4F27A

Crystal structures reveal the multi-ligand binding mechanism of the staphylococcus aureus clfb
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
331
structure length
331
Chain Sequence
DAKGTNVNDKVTASDFKLEKTAFDPNQSGNTFMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFGDINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYGGGSADGDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/blood clotting
molecule keywords Clumping factor B
publication title Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 90
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f27A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f27A02
4JDZB 2F6AA 3IS0X 4MBRA 4F20A 4F27A 4FJ6A 3IS1X 4LEEA 4JDZA 2RALA 4RMBA 3ASWA 2Z1PA 2Y7NA 4B60A 4LE8A 3AU0A 2F68X 4BBWA 4JE0A 2YLHA 1N67A 4F1ZA 2Y7OA 3IRZA 5IHWA 2Y7MA 2VR3A 5CF3A 4MBOA 3V10A 2Y7LA 1R17A 3AT0A 4LEBA 1R19A 4B5ZA 4Q6KA 3IRPX 5CFAA 4F24A
chains in the Genus database with same CATH superfamily
1AFVH 3O0RL 4DSYA 4YDNA 1UVQB 4PGEA 1IB5A 1XF4A 1QLRA 2C9UA 4G80A 3VXOA 3CHXA 2DM4A 2DYPB 4DVRH 4GXVL 3VRLE 3MX0A 4Y4FD 3DTXB 3CZKA 3H7LA 4IK6A 4MXWH 2WVUA 3QUZC 4ANUA 1II4E 5E6SB 5E2UL 3V0IA 1YZZA 4CSPA 3RWIB 2A6DA 2E59A 3FN0L 1ZHBA 4NC1C 1UB5A 1ZAGA 5HHVL 3VI3A 5B3JE 1CFSA 2IH9A 4JFEE 2TRYA 3BSZA 3NCWA 3NJVA 4B3EA 4LLMA 2LFEA 4PTUB 1SJEB 1X3DA 2ALAA 4RFOL 4XRCB 2R59A 2CGRL 4XR8C 3AACA 1GTNA 2HKFL 3OBAA 4JQVC 5IK3B 4ERSL 5D70H 1PY0A 3S88H 4M9PA 2BS71 4D9RD 1E9QA 2E46A 2ZKXA 5C0EA 1XFPA 4XMKL 1FPTL 1GOGA 5EO9A 5FDYA 1KENL 3SSGA 1KBBA 2VDMB 1GRWA 3BMVA 1MPAL 3EO1A 1H3PL 5LCVH 4ZX6A 3DX9A 2X89A 4NN5B 3GXPA 2H0EA 1P7QA 4AI7A 3V7AG 3WNNA 1XF2A 1A1MB 1AS8A 4XPTL 3U2IA 3EH2A 4WTZA 