4F26A

Crystal structure of the second rrm domain of human pabpc1 a ph 9.0
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
b'GNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyadenylate-binding protein 1
publication title Interdomain Allostery Promotes Assembly of the Poly(A) mRNA Complex with PABP and eIF4G.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f26A00
2CQDA 5LSOA 3V4MA 4UY8T 4ZKAA 2MB0B 2L08A 1D8ZA 1VQ4S 5DDRC 2J8AA 2CQ3A 3BEGB 2MQPA 1VQ8S 3CMES 4TU8A 1H2VZ 2FC9A 2DIUA 3H2VE 1A9NB 1JMTA 1L3KA 2HZCA 2M7SA 3EX7B 2DIVA 2J0QD 2RQ4A 3NS5A 1WF1A 5GVQA 2AYGA 2AYEA 2DNZA 1YHQS 3CCJS 1Q81T 1X4CA 2RVJA 2FY1A 1X4AA 1X5OA 2M8DB 5DDOC 2E5JA 2MZRA 2CQ1A 2L41A 2MZTA 5DDQC 2LEBA 3VF0B 1VQ6S 4A8XA 1XN9A 1U6FA 3PIPQ 3IRWP 3CMAS 2D9PA 2MYFA 4P6QA 2DISA 4V19X 3BO3A 5DETA 4QU6A 1H2UX 2DNGA 4W90B 4ERDA 3UD3P 2RUGA 2KG0A 5IM0B 2B0GA 2AYMA 2E5IA 2RS2A 3CC2S 5LSLA 2DNHA 2KRRA 1F9FA 2DNRA 4PR6A 3CCLS 1RK8A 1SJRA 2MQQA 2LMIA 2U2FA 2O3DA 2LXIA 4TU7A 3LPYA 3RW6A 2D9OA 2DGQA 3G6ES 1U1PA 4U67Q 2LXUA 2X1AA 2J76E 3CCRS 2HGLA 1X5PA 2HGNA 1NO8A 1M5PC 2HGMA 4LMZA 2OSRA 4OZ1A 2DNMA 2EVZA 3SDEA 3UE2A 1N54B 1JJHA 1WEZA 3CCVS 3VAGA 3ZZZA 1WHXA 2MQMA 2OIHA 2GHPA 2M52A 2MMYA 2CQ2A 2DHGA 3G96A 2DNOA 2FC8A 4C0OC 2ZJPQ 2DITA 4RU2A 2JRSA 3CUNA 1QVGR 1M5KC 5GAGU 1DHMA 2DH8A 3MOJB 1VQLS 3G71S 2A3JA 4Y0FA 3S6EA 2G0CA 3MDFA 1WG5A 1X4FA 2EK1A 1VQNS 1WG4A 1UFWA 2MPUA 2KN4A 1O0PA 2DGTA 3CPWR 2KXNB 4IO9Q 2NLWA 1KD1T 1A7GE 5BJRA 2DNPA 1U1MA 2KH9A 2MKSA 1U1KA 5HO4A 1VC0A 2L9WA 3NS6A 2DGWA 2DGVA 2CPJA 3CCMS 3UCUP 2LKZA 1M5VC 3VAJA 3UD4P 1YWXA 2MZSA 4OZ0A 2CQPA 4Y00A 5GMKa 2CQIA 3S8SA 2MKJA 2M4MA 1KQSR 2MQNA 1WHVA 4F25A 4QU7A 2MXYA 1SJ4P 5DM7Q 2KYXA 5IQQA 1K73T 4F02A 2ZJQQ 5JVHQ 2DGSA 2SXLA 5IM0A 5IFMA 2BOPA 4W92B 2OTJS 1X4DA 2FPHX 1M1KT 2VOPA 1S79A 4J5OA 4M5DB 1WEYA 1U1QA 3CCES 3US5A 3THPA 2DNQA 4WCEQ 2NZ4A 3CC4S 3CULA 1SJQA 1X4EA 1DBDA 3UWTA 2QEXS 2VODA 1KOHA 3ULHA 2M70A 2N7CA 4Z2XA 3EGZA 1WG1A 1FNXH 2X1BA 2LA6A 1WI8A 2KI2A 2U1AA 1VC6A 1FJ7A 2OJ3A 2G4BA 2KG1A 2X1FA 2XS7A 5GADU 3FEXB 2LEAA 5H1SV 2MQLA 3B4MA 2MY8A 5LJ3Y 5LJ5Y 1P1TA 2LYVA 2RNEA 4CH0S 3CTRA 1U1OA 3MXHP 2E5HA 3DXBA 1N88A 4FXVA 1YITS 1D9AA 5EN1A 3I55S 1FJCA 2M9KA 2DK2A 3NNAA 2MKCA 3TO8A 3UCGA 3VAMA 2N3LA 3R1HA 1KC8T 5CXTA 2PEHA 2YH1A 4LIRA 3BO4A 2V94A 3UCZP 1ZZFA 2DB1A 2M88A 1FO1A 2DO4A 1VQMS 3MD3A 4YOEA 4QPTA 3D2WA 2JVOA 3MUMP 2MGZB 3I56S 1U1LA 1IQTA 1U2FA 2YH0A 2KVIA 3ZZYA 4CH1A 3HHNB 1VQ5S 2YKAA 4C4WA 2OSQA 1VQ7S 2ERRA 3S7RA 2QA4S 1U6BA 1Q7YT 1OIAA 2F9JA 2N3OA 1B7FA 1R8PA 2CQHA 1HL6A 2CPXA 2CJKA 2DH9A 2RS8A 3J7YU 1H2TZ 2DGOA 2PE8A 1DZ5A 4WFNQ 1M5OC 3N9UC 2KM8B 1NJIT 2M8HA 2MZJA 2RQCA 2CQGA 2XB2D 1UAWA 3OW2R 1Q82T 2K3KA 1RKJA 4IOCQ 1YI2S 3SXLA 4BS2A 2HVZA 1K9MT 3MD1A 2MSSA 3S01A 2CQ4A 2LA4A 3P5TL 1AUDA 2DNKA 2I2YA 1KOOA 2MZQA 3Q2SC 1ZZNA 1URNA 2OTLS 1VQOS 3NNCA 1QVFR 2VOOA 1NU4A 2CPZA 5D78A 2RRAA 3TYTA 3CXCR 2MZ1A 2DH7A 2RT3A 4IOAQ 2MSTA 2CPFA 3MURP 2XNRA 5LXRA 3LQVA 1QM9A 5D77A 4TLQA 3VAKA 3P49B 2CQBA 4WIIA 3CCUS 3MUVP 4WF9Q 3J7ZT 3MI7X 2BZ2A 2EK6A 3NMRA 3R27A 4LJMA 2WBRA 2JVRA 2F3JA 3CD6S 2MQOA 1Q86T 1UW4A 2AD9A 2K8GA 3DLLQ 4EGLA 1WF0A 2CPDA 2RRBA 2CPEA 2UP1A 5GAEU 5MLCV 2Q79A 3PIOQ 2ADCA 5GAHU 1WEXA 2KFYA 3BO2A 5JVGQ 1OWXA 1JJ4A 2I38A 2MHNA 3THTA 2LQ5A 3BS9A 3SMZA 2MGZA 1VBXA 1VC5A 2KRBA 1WHYA 1FT8A 4QQBA 3NNHA 3CCSS 5CYJA 3G4SS 2MKIA 2DHSA 1FXLA 4ED5A 2MKHA 5FJ4A 1X5SA 3MUTP 1U1NA 4IUFA 1CVJA 2KXHA 2AYBA 1X5TA 4YUDA 2E5GA 2YWKA 2MKKA 4TU9A 3EGNA 1OO0B 5CA5A 1SJFA 3RW7A 5ITHA 1YIJS 2CQ0A 1WI6A 5DDPC 4WFBQ 3CF5Q 1UP1A 2MY7A 2DHAA 2KM8C 1FHTA 4CIOA 1X4HA 2KHCA 1N52B 4FXWA 2MJUA 1JJ2R 2FHOB 2J0SD 1HD1A 1K8AT 3G8SA 2KU7A 1WF2A 5HL7Q 2YTCA 1N8RT 2GO9A 2DO0A 3P6YC 3R1LA 2G1DA 3G8TA 2JWNA 4F26A 1YJNS 4UQTA 1R8HA 4WKRA 2LCWA 3H2UB 2DNYA 3FEYB 1SJ3P 1W2BR 1HA1A 1VBZA 2D3OR 2QFJA 5LXYA 2HYIB 3VAHA 1HD0A 2KXFA 2DNNA 1OPIA 2JX2A 4WFAQ 3L3CA 2DGUA 3IWNC 2CPHA 2M2BA 1DRZA 1P27B 1YJ9S 2E44A 2ADBA 1VQ9S 1X4GA 3Q2TC 1H6KX 5DM6Q 1VQKS 2CQCA 3B4DA 1VBYA 1X4BA 2RU3A 1VQPS 2KT5A 2XNQA 3CCQS 2VONA 1YTYA 3TP2A 2CPIA 4CQ1A 3VAFA 1WWHA 1S72S 2CPYA 2ZJRQ 1PO6A 2LECA 4YB1P 3SDEB 2DNLA 2XS5A 3U1LA 1WHWA 2F9DA 4PKDB 3CC7S 4PRFA 1G2EA 2DHXA 1FJEB 3JB9k 3P3DA 3U1MA 3K0JA 1WTBA 3VALA 2M0GB 3VAIA 1PGZA 2X1GA 1SXLA 1WELA 1M90T 2XS2A 1YJWS 2DGXA 1U1RA 1X0FA 3G9CA 4C7QA 1ZH5A 3HI9A 1BY9A 2N82B 2XSFA 2MJNA
chains in the Genus database with same CATH superfamily
