 1Q78A 1JLBB 3M6VA 2F5GA 2OMOA 2COLA 5KT4A 4L75A 4B9NA 2W9BA 1TL1A 3AD9C 1CJTB 4ZHRA 4TXSA 1F5AA 3ZZRA 4F3OA 1NSPA 4NA1A 3GR1A 1ZH5A 2DHXA 1M5SA 5CH7B 4H4MA 4HKQA 4R8UA 2I8EA 1U09A 1MWZA 3ZTOA 5AE1A 3R5AA 1XR7A 3W1YC 3KHLA 2A6MA 1U47A 4PUOA 2QL5B 3SV3A 2CPIA 1IJFB 2ZH4A 3K58A 2I5JA 3EX7B 3G6VA 5G4DA 5E2QA 4B9SA 2YWFA 3FC9A 4C0OC 2KT2A 3KUHA 3B54A 3T1AA 1PCAA 4LF9F 1HD1A 5ETMA 4MIBA 2CQBA 3TRGA 4FXWA 2DHAA 3Q8RB 1KFSA 1R6YA 4F8RA 2DPIA 2X51A 3GV8B 4C0BA 1ZPVA 3G86A 2VFTA 3FNNA 4OYPA 3MM6A 3KLFB 4F3MA 3V4MA 4K4TA 3SI8A 1I5OB 2CIMA 1H72C 4EUVA 5HVHA 4V19X 2C3PA 2F4FA 2DNGA 5ETVA 2YNHB 2DPJA 5JXSA 4X4PA 2EC2A 1XMOF 3KLGB 3K5NA 4O3OA 4C8ZA 5A8WB 3KUEA 1XMBA 4I6WA 7FDRA 4PQUB 1A0OB 2A2DA 4OZ1A 3NGDA 5KFDA 3MDFA 1SQGA 3JTPA 5HLFB 5D4LA 3UR0A 3C16A 3CC7S 3QWPA 1FWPA 2XHWA 5H9EK 4ID5B 3O8WA 2HFVA 4TNOA 4B3RF 4CIOA 5HMYA 2V2VA 2XO6A 1FDAA 1FERA 2LQBA 2L3MA 5IQ6A 4OI2A 1TKXB 2FJVA 2DNLA 2ADCA 5GAGI 2K1RB 3P5TL 1YJWS 2PI4A 5C24B 3A8EA 3JQKA 4XTTA 3KNGA 2F8EX 2YKQA 1XWLA 3ENWA 1G7CB 4USUA 4ECUA 2AYGA 4M5DB 4NA3A 3V81A 5ETTA 1TELA 2JVRA 3GFXA 5IT9U 1CJKB 4ZPAA 4D3HA 4TVAB 4PKDB 2DJWA 1U49A 4NLPA 3B6BA 4ZPBA 4IH6A 1IWAA 1H3DA 1RLDA 1UZDA 4CM0A 4NYOA 2ROGA 2D69A 3DLHA 4BBYA 2CG4A 3UN2A 1ZOTA 1WHYA 1KR4A 1VFJA 3TR5A 2XS5A 2J8AA 5AXKA 3RBZA 4YP3A 1RCOB 1FJGF 4ECRA 5E3QA 3M30A 4B9TA 1WD6A 3SDEA 4G1PA 3TZZA 4RW7A 3CTRA 1PGZA 3UVJB 3L95X 5L39A 3QIPA 4X4OA 3CMES 4DG1A 4AYBD 3M9NB 4P75A 2M9KA 1Q81T 3Q0AA 1SQEA 3BQ0A 3M1VA 4IG0A 3CJKA 1UKUA 3G6ES 1FDBA 2KXNB 4DQPA 3PX4A 1BQMA 1YWXA 2Y9HA 5DRKA 2VFSA 1KLMB 4PEOA 3JAMY 2BJDA 3QSIA 4L3KA 1BQNB 3AB2B 4J9UE 3BR9A 4I2PA 2E29A 2JHEA 1CS4A 2E7WA 1S1WA 4E98A 5IT4A 3GIMA 2BANB 4HI2A 3E2EA 4C6AA 4PYDA 4ERDA 3LW5C 3M9MB 2N82B 1SC4B 4H4KA 1YQHA 3SEOA 2RDDA 3NWRA 1U0SA 3AA8A 2H5JB 3BN4A 3ONQA 2E5IA 2IVYA 4K0KF 1B99A 5I42B 4KFBB 4DV2F 7FD1A 4HTIA 3CPWR 3KJFB 2V8PA 3EVOA 3M6XA 1SCJB 1P27B 3ITHA 4PRFA 1BY9A 3P49B 1R8PA 2BJEA 4NLTA 1S72S 1TZ0A 2CPZA 3I32A 3SIPB 2XMUA 1TMJA 4OJ3A 5KFBA 2DITA 3FBFA 3FDSA 1Q7YT 4ZCLA 1HBOB 2C42A 4ZPWR 1KLNA 4IFVB 4Y65A 4DFPA 1U2RA 3PFEA 2YKMA 5CXTA 4TY8B 2ADBA 2C3MA 2ZNZA 1M5KC 1WF1A 1IN0A 3IWNC 4LQ9A 4LFAF 3B8HA 2PE8A 1WC3A 2YKAA 1W26A 3W9HA 2CQ2A 2HBYB 3OLBA 3BGRA 5L46A 2HS3A 3HVAA 1M1GA 1U1KA 5A8RB 2MHEA 1LV5A 1RDRA 1AA1B 1HWLA 4BWMA 2E1PA 1Y00A 1XNRF 2ZUGA 1VI7A 1CEZA 2DTJA 4DQQA 2EXUA 4DL5A 5DG8A 2GIRA 4URGA 1KHWA 5SZTA 2RRNA 4QWEA 3QZ8A 2MZJA 3TUZC 4DV7J 1WORA 3MEGB 2ZJPQ 3DGPB 5KG3A 2V2QA 2ILYA 3I5CA 4IRKA 3TYTA 3DDNA 1G4CA 3TQ1A 2PFFB 3QRRA 2LFVA 2DGTA 3CDAA 3W5ZA 1WKJA 1MW7A 3VVUA 3NNAA 4ES3A 1IQTA 2YNIA 3Q8UA 2W25A 5M2RA 3QLHA 3R27A 1QAJA 1PKUA 1U8WA 2ZWPA 4C8NA 4ZLLA 3DLEB 2DGOA 1RXOB 5J1PA 1RAOA 2MZ1A 2M52A 4NI2B 1R8AA 3E3XA 2UUAJ 1T3OA 3ZZPA 2F7VA 3PEHA 2DGQA 4FXVA 4FVCA 3R2DJ 3P45B 2BKPA 4NX9A 1T05B 2Z8QA 5IT0A 5D0RA 3EJMA 4UOFA 5HJXA 4L3NA 3U7JA 2DY9A 1QTMA 1RB0A 3ZZ0A 3JSYA 2BJ8A 4PG7A 4FYXB 3DYAB 3IRXA 3KK3B 3DRSB 4A48A 3JAMU 1WI6A 1LW0A 3MCSA 1U8SA 3OVSA 4Y2IA 4PXEA 1T03B 2VKRA 3GWCA 4OHVA 4U8VA 4WKYA 2DXDA 4ECWA 3MM8A 1IUJA 2C3UA 2DVIA 4B9MA 3DLBA 1VQSA 2YTCA 1OIAA 2ZZMA 2FVSA 2ZM6F 3A3OB 3DLGB 5IC4B 1HPZB 2MQMA 1H0HB 1RUSA 4K8RA 4F0KA 5T7LA 1QY7A 2W9BB 1N32F 2XB2D 1MMNA 3ADAC 1HQ2A 1U4BA 4Q0BB 2RAQA 4DV1J 1RHMB 1R3NA 2HNDB 4CP5A 3UE2A 4IH5A 4P2SA 1S7HA 2FPHX 3SFUA 5F8MA 2VJVA 1FRXA 2XY5A 4WU2A 4YFUA 1S1VA 2J9DE 1T11A 4DEZA 1RT4A 2GW8A 4PUOB 2BVZA 2W2OP 4DR3F 3PRBA 