3OGOE 4H4NA 4HJJL 4O02B 3TM6A 2KZBA 1OGAA 4KI1A 1OVZA 4N0YL 4TNFA 3DPDA 4PRAA 4WENB 1T21B 5CKAA 4IBSA 1FH2A 3WJMA 1MNUL 4IU3B 2BFGA 3DWTA 4HWBA 4Q74A 4QTFA 3L6FB 4ZTOH 4BXVA 1MFCH 3K0WA 1BOGB 1FGVH 1OGSA 3IJHB 3C75A 3LNEA 3AC0A 3RYMA 4WNJA 3CXDL 2JWYA 3ZKQD 1X5JA 4Z78A 4EUPG 2XU9A 1T7WA 1AKJD 2N3JA 4Z8FL 3AY4C 2VW4A 3GMMB 3QJUB 5BUGA 5DWUH 1AZRA 1RL1A 3VCLA 2G60L 4Y19A 2B7DT 2EDKA 1SVZA 1FFTB 1TETL 3RGHA 1JZ6A 2XG4A 4YDLC 1LO4H 3WFZA 3QFJB 4ANKA 1UWGH 1HCVA 4GT0A 3HS0A 1A3ZA 1EJFA 4M5YH 3ME0B 3V55A 3QIUD 4R7NA 4CJ0A 3FOLA 1CDUA 2EQDA 2BSRB 3I2CH 3TIDB 2CKNA 2WQVA 4JRYE 2UV3A 4ANVA 1JHLH 2VJ8A 1KCVL 3GXUB 2DWYA 3JSSA 4MJIA 1WFUA 4NKMA 4ONHB 5T3ZD 3WU1A 4LHQB 2A1WL 4ZMWA 5I30L 2AQQA 2IQAB 3LPGA 4GQ9L 2B16A 3HI5L 5H35B 4DO5A 4ZK8A 4E9TA 2H9GB 2X9WA 3MJ7A 3JWOC 1B4JH 1GMIA 1UATA 2E47A 3PP4H 3TFKD 3RZCB 1WBXA 2NYZA 4IRZL 1I1FA 4KNTA 2G3XA 3L81A 4NJ9L 4R26H 1PU0A 1BBDH 1E5UI 2FATH 2XN2A 4YK4B 2DM2A 5D8JH 4A63A 2D4DA 2VDNH 2YPLB 3Q48A 4IDJL 2O5XL 3QPXL 3GLAA 5FLUA 5I1GL 3HS8A 3NIGB 4HCFA 4AIXA 3MV01 5DCCA 3WTUA 1UJ3A 2DL2A 5DQJB 1NQBA 2R9HD 3JV6B 2NNAB 2ZCHL 3T3MF 2QVKA 5IIEB 2N59A 4NZDA 1V3MA 1T7XA 2BSBA 4BD4A 2FWUA 5CGYD 1RZKC 3UZVA 1FH5L 4JZOA 3BRGC 2X0VA 3JVFC 3JTTA 1R47A 1EEZB 2P7TA 2YXVA 3U7YH 3ZLQC 2BRRH 3W2DH 4OZIA 3NA4A 4NS0A 2F68X 1F45A 3GIZL 1MWAH 1Q1JH 5I28A 4JM2F 1GMEA 2YXWA 3FFDB 4QOKE 1BGXH 4R90H 2G2RB 4U1GC 1TFPA 1HHKB 2ED8A 2Z8SA 4L9LA 2IH1A 1DLHA 2QMKA 4IBTA 4P46B 3QRFM 1L7TH 1SUJA 5C0AA 5AW6B 5ESAA 4V33A 4LIQL 5GGTL 4BK4A 2JFCA 3L5XL 5DO8A 3K1KC 3TBCA 4MMYB 4UIKL 1T89C 1LO2H 2ATKB 5F72S 5C07A 2X89D 2DYSB 1DJXA 2EIDA 3CFNA 4NZRH 1UHVA 1IGJB 3X3FH 5BV7B 2V17L 4NM4H 5C0BA 1P7QD 3CFJB 1MIML 2EC8A 4PY8I 