4FF2A 4QR0A 2H3EB 2J9CA 4OYIA 2CQ3A 3BEGB 3UFCX 2WCXA 4CLKA 3BZQA 2Y3YA 2FC9A 4RBVA 3EX7B 3M9OB 3FDSA 2YVSA 3W2VB 2GJFA 3NS5A 1S10A 4HL9A 5F3ZA 3CJ3A 2G1HA 2MZRA 5J2NB 5DDQC 5HLFA 3K57A 2E5LF 2H4YB 2O66A 5JUMA 1SVDA 3HVTB 5LSLA 2LDYA 1ZS6A 2YKNB 2U2FA 2BJ9A 4HTIA 3UO0A 3KLHB 1EAYC 4V1Ak 2HZAA 1M5SA 3KHRA 3VTIA 4OZ1A 5B7WA 2UVUA 4U8VA 1QSLA 2V69A 3CJKB 4J7CA 1S1UB 1ZPVA 1FWLA 2HFOA 4PZVA 2X7IA 1H0HB 5DG7A 5IT9U 2A3JA 3ICLA 1TL7A 2CNOB 4FNIA 5IT4A 1VQNS 4LFBF 4LBPA 2MTLA 2XY7A 4X62F 2UVRA 5F0UA 4AL5A 2GV1A 3NS6A 4ZLNA 1S9GA 1Z2LA 2XCPA 4LFCJ 2HK2A 4UUWA 5J1NA 4ZVFA 2GVZA 3FBBA 4DSEA 2B6AB 1NK5A 3IBCB 5G0RA 2OTJS 1M1KT 5FLXY 2ZC4A 2Y8YA 1S79A 5KFLA 4YR2A 2QEXS 1VBKA 1TQLA 3EM1A 2N7CA 1FNXH 2BJ8A 2VV5A 4DX7A 3HT3A 1FJ7A 3KK3B 1W7WA 3M9MB 2WB4A 3W64A 2LU1A 3OUYB 4MIBA 1FRJA 2AX1A 4PEOA 3GWCA 2BEFA 2ZVIA 1U1OA 4RNHA 4XPEA 1UFKA 4B9LA 7AT1B 4TQRA 2A6OA 4X65J 1RT3A 4LIRA 3RB6A 2BR0A 5I4MA 1RXOB 2A0FB 4L75A 4I6WA 4LFAJ 3JSMB 4ZN3A 2HMIA 3FBFA 2YQ3A 1AZSB 3RB3A 2ERRA 1U6BA 3L09A 2IC3B 3RB4A 3QRQA 1ULRA 3NGRA 2VBYA 1RZMA 3IRXA 4N5SA 5AE3A 1SH3A 2MZJA 2CNNB 2RQCA 3AA8A 1YGYA 1FJGJ 1OS5A 1EQMA 4OJ3A 3SXLA 2MSSA 2ACMA 3IG1A 2DNKA 4M5IA 4N47A 1HNVA 2QX0A 3C15B 5D78A 2RRAA 2MZ1A 1ZA1B 1JLEA 3HZEA 5FIIA 4USMA 1U02A 3CCUS 2R3VA 2IYIA 5D0GA 4Z7CA 2HAFA 4LJMA 1RAFB 2QG9B 4J91A 3MWBA 4FYXB 4QIEA 3TA2A 4PXCA 3M4XA 2IMWP 1WEXA 2QYGA 1GX6A 1RT7A 1BUXA 3AA9A 3C16A 3DGVA 4HDHA 3FBCA 2H4WB 3SCKE 2XMWA 3DU5A 2YPZA 4LRCA 1EP4B 2JC0A 1WOSA 1JLCA 2ZH1A 3GV8B 3KJVB 2KM8C 4P10A 1FHTA 2KHCA 2VDIA 2VHGA 5HP1A 2H51B 3D1HA 2VZ9A 5A8KA 4ZVEA 1RBOB 1ZA2B 3X1LB 2KYZA 4ILMA 2QFJA 2Y0BB 2BUNA 4USHA 5SZTA 1OQ3A 3RGIA 1C1CB 2C42A 3EPGA 2H5JB 4KC5A 4UQGA 3D0HE 1YJ9S 1X9MA 1CJTA 1WKLA 3O2IA 4GKJF 2BOAA 4LF5F 1YTYA 1IVZA 3K8VA 4O3OA 2J7UA 2B9WA 4NZ7A 3DDIA 5HVHA 1MU2B 4IR9A 4WFYA 2AV5A 1WC4A 3CCTA 3A3PB 1IBKJ 3BDPA 2AU0A 2XS2A 4RKUC 3E01A 4RNOA 4JI2F 2LQJA 2MJNA 1KBRA 4UY8T 2MB0B 2IPOB 1U0SA 2CVIA 1NKEA 1NZ8A 2DIVA 5GADI 2ZE2A 1WF1A 2BACA 2EFGA 3AB4B 1U8SA 3RBDA 1X4AA 5DDOC 3PRDA 1H73A 2WK4A 4TYAA 3PIPQ 3EYZA 3IRWP 4DUYJ 5DETA 3GSIA 1TL5A 1VK3A 3LO3A 2LEPA 2LVWA 3QWUA 2E5IA 4JYAF 1KFSA 4RW6B 5IC4B 4ZLLA 2IAJA 5K8OA 5F0WA 5KT7A 3FRZA 4PWWA 1OY8A 3DLEB 1HYSB 5K9FA 3J80U 2VFVA 4URSA 3KDOA 4A4JA 3UN5A 2WOMB 1VS3A 4ALZA 1WEZA 2W9CA 3I4PA 4AYBD 1IBMF 2GHPA 1G3OA 4PPZA 1RCXB 4C98A 2Z8QA 4PUOB 1JIHA 4NEZA 2CDRB 2BW2A 3MDFA 4GKKJ 2MPUA 4EFAC 1DTQA 4J9OA 5DLGA 2QLXA 4YB6A 3OTCA 2LKZA 4Q8FA 1FNMA 3O5TB 2OD6A 2ZDPA 4OYOA 3R2DJ 2WW4A 2WSFC 2HWIA 2DRBA 2J7WA 4KO0A 1SCJB 4OX7A 3HVAA 4Q43A 1Z4UA 2Y1JA 5I3UA 2OEMA 4M5DB 4WCEQ 4B08A 3W1YC 3KJFB 1R0BG 3NAIA 4JI3J 2U1AA 3TARA 4ZJOA 3JQKA 1HHTP 5LMNJ 3FEXB 5F8HA 4MMOA 4MK8A 3ILJA 1JXLA 4XPCA 1X60A 1Y11A 3CB4A 3LALA 1ZZFA 3C6UB 4U96A 3W66A 3OR2A 1HQUB 1TK8A 3I56S 1BQNA 2HS3A 1U2FA 4O0IA 1VJWA 2MLYA 3RBXA 2VJUA 3C19A 2R7VA 3GJQB 4F3QA 1HR0F 4EK2A 2DBBA 2IBKA 3RRHA 1UJ4A 3KLFA 4DV3F 1J27A 2C3YA 5HJXA 3O44A 3KOAA 1O5JA 4U7UK 4DL2A 2LA4A 4JB8B 3AOCA 2YX7A 2I2YA 1TP7A 1B0PA 1Y7PA 4EEYA 4U7CA 1JLAB 5JJBA 3EVOA 1QVFR 5T7LB 1NU4A 2BQUA 5L38A 1S0OA 2DD8S 2K7KA 1U8WA 1Q8KA 3T1HF 2Q3PA 1SV5B 3EWGA 4ECVA 1HWJA 4DUTA 4WIIA 2KJWA 5LMUJ 3I9ZA 2R2RA 1EHWA 1P6TA 3MI7X 2BZ2A 4KHRA 5HMYA 2JVRA 5KFRA 5HMXA 5EWGA 4AUKA 1R3NA 1S49A 3W61A 2HVIA 3M2UA 3D5MA 4GVBA 1N5YB 5GAHU 3QBCA 3GIIA 2MGZA 3SMZA 2PI4A 1Q79A 2QC3A 2R4FA 1TKDA 3Q0AA 1S77D 2QRRA 3GFYA 4RUBA 2RKIB 3MUTP 3E51A 3K59A 1Q8IA 4CO0A 1TL3A 4DQSA 4IFYB 1WD6A 1GX5A 1IQZA 2IDLA 2Y1RI 1X4HA 5KFPA 3GU0A 4P71A 2J0SD 3BBBA 1QUVA 2BANB 4N77A 2JWNA 5KG2A 3L9ZA 2ASLA 3OL8A 5L1KA 2ZBQA 2KXFA 2BXJA 4WFAQ 4URGA 3HHDA 3DCAA 3M9NB 1T05B 5CYMA 1JJCB 1KDNA 3KLGB 2CQCA 4AD6A 1OSCA 2FLPA 4CLYA 4NZ6A 1S6PB 2UUBJ 4ZITA 3WX4A 4NLXA 4DV2J 2YNFB 1WHWA 5CYQB 1R27B 3JB9k 2WW8A 3CJTA 1WTBA 1JX4A 1RT4B 2JEJA 1GTHA 3D28A 1REGX 3PO5A 1C0TB 3QZ8A 2WZ1A 1PKUA 4FF1A 1RACB 1C1BA 4YDDB 5AXNA 2VB6A 3EZOA 3FQKA 4RW4A 1F6TA 4NCAA 5C5JA 5DG9A 1TU0B 3KG1A 3H2VE 5I42B 2VFRA 4C97A 1PJ6A 1LXJA 4OHWA 4DFKA 3M6WA 4LRAA 4RU9A 2HWTA 1TZ0A 4C8YA 2D9PA 4LQ9A 3BO3A 2V2VA 2BRLA 5ETLA 5E3AA 4V19J 3OJSA 2PEBA 2QSFA 4FVMA 4OJGA 1SC6A 4LSZB 2JLEA 2GVDA 3GIMA 1RTIB 2FVRA 1RAHB 2AJFE 1S99A 3P45B 1UVJA 4TVAB 2YPYA 4TY8A 1HQEB 1QSYA 1N54B 1FESA 2DXDA 3M2RA 3Q23A 2A1BA 1MN9A 2HQGA 1F5CA 4NCGA 4IYQA 1DHMA 2AZ3A 3MOJB 3PHTA 4QIGA 1GTEA 1RTJB 1NJYA 4OYAA 4Q8EA 3M8QA 1WG5A 1AA1B 1VRUA 3MOZA 1RHJB 2HLUA 2KN4A 2VPYB 4UOGA 2VC1A 4XO0A 4F7VA 4F50A 2HPUA 4XAKA 4YDXA 4B9MA 2UVVA 2ZHBA 3PVXA 3DDNA 3GIRA 2ZKUA 2M4MA 1R0CB 5D0HA 1QJHA 5A2QU 1JKHB 3QGIA 1I94J 1F9EB 1WC6A 2XLIA 2SXLA 1B99A 4ILRA 1SQEA 1CJKA 2J7KA 5KG6A 4YB5A 2X3DA 1TUGB 1NKCA 2Q43A 2W8KA 2BM0A 4NCBA 2FGOA 3M2VA 2KVQE 1TL4A 2UXCJ 2ZH3A 1X31C 3IR7B 1IXKA 2QJ3A 2B9XA 1JLGB 1RI7A 1SIWB 3PYFA 1FDAA 5LJ5Y 5KT3A 2QSWA 3MXHP 4DV7J 3LGNA 2VG7B 1QAYA 1KHVA 3KK2B 2N3LA 5HROA 4KFBB 4Q7AA 1Q8LA 2EC0A 2BQRA 2HQDA 2AMCB 1QDUB 3D2WA 4M1KA 1KTQA 3PX4A 3IWLA 5J1PA 4NI2B 1HPZA 4LRDA 3K5PA 1FX4A 1DAXA 4U95A 2FJBB 2HNDA 2CQHA 4IH7A 4CO2A 2DH9A 2IMOA 5C24B 3ITHA 4KHPJ 3TUJC 4O0NA 3RZAA 3LP2A 1YBUA 3GFXA 4WE1A 1JLBB 1NAQA 1I1GA 2HHWA 4LF1A 5J2MA 3OVAA 1V6HA 4OYWA 2YX4A 3SYZA 5KFJA 4JI1J 5B0DA 1CS4B 1ZTWA 2CPFA 2XNRA 2HFVA 3P49B 4ZVSB 2XZWA 3MEGB 1TMJA 3J7ZT 3ZTSA 1FKAF 3EGWB 3JTNA 4KV8A 3A13A 2QMWA 1FXRA 3KHGA 2K8GA 2PGCA 4NXMF 3PEHA 2CUYA 3MM7B 3ISND 1FFGB 3W9IA 1CJUB 3LWLA 1T9TA 3THTA 4MKVA 1QLNA 1F9HA 4QQBA 2C2MB 1HLWA 4QCLA 1RTHB 2ZH9A 2MDAA 5CYJA 2AZ1A 1T7PA 2E5GA 3MM5A 3JAMU 3F0NA 3MMAA 4DFJA 1QSSA 4DG1A 4PG8A 3F41A 3EDRB 4ED7A 1NJXA 2UXBF 2W4PA 4JBCA 1D3WA 1CC7A 2UV8G 1R31A 3OFEA 1HA1A 4CI0B 1GH8A 