5KG6A 3M8QB 1LXJA 5HI7A 4CLKA 2B6AA 1RAFB 2ZEJA 4O3SA 1FNMA 1KRPA 1S99A 2HHHF 2NQPA 2ATLA 1Q8LA 2XMMA 2UUCF 1YRUA 2RRBA 1F2GA 1WOPA 2Y8WA 2Y3YA 5A6WA 1TVRA 4C9DA 4A8YA 5KT7A 3D1HA 4XPCA 1U45A 2EK1A 5LOQA 4DSIA 3KFWX 2DB1A 4QQBA 4I6AA 2MHNA 2VJUA 3KDNA 5G0RB 2EEYA 2NZ4A 3IC1A 2AZ3A 1EJ7L 3GE9A 2BM1A 3X3UA 5EN1A 1WOOA 2H51B 5IM0B 3Q8QB 1N5YA 4DU8A 3CJ5A 1HIYA 2UUTA 1VMBA 5C7PA 2E5LJ 1H2TZ 1YSJA 2FGCA 3P4UB 4JI6J 1H2UX 5D0HA 2R4FA 3TA1A 4I2QA 1AROP 1RKIA 5AXLA 1KVIA 2KVIA 4CWBA 3CF5Q 4DV4F 2LA6A 1VQKS 2QGFB 2A0FB 4Z7CA 2J76E 1S1TA 3H4BA 2W2QP 4Q44A 1RJJA 4M5MA 1PILA 2C2OB 2YX1A 2W1BA 2MZSA 4P7TA 4L72B 4UUXA 1MU2B 2JEFA 4I1TA 3NGSA 3IRWP 3EDRB 1RBOB 2VBZA 6FDRA 3N5FA 2HFZA 1U25A 4ZVGA 2RQCA 4QR2A 2Z30B 4LR8A 3K59A 1AW0A 2ASJA 2V4JB 3IGVA 4A8WA 1RT1A 5L38A 2ASYA 3ICLA 1S6QB 2RF2A 3KJVB 3NG8A 3MM7A 1B0PA 1JIHA 1VQ6S 2RNEA 8RUCA 4JB8B 4JI4J 2BE7D 1CULA 1UEUA 1RWNB 1U48A 4F67A 3D1OA 4CO1A 2J9DA 2IBOA 2E66A 3SQGB 2HZAA 5DQHA 2Z2ZA 1S12A 4MH8A 1HQEA 1MMLA 2V9WA 2OJ3A 1VYAA 2ROEA 2J0WA 3TZYA 2WB1D 3BGLA 3PYDA 1ICEB 4CLZA 2HQCA 5ETNA 1GK8A 3I87A 1SUQA 5HL7Q 3QGHA 3SCJE 1S9FA 4QWDA 5KFZA 4NLGA 4FN5A 1S1XB 1F5BA 4X4UA 2XMAA 1RWWB 4YB6A 3AFGA 2Z4PA 4X4TA 3LQVA 4DR1J 1CJVA 4XIUA 2HKEA 1DQ8A 2I0XA 3PG9A 2E5HA 4BC7A 4PG6A 1C1CA 2QA1A 5A0YA 2ZD1A 1RWOB 2AYMA 4DUTA 1VBKA 5KFVA 4CRJA 5EGYA 3NCPA 1V5VA 4DDFA 4WTOB 3D54A 2XNQA 4URSA 3KJNB 1UVKA 2A6OA 4B02A 3KTQA 3CIZA 2E1RA 1LK5A 1WJ9A 1PBAA 4WTYA 3CDUA 1REGX 1VOMA 4A8OA 4LSNA 3JYTB 3IAS9 3Q2TC 1G6BA 2WBRA 4QW8A 4X4NA 3DXSX 4KHPJ 1IBKJ 4USTA 2UP1A 1YITS 2R7VA 2KXHA 3W8GA 5LMNF 3POTB 2BXJA 2NZCA 2VG5A 4MFBA 1HYSA 1SB6A 2VG6A 3BSAA 4P73A 4ETXA 2EFQA 1Z2LA 4KE5A 2B8PA 3AXMA 1S4FA 4PPDA 2BOAA 2G0IA 4ZVHA 1KHVA 1RHQB 4KHMA 3BBCA 4FNIA 5AJ3J 5CYQA 3BQ2A 4PYAA 4ECVA 4Y2KA 4RBTA 3N5BA 3QAUA 2B51A 3GJRB 4FPRA 1HARA 3THPA 1CSJA 1FD2A 3CD7A 2KFZA 4RO0A 4DF4A 3CJ0A 2EPIA 3Q8SB 3UN5A 3RJMB 1FKOA 4HL9A 3FSYA 3D3BJ 3I9V9 4F50A 2AQ4A 3GV7B 3EGWB 2DYAA 2J0XA 2B7CB 3DMJB 1VC0A 2CQ3A 2OP5A 3GCWP 3UDVA 2JL9A 2CVEA 4M63A 1FRKA 1C1BA 3FRYA 2LU2A 4ZPTR 4OX9J 1FD8A 1OYDA 3CD0A 2MKHA 5BR8F 1FF2A 2EW9A 3FEZA 2LQ5A 2YNIB 1RT2B 4ECZA 1OWXA 1RT6A 3JS9A 1ZS6A 2Y1RI 4OI4A 3F0NA 5IC6B 3SMZA 5L9NA 1GEHA 1E6YB 1WG1A 1PIEA 2KG0A 4HHHA 1IKWB 2XCAA 1M1KT 1HNZJ 5L8RC 1O5JA 1NM2A 4M5HA 4ED6A 1SVDA 3O3LA 1U1NA 4ZS6A 4QPXA 3G8TA 1RTDB 2YXLA 1GQEA 1Q8BA 4X64J 2ACYA 4CT8A 1LW0B 4RUAA 3VZHA 4JI7J 4N41A 3A3NB 4IYQA 2W4CA 3CO0P 4DR7J 3UDLA 1VQYA 1MNEA 4DV7F 1PBUA 4J9PA 3VAKA 3SCIE 3CGIA 5IZHA 3TEGA 5DM7Q 1Q8KA 3GCXP 4W4MA 4DCOB 1IR2A 1PC5A 1IKVA 3NOGA 2BQUA 3PFOA 4OHWA 1R0AA 2XZWA 1UAWA 2IDLA 3OV7A 3K5PA 2GFFA 1KONA 1W7WA 1R27B 1VIXA 4FYWB 3MUVP 3MUMP 3GFYA 1ZA1B 3HT3A 3KHRA 1DQ9A 5L9XA 4KSEB 1DLOA 3D7SB 4C0HA 1HNVB 1JJ4A 2U1AA 1X8DA 2DIVA 3AA9A 1P9YA 1RBAA 3KMQA 2UUAF 2FY1A 4Y34A 3BKUA 5DG9A 2M88A 1K1QA 2FY8A 4LF5J 3ZZYA 4H4KC 3ZTQA 2CDRB 2EFOA 2MPUA 2B5JA 2CZ9A 3PACA 1EZZB 2HNZB 4EFAC 3KK2A 3ILIA 5KT2A 3ZTSA 5K8OA 2GO9A 4IUFA 3DRRB 2G2ZA 1Y0HA 1QDUB 3MTKA 1TAQA 1YLXA 3OTDA 1WHXA 4IG3B 1J5OB 3SXLA 4HT5A 2BDPA 1RHRB 1IBLJ 2F1FA 2O1PA 2M70A 1SH3A 5LXYA 4WXWA 2AIRB 3RB4A 3K2YA 1CBKA 1YX2A 4OMFG 3PYGA 3QSYB 3DU6A 1T9VA 3CD6S 4RW4A 3WIUA 4ZVFA 3H20A 4RR5A 2V94A 2XY7A 2JFKA 3BGUA 1FHTA 4DV1F 1H7WA 2HFUA 1NUEA 4JI1J 4DL2A 5B7WA 4IOCQ 4ZN3A 2HRTA 4B3SF 1JKHB 2OSQA 2XYGB 2PN6A 2PA8D 1YJVA 4DPTA 1RA6A 3L4BC 2VG7A 5IFMA 1NJWA 2ZH6A 2IHR1 3WDOA 2LDYA 