2EIZA 5E08L 2XN9E 25C8L 3HPLA 1ZHKA 4DN3L 3DIFB 1XBRA 3P9WB 4L05A 1ODAA 1OGAD 1HIML 1NUNB 1FIGL 2FJFB 2VL4A 4HFUH 4HETA 3Q43A 1KB5A 4TN9A 4G1EA 5B39G 5CIPA 5DJAB 5C09E 1P1ZA 2EJ1A 5EZIL 4JX0A 1EUUA 1WZAA 2ZOLA 4Y4HA 5ICXA 3R18A 5I74C 5J56B 5FYKL 4CVWA 3T2LA 3W9DA 2RQ8A 1V3JA 1WAAA 1QFWI 5DYFA 4OLYH 1ZS2A 3B9EA 4PHXA 3SPVA 2WB7A 3VGBA 1V7ML 1ZY9A 1U8OB 4PVLA 2J5LC 4GUPA 1L9PA 4QUOA 2V3DA 3WAKA 2QZQA 4PYGA 5TE6L 3NN8A 4IBLT 4Y19D 1GC1L 1X5LA 2Z34A 3EYSH 4HH9B 1PZ3A 4M8QA 2J1WA 2GG1A 4HDIB 5DRNA 3X13A 1BM7A 4HWEH 1L0PA 3A6BH 3HMXH 1LYQA 4MNQB 3IDXL 1TNNA 2IO5A 3PHQA 1CQKA 1Y0LA 2W80C 1IQWH 3MC0A 5BMFL 4WK0B 4OUUA 2BERA 3CXHK 4ZS7L 3SDXB 1I8KB 1YJDC 4MJID 2XXFA 4G7SB 2CIKB 2QGCA 3TO4A 2VXVH 4MQSB 4JB9H 1FI8C 2XIDA 4TQIA 1EHNA 3VA2C 4JJOA 1IIIA 4AMWA 3LRSB 2D7TL 4UTBA 4JFVA 3MCG1 1E6JH 2A4EA 4LNRA 3C8KA 5DJXA 4BCYA 4JN1L 3D25B 3MV8E 4Y5VB 1EXUB 2PWGA 2DLFH 2RB8A 4RISH 3MLRH 3VXPB 4XOAA 5DK3A 3SYQA 1XXFC 1RUPH 2FAUA 3H1ZA 5KYXA 4AEHL 2ICWA 4K8RL 3DK0A 5I6XC 1N68A 1R3JA 2IPTH 3Q8CA 4ONGH 4P2YA 4RWYL 5KS9A 1KTDB 1CT8A 1ULVA 4EI5A 2CXGA 4OGQC 2HZHA 1JJUA 4W9IC 1TVHA 1FVEB 3ARGA 5CKGA 1WAPA 4PB0H 2UX6A 4JFQB 1HH9A 2JE8A 5JPMC 3LEYH 4HJTA 3DHUA 2MOGA 2X6VA 4F15C 1IT9L 1K4CB 3CZFA 2XTJE 1ZJBA 4YSPA 4P57B 1NL0L 2OLDA 1SJHA 3MRGB 3F58H 4W4NA 2PW2B 3WJLA 5CUSL 1ZVSB 3VWKC 3RILA 5DZ9A 4DPBX 3V4VA 4NYLB 3KPPA 5D4JA 4QRAA 4JLRB 1KXQA 4A7GF 3PIQA 4G5ZL 1NIAA 4TL5A 5C0AD 1PFCA 3CH8A 2XWXA 4K71B 2BMKA 5F0PB 5F7DA 1F11A 1QPKA 3BUPA 3P77A 2CJUL 5C07D 2VDOB 3RX8A 4UOW0 4WNQB 1NCIA 3L3OC 5C0BD 3S34L 2OTUB 3IB4A 5B21A 2OAAA 4C56A 1X5XA 2NY3B 1TZHA 3CVHB 5FF6B 1I3VA 4K3JL 5HP5A 4BEIA 1L0YA 4X4YA 2J55A 2ARJQ 5IJBC 3I84A 4N2FA 4B41A 4ONFL 