3VAHA 4I6YA 1Y00A 2JX2A 3IWNC 4K4SA 3F44A 4C3LA 4P72A 3E3XA 2BA9A 4LSLA 3RJMB 2BMBA 2APOA 4ZLPA 2K2PA 4LR7A 4DSFA 2GO8A 2PO4A 5L9XA 4P73A 5J2QA 1BQMB 5CH7B 1MWQA 3UDEA 1YK9A 1KLNA 2P9GA 1U0HB 1XIQA 2B8QA 3HKWA 1EZZB 1U1RA 1WUUA 1BY9A 4DR2J 2QMUB 1XMBA 5J2NA 1XNQF 5AE2A 3Q8VA 4R25A 1N0VC 2J8AA 1E6VB 2GMJA 5KFTA 3HSGA 1NUEA 3W60A 4DMZA 1FD2A 4IO1A 1HBMA 5HQMA 2OEJA 1JMTA 3Q8RB 1P8GA 4LFCF 4LT6A 2JLFA 4F36A 5E3QA 1XEZA 3PFEA 3DLBA 2VF3A 1X4CA 4N76A 4I2QB 1SBRA 3BH6B 5K8PA 1VQ6S 4CO3A 4FYYB 5ETNA 3BQ1A 3UD3P 2RUGA 1YRTA 1HIYA 3BYRA 2AT1B 3GG0A 3BH7B 4XDDA 2OPPB 1J5OB 4Y2CA 5KT5A 3CJKA 4DU8A 3A3OB 2GS8A 2HURA 5HAOA 4ICLA 1TL1B 4CTAB 4F3OA 2JJ4D 3R5BA 3SQGA 5DQGA 3UE2A 3J7YI 2PMHA 4OHVA 4QYZK 1NM2A 2OIHA 3KNGA 4IRKA 2EBEA 2OMLA 4X65F 3UN2A 4C0OC 2R7TA 2HIYA 3AAWB 2ZJPQ 3NXZA 4ETXA 2HHHJ 1NEEA 1DQ9A 4LFAF 1TR0A 2E7VA 3ELHA 4PQUB 2HHTA 2EK1A 3N4WA 4DQRA 3NY0A 3CPWR 4JI6F 2XULA 4TQSA 5J1EB 2KH9A 2RHQB 2XI2A 1HNZJ 2DGVA 2CPJA 3CCMS 1VOMA 2L3MA 4ZOSA 1FJGF 1WDTA 1PYTA 2J6SA 5D3GA 2WONA 3EZ5A 1UJ6A 1V3RA 3C8YA 4W92B 1X4DA 4K4YA 4DEZA 3DRPA 4QWEA 2VA3A 2F4FA 4DF8A 4QW9A 2NZ4A 2COLA 5K14A 2ZZMA 2GA7A 3DLKA 4GO7X 2VODA 2P8IA 1U2RA 4Z2XA 3M8PA 3B6BA 1Q4RA 3DRRA 2VC0A 5KFKA 1GEHA 3JYTA 5KFOA 3BJYA 4I2PB 4NRUA 2MY8A 4A8FA 3RAQA 3MPUB 1VYAA 4J37A 2GJIA 2M9KA 3NNAA 2XBPA 3LF0A 4N41A 4JV2A 2DO4A 3K5MA 3MAAB 3TVZA 2B4PA 1NMEB 2FHKA 3R3TA 4JV0A 1RYRA 3DRSA 4MFBB 1OIAA 1IN0A 2X51A 4B9UA 2K7JA 3DHWC 1K44A 4HT7A 3SSSA 4K4TA 1FDBA 3M30B 3NCPA 8ATCB 4ZPCA 1NJIT 2Y0SD 3KHHA 1VK8A 4KPYA 4KPCA 3Q2SC 1NSAA 1CJVA 2FVCA 1RT2A 2NUUG 3EICA 5KFWA 1MMNA 3SFUA 4WP9A 2PDAA 4KGZB 1LWFB 3LQVA 5EX3A 1QM9A 2YXLA 1ITPA 1N0UA 4W4MA 4J9QA 3FCHA 1UPMB 1EP4A 1IBKF 3CD6S 2J0XA 3MM6B 3I0SB 1QAIA 1WF0A 1HNXJ 4MKYA 3L4BC 2FJDB 5C42A 4ZHRB 1VC5A 2ZOMA 1MG7A 3WC0A 2MKIA 4J9KA 2HZVA 1FRLA 4C9DA 1DFDA 2W9BA 3BYPA 5ITHA 3LGHA 4LRBA 3TZWA 3DDKA 5BR8J 1FRKA 2FJVA 4DUYF 2YKMA 3D6MB 4DV4J 3SSRA 1TKXB 1YJVA 2OP5A 2VFUA 3N0VA 4B3MF 1CC8A 2KU7A 1KS2A 5B0GA 2QN6B 3RBEA 3P6YC 2MQ8A 2OH2A 4F2SA 3G8TA 5HLFB 3TZXA 3ISZA 3KMQA 1MU2A 1FA0A 1W2BR 3NMAA 1VIXA 2DGUA 1G4CA 2YWEA 2FVSA 4RW8A 2ADBA 1VQ9S 4G65A 2ZWPA 3JTOA 5HK4A 3Q8SB 2LECA 4YB1P 1FDDA 4C8KA 2M0GB 4YB7A 2CJYB 3ZTOA 4GKKF 2VDHA 4DSLA 2ATCB 3HI9A 2UZAA 2XMVA 5KG7A 1R8BA 1GQEA 1LQ9A 3RU0A 2MQPA 4EO8A 2IVYA 4NA2A 5A8WA 4RW7A 5A8RA 4IOBA 1K47A 1S9GB 1KP6A 4PXBA 4YMEA 1NK9A 3PDNA 3HSZA 4GRSA 4HT5A 3I32A 2E1CA 4U9RA 2IDEA 2MYFA 3OXGA 3K17A 3WC2A 2EKYA 1H74A 2GVZB 4EBCA 1DARA 4EBEA 2W7AA 1NK8A 2EPIA 2DNRA 4RNMA 2CZVC 3PV8A 1IR0A 4WP8A 1NDLA 3HHEA 1T03A 4ZJQA 3RAXA 4LMZA 4USKA 4MKBA 1R89A 2CXEA 2V5HG 1M1HA 3BGRA 2QL9B 3BPSP 2BJ7A 2RD5C 3IBFB 5D6GA 5SUHA 4GC7A 1JLFB 2IIHA 3QT7A 4JI7J 5KFVA 2QZ8A 1RT3B 4K7QA 4QYZJ 1X4FA 1UFWA 1SC1B 2WTFA 1B4SA 3W5ZA 3L7UA 4IQXA 3I96A 2XCAA 3LPEA 3FGVA 4I0WA 3NG8A 1F2GA 2CQIA 1JLQB 2RQKA 2VQFF 3FRYA 4OYBA 2HKEA 3LH2S 1RHQB 3IRXB 2ZJQQ 5JVHQ 1SUQA 4EBDA 1RAEB 1LW0A 3FK4A 4OYMA 2N4CA 2PIIA 2VBZA 1CSJA 3D9BA 3IG1B 4XDCA 1HNVB 2LA6A 5LMUF 5M2UA 1AXQA 3LW5C 5GADU 1JLEB 3TVKA 4IG0A 3M05A 2K1RA 3PW4A 2P6SA 1APSA 2OO4A 5EN1A 1PJ7A 2KZMA 4UT4A 1G6BA 4PAAA 1PAUB 1IKWA 1N5VA 2NPFA 3R6GB 1RT7B 3G86A 3C16B 1CQMA 2N3OA 3QSYB 1RE1B 5ETKA 1JK9B 4KKOA 3HFKA 1HL6A 3ZC4A 2VKRA 4CH7A 4CNYA 1JLCB 3HHLC 4O4GA 1WOOA 5MAOA 1LOUA 2NS1B 2F5GA 4IH6A 5HP1B 4B9SA 2MZQA 1AT1B 5A8KB 3GTYX 2ZBIA 1I6JA 2VOOA 2CPZA 4WYLA 4EZ6A 1Y3JA 3GG1A 4PABA 2UUBF 3B8HA 2CZ4A 1CJTB 5HJYA 3UN3A 3H5UA 3MUVP 4FKXA 1OYDA 4I56A 4OI1A 3C46A 3R97A 4RNNA 4W98A 2Q6BA 2PFFB 4IFYA 4B3OA 3MR3A 5JXSA 2LQ5A 1RQ0A 4GMKA 2ALZA 7FD1A 3KG0A 4DQQA 3CEDA 2RJZA 1ZETA 1RGVA 3RG6A 4DPUA 2VG5A 1NK7A 4DSJA 1N32J 4J90A 2GNKA 2V9KA 3CDBA 2HW3A 3MR2A 4BHQA 2QYCA 2DHAA 2ZE2B 4M63A 1NDCA 3J80Y 3OTOJ 2FJEB 4FZVA 1JJ2R 1K8AT 3HZGA 3H2LA 1LWCA 2YTCA 3Q86A 2FB0A 3T1YJ 4UZBA 2H9ZA 1F3FA 5E41A 3SCIE 3AHPA 4ECXA 2IAJB 2FY8A 1R43A 2VQEJ 1U2CA 1DRZA 4K2XA 1Y3KA 2ZH2A 2ZBRA 1QAXA 1X4BA 4K2JA 2KT5A 5KT2A 1XMOJ 4YN3B 1FKOA 3NBPA 1TK0A 1R7IA 1N34J 4ED6A 2W9CB 4LF7J 4PRFA 2B8PA 1EKSA 2R7QA 2DXFA 4H54A 4DV1F 3QRPA 3V4MA 2XSJA 4DN0A 1DTQB 5HN0A 1WC5A 5DLFA 4TU8A 1J5EJ 5KFMA 3CT9A 5GVQA 3I0RB 1S57A 2RVJA 1I94F 3FCWA 4QZVB 4OHZA 1RCOB 1HQEA 2DNGA 4KO0B 4ZK7M 3TAMA 4F3MA 2RS2A 2C2NA 1XNRJ 5I3UB 2YNHA 3DKDA 1RK8A 1L5UA 3SZ2A 1RBLA 2E7XA 3R7NB 2D9OA 1DURA 2DGQA 2LXUA 3ZXWA 2ZH6A 2ZZNA 4G1IA 3T19A 1SH0A 4PCQA 1HKAA 3EVMA 3BF4A 1RT5A 1B3TA 3EDQB 2POKA 3W9JA 2FZKB 1XJWB 3ENWA 1F2HA 2RE1A 1Z2ZA 3UDVA 1RTZA 2FIUA 3NOGA 4CRJA 3H4DA 4ZVRB 3OR2B 2OAUA 2RUSA 3OTEA 1BQNB 2DHHA 4IO9Q 1A7GE 2G13A 3DXSX 1U1KA 3L95X 2H1YA 4G3IA 4KHPF 4FN5A 4LVNP 4DS4A 4Z37A 2Y8WA 4O3PA 5LT5A 3KLFB 1Y4ZB 3VV2B 2F8MA 2NXEA 2BOPA 1RT1A 1E6YA 1XBWA 4LVOP 3P5BP 1UL3A 2W01A 4DUZJ 4BC9A 3M6UA 4KFBA 4FF4A 3MAHA 1NNDA 1EIYB 5CHCB 4J9SA 1FTRA 1BC6A 4ZDNA 4UOCA 3MZIA 4KBIA 2DR8A 2JEGA 4CH0S 4LF8J 2H54B 3I55S 1NZAA 3TUZC 3G82B 3DC2A 3UCGA 3G6XA 2F40A 5K20B 3NAHA 1GNKA 2W8LA 2OUGA 2V94A 3R8YA 2JDJA 3M2UB 4GVBB 2ZOGA 2MGZB 4WPAA 3IN5A 3QLHA 1UA1A 1RT6A 