1JLGA 1DZ5A 2FJXA 1GMWA 5LSRA 1O8BA 2HFSA 5KFPA 3GONA 2NUUG 2B0GA 2YNGA 4ECXA 3DOKB 2W4DA 3M8PB 3W5YA 2QLFB 2WSCC 3TEHB 4UOHA 4I0WA 3G96A 1FXDA 1QSSA 4MMOA 3DHWC 3FFIA 3MMAB 2Z0GA 2HZVA 2OHDA 2HZCA 1FVSA 1RT1B 3PRVA 4RZRA 1C0UA 5LSOA 3Q83A 3AQPA 3QNWB 2NSBA 2IPOB 3C46A 4I4BA 1VQ8S 2NREA 3GR0A 1VLYA 2G9OA 4QBUA 3HFZB 3FCWA 1XC9A 3QT6A 3MM7B 3M9OB 2HBQB 4MYUA 4C8MA 2DNNA 2E5LF 2QMWA 4FYDA 4DN0A 2VA2A 3IWLA 4P2FA 4QU6A 1HQUB 3ZZZA 2DGXA 1Q5VA 2JSXA 3PY8A 2GA7A 3CCVS 3Q89A 2VONA 2GMHA 1FFSB 1C4AA 3A4TA 2J9CA 4RW8A 4QIWD 3W61A 4CDIA 2ZH5A 5BXIA 2E1CA 2G4BA 4NLVA 2YVSA 4ZPDA 3RYLA 4FKYA 3OFHA 1RADB 5J2PA 4DR5J 4F4AA 2ZJRQ 3KLVA 4I7FB 4KH0B 1JNZB 4LSZB 1VQMS 3ENVA 4ZLPA 4KT0C 4IRCA 2B43A 1D9DA 3UCGA 2KZMA 1WWHA 5KAKA 3B78A 4QWCA 4AQYJ 4B3TJ 1NK4A 5E7OB 3R5DA 3HT0A 3C6TB 4DJBA 4KGZB 1R0BG 4CLFA 2AEJA 1RP5A 2A3JA 3GG0A 2DNRA 4P10A 4A8SA 2G1DA 1FFWB 3R8YA 4OI6A 4F3QA 2OPPB 4RL1A 4DUYJ 1GXLA 4DZ6A 4OYIA 2L9WA 2OPQA 2AEFA 2MLZA 4F4WA 3C8YA 3LH2S 3LPYA 3KG4A 3M2RA 4J9OA 2VU5A 4PABA 2XI3A 4ZLNA 2GAHC 5EWGA 2YQ1A 4RBUA 2HQGA 3MR7A 1ELOA 1R0CB 4FDFA 3HSGA 3QATA 3HJVA 4KBIA 2NXEA 2DGWA 3PXGa 2W24A 4ZJOA 5B0CA 3V2UC 3D0GE 3PW5A 1E6VB 3NEKA 5F8HA 2KHDA 1TTHB 2ZH9A 5MLCV 1PG5B 4TU7A 2WBMA 3TNVA 2IMOA 2PSZA 3G71S 1RSCA 2R7XA 1JB0C 2NYHA 4QYZK 1ZAXA 5DZ7A 1FEEA 5B0GA 4EWTA 5ETQA 3KWMA 1LW2A 2VF3A 4FYVB 1EARA 2KG1A 3S8SA 2K3IA 2VDIA 3GJQB 1CJUA 5FDLB 2R2RA 2HWTA 3D6HB 2AV5A 5M2PA 2Y0SD 4WPAA 3CW2C 2EKYA 3R3TA 3ZXWA 3T6JA 2L9NA 3M2UA 2QLXA 4ES1A 3OD2A 2PA3A 3EXYA 5A8KB 2JZ5A 5EWFA 4L74A 2RB7A 3H42A 4NLSA 3C14A 3H4DA 1FWLA 3QJLA 3DC2A 1KKHA 5KG2A 4K4ZA 4HACB 2HQFA 4N76A 2XSJB 3CJ2A 4UZBA 5D4NA 1IBKF 4FS2A 3U1LA 1AT1B 5GMKa 1RT7A 1UTAA 1RWXB 3OVAA 3LAKA 3NRBA 5U47A 4QYZJ 1Q53A 1C1BB 3MI7X 1FXLA 1MWQA 3C6UB 1YBTA 2R2UA 5HSPA 1DARA 1HR0J 3MR3A 2D3OR 3EVWA 2UUBJ 3KXDA 2CJQA 1Z1ZA 4B3OB 4KTQA 4PWDB 2YKOA 4HEA9 4G1QA 4RW6A 5AT1B 3UN3A 3CDEA 2CNKB 3GQCA 3TZXA 3EWGA 2VFRA 2UXCJ 1UL3A 4Y3CA 1HA1A 4CLWA 4ECYA 4TYBA 5CYJA 1EQ0A 4KKOB 2H4WB 5AJ3F 2HPUA 3I55S 1XEZA 2JEJA 2QE5A 2QA2A 1NKEA 3BO3A 2HVIA 1F0XA 1DTQA 4A8KA 1B0VA 3MAAA 4ZP6A 2EBEA 1HI0P 3KLIB 1I94F 4Z37A 3LGNA 2CPXA 4ECQA 1JXVA 2AF6A 1PO6A 4Y2AA 2QLJB 2ASDA 4CNYA 1UVLA 5B0FA 3AOAA 3ZNUA 3VAHA 4EZ9A 3PTWA 1MROB 2HAIA 2XBPA 5J1EA 4ELUA 3QT5A 3LP2A 1RHUB 2R7RA 3ZTRA 1Q82T 1S6PA 2AJ0A 2HHSA 4CM2A 1Q86T 4OX9F 4ER8A 2OKQA 1SXLA 1APSA 3RB3A 1GH8A 3FK4A 2P2CB 3M32A 3LUYA 1TL7B 2BKNA 6FD1A 3DU5A 1NHVA 1UCNA 2UVVA 3G82B 3S6EA 1U26A 1Q16B 3DOLA 1RTHA 3EM1A 4QPTA 3B4DA 1CQNA 3OPKA 1GX5A 4YS2A 3MGJA 3KJQB 3MD3A 5E33A 1FRLA 4CH0S 2YWWA 2DXEA 2RQKA 2B5JB 3OJSA 2OFHX 4W92B 1XTZA 4P6QA 2VFUA 2G0CA 3VAIA 4JI7F 2R8JA 2L08A 4DR7F 2GZOA 1JLAB 1KTVA 3KLHA 3I82A 1F9HA 4OZLA 4X4SA 3I56S 2QYGA 3NAIA 4U96A 2K7KA 4A8XA 2NXNA 4OHZA 5E3CA 3GYGA 2HSEB 1FT8A 4J7CA 1X0FA 3GJSB 3R7BB 2HRUA 3GV5B 1UFWA 1RYSA 2CRLA 2RSQA 1X4EA 1VQ5S 3HK2A 2F65A 2IRYA 2DNMA 2X7IA 1YZ6A 2RUGA 1S9GA 4OYXA 1RKJA 3Q86A 3OFGA 1YJ7A 4IR1A 3J7Z5 2DGUA 3M05A 2PC6A 3TX0A 3VZIA 3TJAA 1FTCA 3BSNA 2X3GA 2HRYA 4JI2F 1Q8IA 1X4GA 3R1LA 2DGVA 4RW9B 3CCRS 5C5JA 4FPIA 4ILLA 1KTQA 2ALYB 2E7VA 5DM6Q 2BJ3A 3HLUA 3ELHA 4DPWA 2RE1A 1FK9B 3IXQA 4CQ1A 2XWXA 3R6LB 1VRTA 4DZDA 4ZDNA 2XTJP 1IBLF 3H7HB 1DBDA 3NMAA 2ZOMA 1IKXA 2FHJD 4FF2A 3H5UA 1TKZB 4CTAA 1C0UB 4J90A 3MEEB 4Q2LA 1Q5YA 1JLQB 1NO8A 2RKIA 3GG1A 4U7CA 2NXJA 4UTGA 3FCHA 3D0HE 3MMBB 1BD6A 4JI1F 2W9CA 1OYEA 3M8SA 4Q7AA 