4YDKH 4Z7WE 3QXDB 2IQ9H 2XZAL 1MI5A 4AH2A 1FDLH 5CZXC 5DGQA 4LU5H 2J1ZA 4Y4HD 4H20L 1VESA 4XNMB 5TF0A 4LLDA 1HNFA 3MNVA 4F57L 5F3BA 1ZD6A 3RFZA 1EDQA 4UT7L 5DQDL 4JDEB 4Y7OC 4YPGA 5D2NE 2AEWA 4EUPA 2NNRA 1TZGH 3TJEL 5DVMA 5INCA 1H3VA 3F05A 2G4GA 5L7XL 43C9B 4PJXF 4JPSA 3FB5A 1RZKL 5ADOL 3TO2A 4XPAH 4AQAB 3MV7B 5B4MD 1G6RH 1I3GL 1S9WA 1SN0A 1CFQA 3MCLH 4NN5C 2Z64C 4PMEA 3V0HA 4OM1H 3B2XA 3RWDA 1PEZA 3O6KL 5IV2B 2WXRA 2Q8AL 2J6EH 2YMXL 1SOSA 4FXKA 4FFYL 4OLWL 3ARFB 2YRPA 3TO4D 2VR9A 3S96B 3DV6B 1CLZH 2UZPA 3IKCA 5JHDE 5CFHA 5DRXA 4N6RB 1PZAA 5KUMA 5IT2L 3NZHH 1LM8V 2QZ5A 4XCEA 1SZNA 4PH8A 4QXUH 4MA8H 3MREB 1WBYA 1A3RL 2H26A 5DR5H 1IIKA 3ZQWA 5FGBA 5EO1B 3D05A 1I85A 2C3GA 4I0PA 2CWRA 1S7WA 2K7QA 1QFUL 2HJFA 3N1MC 4H8HA 5CN2A 4BHUI 3OKEB 3VI4B 2NY6D 3MJ9H 3UBFA 1I7UB 1BVKB 4HXAH 4ZTPL 3EJYC 3NFPB 5LNGA 5EBLB 1SQ2N 5CD5C 2VLJE 4A2MA 5DRWA 3GXTA 2CK2A 4Y2OA 4EI5D 5LGHH 4PLNC 1UGNA 1DQDH 2QTVA 3ARGD 2YD0A 4F7CA 4TV3A 1AQ8A 2YBRA 2VDRB 2ZXGA 3MODH 4FFTA 4JPKH 1F41A 4KAQH 3HAEH 1UQSA 4GAJL 1BAFL 3R8QA 5B8CA 4G8FB 3NBNA 4AENA 3C5SA 5D93B 1NM4A 2VRAA 5I15L 2B5IB 2OJ1A 2OYLA 4GQZA 3HTLX 3RY6C 5E4OA 3WLBA 4G8EA 4OCYL 3MN8A 4MNGE 3T0VA 2EEXA 3ARDA 3HZMA 1U6AL 1IKFH 4RETB 2A6KA 3Q9QA 3ULUL 2YD1A 2ID5A 4PRBA 3BIAX 3VJ6A 4HHAB 5I1LA 2GTZB 1E43A 3I6KB 3HZYB 3TNNB 1BEXA 2D4FA 3H9SE 3S9DB 1KPVB 2E9BA 5CD3A 3DGDA 5FB8B 5KG9A 3EH1A 3P3RA 1EJOH 3PAYA 3CGTA 1KN2H 5IB1A 4UF7C 2XX0A 4XCNA 5BVPH 4JAMB 3FHEA 3MI6A 4BFNA 1L9OA 1SXNA 4Q0XH 2VDPB 3F7PC 1IEBB 5FUCE 4AQEB 4AW7A 3WTWA 4QCIA 5CJXA 1AR2A 1NCAL 2J57A 3H6JA 3S4SA 1DVFC 4UQCA 4ZNEE 4AGNA 1RU9H 1NCCH 1MI5D 3B3BA 5T1DL 5B39A 4X4ZA 4X5WB 4PW9A 2OSLA 4DTGL 2NTSP 5T3ZH 2XFXA 4XBGB 2BHYA 