2OSQA 3DMJA 3OPKA 5IS2A 3D6TB 1TVRA 1G7CB 4ECUA 1Q78A 2DCUB 5DGAA 4K5SA 1TL3B 4ED8A 2C3PA 1S12A 2M8HA 3CWJA 2J0WA 2XB2D 1BLUA 4KQZA 4YQWA 3GCWP 1YI2S 1AB8A 5A76A 4USIA 2VA2A 1UJ5A 5EWFA 2EI5A 5F8IA 2CZ9A 4NLYA 2L48A 1PAEX 4CLPA 4NASA 2B43A 3VQSA 2UXDJ 3W62A 4TLQA 2CQBA 2ABYA 5CYMB 2ZH5A 3BREA 4DV6F 2DCLA 4OJHA 4NYPA 3L7PA 4X4OA 4WTYA 4ZA1A 3MM9B 2NPIA 3ZTRA 1Y0HA 4ANEA 4DR7J 1HBUA 3W5YA 4DR2F 1OWXA 3HK2A 3IS9A 4E98A 1FT8A 1NK4A 4ILLA 1NB2A 5B0CA 1LW2A 1S9EB 1LWEB 1C1BB 1QD1A 4CYUA 4TU9A 2CNLB 3CO9A 3CF5Q 3D67A 1U4BA 3C6TA 4YHHJ 1RHMB 4XK8C 3Q8PB 2QL5B 3IWXA 5GAGI 3D4JA 5HQ8A 3X3UA 2WB1D 2E1PA 3CW2C 5LXYA 3AD7C 4RJVA 1IBLF 3HPOA 2GVDB 3PJWA 4L74A 1TELA 1ACMB 3PXGa 2XNQA 3HF5A 4TY8B 4QR2A 1ZPWX 2HFZA 3K58A 3SQOP 1CBKA 4OX8A 1FEHA 1WELA 3CD7A 4Q0BB 4NCGB 3UI3A 5G4DA 5A2QY 2QA4G 3CVKA 4H4MA 4DDFA 1XQIA 2FHJA 2OELA 5LSOA 3M8QB 2QMXA 1VRUB 1PC5A 3QIPB 1HNZF 4Y65A 4NOHA 4QWBA 5B0BA 3EMTA 1GMUA 2FLOA 4C8MA 3PR5B 2RSQA 2HVEA 2AYEA 1FRIA 3BBCA 4ZP8A 1X5OA 1EJ7L 2HQIA 1TL1A 2CQ1A 1XN9A 3OJUA 4DXLA 2F63A 3PKYA 3KK1A 3L7OA 4IQMA 2DNHA 1CJKB 4OQJA 4TY9A 2ZKTA 3ZNUA 4M8LA 2A6MA 1ZAWA 1OYEA 1HI0P 4IRDA 4IR1A 1D9DA 3M2VB 4X4QA 3GMGA 2DR6A 4OI0A 4X4VA 3CCRS 2YWFA 2EC2A 2DNMA 3CCVS 1FF2A 4ZS6A 1N48A 4DPTA 4QIFA 1M5KC 2BM1A 4KRWA 2Q6CA 3G71S 5HROB 5KAKA 4P52A 5CABA 1BD6A 4GO5X 4DCOB 2KXNB 1W25A 2IA0A 1HPZB 3T5LA 3TR5A 3CJ4A 3UD4P 3BN4A 3K2YA 2HNDB 2CQPA 4Y00A 1AW0A 4KTQA 1XMQJ 4ZVGA 1RA6A 3ITHB 2EEYA 3ZZOA 4P2XA 1T3NA 3HFZB 4WE1B 2LDIA 3IGNA 3MTJA 3LP0A 2J6TA 5J2MB 2C2DA 3B78A 3DRYA 2GCFA 5KG0A 2VH7A 3W63A 4ZIWA 4DFPA 3ZFVA 4A8QA 4O3RA 2BE7D 1TAUA 4NLQA 3PYDA 1EETA 3GILA 1LFWA 2EFOA 3DXBA 1IKXA 4KV8B 1D9AA 3JAMY 1YJ7A 2DK2A 2XMTA 3MEEA 4NYZA 1D8YA 3BO4A 5ETMA 3M30A 4R8UA 4H4KA 3MD3A 4DR6J 5IC6B 4DI6A 2AGQA 4OZ3A 1T9WA 3OBIA 2F9JA 1B70B 5BR8F 2AQ4A 2FDNA 2AP6A 4BWJA 1MW7A 1FI4A 4DV4F 3MM5B 3KLIA 4YY3J 3J7YU 3PNIA 1M5OC 3MMAB 3J81j 2G0JA 3BV8A 1DQ8A 4DG1B 1HBNA 3H98A 4IRCA 2HS4A 4IOCQ 2V63A 3D66A 1K9MT 3ZZPA 4E2FB 4CWBA 3PEJA 1ZZNA 2JC1A 4FKYA 3GJSB 3GIKA 1VQOS 5L46A 4AQYJ 3VHQA 3IXQA 2G9OA 3AD9C 3CXCR 4R5PA 4OL8A 1V5IB 3MURP 1RAJA 1ICEB 4TKTA 4ZVHA 2YKQA 3HD2A 2F3JA 3QSIA 1Q86T 1SKRA 3NEKA 3UR0A 5J2QB 4ZP7A 1S4EA 3UR3C 2XI3A 1P9YA 2C3MA 2ZWOA 1TFYA 1WHYA 1TKXA 2FJAB 3ZTPA 3HVWA 1RSCA 1LEOA 2MKHA 2OD4A 1F5AA 3VVTA 2BE2A 1N5QA 4USTA 2DXEA 2ZDOA 2YWKA 3EGNA 3R5AA 1HBMB 1YIJS 2XWYA 5DDPC 4WFBQ 1YDLA 1KQKA 1H7XA 2Z2MA 3M32A 8RUCA 2R7OA 2MJUA 4Y2MA 3D1QA 1LFPA 5H9FK 1JQGA 3FCVA 2KZZA 5HL7Q 2G1DA 3HKZD 2FGCA 1WC0A 4DL6A 3KJQB 2L9NA 1SJ3P 2DR9A 1ELOA 2V2QA 3T9ZA 5ETPA 5DM6Q 3Q8UA 4ICLB 1N36J 2RU3A 3DOKA 3BSCA 3SQGB 4I64A 3GV7B 3LGMA 4DL5A 6FD1A 3BR9A 5KFEA 5A0YB 2W2OP 2H5IB 4X4PA 2HQCA 1X7VA 4JI7F 4WTOB 3RYLA 2X1GA 3M1VA 2CG8A 1N5TA 4ECRA 2QLJB 3FC9A 5IV3A 1RWNB 2N82B 1VJQA 3DGPA 2HHPA 2YWWA 2DJWA 1W2IA 4HR2A 3HXMA 2DTJA 4YP3A 1CULA 2M7SA 4B9TA 2RDIA 4UOHA 3CCJS 3CJ0A 1LWXA 2M8DB 4F0HA 5KT4A 2L41A 5DJBA 2B9EA 4Q45A 4A8KA 4FNHA 2UU9J 5D3GB 3M6VA 4IDKA 2WONB 3PJ9A 2AYMA 4UZCA 4ER8A 2W2MP 3CC2S 1IKVB 4OHYA 3DRPB 1JXEA 3QO9B 3CJRA 4B17A 1JLFA 2ZH7A 5K14B 3DLKB 3M8PB 4GVLA 5LSRA 3DRRB 2D74B 4OYZA 1FKPA 1U25A 3JYTB 5AXLA 3SDEA 1IWAA 2DHGA 1NKBA 1CG2A 2DITA 1FFSB 2DH8A 3I31A 1JLQA 4Y0FA 2QO3A 3R5JB 3LAMA 2XMJA 1N4LA 1TKZA 5HVGA 2PA3A 2DGTA 2NLWA 3FMWA 2GHVC 1RWMB 3TUPA 3PW7A 4YR3A 3DRSB 3W7BA 5KFGA 2MZSA 1B0VA 3EVWA 4DR4F 3I9V9 3TX8A 1K1QA 1WTFA 4L3KA 4EU0A 2QIFA 2KYXA 3VR1A 2DGSA 3IO1A 2BE9B 2BQ3A 1MLAA 2AW0A 4Q44A 2QE5A 2CWKA 2XMMA 2IBOA 1CEZA 3THPA 4HHHA 1ZM3A 4K4VA 3UWTA 5B0EA 4S0MA 2Y1LB 1CJVB 3KDNA 3IR6B 1YVFA 1RT2B 1HNWJ 4RW9A 1S6OA 4HDGA 1VC6A 2KT2A 5L8RC 3J7A1 1FX2A 4EYIB 2E5HA 4NA1A 5IWAJ 1DQAA 2V67A 2DRDA 2ZNYA 4ZJLA 5E3PA 4FPIA 5C42B 4YOEA 1RTDA 3BQ0A 1R8CA 1KN6A 4LF5J 3VQTA 4CH1A 2WVFA 2WBMA 5F9NA 2YKAA 1JXVA 1N32F 4DV5F 1Q7YT 4HHJA 4F4YA 2ZITA 2YQ1A 4J9MA 3HM9A 2W9BB 1TV6B 1IM6A 1KVIA 2RS8A 2B7BB 4G6VB 2PE8A 4CT8A 3DLGA 3D6HB 4M5LA 2YKMB 1B64A 2Z2ZA 4C11A 2HVZA 3O6QA 1KOOA 4CCHA 4ZPAA 2VQEF 1RABB 5GMEA 4C3MA 5E33A 1TUVA 2YBVA 3I87A 1T9UA 2XEXA 4IOAQ 3NS7B 5E2QA 1XMOF 5LXRA 3LWMA 3QNWB 1UWBA 3D0IE 5J2PA 4RW8B 1S6UA 1N34F 3ZZ0A 3NGSA 2JL9A 3CGIA 3U1NA 2AHOB 4ZIVA 3I5BA 4USWA 1U48A 4JYAJ 2MQOA 4YFUA 4RL1A 4FS1A 3CNQP 2CPDA 1SC4B 2RRBA 5GAEU 2E1RA 1QTNB 1WKJA 1FCAA 1GAOA 4QBUA 3C66A 2I8EA 3R7SB 4EMDA 2W25A 3SEOA 3IMQJ 1T94A 4DCPB 2J9DA 2PMZD 1LKZA 1TMMA 4J9RA 5A8WB 5A8RB 2NXCA 4RW7B 4DZ6A 2Z30B 2JLGA 2F65A 4A8SA 4CIOA 1PCAA 4PYAA 1N52B 1UKUA 2G0IA 2N7YA 5KFNA 1WF2A 1N8RT 2C28A 2LXFA 2LFVA 3EJMA 4C8LA 1I51B 1RWUA 3FEYB 3MPYA 4OYPA 1V3ZA 4ZVQB 2HYIB 3LANA 5H9FJ 1RHKB 2CJAA 1H6KX 1VBYA 4QIWD 3LUYA 4URQU 1T03B 2EFVA 3DOMA 8AT1B 2A18A 3CC7S 3BGRB 4KHMA 4DZDA 3P3DA 2NUHA 3VALA 3WDOA 5AT1B 1DLOA 3WZ0A 2W9AA 3I0RA 2K06A 4CT9A 3G9CA 2ASJA 4RBUA 5E7OB 2CQDA 2BABA 3K8WA 4FYWB 1MSWD 1FERA 2OFHX 3PJXA 9RUBA 5L39A 2OPQA 3POTA 5KG1A 4JUZA 3K7RA 1NHKL 1Q81T 3BGUA 2ATLA 2QA2A 3GFZA 2VPZB 1Z1ZA 4ZN1A 4RR5A 1SKSA 5ETVA 5KFIA 2ZD1B 3VF0B 1IKYA 3CMAS 4P6QA 1U24A 4NLSA 1S97A 