4RNOA 5EDWA 2CQ1A 3VV2B 5JVHQ 2E7XA 4LSLA 1UJ4A 1ZAWA 3IMQJ 4EBDA 3C15A 2HHPA 4O23A 1WTBA 4YR0A 2MGZB 4QIVA 2YWHA 4NA2A 4ED3A 1NPRA 4CYUB 5DDRC 1S6OA 4OX8A 1LXNA 2EG2A 2BJ7A 1SJFA 3K17A 4LR7A 1NZ8A 5K5MA 5F8IA 3FEXB 3GPAA 4K4WA 3LALA 1JLEA 2XQCA 1WC1A 1U2FA 5SUHA 5LM7E 1PJ7A 2OFGX 2GJ2A 1NCLA 1CVJA 5LMUF 2UU9F 1WF0A 4F4XA 4DR4J 3IG1B 3J7A1 1FDNA 1URNA 5HATA 1DTTA 4UUWA 1LWFA 4LVOP 2QA4G 2WVFA 5GAHI 4Y28C 4GVBA 3GFZA 1HMVA 3OR1B 2N4CA 4RNFA 2K3KA 4F26A 2WVBA 3LGHA 1EETB 1JLCA 3QGIA 3K57A 3D6MB 4LT6A 1N54B 5DDPC 4WFYA 1N6QA 1HD0A 5F9LA 4AXJA 2FVCA 2EVZA 4DU7A 3D5MA 4R0JA 3SSQA 3VAMA 1B3TA 3UPFA 1RWKB 1SH0A 3Q2SC 3FQLA 1REVA 1TV6B 5CYMB 1YRTA 1GMVA 1C2PA 2QRRA 3OUYB 5L1JA 2PT0A 1T95A 3HVTA 2NS1B 4J9LA 1AFJA 4O4GA 3IO1A 4DR5F 1UWBA 1HBUB 5IOLA 2ZH2A 2QV6A 2E9TA 4ZVSB 2OPSB 4IOBA 4GRSA 4M5JA 4DQSA 2DNKA 2WOMB 3KK1B 4AQYF 4B3TF 4LF7J 1XMQF 2XC9A 3N6NA 2KT3A 1FKAF 4N56A 5ETOA 1RZMA 2ATCB 2IA0A 2L41A 2BW2A 3G2XA 1FNOA 4U7UK 5D8HB 3MMCB 1IR0A 3NBPA 4DUYF 3G6YA 4CLYA 2EFPA 3LPEA 4LFAJ 1S1UA 3DKDA 4NPOA 1SH2A 4M5KA 2ZBPA 3QYYA 1N8RT 2WONA 4HI1A 4ENOA 1BUXA 4G3IA 5F3ZA 3V4IA 1X5TA 4BCAA 1GX6A 1TUGB 1LFWA 1UEVA 3SYZA 2E9ZA 1GTEA 2WW4A 1JLFB 4X66J 2DBBA 3DRXA 3OJUA 1BE4A 4NCGA 2NR0A 3H5YA 3JXOA 5C25B 5DO2A 2Z2YB 4USHA 3DDIA 2IMWP 5KG1A 1ZBTA 4Q2MA 3QFHA 1XNRJ 1UW4A 1VQOS 1HW9A 2M2BA 2J9EA 3PW7A 4K4SA 1ZZFA 1HW8A 1VQNS 3ZZUA 2ZJQQ 5HQMA 2DNQA 2GHWA 4LQ3A 4ED4A 1RAAB 3FJ2A 2GQCA 1H38A 3QO9A 1ZPWX 1TL3B 1L3VA 2VC1A 2O66A 3KMSA 5AE2A 3W2WA 1NDCA 4K5SA 2HVHA 4UOCA 2ZVIA 2MLYA 1TFYA 1LWXA 3JTOA 4U8YA 4R5PA 3M2VB 4C11A 1S0OA 3UO0A 2UXBF 3PX6A 3BSCA 4IFYA 2KFNA 1NXIA 1LWCA 3EVMA 2HFOA 3HZEA 3EUNA 3U1MA 2RD5C 3RG6A 2AYEA 4NWBA 1RT5B 5J2QB 2PMZD 1I3OB 3S1TA 5HROA 4RPFA 4HHJA 1RISA 1X5SA 1R8BA 1X0PA 3RBEA 1VBXA 3HHKA 3NGUA 4NLUA 1D9FA 3G8SA 3W2VB 2P9EA 2HAFA 4LBIA 3T5KA 1G2EA 2OELA 4RUBA 5DZ6A 3VAFA 4E0DA 4MKAA 4U95A 5KFUA 2XS7A 3MEKA 3KYLA 4O4RA 3THVA 3GJTB 2FUG9 1HR0F 3FBBA 3HKZD 4ANEA 4DI6A 2LQ8A 3RW6A 1Q0NA 2R7UA 2LCWA 3D4JA 2D3ZA 1RQ0A 2UXCF 5ETSA 2ZM6J 4CZCA 2BOPA 2OPRA 1HBMB 2MEWA 1SQFA 1B4SA 3WZ0A 1OQ6A 2N7CA 2LXIA 4MYTA 2DR8A 2VBXA 2WB4A 1AFIA 3MPYA 4IDKB 1S57A 2GX8A 5IV4A 1HWUA 3HHDA 2B4PA 2XSFA 1UETA 2JEIA 4DX6A 2XLJA 4HH1A 4LRDA 4RU2A 1TKTB 3T6BA 4KO0B 4DR3J 4DV5J 2HIQA 3W9JA 3OT9A 1ZM3A 4J9MA 4ELVA 2MQLA 3H2LA 3CO9A 4WYLA 3HZGA 5H1SV 3HDSA 2XM3A 2HHHJ 4JYAJ 3J80U 2UUCJ 3MR6A 3D9BA 7AT1B 1FA0A 4WKRA 5BJRA 4C3KA 5DDQC 2I2YA 1OQ3A 1IKYB 4ED7A 1U2CA 2CDQA 1HL6A 4NRTA 4F0MA 2HGLA 1XBWA 3H2UB 3B82A 3IS9B 1VC5A 1QLNA 1S9EB 4OHXA 3SCKE 2HHVA 2YNFA 2ZDOA 3QJPA 3CDBA 1NU4A 1PYTA 2M7SA 3L9ZA 2VIHA 1WNEA 4BHQA 1SV5A 2PMWA 1T7PA 1RTJB 2HHUA 3FGVA 2AX0A 4WU3A 5HVGA 5GADU 3WX4A 6AT1B 2D3O1 3G87A 4WE1A 4KHRA 5IQQA 2D74B 3CUNA 2VHGA 1HHQA 3BDEA 5J2NB 3HF5A 3KHHA 3AODA 2P9CA 4ZOSA 4CI0B 3VGUA 2WVDA 4ETZA 1NSAA 3AB4B 1FFGB 1M5VC 4LFBJ 1Y5IB 2HVZA 1WUUA 1AZSB 1B7YB 2FLOA 3PEJA 1NK9A 3MR2A 2K06A 4DV4J 2D3UA 4L76A 1OMSA 2AGQA 4ANCA 4Y00A 5I3UA 2DEIA 3NS6A 1VK3A 3R7SB 1KOOA 4EK2A 4M94A 2RVJA 3TZWA 2E9RX 4WFNQ 5FIIA 4GVLA 1SKSA 1N36J 4QIGA 3J7YI 3KG0A 1TL5A 3MECB 5GAHU 5HBMB 4P71A 4H54A 1VBZA 1BWEA 3FQKA 3MM5A 3T1YJ 2KKHA 3PJXA 1HBNB 3DOMA 3MPVA 4ICLA 3NWGA 1S76D 5FLXY 3HHEA 2JC1A 3BPDA 4P2XA 4C48A 3FCVA 4J9SA 3BO4A 3PDNA 1UEKA 3MCOA 3RAMA 3KLEB 2R8HA 4IH7A 4YEAA 4I56A 4DL4A 2J7WA 1FEHA 5KOWA 2YY3A 4X4RA 2HK2A 4DPUA 1LWEA 2IYGA 4UT4A 2WSFC 3TI0A 3PJ9A 3NGTA 