5DFTA 5I0XA 5JR1H 4IS6A 3DVGB 4DAGH 2QPFA 2YEVB 1N0LB 4GLRI 3WJJC 2A4ZA 3WY4A 1HXMA 3CQQA 4HXBL 1E67A 3DOSA 5DD3H 2EECA 3GZOA 1CLVA 1OT1A 4XXDB 3SYCA 3SZ6A 3WXWL 1RZJH 1FHGA 5B3SB 4RMSA 1A14L 3DMMB 5IHUH 1NOFA 3VD5A 1N3NA 4QAMB 4G7YL 5FUZL 3ZE1E 2EDNA 3GRWH 3K2IA 3R0MA 1Z32X 3THML 1MCJA 2PWHA 5CEZL 3PAZA 5BV7C 3UBHA 5DJCB 4L8CB 5T5FA 4NI3A 4K9EC 2NUPB 3L45A 1OP3K 4OKDA 3FCTA 1KBWA 3ZTNL 5MHSD 3PU7A 3DIDA 1J0YA 3BKCL 3X3GL 1YECH 5F8QC 1J1PH 3MLSL 1PG7L 2EXWC 1SJXA 3B2PA 3G08A 2W95A 4PBVC 4R6UA 5TDPA 5D5ME 3TZVA 5DMJB 4F7MA 3T65A 3VGFA 2JK5B 1JI2A 3DSFL 2WTPA 4AXWA 2Y3AA 2ESVB 3SY0A 1NFIB 1MFAH 2JKWA 2AFNA 3BSZH 3ISYA 1OLLA 2E4TA 4FYRA 4IKJA 2AXFA 4JFZL 4IKLA 3T6ZA 1OK0A 3VFWB 2MCPL 3V6FA 4KO9A 4OT1H 4AM0A 4I0PD 3P4NB 5B1CA 1OQXA 2FHCA 2HVBA 4IMLA 3ZYIA 3EADA 3M8OL 3QWOA 4GP8B 1AQKL 1L5GB 3GJFA 1MREH 1R5WA 2NMSA 3GS4A 4XN1A 4CW1B 4V11A 5C6WH 5HGBA 4P06A 1RJYB 3IGAB 3VVWA 2IVFC 1RHHA 3ILEA 4PJIE 2HX7A 2MFNA 2OZ4L 3MRRA 4NXKA 2W9DL 3D50A 1RKRA 1TCRB 3HZVA 2VDML 1Q72L 4G6KL 5LGJB 4WKXA 2EVIA 1S3KL 3CSGA 5IUCA 4HIIA 1RURH 2AEOA 1SYSB 2WBXA 3NACL 3FC8A 1A1OB 5I18H 1GAFL 3ARDD 2DJ4A 4KY1L 4HWBH 4AZUA 4Y5VC 3S2CA 1M7DA 3DJSA 1SN2A 2ZJSL 2EUZA 3CDYA 5CCHE 5IB5A 4CMMA 1CF8H 4I9XA 4MAZA 3T3PB 4D9RE 3CK0H 4L4TE 4NNPL 2TAAA 1XCQB 2VMCA 3FHQA 1JK8A 4OQTA 1OE3A 1Z1WA 2B39A 4W93A 4ATWA 2VJXA 3A22A 5C0DB 5TD4A 1KG0B 1GIGH 4OD1H 2QJDA 1GGCL 3UJTL 3QUXA 4YPJA 1KB9J 4ABWA 6FABH 1A6TB 4EKXA 5I8OH 2SEBA 4LKXB 3WNOA 1HAWA 5IMMA 5LNDA 1BEYH 1WE5A 5LDSA 3CFTA 5I16B 2AZAA 1QZ1A 5BVJA 3I9AA 4WTQA 4B53A 4QXTA 4ZUTB 4PJCE 4F7KA 1MCSA 5AAPA 3UTTB 3MLYL 4PJ5B 4PLKD 3TYFB 3ZK0A 1IKNA 1RZQA 2BC4B 2WXJA 4Y9FA 3TH4T 3LKRA 1J8SA 1N5YL 3BT0A 4K71C 