1ZM2A 1W26A 1SUQB 4X2BA 1LW0B 2R42A 5B09A 4DV0J 3MCSA 3FKBA 2LQ9A 3H59A 5AE1A 5FDLA 4Y3CA 3A12A 3OVSA 1XWLA 1LK5A 1UTAA 4NLTA 2V6AA 2R7XA 2F4VJ 1FWKA 2UUTA 2J76E 2CNKB 2HGLA 1M5PC 4K8RA 2KO1A 2R8IA 2HRUA 4HACA 3G2XA 4IG0B 2MMYA 2CQ2A 1FE0A 4MYUA 4WKYA 4Y2AA 1FRXA 2K1RB 5BYQA 3B54A 1Q53A 4ES1A 1RWOB 3HSDA 1VQLS 2B5JB 1S59A 3A8JA 3T1HJ 1S4FA 2HRTA 2DKOB 2GW8A 3PHEA 1IKWB 1X8DA 4OI4A 5B0FA 2OHDA 2AF6A 3QJJA 3A8KA 1JNRB 1VC0A 4ETZA 3UCUP 1YWXA 1WC3A 1RADB 2NYIA 2B56A 4KKOB 3S8SA 2WSEC 1KQSR 5CCMA 2ZH4A 5DM7Q 2JEFA 2IRXA 4O4GB 4F02A 5CZVA 3BSNA 2FPHX 6AT1B 2DNQA 1NRKA 2VFSA 2BX6A 5ETTA 1SJQA 3G82A 1SL1A 3TAQA 3CE8A 2BJEA 1MWZA 4OIXA 3C2PA 1TKTA 4IFVA 5I3PA 4ZP6A 1WC1A 3WQPA 1VRQC 1C4AA 4NLUA 2R8JA 3N5FA 1P1TA 3ZO7A 2E7WA 4DR7F 3HCXA 4F2RA 4Q5VA 3MCOA 4QOTA 4LR9A 3R1HA 2YH1A 5HANA 2V4JA 2V9WA 2DB1A 3SV3A 4B3OB 2JVOA 2F7VA 2I6WA 1Q5YA 3MFIA 1ZOTA 1VQ5S 4C4WA 1N6QA 4WIQA 5KFYA 3ZZTA 2VD3A 2ZFHA 4YHHF 1SPBP 3UVJA 2VG5B 4DF4A 1HNIA 1PBUA 1OSDA 4KB7A 1IWGA 4LF6F 1RAIB 1NH8A 3CSKA 4B02A 4OLPA 1LWCB 1AYEA 1UEUA 3K89A 1BQXA 1UEKA 4OX9J 2R8KA 2DR5A 3OFHA 3MM9A 2UVWA 2IJFA 4MIAA 2DH7A 1RLCL 2H5EA 1S1TA 2HG4A 3OXLA 4RUCA 2IVFB 3VAKA 2QT7A 2I5JA 4WZMA 1H7WA 2VICA 3FEZA 3NMRA 5FD1A 2ZOFA 5KFXA 3TJ8A 1S9EA 1LWEA 1FKOB 1TFWA 2OI2A 3NBPB 4H4OA 2GFFA 2D69A 4EGLA 3IBWA 3QGPA 4AE5A 3ILOA 4X4NA 1YG0A 4USUA 3HJVA 5DGBA 1Q1KA 1VRTA 3CMQA 2R7WA 4FP9A 1B7YB 1Q7LB 1T9VA 2KXHA 2XSJB 2V8PA 4MJKA 3MAQA 2WHOA 5D4PA 3RW7A 1BWVA 5K8MA 1HHQA 4P7VA 2R7UA 2FTRA 2RRNA 1Q0NA 4FXWA 3HFVA 1KR4A 2DPIA 2Z4PA 2XQCA 2Y1IA 4QWCA 1RHRB 4DLEA 2AJ0A 3ZZUA 4F26A 5IZHA 4OI6A 2RDJA 3TAMB 3M7VA 2D3OR 2YNHB 3SBMA 4OZLA 4UY85 2D3UA 2DNNA 4ED2A 4Q0BA 3D3CJ 3KYLA 2XG8A 4EO6A 3TEHB 1BXNA 3CCQS 4B3RJ 3IC1A 3QIPA 4IKAA 1UETA 1HMVA 2E1MC 3U1LA 5L1JA 1RT5B 4KSEB 2V2KA 4WU2A 2BV3A 2KJVA 4AL7A 4TXSA 1U7LA 3N5BA 2C2ZB 2EG2A 4F4WA 1KD1T 5BJRA 2V2ZA 1RWPB 1HWUA 2ZM6F 4CLTA 1D8ZA 1FK9A 1H2VZ 1A9NB 4ZCIA 1XMQF 1GMWA 2AYGA 2FQQB 1HHSA 2DNZA 2XWXA 1DTTA 2FY1A 5IXUA 1NCLA 1L3TA 2GMLA 4YR0A 2JNJA 3MPWA 4WYWA 1WSRA 1KVJA 3R5CA 3QGHA 3QQCD 4KY3A 2VU5A 1RT1B 4DL4A 4C0HA 1E6YB 3NLCA 2J5AA 3DM2A 2NZCA 3U27A 3ZNJ1 3LPYA 2YWHA 2EFPA 2HSEB 5AJ3J 2HBYB 2OSRA 5EGYA 1S1VA 1FTCA 3ZZZA 5DZ7A 2L9DA 3MR7A 1QVGR 5GAGU 4B9VA 4DR6F 2IVMA 1F0XA 2GHWA 1S9FA 5GMDA 3FJ2A 2HQFA 4E8UA 2W4CA 5KG4A 1MWYA 3QLHB 2JH3A 1A0OB 2MKSA 1RT6B 1UMJA 1OJ4A 3I82A 3DMJB 2HK3A 4YY3F 4KYZA 1YRUA 1TVRB 3R2CJ 3VAJA 1YKWA 3VZHA 3KFWX 2QFIA 1ROFA 1RU1A 1WORA 1Q8BA 3V6DB 1VGYA 4EUVA 5IQQA 4I6AA 2Q1LA 4D3GA 3NGKA 3AODA 4AQYF 4TN2A 4ID5B 2NSBA 2HLTA 4C0BA 2OLWA 2H65B 3KUGA 3ULHA 2D1CA 4A8MP 4ELTA 3G6VA 5HI7A 4ED3A 4FYVB 1FRMA 2X1FA 2UXBJ 3DN9A 1IR2A 3D1OA 5F3TA 1B0TA 3T3FA 3MM8A 3PM9A 3JQMA 3AB2B 5CXTA 1SI9A 3OHBA 1LNQA 2KFNA 3DLHA 4NE9C 2FVPA 1FO1A 1HBUB 2BJ1A 4CO4A 1SKWA 5HATA 3IS9B 3DHXA 2KVIA 3OL6A 5KOWA 5CD4H 3S7RA 1D1UA 4DR5J 1FVSA 2BJDA 1LW2B 4DL7A 3GQCA 3AXMA 4ED0A 3GV5B 3WIUA 4CYUB 4J9VA 3CJ8A 3KLEA 3FZ2A 1Y5LB 2XM3A 1VMBA 3M8RA 5CQGA 3C6TB 2Z57B 3NP5A 1XNQJ 3EZUA 2K3KA 2ALYB 2LU2A 3EGVA 4DR3J 2XMKA 4WFXA 2UUWA 2VIHA 1K1SA 3EXYA 3D7SB 1ZAVA 4LF4J 1UCNA 1N36F 2VG6A 3TZZA 1S76D 4F4ZA 3MCNA 2MKYA 1VISA 1V3SA 2V8GA 3W9HA 1S5ZA 4JP8A 3PO4A 2AD9A 2E29A 2HNYA 2XO6A 2D41A 3OT9A 2FVQA 1CQNA 5BXIA 2KB2A 5M2PA 2FHJD 2MHNA 4N8NA 4RWWA 5F8JA 4H4MB 2R8HA 3NKYA 1FXLA 4Y34A 5FJ4A 2CJBA 3HULA 2Z58B 4ID8A 2KL8A 4WXWA 1SJFA 2CQ0A 3PW5A 1UPPA 2FJWA 1NPRA 4WFZA 1WJ9A 4HKQA 3V2UC 3TX0A 2UU9F 2QLWA 2FHOB 4P74A 3OR1A 1FRHA 4JI6J 1REVA 3GE9A 4LQ3A 4OHXA 3KK1B 3H2UB 3OL9A 4K5RA 5A0YA 1F3VA 3GCXP 3TWZA 4B3TJ 4ECSA 3A3NB 3L3CA 2V8VA 3TQEA 1SIZA 1TK5A 5JMNA 2M2BA 1X4GA 2XLJA 1VQKS 3UDLA 1GT8A 1NHUA 4I68A 3FFIA 2CPYA 3PACA 1IUJA 4FS2A 4X4SA 2UUAJ 1NSPA 3K0JA 1OMSA 4CLUA 1PGZA 1SXLA 3AH6A 3T5KA 2ROPA 1X0FA 1XR5A 2GIQA 1UVNA 2EW9A 4LF9J 3BDEA 4HEA9 3Q24A 2CDQA 5DDRC 2GMHA 2W2QP 4ZVUB 1RHUB 1IKVA 1FVQA 2J0QD 3QO9A 3LTOA 3K5NA 2FJXA 2JFDA 1KFDA 2E5JA 2DVIA 3VGVA 1X0PA 1HBOA 4V19X 4QWDA 3VZIA 4ERDA 1RAOA 4CLFA 4F4AA 3BGFA 4YS2A 1F9FA 5BYSA 1EX8A 1HNWF 3LP0B 1T02A 3N28A 4CM0A 1U45A 3J81Y 4HYKA 1U1PA 4IG3A 4PWDA 2X1AA 3TJ9A 1JJHA 3BBFA 5IWAF 3ET6A 2OPSA 5KFQA 3G96A 2W2NP 1EETB 1SH2A 4I69A 2CIMA 3QGGA 4C48A 3CUNA 3LP1A 1IKXB 3JQJA 4DFMA 3MEEB 3MFHA 4K4UA 4ZPBA 2BKOA 1PSDA 4R8UB 2EWHA 3CJSA 3FBEA 2Z56B 1HWLA 3BB5A 3ILLA 2DNPA 5A6WA 4USVA 4LSNB 2DRAA 2DGWA 1JNZB 1FEEA 2ZUAA 3DOLA 5T41A 4AXJA 2FLNA 2E66A 4HI2A 3O1LA 3KLIB 1XC9A 2MXYA 3V6JA 4Y6IA 3FSIA 3V4IA 1HBNB 4ANCA 1T11A 1U47A 3ETMA 4MK7A 4P7TA 4NLDA 2BRKA 1DBDA 1H72C 1UWAA 3W8PA 1P9QC 4YEAA 2XHWA 4R5PB 3R5DA 4Z7YA 1SQFA 4B3MJ 4ZPVR 5H1SV 4O44A 2EFNA 4DR1J 3W5XA 1RAAB 1N88A 1YITS 2R2TA 1FJCA 2KFZA 2MKCA 2B51A 2V68A 1TV6A 3UCZP 5L1IA 1UVKA 1TTHB 5EX0A 1UA0A 5D15A 4DWIA 1U09A 4MK9A 2JEIA 1IQTA 4OJ1A 4HI1A 3CDUA 1MROA 4F0MA 1KKHA 4NL5A 1JWWA 2WVCA 2ZUGA 2RIJA 2BE2B 1ZTTA 3H5SA 3MECA 1HI8A 5DZ6A 2RHSB 2ZNZA 5F9LA 2CJKA 1O51A 1S7HA 1UVIA 4P2SA 4K0KJ 1NBEB 4WXOA 3J7Z5 1DZ5A 4LR8A 5IT9Y 3M8YA 3MPDA 3M32B 5ETRA 3CJ2A 3OW2R 1FXDA 3ENAA 