4Y2CA 1FRMA 4B9VA 3CMAS 4K4VA 4NEYA 5LJ5Y 2IJFA 1SKRA 1S0MA 1NKBA 1QE1A 3D6TB 4ITSA 1G3OA 1OO0B 4OJHA 2OEKA 3BN7A 1NPPA 1RT3A 4LRBA 4K4YA 2CADA 3AJ2A 2BX6A 3IWXA 2GVZB 2ZWOA 1B64A 1RWMB 4J9QA 4XK8C 1HMVB 1HNWF 1SJ1A 1H7XA 3M8WA 3TX8A 3EGNA 3IM9A 2W9AA 1EP4A 1RHKB 2K2PA 1FRIA 4DPXA 1Y5NB 1W2IA 3IBWA 2HHQA 3ET6B 1OY9A 2HQIA 2DKOB 4OIXA 5H9EJ 2P5VA 4AT1B 4Q8FA 2BE9B 4ZCMA 4HDGA 1C0TB 2VPWB 1WC5A 2ZKUA 2MZRA 3BH6B 5K14A 3G8QA 1T0TV 1X9SA 3UDEA 3ENAA 3KDOA 3FKBA 2DR9A 1YG0A 1HNIB 2ZBCA 3LP1B 5IS2A 3WX8A 2DHGA 4RJVA 2ZE2B 3TUJC 5DS7A 4ZK7M 2QL9B 2VL1A 1UWBB 4QYRA 4AD6A 1SBRA 3PNIA 2FC9A 2HNYB 3M6WA 4TLQA 2MQQA 1L3TA 4DR4F 3R9LA 4UOGA 2D7SA 2MJNA 4OX6A 2GMLA 1XIQA 3PHTA 4EI2A 1S48A 3PYFA 5LMNJ 4OLOA 3HFVA 5IV3A 4M8LA 2I38A 2R3VA 1Q7LB 4ZP9A 3TJ8A 4IKAA 3HJFA 2Y1IA 2GAGC 3NCRA 4ILMA 3LP0A 1VQ9S 3TA2A 5ETPA 4YMEA 3VR1A 3VVTA 3MHYA 3CCJS 1EKRA 2GHVC 3OXLA 5C2GA 3FEYB 3V6JA 1KWMA 3TWZA 4YB7A 3E51A 1XQIA 1VC6A 2WRMA 3O44A 1YJRA 4DFMA 1UFKA 2MTLA 3UNYA 4WK3A 2VODA 2M0GB 1N0VC 2QFJA 3G6XA 2XMTA 5FLXU 4YY3F 5CCMA 1AUDA 3EGVA 3HPOA 3RRHA 2GVDB 3TO8A 4K7QA 4N7TA 4H4OA 2PMHA 1D9AA 1PSDA 2CQHA 4LF7F 1T9YA 2FHOB 2RHSB 1JWWA 2BE2B 2WHOA 2Q1LA 4C8LA 2CNOB 1UWAA 1JLBA 2LP4A 2QO3A 1S59A 3W2WB 5BR8J 3Q8VA 1WTFA 2B56A 3CCES 1CJTA 2KM8B 3EPIA 3Q8PB 4BWJA 2JJ4D 2HMIB 2EFGA 3KOAA 1ZETA 3MEDB 3K8WA 1YKWA 4PPZA 5C2CA 3A13A 5BYQA 3UD3P 5B0AA 4DN9A 3S01A 5F41A 1QM9A 4K5RA 4O3NA 4X66F 2BABA 3VAJA 2V4QA 2CQCA 4DOZA 3DRPB 4V1Ak 4FF1A 3BGOP 1HWKA 4NYPA 5JJBA 4NCAA 2FDNA 4FF3A 4EYIB 2LEPA 1Y3KA 3DLKB 2IC3B 4LF6J 3TAMB 1OPZA 3W64A 4YB5A 4WXOA 1U1LA 1YJUA 1S0VA 2MQNA 2HHXA 2R7QA 5KFLA 3HVWA 4WP8A 4R25A 4BS2A 3TVZA 1D3WA 3KLFA 5RUBA 1N5TA 4PWUA 4ZJLA 1TAUA 1DQAA 2OPRB 4DSKA 3GYNA 4IO9Q 2V68A 5CZXA 4E2FB 4DLGA 1UZHA 2CJKA 4WK1A 3W8PA 2YNHA 5DGBA 3DHXA 3QWUA 3KLGA 2IFXA 3MPUB 5A8WA 1X4FA 1AUSL 2ZITA 4GO5X 4NLXA 2MXYA 4PQUA 5J2MB 3I0SB 2XS2A 2CJAA 2ZOFA 2G13A 3V6DA 3M8RA 3PW4A 3BR8A 4C8OA 3N4WA 4AUKA 1XN9A 4Y0FA 2YKNB 2NSCA 3IBFB 1D09B 1GXTA 1QD1A 5K9FA 1R8HA 1VQLS 1TQLA 1MWYA 1J5EF 2D41A 3JSMA 2DISA 1TKXA 2B9WA 5CD4H 1MMDA 2NXCA 3M7VA 2K1RA 4MAKA 3RGIA 4DF8A 3LO3A 3UD4P 2MQ8A 2XWYA 4K50A 2F8HA 4LFCJ 5HP1A 1VRUB 2IAJA 1OJ4A 4N8OA 1QTNB 4M5DA 3J7YU 2XMVA 4F25A 1YJNS 3HHLB 3UCZP 4PXDA 1CJKA 4K4UA 2YNFB 4J91A 1ZZNA 1NK0A 2BRLA 1FI4A 4LREA 1QAYA 1XNQF 1TL1B 2M8DB 2C2RA 2HBZB 4J5OA 4ZHRB 2V8DA 1NLKL 2J0SD 1ZAVA 2LKZA 3GP9A 4TU8A 1FCAA 4JV5J 2XG8A 2DH9A 4H4MB 4DV6J 4LRFA 3LGMA 4R8UB 2EG1A 2ZBRA 4KGMA 4Z2XA 3NL0A 4B3SJ 2KU7A 1M1HA 1Y3JA 2CZVC 2JOQA 3VAGA 2ZUAA 4DV5F 2CQGA 2V2ZA 1SL2A 2I5JB 4OYOA 1IR1A 3BDPA 4FZVA 3SFGA 3UVJA 1ACMB 1JJHA 4O44A 2XO7A 3RRGA 3BM7A 2LU1A 4JYAF 2MKJA 2LECA 1HKAA 2HS0A 1X4CA 2A1BA 3CT9A 3H8YA 4NEZA 2OAUA 3ETMA 2MMYA 5T14A 2OEMA 3OTEA 4ATNA 4KPYA 4DX8H 1D8ZA 1KLMA 2UV8A 5KFRA 1OY6A 4L73A 3MM6B 2DH8A 2AYBA 3DOMB 5HVFA 2ZBQA 1UVNA 1KBRA 1BQNA 2BEFA 1S49A 1S79A 2VB6A 4B9UA 3NS5A 4KGKA 5AXNA 1R43A 2KM8C 2C2DA 4QCLA 1WEXA 2K8GA 4X62F 1NJXA 2BANA 1NJIT 5K8NA 4DSEA 2R2TA 4KGXB 2XY6A 2Z58B 2BUNA 3C16B 4LFBF 3RB6A 1N56A 4Z7YA 1N5SA 2VPYB 4KFBA 1NAQA 2SXLA 1UVJA 3IA0A 4DFKA 1FE4A 4QOTA 5ETRA 5DDOC 3IR7B 1UA1A 2OMLA 3MUTP 3CXCR 5EWEA 2J8SA 4OFZA 4JV0A 3L3CA 1WI8A 3H2VE 1TFWA 4YHHJ 5DQIA 1B0TA 4DBQA 1N36F 2POKA 4F2SA 4CO4A 1VIOA 4PG5A 3CJ8A 2BW7A 3CSKA 4ED8A 1UVIA 3V81B 4LRCA 1ZYQA 1U02A 1HBOA 2CJBA 4RUCA 3T1YF 1FVQA 4IFVA 1ZM2A 4TY8A 1MLAA 1EP4B 1NK5A 3QRQA 