1URZA 4JFYB 4LSRH 2QHRH 3HG1B 4RIRB 2F9BT 3CMOL 3CQFA 2QQLL 3MUY1 1CLOL 3OZKA 4WHYG 5I5JA 3SQRA 2OMWB 3TJHC 3BSHA 1AR1B 4P4RA 3O2VH 5DSCB 1NBVL 2FX7H 1CURA 2CHNA 2WVSA 5DZAA 3HC4L 3LNIA 1KXTB 2BCKB 3P4MA 3SD2A 2PO6B 5CILH 3DX7A 4D9QE 3TZVD 2FL5A 3F12B 3WS6C 2RFXB 3CVIH 4KUCF 5SX5K 2HFEB 2XVBA 3BH9A 3CD4A 1D5MB 2XLLA 4IRJB 5T3ZE 5DLML 5JOFA 4DP8X 1D5BA 4LMQI 1VJSA 1TEFA 2UYLA 3RDJA 1OF0A 1A4KB 4LSQL 3DUUB 2N7SA 3BZEA 3RVVC 1U8HA 4L8SA 1T80A 3VD1A 3B7YA 5LLIC 2WINA 5MP6H 3RAJL 3VSTA 4N0CD 1BZEA 4BGDA 1N5AB 4LO9A 4Z7UF 5CBAA 1HCYA 1B2YA 1NTDA 4OZGF 1EZUA 4UM8A 2PTTA 1KLFB 3MKKA 2VXQH 4L0YA 2P44B 3QG6A 3NK4A 4HK0B 4IIQB 4K3EH 5K9KA 4FL4C 4QRRE 1YEGH 4PRIE 5L8JB 2K6ZA 4BFGA 4HPOH 1JYWA 3FQUA 5ENWA 3ZT5A 1VCBC 1LDPL 5HYJB 4K94L 4OCMC 3FO9B 3P3TA 4MCYA 3ESPA 1FZJB 1KB5H 2VAAB 4K9EL 1XSJA 5CIPH 4CNIB 4J23A 2WGXA 5K9OB 2PP8A 1TO5A 4ZZFA 4FQJL 3VRIB 3F04A 3N85H 1CXLA 1WS7A 1Y7VA 2A99A 2KT6A 1YNLL 2XQYK 3O11A 3QRLA 4KKLC 4U6VL 1JZ2A 4L1BA 4KDWA 2K45A 2DWDB 4JDTL 4ILDA 3UTOA 1T0PB 2GCYA 3SOBL 2VL5A 1BQUA 2Q3AA 2E74C 5BPPA 2H8PB 4YHPB 1SLXA 2QT6A 1ZLSL 4TLSA 1EJ8A 4F8LA 5HVFB 2X2YA 1X9UA 1FNSH 5IVXA 1MCPH 3FO1A 3KYKH 3MO1B 1QRNE 1M7UA 3ETBJ 4HS8L 4GSDL 3WV0A 5J7CC 2XETA 2ZOKB 1I8UA 4XB8A 1ACYL 5HHXL 3QUXD 5AVVB 5IEKA 4BCZA 1GHFH 2AXGA 4HC1A 4NQSB 5D93C 2WIIA 3MTXA 3PL6C 4I3SL 5EC1B 4XNXH 2YPKB 2Z1KA 1M7XA 3GI9H 1IGFL 3VA6A 3ZDYB 4JFXB 4Y2DB 4N6QA 3EOTH 3V0GA 5F0MB 1NGZB 1WFMA 5GGRA 4QHMA 3P0VH 4PS7A 2MHAA 4AE0A 4FFYA 1BZOA 1SLUA 4X5RA 5DHVB 1RIUH 3RJDA 3SKNA 1OAUL 3HHSA 4Z7VA 3I50H 1P84J 1YPZE 2EIEA 2NY5L 1BFOA 3AXIA 2F19H 4MCZA 2R56H 1F4XL 2P24A 2ED7A 2O93L 3I75B 1PX4A 1TO4A 2QFPA 4XGZA 2WLIA 3ELQA 3SDYH 5I1KH 5L88H 3WELA 