1YSJA 3PX0A 1HWKA 1MMDA 2VPXB 3MD1A 3P5TL 1S1XA 3AD8C 1KHWA 1XR7A 3HHLD 1PIEA 4OV1A 2NYHA 2RB7A 1RBAA 3HHLB 3C14A 2OPRA 4Y2IA 4KJIA 4M5GA 4L73A 4CO5A 1H38A 4EWTA 2IY5B 3DOKB 2BVZA 3R27A 2WBRA 2HWHA 4KGXB 1UVMA 2CJ9A 4F0KA 5D0RA 3TA0A 1VBXA 4JI5J 3JSBA 3KWMA 3M1VB 3PX6A 2KRBA 3RTVA 1NXIA 1WKKA 1URRA 3DGPB 3GR1A 1CVJA 3T5HA 5H9EK 4YUDA 3OHAA 2IM2A 1F5BA 3TEGA 1OO0B 4WU3A 5EUHA 3SIPB 1CULB 5KG5A 5DS7A 4L3NA 3D0GE 3KUEA 4JI3F 4QR1A 1QE1A 4CLWA 1PC4A 2W2PP 5LMNF 1S6QA 1QAJA 4DV0F 4QJVA 2GO9A 2XY5A 3MMJA 4NX9A 1YJNS 4IDKB 1YJRA 2R2SA 3QMQA 1D9FA 3V6HA 2QGFB 2PC6A 2F4VF 3SV4A 3BPDA 1VR6A 3HDSA 3QT8A 2VQFJ 3Q2TC 3A4TA 5KFSA 2AEFA 4C3KA 3TP2A 2CPIA 1WWHA 1FKPB 1KNZA 3SDEB 2XS5A 2VBXA 1M5HA 4I7FA 3OD2A 3HSJA 2CG4A 3Q8YA 2GQ2A 1YJWS 2VL1A 1NHVA 5B0AA 4OFZA 2I1RA 1XERA 2YY3A 2ZD1A 1XTZA 3DU6A 1Y9OA 2L08A 1TKZB 2IA6A 4RPFA 5GAEI 4HHUA 2HZCA 4WK3A 4A8YA 4DQIA 2RQ4A 2GC8A 1N5SA 3TVYA 3I4HX 4DX8H 4DHVA 4B3SJ 4X66J 1HARA 1YBAA 3BGLA 4LIWA 4JV1A 2DISA 4Y28C 4QU6A 1H2UX 3QAUA 2DY9A 3D68A 2KG0A 4GC6A 3NGDA 4FXDA 2B0GA 1S1WA 4CLLA 4QWAA 3HJFA 2MQQA 1ZM4A 3M8SA 1WSVA 5C7PA 2B5JA 4DSKA 2UUCJ 4RW9B 4O23A 2HGNA 3MEDB 2VASA 2EVZA 3VAGA 2YNIA 1GFWB 2NQPA 4PXDA 2IRYA 2Z2LA 2AJ4A 3V5RA 3MGJA 3IM9A 5DQHA 3H90A 1YJTA 4FBTA 3KTQA 3PCOB 2YNGA 1RTDB 2HQ3A 4K50A 5EDWA 4A8WA 4F4KA 4C8NA 2C2OB 1KVKA 3GPAA 2KT3A 2HFUA 2IM3A 5GMKa 2XZDB 3ZTQA 2CA9A 4TNOA 3DLGB 1SJ4P 3P96A 4JOUA 2JHEA 2P5VA 4P9SA 5IM0A 5IFMA 3JXOA 1WDDA 4G1QA 4DV2F 4FF3A 4OX9F 1H98A 4NLOA 4C11B 3CCES 3CULA 3BKFA 2NSCA 2X1BA 2HS0A 5CCLA 3WHIA 3CD0A 2FUG9 1UEVA 1QTMA 4CNZA 4FYDA 1UWBB 5J2PB 3B4MA 4JI4J 3UDCA 4J9PA 3VGTA 3PKMA 4ZCKA 1KONA 1IJEB 1PYOB 1KC8T 2HEKA 1OPZA 2C3UA 2C1EB 1NJWA 1RP5A 1YX2A 1VQMS 4QPTA 3BN7A 3ZZYA 3E2EA 3GZ7A 2AX0A 2DYAA 3QIDA 4FPRA 2XO7A 3R6LB 1GXUA 5KFAA 2HHSA 4J9UE 2DGOA 1M1GA 4WFNQ 3N9UC 4ZPTR 2OMOA 2HNZB 3MMCA 4DV1J 3NGTA 4MAKA 1RWWB 3GYXB 4FVCA 4BS2A 3CJQA 2HVHA 1NSKL 2W1BA 2RMLA 5C2GA 2HVDA 3FUYA 3ILIA 4ZVPB 1URNA 2OTLS 1NSQA 3TW0A 2E9ZA 2PA8D 3CDEA 3TYTA 3V81A 4X64J 5HBMA 4EI2A 3TQ1A 2RT3A 5C25A 2MSTA 2P6TA 4B3RF 2GGPB 2VKZG 2DEJA 4WF9Q 3JTPA 2EK6A 3OL7A 3HD1A 5IOLA 1OQ6A 3DOMB 4I4BA 3SI8A 2CPEA 2UP1A 1NDKA 1U26A 3H42A 4HTJA 5MLCV 3W2WB 3U02A 3HLUA 1DLOB 1SB6A 3AOAA 3JSYA 1BMQB 2KKHA 3DYAA 4PQAA 2XZTB 3G6YA 3G4SS 4NMLA 3RRKA 2JZ5A 4IUFA 1SC3B 1X5TA 2MKKA 4NLRA 4CLZA 2OPQB 5KFBA 2XY6A 3QYYA 3I5AA 3POTB 4NPOA 4UF4A 3OTDA 4ELUA 2V0NA 2UXCF 3F73A 4UOFA 5A6PA 5H9EJ 2B9YA 4M95A 5M2RA 1R0AA 3LAKA 4JV5J 2E9TA 1IKYB 2DO0A 1N33J 2VBWA 3IFEA 4DV7F 2LCWA 3BSOA 4LRFA 3T41A 5DO2A 2OEKA 5FDLB 3D6FB 5AJ3F 4O3QA 2PD1A 1P27B 2HRYA 3BGOP 2B7CB 3GFHA 4ATNA 2ROGA 2EG1A 3LOUA 4OLOA 1S72S 1NLKL 1G2EA 3CJ5A 2C22A 4HACB 2XGPA 1C0UA 1FJEB 2AJQA 1WACA 4AT1B 4DU7A 5EHHA 1KLMA 2G2YA 4HH1A 1VIOA 3FSYA 3HT0A 4DSIA 3OFFA 2RAQA 3TRGA 5IV4A 3BKTA 1VQ4S 4BWMA 1VQ8S 1YJUA 4BLGA 4LREA 2J6UA 1KSPA 4USJC 3FMBA 4JI1F 1YHQS 4NLPA 1T3OA 2B3TB 4DL3A 1U6FA 2J8SA 5HQLA 3M8ZA 4WZQA 2PFDA 2PMWA 3V6KA 3Q83A 4PR6A 5KFZA 1SJRA 3TUIC 2AKWB 3GIJA 4TU7A 2NREA 4F04B 1L3UA 1NPKA 2W7PA 1UZDA 1TKTB 2W24A 1X5PA 1NO8A 1FFWB 4IFVB 3PW2A 1C2PA 5D4OA 2DNOA 3KHLA 2JRSA 2X3GA 3IGVA 4OZJA 2RF2A 1S7IA 3BQ2A 3F56A 2FYXA 1V5VA 4ES2A 2RDDA 2AJ1A 2KHDA 2V4JB 4BBYA 1WG4A 3V6DA 3QFWA 4JI8J 1U49A 4NLWA 4DR5F 3FVYA 4DV6J 5D0EA 2FZGB 2M5YA 4KH1B 3AY0A 1U1MA 2FZCB 3NCRA 1N6QB 2ASYA 3OQ2A 3W2VA 1LK7A 4ID5A 2IJNA 2GAGC 5C2CA 9ATCB 3UVJB 2MQNA 3EXCX 1HNIB 4ZVOB 4KT0C 5KFFA 1V9OA 5KTQA 5L1LA 4DR3F 3HVTA 5KOXA 4KGVB 1U1QA 2P9CA 2YKNA 4LF4F 2FLLA 3CC4S 3OTBA 2QL7B 2ZVSA 4DN9A 2AGPA 2M70A 3KLHA 1WG1A 3EPIA 4OV6A 4ELVA 1D09B 2ILZA 5B08A 3ETOA 4KR0B 1S1TB 1S48A 2F1FA 2I5JB 2HIQA 1RWKB 2RNEA 3CTRA 1S1UA 1KRPA 3D54A 2HFSA 1FD8A 3TO8A 4H4OB 2I9SA 2PEHA 2WSCC 1IBLJ 5HMWA 2J9DE 2WAQD 5D8HB 3M8WA 2HHXA 1VRTB 3FNNA 2QA4S 3D3BJ 1R8PA 2MHEA 4Y2KA 2QLBB 1S0VA 3H20A 3RBZA 2WVEA 3BSAA 3RR7A 4ZPWR 3W3SA 2B6AA 1KWMA 4OMFG 2ZBCA 2CQGA 4LF2A 4QPXA 4N8OA 4NXNJ 3C3LA 4BCAA 4B3TF 1SQGA 3R9LA 4J9LA 2CWXA 2RU9A 2HHHF 2QV6A 3OFGA 1EB0A 3KK3A 2B4OA 2IHR1 3ISNC 1OY6A 3WX8A 3OUYA 2GAHC 5KG3A 2D3O1 2ZBPA 4ENOA 2UUAF 3WIVA 5FLXU 3SFGA 1HMVB 4C8ZA 1RUSA 1Y5NB 1YLXA 4LF9F 5E3RA 3JSMA 4F8RA 1AZSA 3TA1A 5F8MA 3U7JA 4PG6A 5IQ6A 2IC3A 3DFEA 3MMBB 2ZC3A 2C3OA 1GMVA 2NR0A 1U1NA 1PJ5A 1GMWD 1T95A 4HH0A 2VPWB 1FK9B 2DEIA 3MHYA 1UP1A 3TANA 1SL2A 1KQGB 1XK8A 4M5JA 4UUXA 1KQFB 2VUGA 4RX6A 1DTTB 1S0MA 5F41A 4P75A 3G8SA 3TNVA 1CLFA 4ZLJA 2DR7A 2GQCA 4UQTA 1R8HA 4OZ5A 2DNYA 1YZ6A 4M5NA 3C15A 2CADA 3DM2B 1R8AA 4RO0A 4RLEA 2I0XA 2BW7A 1NH7A 1GXTA 2AEMA 1Q5VA 4R0EA 2ZJRQ 2HBRB 1S1VB 5I3QA 3QT5A 3TZYA 3NGUA 2F9DA 1VDHA 2DHXA 4C2MA 2IRUA 3N6LA 4RUHA 3TAPA 3KMSA 3NOCA 2XSFA 5KFHA 4PPDA 2P2CB 2PN6A 5AXKA 4QW8A 3HP6A 4MIWA 4OZNA 2GQQA 3NL0A 3CMES 3AFGA 3CD5A 4MYTA 2O67A 3DI6B 2H48B 3KJVA 2MLXA 2LP4A 4MKAA 4ZCMA 4F67A 3UQSA 5HMZA 1SL0A 2G2ZA 4O4RA 1RDRA 3GLJA 4W90B 4DQPA 5F8LA 3RB0A 1QY7A 2XTJP 5CD4A 2KRRA 3CCLS 2YKOA 3A8IA 1C1CA 1HNXF 2O3DA 3N6NA 3KG4A 2AGOA 3QWPA 1TAQA 2EXUA 4DR1F 4LUBA 2B4VA 3IP0A 