2CG8A 4Y6IA 1WF2A 2V50A 3LWLA 4RU9A 3CCWA 3QIDA 5KFIA 1VQ4S 3U02A 2AJ1A 2MJUA 2ZNYA 3UCUP 2FVQA 3HI9A 5A8RA 4CH7A 5ITHA 2RS8A 3BBFA 2F4VF 1SJRA 2PEHA 3FZBA 1RYRA 3OL7A 2H54B 3ZZOA 1A9NB 2RHQB 5A76A 2MDAA 2NYIA 4E8UA 3PO5A 1LNQA 3PM9A 1MG7A 2K7JA 3M30B 3DXBA 4AE5A 1KDNA 1Q4RA 3SDEB 4RW7B 1IQZA 2RMLA 3W9IA 3IFEA 3VQTA 1UP1A 4ZVQB 2CFXA 2C2KB 3QIPB 4LJMA 1DAXA 3MEGA 2QTWA 3T5HA 3IBCB 1GXUA 4DG1B 3AOCA 3JTNA 4TYAA 4P74A 1ZM9A 3M1VB 4IG0B 3CJKB 1NPKA 2XGQA 5E0OA 3Q22A 3FSIA 1FKPA 1BQMB 3PRDA 2DIUA 4RUHA 1C4CA 3KKFA 1TL4A 3HHLC 1RABB 4OL8A 2I9SA 2PD1A 2XI2A 3GSIA 2WTFA 3LP0B 2MLXA 4I2PB 1CS4B 3D6FB 3R5BA 3OXFA 3O6QA 3DLEA 1S1WB 2CA9A 3MR5A 1L3SA 5KG4A 4NI2A 3TUPA 1RAJA 2VICA 2IA6A 2HK3A 1W2BR 2AT1B 4ED0A 1EAYC 2KL8A 2HHTA 1T05A 3GB0A 1IBMJ 3A1YG 3CJ3A 2XLIA 3UW1A 2BJ9A 1NHKL 2DEJA 1LFPA 1PYOB 3DRSA 3KK3A 2WCXA 2V5HG 4RWXA 1YZ7A 4LBPA 1T9UA 3JSBA 1T03A 1N52B 1SIZA 1UJ6A 3HXMA 3ITHB 3DDKA 4RX6A 5CD4A 4PWWA 1U24A 2JLGA 2FVPA 1RACB 3SCLE 4S0MA 3ZFVA 1K9MT 1GMUA 1IVZA 2F8MA 1WSRA 1EHWA 1QAXA 1KVJA 4DV0J 3DLGA 2FYXA 2HURA 1HPZA 3NLCA 2QEXS 1SI9A 1XR6A 3N6LA 2NCKL 1QVFR 2YKMB 2VFVA 2M5YA 2H9ZA 1P1TA 3E01A 3HCXA 1RCXB 4Q0BA 2HNDA 3H5XA 1K47A 4P52A 5B0BA 3LA0A 5F8NA 3IAM9 1X4DA 2AGOA 1QAIA 3BGRB 4DR6J 2CYYA 3P5BP 4DPYA 3K5OA 4GKJJ 1UPPA 2QJ3A 4EBCA 1K1SA 4CNZA 3M8QA 2MYFA 2WVEA 2VPZB 3A8JA 5C42A 1I94J 3P96A 1T94A 5LXRA 2NUHA 3VGTA 2GCFA 3JB9k 4ZN1A 3ULHA 4OX7A 2YPYA 4Q8EA 1EQMA 4HR2A 4QWBA 3FMBA 3HFKA 1ULRA 1X60A 5FJ4A 3UQSA 4W90B 3FVYA 5G0RA 2GIQA 3EXCX 2VOOA 2AEMA 3PW2A 2R7OA 4F04B 4R0EA 3QLHB 5IM0A 4O3QA 5B09A 4OZ0A 1FRJA 4F4YA 3OFEA 2XYPB 3UNGC 2BBEA 3T41A 3V6DB 2HG4A 1KVKA 4HT7A 3H5SA 4ZVOB 1L3UA 3DM2A 4WYWA 2Z2MA 3US5A 3ISZA 3QQCD 3EZOA 2DO0A 2DT9A 4JI8F 3IRXB 3JSMB 1MN9A 4OZJA 1G1XA 3CEDA 4LF6F 1VR6A 1MU2A 5THWA 4NXNF 3RZAA 3BBBA 4K2XA 3MM8B 3PIOQ 5HP1B 3QGGA 2IAJB 1WHWA 4YOEA 4OLPA 2W8KA 4DL3A 1PJ5A 2MSSA 1V9OA 2VZ9A 2YX7A 1WKKA 1XR5A 1DURA 4CLLA 4JI5F 3OL6A 2V4JA 4PR6A 3BYRA 3MD1A 1KSPA 3RW7A 5F0WA 4L6V3 1S6QA 5T7LB 1OSCA 3KNAA 3KJVA 1O51A 2DRDA 1VCTA 3CCTA 1MSWD 1S1VB 5I3QA 5CA5A 1PYSB 2MZQA 4DX7A 1LKZA 3JQMA 2JVOA 2CPHA 2RILA 2V63A 1RT4B 3T5LA 2F9DA 3A3PB 4JI2J 4B17A 4DR2J 3SQGA 1DRZA 2N4DA 3M6UA 2B6AB 2A18A 3ZO7A 2VASA 2FHJA 2G2OA 4O44B 4IO1A 3ZC4A 2OD6A 2W4PA 2LEBA 4OYBA 2E44A 5D0EA 2KTQA 4LFCF 3B4MA 4C2MA 1FO1A 3OSPA 1TVRB 2A2CA 5CCLA 4MJKA 2CQ4A 3PO4A 5E41A 4RNHA 4XO0A 1QUPA 2GC8A 1S1XA 3NXZA 3W3SA 2RS2A 1VISA 1N48A 4EBEA 5DQGA 1T9WA 4EEYA 1R7IA 2YWEA 1NSKL 1U6ZA 4LIRA 4KJIA 3LWMA 2KN4A 4AXIA 5KFWA 3UD5A 3QFWA 3EDQB 1N5YB 2DK2A 4JV5F 2J5AA 1X4BA 2FZKB 4O3PA 4ZIWA 4G6VB 2IVFB 4DV6F 1UW9A 1X7VA 1WELA 4LF1A 3W62A 2AHOB 1Y9OA 4P9SA 1YJTA 3CD5A 4K2JA 3S7RA 3OVBA 4I2QB 3CDWA 1Q79A 2HQ3A 3LANA 4FKXA 2W2PP 1IM4A 2CNLB 1S1TB 3A8IA 3MCNA 1H73A 3QZ7A 5HANA 4DSJA 3JYTA 1JX4A 3QT8A 5D3GA 4QU7A 4J9VA 2QLWA 1RBLA 2VKZG 4USVA 2BR0A 3OL9A 3BREA 3CWJA 1HWIA 4OJGA 4F36A 1TR0A 4MKYA 3POTA 2YWKA 3OTOF 4Q5VA 1RAGB 4DX5A 2R9LA 2KRBA 5LMUJ 2UU9J 2UXDF 4F4KA 1W25A 1RTIA 1H2VZ 2B9YA 1AXQA 3BS9A 1Y7PA 2RF2B 3TOQA 2CQPA 2B4VA 2RIJA 4ZPVR 1SJ4P 1RAEB 2D1CA 2CPDA 1FE0A 1CULB 2N3OA 2GS8A 1WG4A 3NP5A 2BQ3A 5D15A 2KZZA 2NPFA 1TUWA 2R7WA 1J27A 2OTJS 5H9FK 1URRA 4LUBA 1CQMA 2KDOA 4FYYB 2DR7A 1HQEB 3QGPA 4F4ZA 3T5JA 2GHPA 2XYHB 2MKYA 1UA0A 3Q24A 2ZFHA 2DNYA 4YHHF 3BB5A 4CO0A 1HI1A 3DMJA 3AQOA 1RTZA 1SUQB 3GIRA 5KG7A 2UZAA 1FKPB 1HHSA 1ZTTA 5L1LA 3G9CA 1KQSR 