3ZZSA 2AJVH 2XPZA 2C4XA 3LRLA 3MUJA 1VHPA 5INDA 3AU0A 4KRLB 1AZCA 3LXAA 4HQQH 2FLRT 3ZZ1A 5E6YA 3UTQB 4XMLH 5E9NA 1G9MC 4HKXA 1F2QA 3QFDA 5CNHA 3H42L 2DV6A 1ROCA 4FLQA 3T3MB 2OPCA 1AD0A 4B0MB 4UM9B 5LXGH 3DX4A 3VGGA 1G7QA 4X6BA 2DYRB 4BH8A 4KTDL 2E8ZA 5CJ5A 5IQNA 3IU3B 3MRFB 1SM3L 3G9AB 3DMMC 2ITCA 3LKQB 4UYQA 1P6AB 3VH8B 2Z0BA 2NLJB 2VWEC 3X11A 4R3SB 2OMXB 4RSVA 3TTYA 1U4EA 3P73B 3H55A 3SGJC 3QUYB 5DEGA 3AQXA 4FXGB 3FQ1A 3GO1H 4G7RB 3VGEA 3LNGA 7CGTA 1ZK9A 3I3BA 5D1XB 3GYRA 4L2LA 3OQRA 1IUZA 3U79A 1CICA 3F7LA 3QNFA 1NJ9A 3WMSA 2GJ6E 1NGXB 3V52H 4YZFF 1R3IL 4GT7A 5JW4R 5CHNA 1OE1A 5F9DC 4R0LC 2XV3A 1B0GB 2VDOL 3DYPA 4B27A 4F80A 3APNA 3FQRA 2KERA 5GGVH 2Q7YA 3CVHL 2AERT 1WFNA 2YKKA 3MLUL 1HINL 1NCDL 5AYUL 3ZDZF 2P3YA 3TPUB 3VXMA 2Z7YA 4M8UA 2DAVA 3M17A 3NCJH 4JUSA 4EUPH 1EFQA 3RA7H 4FOMA 1HU8A 3FMGH 1RK7A 1MCIA 1HJCA 4N2OA 1EHLL 3OHMB 3UC0H 4L29A 5KVGL 5C0AE 4WUUA 3L2LA 1N4XH 2YKLH 1QW8A 3VFUB 1GGBL 1S9XB 5I8EA 1SRDA 5C07E 1EO5A 2D2OA 5C0BE 2Y36H 3ZN6A 1A7QH 3WY3A 3JT0A 2GEQA 1TQUA 3VFTB 1RZIA 1J0JA 4Q9QH 3LKOB 3FL7A 3EXLA 2YSSB 5GSRA 4ORGA 3P3YA 4A6YH 3FONA 1OARL 3QZWG 4EZKA 2VN4A 4NXSA 4L23A 3DVNA 1T5WA 2F53E 1KC5H 5DRZB 5FO8B 1KTLA 3AZUA 1WAAE 5A1AA 1XSOA 3BESR 3LHAA 5LXVA 5E1AA 3VX0A 1FE8H 2X10A 3U2SA 5JZ7D 4JR9L 4U1LA 4MAYB 2ICWJ 2OCFD 1VADB 5JIIA 4Z7UE 5CCKH 3LZFH 5E5MB 5FLVA 2NY1B 3FPXA 4OZGE 4PJFF 3OLIA 4BQ6A 2PCPB 3WEBA 5CZVL 1JGVL 3IDYB 5GHWL 4AYBA 3DJZA 2W9LA 4JHVA 3NAAH 4G6JL 2APTA 4L1TA 3FTZA 3D87B 5GJTL 5JW5B 4M7JH 1IM3A 1EERB 4C4KT 3MXWL 4PYHA 5D2LA 2NDFA 4FFWD 4H7VA 3IK2A 2LU5A 1G9NH 5DD5L 4YDZA 4Z5RB 1RUQH 2Y7NA 2BCMA 3HB3D 3JBG7 4LSSH 4XC1H 3ZE2B 1UZ8A 3BN9C 2VDRL 2O5NA 4ODHH 2VR7A 3HFMH 4RSYA 