4ED1A 4K59A 1WHXA 1PILA 5K8NA 3T5JA 4ZMMA 3MPVA 4LSNA 2RH3A 2DY1A 3MM8B 1CPZA 4MT1A 4JI0J 5F8GA 4NLGA 5BYRA 3AJDA 4R0JA 2ZHAA 1R6VA 4A46A 2XGQA 4NA3A 1VHIA 1YBTA 3AQPA 4D3HA 3VCDA 2NXNA 4OI2A 4XTTA 5DG8A 1SKUB 4K0KF 4X4UA 1F1BB 3RAMA 5E5NA 1MNEA 2CVEA 3QPIA 4FDFA 3KLEB 1TL7B 2CJQA 3MEKA 4F25A 4TYBA 2V8DA 4U7UD 1AROP 4I1TA 1VQSA 2G2OA 1RYSA 2O5DA 2AWZA 2QTWA 4RW6A 2VOPA 3N01A 1WEYA 3TOQA 1IBCB 3US5A 2E5LJ 4DLGA 2WVDA 4CM2A 1X4EA 2NXJA 3W8GA 3DLEA 1HYSA 4QYRA 3VVUA 2LQBA 3EGZA 4O3SA 4AL6A 5HVFA 4WWSA 3HVRA 2WOMA 2R8GA 2HHVA 3UD5A 2KG1A 2VG6B 2LEAA 5G0RB 3ONQA 2Z0GA 4M5MA 1RKIA 4PUOA 1P1LA 3SCJE 5KFUA 4JI5F 3VAMA 3Q8QB 4F4XA 1HW9A 2HNYB 3PTWA 4ZP9A 2M88A 4H4KC 2BKPA 1NJZA 3DLJA 3MUMP 3CCWA 2YH0A 2V8HA 3ENQA 3QJLA 4CO1A 1NDPA 4LFBJ 3QFHA 3GJTB 4NWBA 3W65A 4X62J 2CPXA 3H5XA 2BKNA 3PZPA 2JFKA 4EZ9A 3HHLA 2KM8B 1ZAXA 2HMIB 1BE4A 4LBIA 2XC9A 4M5DA 3VWSA 2YX1A 2CQ4A 3NWRA 3OR1B 5CZXA 4G1PA 1REVB 4A8OA 3VGUA 1VFJA 2N4DA 4DX5A 1Y10A 2R7SA 5ETSA 3IM8A 2XMUA 3I5CA 3PRVA 5KFDA 3KLVA 2ZEJA 2VJVA 3GYGA 1EKRA 4P2MA 3GR0A 1T9YA 1BHNA 5U47A 3FFIB 1A6LA 1EARA 4J9NA 3QT6A 5AXMA 3C6UA 4CDIA 5F8NA 2ADCA 5JVGQ 1HQUA 2WRMA 2OGUA 1VLOA 2ROEA 5D4NA 3CDAA 3PR4A 2C2KB 4ED5A 1Q95G 4I67A 4PWUA 2UV8A 2AYBA 4U6PA 1IJFB 4WK1A 2V50A 1JB0C 2IJRA 2RILA 5CA5A 4B3SF 4X66F 1WI6A 2RQMA 1FDNA 4X4RA 1LXNA 4L76A 3MTKA 1DJ0A 2NCKL 3THVA 1J2VA 1HBOB 2XYHB 1JLAA 4WKRA 2XYGB 1I3OB 4HLBA 5T7LA 5HSPA 3GP9A 1KTVA 5KT6A 2AJ2A 2UUCF 1OPIA 1UFLA 1AFIA 1SV5A 2P9EA 4DR4J 4PXEA 4XIUA 3S1TA 1OY9A 3PRBA 3B4DA 1VHFA 1VQPS 4PG5A 4NRTA 4IG3B 4PWDB 4CQ1A 4RWXA 1VQYA 2W4DA 5ETOA 3BKUA 3ET6B 1DY3A 3MF5A 2OPSB 2O1PA 4ES3A 4OZ2A 2V34A 1N5YA 3VAIA 1PYSB 3LP1B 4M94A 1T8EA 1ZH5A 2RKIA 1O6XA 3IAS9 3OXFA 3RR8A 3I6PA 1L3KA 4M5HA 1NB7A 5DQIA 2R9LA 3E01B 3DOLB 4KIAA 2B4UA 4DOZA 4ECWA 1UW9A 2PI5A 2GIFA 2MZTA 2LEBA 2BANA 4ECYA 3MEDA 5L9NA 3NCQA 1NPPA 4DV5J 3V4IB 3SCLE 2HHUA 3K5LA 5CAAA 3WBZA 2LMIA 3DRXA 1T05A 3IR5B 3KLGA 2F8EX 4JI4F 3G6ES 1S6PA 4L6V3 4GKJJ 2YNFA 1YZ7A 5CYQA 2MQMA 2M52A 4O44B 2F8HA 2DT9A 1RT4A 5E3CA 3PFOA 2WVBA 1C4CA 1C0TA 3GJRB 2HAIA 6FDRA 2G0CA 3OTOF 3UW1A 4ZPDA 3QZ7A 4KGKA 5D4LA 1O0PA 2AEJA 4JI2J 3OLBA 3T1YF 1MROB 5I42A 2L9WA 3T6BA 3MECB 3K5OA 1HFEL 3GONA 2MKJA 4ANDA 2Q66A 2E1AA 1WHVA 3H0PA 3H8YA 1WOPA 1K73T 5GAHI 1T0TV 3P8BB 2GJ2A 3H40A 4LF7F 4N56A 1RTIA 3GSDA 1S1XB 4X64F 2FHMA 1QUPA 1KOHA 2MEWA 2HFNA 2IFXA 1WI8A 3CCZA 3KNAA 2KI2A 1RU2A 2GX8A 1NK6A 1BGXT 1ZM9A 3C14B 2E9RX 2OPRB 2OJ3A 2G4BA 1VCTA 2QA1A 3CDWA 4DPOA 3KUHA 5LJ3Y 3UNGC 2A10A 1J5EF 4FXVA 3AQOA 1IBMJ 1SJ1A 3B82A 1RTJA 4RNFA 3GB0A 3MCMA 2C2EA 4ED4A 7FDRA 2HNZA 3Q22A 3IAM9 1ZYQA 4RZRA 5ADZA 4DBQA 1L3SA 3HHNB 2D3ZA 4IH5A 4KAIA 1XNRF 1B7FA 1RWXB 4ECTA 1JKHA 1H2TZ 4NYOA 3OSNA 4JV5F 4X4TA 5DRKA 1N33F 1QE1B 2GGPA 2IM0A 1YQHA 1HW8A 2YKPA 1S6QB 3S01A 1RISA 1AUDA 3AOBA 2IM1A 3NNCA 4OYXA 3MR6A 2OFGX 3W2WA 1MN7A 2LLZA 1JLGA 3H5YA 5D77A 3ENVA 4QIVA 2Z2YB 4MH8A 2VG7A 1UW4A 3KK2A 2YQ0A 5RUBA 4I7FB 4BC7A 1AUSL 1VLYA 1H3DA 1O8BA 3BO2A 4NMXA 3BS9A 5EWEA 3NNHA 4NI2A 3CCSS 2DHSA 1ZBTA 2Y9HA 4U8YA 1RA7A 3AXKA 5E0OA 4K4WA 2ZHOA 1K0VA 3P4UB 2ILYA 3MR5A 2KTQA 4DUZF 5C24A 2K3IA 3T1AA 3T9NA 1HR0J 3R7BB 4KGMA 4BDPA 1WNEA 5LL6d 5LOQA 3CIZA 1JLBA 3N6MA 3AJ1A 4ZVTB 4DX6A 4DV3J 4HVZA 5THWA 4LF8F 1HWIA 3BR8A 1IM4A 1S1WB 1VBZA 3M6XA 3PG9A 1CS4A 4KE5A 2CYYA 1HD0A 3FQLA 4B9NA 3R5GA 2CPHA 1BWEA 2E44A 4NEYA 3OLAA 3MEGA 4DPXA 4A48A 3TJAA 3N79A 3JSRA 3EUNA 2VONA 3KJNB 1PO6A 2DNLA 4N7TA 2YNIB 4RUAA 3MM7A 3U1MA 1CJUA 4ECZA 1RAGB 4JI8F 3ADAC 1RTHA 2KDOA 4NLVA 4ZKAA 5KFCA 2YNGB 3RUBL 2D7SA 2HBZB 2DIUA 2A2CA 3OV7A 2UXDF 3LA0A 4PYDA 4A8XA 1I5OB 4MTPA 1GXLA 4TLRA 5K5MA 4RW4B 4K4XA 4CLSA 5IM0B 2W7OA 4G1QB 1Q16B 5IT0A 2ACYA 3ZZRA 4DJBA 2LXIA 3T6JA 1FE4A 3NRBA 1R6YA 1RJJA 3BM7A 3RW6A 4DPWA 4U67Q 4LF6J 2HGMA 3HX9A 1BQMA 2FC8A 2XHCA 1U0HA 4RU2A 1K0TA 2IYGA 3E8OA 3O3LA 1RWVB 4DL0C 3S6EA 1UVLA 4NZ0A 1F60B 2V4RA 1E6VA 1HI1A 3M2RB 2NXUA 3J7AN 1HQ2A 1EQ0A 3SSQA 4Q2MA 2HBQB 5HO4A 2VFTA 1PG5B 1M5VC 4KH0B 2OKQA 4WJBA 4OZ0A 2ASDA 4I2QA 3NWGA 3GYNA 3UPFA 5T14A 4QU7A 3H4BA 2BDPA 3PY8A 4WP3A 2QLFB 4NXNF 3MMCB 3AJ2A 4M5KA 2OPPA 1LV5A 1J5OA 3AT1B 4J5OA 1MMLA 2J9EA 3H7HB 2JSXA 3PW0A 4PG4A 2JOQA 4CTAA 2DPJA 3V81B 5HBMB 1S0NA 5C25B 4X84A 3QJPA 4UTGA 2XS7A 4OX6A 2MQLA 1T9XA 4WBFA 3TI0A 2LYVA 1N56A 1GK8A 3EE3A 4CP5A 1Y5IB 1VI7A 4PQUA 2AIRB 3OVBA 1FWPA 1U1LA 3HHKA 3DYAB 2R2UA 5J1EA 4RBTA 4DCJB 2LQ8A 1VQ7S 4ECQA 2ZZTA 3CIMA 2M3DA 1AFJA 3PYEA 3PYGA 2HHQA 4E0DA 2EKNA 1RLDA 4C6AA 1XR6A 2BYCA 4ITSA 4DPYA 3JS9A 1L3VA 1UAWA 3H25A 2ZM6J 1Q82T 1RKJA 1D0EA 4K4ZA 3Q89A 4DS5A 1R0AB 3FZBA 4C8OA 3QRRA 4LBHA 3DNCA 3O8WA 1UZHA 2CFXA 2XMAA 2GIRA 3VGSA 2V4QA 2C2RA 4PG7A 3QATA 2CAJA 1X9WA 3HO1A 4I2PA 2PSZA 3LP2B 1M0SA 1TUWA 3MMBA 2O01C 3IA0A 3DLLQ 3A8EA 3CO0P 4AFFA 4L72B 2XYPB 1C0UB 2Q79A 3PIOQ 3MAAA 2KFYA 1JJ4A 2I38A 1PBAA 1KLMB 2MLZA 3A1YG 2PT0A 3G87A 2A2DA 4MFBA 2CRLA 1X5SA 4A47A 2CJXB 2YWGA 4O3NA 4Q2LA 2XLKA 2BJ3A 4CZCA 2MY7A 1FNOA 4UW2A 3J81U 3RRGA 2EFQA 1HD1A 2FD2A 2R7RA 1IR1A 2GZOA 1NK0A 2EBGA 3KXDA 3R1LA 1U6ZA 4FBUA 5LM7E 1RB0A 4ZCLA 1X9SA 4EYHB 2ZH8A 2CKWA 1LWFA 4P2FA 3QAEA 5ETQA 2BBEA 3VAFA 3FSXA 3MM6A 3I0SA 4OI3A 4PKDB 4JI0F 3G8QA 3OSPA 3DI6A 1G1XA 3KKFA 4ZHRA 1M90T 2DGXA 3HMJG 4AXIA 4NXMJ 1YRXA 4C7QA 2RF2B 1KEKA 4LSLB 3UNYA