2DO4A 2V6AA 5KFKA 5EX0A 2VD3A 3CB4A 1CJVB 1B7FA 1RT2A 2LXFA 2QMXA 3RR7A 2IY5B 5B08A 3RUBL 1SPBP 3NAHA 4PG8A 4DCPB 4HDHA 2FLPA 3CE8A 1XMQJ 4ZKAA 1C1CB 2XULA 1E6YA 5A0YB 2ZD1B 3NMRA 2HS4A 5H9FJ 2QC3A 2KO1A 4FBUA 3DNCA 5DLGA 1IKWA 1VDHA 2FLNA 2WZ1A 1TUVA 4GO7X 1RWUA 2GIFA 3H25A 3NNHA 3DFEA 4P2MA 2AU0A 4GKKJ 5F3TA 4PCQA 2DR5A 2BKOA 2FJAB 1RTDA 4QW9A 2FGOA 2D9OA 2HBRB 3TVYA 2VQEJ 2C2NA 2YKPA 5KFSA 1FJEB 1NDKA 1FRHA 3DLJA 1K8AT 3TVKA 4QR1A 2D9PA 2WAQD 2HVEA 5LSLA 4OI0A 4LSNB 4NZ7A 5D4PA 4A47A 2JLEA 3VHQA 3N0VA 1S77D 2FTRA 3CJSA 3PZPA 2W7AA 2FQQB 2RDIA 2Y1JA 2QG9B 2HVDA 3VGSA 2VG5B 4MFBB 3IM8A 1HYSB 3SV4A 2VG6B 5B0EA 2PIIA 3JSRA 1PAUB 2FJWA 1RU1A 2VOPA 3E01B 4Y2MA 1U7LA 2FC8A 2UVWA 3HM9A 3PIPQ 1HNVA 2Q66A 1SC3B 2PFDA 1V6HA 1S6UA 3CULA 5CYQB 3CCLS 2G0JA 3MOZA 3CJRA 2G1HA 2XMWA 5CQGA 2AJQA 1KP6A 1IBMF 2UXBJ 1QJHA 4B9LA 4XAKA 4LF4J 3P6YC 2HNZA 5C42B 1VQ7S 2EKNA 3OTCA 4RLEA 4DUZJ 2J7UA 3DRRA 1CC8A 1Y4ZB 1FKOB 2BMBA 5GAGU 2J7KA 1JJCB 1OY8A 2RJZA 3A8KA 2PDAA 4IG3A 4LR9A 1J5OA 2O3DA 4J37A 1Y5LB 1WEZA 2IYIA 2KYXA 2MQPA 3O2IA 4DV0F 3OBIA 3MXHP 4QIEA 3LTOA 4NE9C 4JUZA 3AOBA 3AJ1A 4D3GA 1RT6B 3IGNA 1NK7A 4KRWA 4KB7A 3GYXB 2L48A 3HHLD 1NSQA 3IR5B 2W8LA 4DHVA 1UFLA 4KY3A 3SSRA 2OSRA 2QT7A 2DH7A 1TP7A 2QSFA 4DR6F 1JKHA 2FLLA 2MKKA 4ZLJA 1IWGA 5GVQA 2FHKA 4GKJF 4GC7A 4C3LA 2VC0A 3DM2B 3WIVA 4I64A 2F3JA 1U6BA 9ATCB 3DOKA 2V0NA 4XDDA 3M8PA 2GGPA 5BYRA 2HQDA 3ZZTA 2KVQE 1XERA 3R1HA 3AAWB 3NS7B 1BC6A 3GLJA 3NGKA 4I6YA 5KT3A 1A6LA 5MAOA 1IKVB 3MAHA 3MMAA 4IRDA 2B4OA 1R0AB 4WZMA 3F56A 2KJVA 3FZ2A 3J7ZT 2M4MA 1FTRA 1S4EA 3IP0A 2NLWA 2W01A 2VBYA 5F0UA 2NPIA 2V67A 1B70B 1DLOB 4KPCA 2Q79A 4N5SA 3RBXA 4QJVA 2EK6A 3N9UC 2FJEB 1QSYA 2JWNA 2R2SA 2ZH7A 4FP9A 2RU9A 1HQUA 3OTBA 3D2WA 1ZTWA 4NLDA 3AH6A 2HLUA 2AWZA 2DHHA 3EICA 1S7IA 1M5OC 2Z57B 1R8CA 2CUYA 2DNPA 3KK2B 4PQAA 4OZNA 4NLWA 4TY9A 4ZCIA 2MKIA 1U6FA 5D77A 3QAEA 2IRUA 4A8QA 2X1FA 2PGCA 4YUDA 2DNOA 1S10A 2IIHA 2ZHAA 1BWVA 3TA0A 5KT5A 4CO2A 5AE3A 4UF4A 4NCBA 1NBEB 2CQ0A 4DL6A 3WC0A 3PCOB 4OI1A 4WWSA 4I7FA 2XGPA 4FNHA 5B0DA
chains in the Genus database with same CATH topology
2HZCA 1FVSA 2C3OA 3K5LA 2AX1A 4LF7F 1L3KA 2P9GA 1RT1B 4WFZA 3SZ2A 1QVGR 2FHOB 3MFIA 4GMKA 2IM3A 4C8YA 4RZRA 1JWWA 1C0UA 5LSOA 2BE2B 2WHOA 2Q1LA 3AQPA 4C8LA 2NSBA 3C46A 4I4BA 4RW4B 1VQ8S 1NH7A 2ASLA 2WSEC 1JLBA 2QO3A 3W2WB 2NREA 3GR0A 1VLYA 1WTFA 3C6TA 2G9OA 4QBUA 3RB0A 1LK7A 2B56A 1XC9A 1SKWA 1JNRB 3FMWA 5BYSA 3CCES 2RQ4A 3MM7B 2KM8B 3M9OB 3EPIA 1SL1A 3Q8PB 4BWJA 2EFNA 4MYUA 2JJ4D 4C8MA 4Q43A 4C7QA 2DNNA 2JDJA 2O5DA 2HMIB 5D78A 2E5LF 1FJCA 2OPPA 2QMWA 4FYDA 2JH3A 2EFGA 5E3AA 3KOAA 1UMJA 4DN0A 5J2MA 1ZETA 3MEDB 3I0SA 3DN9A 3IWLA 3K8WA 2VA2A 5DLFA 4QU6A 4PPZA 1HQUB 3ZZZA 2DGXA 1HFEL 4MTPA 2JSXA 2VG7B 5DG7A 5KFYA 5IT9Y 3PY8A 4X65F 2UV8G 1IJEB 5BYQA 3PJWA 3UD3P 5B0AA 4DN9A 3EYZA 4DR2F 1L5UA 2GA7A 3S01A 3CCVS 1JLGB 3VF0B 4MIWA 2VONA 5F41A 2LXUA 1QM9A 4K5RA 2GMHA 2KYZA 4O3NA 4C4WA 1C4AA 1P6TA 3HMJG 4X66F 3SSSA 1FNXH 2BABA 2YKNA 1X4AA 3VAJA 3I4PA 2ZZNA 2J9CA 3ETOA 2V4QA 2MB0B 1GTHA 2CQCA 4TN2A 4RW8A 4DOZA 4QIWD 3DRPB 5DGAA 2J6UA 2YNGB 4FF1A 4BC9A 3DYAA 1HWKA 4NYPA 5JJBA 4NCAA 1OSDA 2ZH5A 5KFCA 5D3GB 2E1CA 4IQXA 2DD8S 2FDNA 4FF3A 2G4BA 3MPWA 4NLVA 4EYIB 2LEPA 1Y3KA 3DLKB 2IC3B 5K8MA 3TAMB 1D0EA 1OPZA 2YVSA 2MSTA 1DJ0A 2YH0A 4WXOA 4YB5A 1YJUA 4ZPDA 3RYLA 1U1LA 3I9ZA 1S0VA 2KI2A 3MZIA 2E1MC 3OFHA 5J2PA 2MQNA 1E6VA 2ZH8A 2QZ8A 4MK8A 2HHXA 3TAQA 