chains in the Genus database with same CATH topology
1R8BA 4FF2A 2CQDA 2BABA 3TRGA 3K8WA 4QR0A 1MSWD 1GQEA 1VQ4S 1LQ9A 3RU0A 1FERA 2J9CA 2CQ3A 2OFHX 3BEGB 2MQPA 4BWMA 3PJXA 1YJUA 2WCXA 3UFCX 1VQ8S 5L39A 3BZQA 2OPQA 2FC9A 4EO8A 2IVYA 4NA2A 4RBVA 3POTA 5KG1A 5A8WA 4RW7A 5A8RA 3M9OB 4IOBA 3EX7B 3FDSA 2J6UA 2YVSA 3W2VB 1KSPA 4USJC 3NS5A 3FMBA 4JUZA 1S10A 4JI1F 3K7RA 1S9GB 4HL9A 4PXBA 1YHQS 4YMEA 1Q81T 3BGUA 2ATLA 1NK9A 2QA2A 3GFZA 3PDNA 4NLPA 2VPZB 1Z1ZA 3CJ3A 5F3ZA 1T3OA 2B3TB 4HT5A 1SKSA 4DL3A 2MZRA 3I32A 5J2NB 5KFIA 5DDQC 2ZD1B 2E1CA 3VF0B 4U9RA 1IKYA 1U6FA 3CMAS 2MYFA 4P6QA 3OXGA 1U24A 3WC2A 5HLFA 3K57A 4NLSA 1S97A 1ZM2A 2E5LF 2EKYA 4WZQA 4EBCA 1SUQB 1DARA 4X2BA 1LW0B 4EBEA 2O66A 2W7AA 5JUMA 1NK8A 5B09A 3V6KA 2EPIA 3HVTB 3MCSA 5LSLA 2LDYA 2LQ9A 3H59A 5AE1A 2DNRA 5FDLA 4PR6A 4RNMA 4Y3CA 2CZVC 2YKNB 5KFZA 1SJRA 2U2FA 3TUIC 3GIJA 4TU7A 4HTIA 2NREA 3OVSA 1XWLA 1L3UA 1LK5A 3PV8A 1IR0A 3KLHB 4NLTA 2R7XA 3HHEA 2W7PA 1T03A 1M5SA 1TKTB 2W24A 2UUTA 3KHRA 2J76E 2HGLA 1X5PA 1NO8A 1M5PC 3RAXA 3VTIA 4IFVB 3PW2A 4LMZA 2KO1A 4OZ1A 5B7WA 2R8IA 2UVUA 4MKBA 1R89A 2HRUA 1C2PA 2V5HG 3BGRA 1QSLA 4IG0B 2MMYA 5D4OA 2CQ2A 1FE0A 4MYUA 4WKYA 2DNOA 4Y2AA 1FRXA 2K1RB 3CJKB 5BYQA 2RD5C 3KHLA 1Q53A 1S1UB 5SUHA 5D6GA 2JRSA 1ZPVA 4GC7A 2HFOA 2X3GA 1JLFB 3IGVA 4OZJA 4ES1A 2RF2A 3BQ2A 3F56A 1VQLS 1H0HB 5DG7A 2A3JA 3ICLA 2B5JB 5KFVA 4ES2A 2QZ8A 1RT3B 4FNIA 2AJ1A 2KHDA 2V4JB 4QYZJ 4BBYA 1X4FA 5IT4A 1VQNS 1S4FA 1UFWA 1WG4A 3V6DA 2GW8A 2WTFA 3PHEA 4LFBF 1U49A 1IKWB 1X8DA 4OI4A 4NLWA 5B0FA 4DR5F 3FVYA 2AF6A 2XY7A 3QJJA 4IQXA 3I96A 2M5YA 4X62F 3AY0A 1U1MA 2XCAA 2UVRA 3NCRA 1JNRB 1N6QB 5F0UA 2ASYA 4AL5A 3OQ2A 3FGVA 3W2VA 2GV1A 1VC0A 4I0WA 3NS6A 4ETZA 3UCUP 1LK7A 1S9GA 1YWXA 4ID5A 2IJNA 2NYIA 3NG8A 2B56A 1Z2LA 4KKOB 1F2GA 2CQIA 1JLQB 2RQKA 3S8SA 2XCPA 2WSEC 1KQSR 2MQNA 3EXCX 2VQFF 3FRYA 1HNIB 4UUWA 4KT0C 3LH2S 5J1NA 5CCMA 5KFFA 1V9OA 4ZVFA 2ZH4A 5DM7Q 3IRXB 5KTQA 2IRXA 2JEFA 4O4GB 4F02A 2ZJQQ 5JVHQ 1SUQA 2B6AB 4EBDA 4DSEA 5CZVA 1LW0A 5L1LA 1NK5A 4DR3F 3BSNA 3HVTA 5G0RA 5KOXA 2OTJS 2FPHX 1M1KT 2N4CA 2PIIA 5FLXY 2ZC4A 1S79A 5KFLA 1U1QA 2P9CA 2VBZA 2YKNA 2DNQA 1NRKA 2VFSA 4LF4F 1CSJA 3IG1B 2FLLA 3CC4S 1SJQA 4YR2A 2QEXS 1SL1A 1TQLA 3OTBA 2ZVSA 4DN9A 2AGPA 2M70A 2N7CA 3KLHA 3TAQA 4XDCA 1WG1A 1HNVB 3CE8A 2BJEA 1MWZA 2LA6A 3EPIA 1FNXH 4OIXA 3C2PA 4ELVA 1TKTA 2VV5A 5LMUF 2ILZA 4IFVA 5B08A 5I3PA 3HT3A 3ETOA 4KR0B 5M2UA 1FJ7A 1S1TB 1S48A 4ZP6A 3KK3B 1AXQA 3LW5C 5GADU 1JLEB 3TVKA 2F1FA 3M9MB 2WB4A 4IG0A 2I5JB 1C4AA 4NLUA 2HIQA 2R8JA 2LU1A 3M05A 3OUYB 2K1RA 3PW4A 3N5FA 1P1TA 2RNEA 3CTRA 1FRJA 2AX1A 1S1UA 2P6SA 2E7WA 3GWCA 4MIBA 4RNHA 4XPEA 3D54A 1KRPA 4DR7F 2OO4A 4F2RA 1APSA 5EN1A 4B9LA 4Q5VA 1FD8A 3TO8A 4H4OB 2I9SA 4QOTA 4TQRA 3R1HA 2PEHA 2WSCC 2YH1A 1RT3A 4LIRA 3RB6A 2V4JA 2V9WA 2KZMA 2BR0A 2DB1A 5HMWA 3SV3A 4B3OB 1G6BA 1IKWA 5I4MA 1N5VA 2JVOA 2F7VA 2J9DE 2NPFA 4I6WA 3JSMB 2WAQD 1RT7B 3G86A 2HMIA 3MFIA 5D8HB 1ZOTA 2HHXA 1CQMA 1VQ5S 1VRTB 2YQ3A 3FNNA 4C4WA 1N6QA 3RB3A 2ERRA 1U6BA 2QA4S 3L09A 2N3OA 2IC3B 3RB4A 5KFYA 1R8PA 1ULRA 3ZZTA 2MHEA 1JK9B 4KKOA 3HFKA 1HL6A 2VD3A 4Y2KA 2ZFHA 3ZC4A 4YHHF 1S0VA 2VG5B 2VKRA 4CH7A 4DF4A 1HNIA 2VBYA 3H20A 4CNYA 3RR7A 3BSAA 4ZPWR 1JLCB 3W3SA 3IRXA 1OSDA 3HHLC 4KB7A 4O4GA 2B6AA 4N5SA 5AE3A 1SH3A 2MZJA 4OMFG 2ZBCA 4LF6F 2RQCA 2CQGA 1YGYA 3AA8A 5MAOA 4QPXA 1LOUA 1OS5A 2NS1B 1NH8A 4OJ3A 3SXLA 3CSKA 4IH6A 2MSSA 4N8OA 4B02A 4OLPA 5HP1B 1LWCB 3IG1A 3C3LA 4BCAA 4B3TF 2DNKA 1UEUA 1BQXA 4B9SA 2MZQA 5A8KB 4N47A 4J9LA 2RU9A 2ZBIA 1HNVA 2R8KA 1I6JA 2HHHF 2DR5A 2QV6A 3OFHA 2VOOA 3MM9A 2CPZA 5D78A 2RRAA 4WYLA 4EZ6A 2UVWA 2IJFA 1Y3JA 4MIAA 2DH7A 2MZ1A 2H5EA 3GG1A 3OFGA 1S1TA 2HG4A 3OXLA 3KK3A 1JLEA 4RUCA 2IVFB 2UUBF 3HZEA 5FIIA 3B8HA 3VAKA 2CZ4A 2B4OA 2QT7A 2I5JA 2IHR1 3ISNC 4WZMA 3OUYA 5KG3A 1H7WA 3CCUS 3H5UA 3MUVP 2IYIA 3FEZA 4I56A 4OI1A 3NMRA 5FD1A 4LJMA 2UUAF 2ZOFA 5KFXA 3C46A 1S9EA 1LWEA 4RNNA 1FKOB 1TFWA 3SFGA 3NBPB 4H4OA 1HMVB 2GFFA 3MWBA 4C8ZA 4EGLA 2Q6BA 4QIEA 1Y5NB 2PFFB 3IBWA 3QGPA 4AE5A 4IFYA 3TA2A 4X4NA 4PXCA 4LF9F 4B3OA 1YG0A 3M4XA 3MR3A 2IMWP 1WEXA 5E3RA 1GX6A 5JXSA 2LQ5A 1RQ0A 3JSMA 5DGBA 4F8RA 1RT7A 4GMKA 1Q1KA 3AA9A 2ALZA 1VRTA 4HDHA 2R7WA 7FD1A 3TA1A 3SCKE 1U1OA 5F8MA 3KG0A 3U7JA 4PG6A 2XMWA 4FP9A 5IQ6A 3DU5A 4DQQA 2IC3A 3DFEA 3CEDA 2RJZA 1Q7LB 2ZC3A 3MMBB 2C3OA 1ZETA 1U1NA 2NR0A 1RGVA 1EP4B 2KXHA 2JC0A 2XSJB 4MJKA 1T95A 3MAQA 2VG5A 4HH0A 2WHOA 1NK7A 5D4PA 4DSJA 2VPWB 1FK9B 2GNKA 3MHYA 2V9KA 3RW7A 3CDBA 2HW3A 3MR2A 4BHQA 1JLCA 1UP1A 3TANA 1SL2A 5K8MA 2ZH1A 1KQGB 3GV8B 4P7VA 2QYCA 3KJVB 2DHAA 2ZE2B 1XK8A 4M63A 2KM8C 2R7UA 4UUXA 1KQFB 3J80Y 1FHTA 2VUGA 4RX6A 2FTRA 2RRNA 2KHCA 1DTTB 2FJEB 1S0MA 4FXWA 4FZVA 1JJ2R 1KR4A 5F41A 2DPIA 1K8AT 2Z4PA 3HZGA 3G8SA 2Y1IA 3H2LA 5HP1A 3TNVA 1LWCA 2YTCA 2FB0A 4QWCA 1CLFA 4DLEA 2AJ0A 2DR7A