1VRUA 2ZJRQ 4IOAQ 3KLVA 3ISND 3IN5A 4H4OB 2R7QA 3FFIB 1K73T 2B3TB 4I7FB 5KFLA 5F9NA 2V8VA 3HVWA 4IR9A 2BA9A 1JNZB 1VQMS 2KRRA 3CC2S 3ENVA 2OD4A 4V19J 3HHLA 3AY0A 2DCLA 4NOHA 4R25A 1RTIB 4ZLPA 4KT0C 4IRCA 2B43A 1D9DA 3UCGA 2IVMA 4PG4A 1NRKA 2UVUA 2ZDPA 4RBVA 2ZHBA 4BS2A 3U27A 3TVZA 1D3WA 1WWHA 3B78A 4ZPCA 5KAKA 3KLFA 2KZMA 2AJ4A 4QWCA 4NMLA 3LOUA 3X1LB 1N5TA 1QSLA 1NZAA 4PWUA 3OR2A 1NK4A 5E7OB 1U1QA 3R5DA 1Q78A 1TAUA 1JLBB 3M6VA 1DQAA 2OPRB 4KQZA 4DSKA 2OMOA 3GYNA 2COLA 4IO9Q 4EZ6A 3C6TB 4DJBA 5CZXA 3T9NA 5KT4A 5A6PA 4B9NA 4DLGA 2W9BA 1TL1A 3CIMA 2CJKA 1RP5A 4WK1A 2A3JA 4ZHRA 3GG0A 4TXSA 2YNHA 5DGBA 1F5AA 2DNRA 3ZZRA 2IRXA 3DHXA 3I31A 4A8SA 4F3OA 2G1DA 2F40A 3QWUA 3KLGA 5KFTA 4NA1A 3GR1A 2V2KA 5FDLA 1ZH5A 2IFXA 4OI6A 4F3QA 2DHXA 2OPPB 5A8WA 1M5SA 1X4FA 4NLQA 2ZITA 4GO5X 4NLXA 2MXYA 2BV3A 5CH7B 4H4MA 4HKQA 4PQUA 5J2MB 4R8UA 3I0SB 1GXLA 2XS2A 2I8EA 5GADI 3RR8A 2L9WA 2OPQA 2CJAA 3EZUA 1U09A 1MWZA 2LEAA 5AE1A 4F4WA 3R5AA 2ZOFA 1XR7A 2G13A 3C8YA 3V6DA 3M8RA 3LH2S 3PW4A 3KHLA 3BR8A 4C8OA 4ZP7A 3LPYA 5KFAA 3KG4A 3N4WA 4AUKA 5KFFA 5A8KA 3M2RA 1U47A 1XN9A 3FRZA 5EHHA 4Y0FA 2NXUA 4J9OA 4PUOA 2YKNB 2XI3A 2NSCA 1X9WA 5EWGA 4MIAA 1GXTA 2EBGA 3SV3A 2CPIA 4ES2A 1IJFB 2ZH4A 4RBUA 5K9FA 4RW8B 5HN0A 4CT9A 2I5JA 3K58A 1R8HA 1YHQS 1VQLS 3EX7B 3G6VA 5G4DA 1TQLA 1MWYA 1J5EF 1ELOA 2OO4A 5E2QA 2D41A 3JSMA 2DISA 4B9SA 1TKXA 4KBIA 2B9WA 2YWFA 4KR0B 5CD4H 3T3FA 1MMDA 4C0OC 4WJBA 2KT2A 2DGWA 2XSJA 2K1RA 4MAKA 3T1AA 2IM2A 3PXGa 4FS1A 4DF8A 2VV5A 3LO3A 3UD4P 4LF9F 2HWHA 2XWYA 1HD1A 2W24A 4MIBA 2CQBA 3TRGA 4K50A 5J2PB 1KFDA 2F8HA 3V2UC 3D0GE 5B0CA 3PW5A 3RU0A 1E6VB 5HP1A 4FXWA 2DHAA 3Q8RB 1VRUB 1KFSA 2IAJA 1R6YA 4F8RA 2DPIA 4JOUA 3C6UA 5F8HA 2X51A 4TQRA 4N8OA 3M4XA 4WZQA 4UW2A 4M5DA 2KHDA 3J7YU 3GV8B 2ZH9A 2XMVA 4F25A 5MLCV 3PX0A 4C0BA 1YIJS 1YJNS 1ZPVA 3HHLB 4TU7A 3UCZP 2OLWA 2WBMA 4PXDA 3G86A 2VFTA 3FNNA 3TNVA 2IMOA 2CPYA 4B3OA 2PSZA 2HWIA 3G71S 4TU9A 4PWDA 4K4UA 1CPZA 2YNFB 3TUIC 3MM6A 2R7XA 3KLFB 1JB0C 4F3MA 1ZZNA 1NK0A 2BRLA 3V4MA 4K4TA 3SI8A 1ZAXA 5E3PA 2CIMA 4EUVA 4CO5A 1KD1T 4V19X 1FEEA 5B0GA 4EWTA 2C3PA 1QAYA 2RH3A 1XNQF 1TL1B 3KWMA 2M8DB 2DNGA 2GJIA 2C2RA 4KKOA 4J5OA 4ZHRB 1LW2A 2V8DA 2YNHB 2J0SD 2KG1A 2DPJA 5JXSA 1ZAVA 2LKZA 4X4PA 2C3YA 3S8SA 4TU8A 1XMOF 2MKCA 2K3IA 3KLGB 2W7PA 4OI3A 5FDLB 1FCAA 3K5NA 4O3OA 3PVXA 2XG8A 1HI8A 3UWTA 2R2RA 4C8ZA 5A8WB 3HX9A 2HWTA 1XMBA 2DH9A 3W7BA 2AV5A 2AJFE 4I6WA 7FDRA 2C2EA 4H4MB 4PQUB 3LGMA 4R8UB 5M2PA 4FVMA 2EG1A 1F60B 2A2DA 2Y0SD 4OZ1A 3NGDA 2OPQB 2EKYA 5KFDA 3MDFA 4KGMA 1JMTA 2GMJA 3R3TA 4Z2XA 2KU7A 1T8EA 3NL0A 3JTPA 3T6JA 5HLFB 1Y3JA 4XDCA 2CZVC 2L9DA 2L9NA 5D4LA 3M2UA 2QLXA 3UR0A 4ES1A 3Q23A 3CC7S 2JOQA 3KLIA 3QWPA 3IR6B 3VAGA 2XHWA 2PI5A 2HGNA 4ID5B 2PA3A 3EXYA 4NYZA 4U9RA 1ZM4A 2JZ5A 3O8WA 3M2RB 5A8KB 5EWFA 2RB7A 4TNOA 4X84A 4NLSA 4B3RF 3H4DA 4CIOA 4DV5F 4ED2A 5HMYA 1NB7A 1FDAA 3VWSA 3QJLA 3DC2A 2CQGA 1SL2A 1FERA 2I5JB 5KG2A 3BDPA 2LQBA 3KG1A 2KT5A 2L3MA 4FZVA 5IQ6A 4OI2A 2ZH3A 4K4ZA 3SFGA 3GILA 1TKXB 4USIA 2KFYA 1JJHA 2FJVA 1MROA 2DNLA 4N76A 4O44A 2XO7A 3RRGA 2ADCA 3BM7A 3I0RA 2LU1A 2XSJB 3CJ2A 5D4NA 2K1RB 3P5TL 2MKJA 5GAGI 4FS2A 1YJWS 4WCEQ 3U1LA 2LECA 2PI4A 1LOUA 5GMKa 1RT7A 2HS0A 5DETA 3OVAA 5C24B 3LAKA 3NRBA 3A8EA 5M2UA 5U47A 1X4CA 2A1BA 3CT9A 2BACA 3H8YA 4QYZJ 4X2BA 3KNGA 2F8EX 1Q53A 1C1BB 3MI7X 1HHTP 2OAUA 1M90T 5F8LA 2YKQA 4O0IA 1FXLA 1T3NA 1XWLA 3C6UB 2R2UA 1DARA 3ENWA 1G7CB 3MR3A 2MMYA 4ECUA