4N22A 1OZTG 1UM6L 3DO3A 2EE2A 3A6CL 2O6FA 1YYMH 2XRAL 3NVQA 2B1AH 2DOCA 4FD0A 5GRYA 2X4NB 1JNJA 1LEGB 2B20A 3OGCB 4HK3N 5SWZA 4GEJA 4CAGA 3IDMB 4NX0A 4RQQA 3L4CA 4CN1A 1IGCH 3Q3GA 4R8WL 3ZQXA 1AR1C 4G71B 1A9BA 4LEEA 4ZPVB 2AC0A 3FRPG 1PJ9A 3NP4A 1CICD 1ZDSA 5JDSA 5KSUB 1J7VR 5T1KB 2CK0L 4XPGH 1H6TA 3F7YB 4PV8B 2H6UA 3FQTB 3QUGA 2MSPA 4J2XA 2HG5A 1HOCA 3LDBB 3RIAF 1QEWA 4PJBF 3E6FA 5IKCA 4QPEA 4AUUA 5I1IH 2ADJA 2K9UA 2UXTA 4NM8H 4R97C 1KB3A 3FO0H 3H4HA 5F9WB 5IW1A 2PETA 3MBEB 5DO2D 4NNYA 1WZLA 1UH2A 3T08A 3IDGA 1E4XI 4G3YL 2ZWZA 2VDPL 1DUZB 1I8IB 3CDFA 1CTNA 4KTEL 3M88A 4M4RA 3VXMD 4EDXB 2O1AA 1RIHL 1OTSC 2IADA 3MRHA 4OLZL 4UQ2B 4X98B 3BC9A 1S7QA 3PWLB 5L0QB 4ZMYA 3WEXB 1NBYA 4Z7AA 5BJTB 1KXQE 1TNMA 2X41A 2VZSA 3FW6A 4QGTA 4ZXBC 4H40A 3TVMA 1IFRA 4WUUD 4OZHB 2IBGA 3P0YL 1BD2A 4FFVC 5HI3D 5I6NA 4IIQC 4HLZH 5T5FH 3DKHA 4LVNC 3FRUA 2FQEA 4IJ3B 4C56E 1KGYE 5F96L 4U1JB 3SYOA 5CINL 2ENYA 1F3JA 5C08A 2DIAA 3WXVH 1I4FB 2X6BA 3KAAA 2OYKA 3MR9B 1HE8A 1NANH 2VH5L 5FDWA 2JVUA 1QLEH 2LLNA 5A6MA 2UZXA 5I6MA 4TUJA 2O5YH 5C0IA 3RG1C 4UOQA 1DQLL 1MI5E 2C3HA 3BQUA 4H8WH 3ILQD 4ZQKB 4XMVA 3CDZB 1QA9B 1QBLH 5DJ6A 1FL5A 3UFIA 4DP6X 3VGHA 1R46A 2RIKA 4U1IB 1ESOA 1OF2A 4KU1A 3B34A 3DPBB 2BP0B 4PR5A 4WAFA 5E2VL 2DJUA 4IU2B 4YIQB 2FIKA 3IDUA 2Q76B 3B9AA 1K3ZA 5F9OL 3W0WA 3DO7A 1CI3M 1FC1A 2AEPL 3GJFH 3VFVA 2AJSL 1ET5A 1F58H 3O4LE 1B4LA 4OVVA 1KJ3H 2UWEA 3ORJA 1IM3D 3GIVA 4BH7B 5AWNH 4LHUG 3E1ZA 3X12B 3DXAE 4ZMVA 3A3YB 3UTZB 4KK5C 4A1RA 1CIUA 2TSBA 1L3NA 3BX7C 3B1UA 5AYQA 1S4IA 1FNEB 1G5GA 5LQBL 5D1ZI 1I1CA 4BWWA 5D72L 3FN9A 3FT1A 4Y2DC 5TQ0L 3O6FA 4OJYA 1A5FL 4QRFA 1BZ8A 5J9PB 3Q1SH 2DEYX 3L5JA 2CRIA 1XWVA 2UY6A 4H2AA 4F7PB 2CDFA 1D5XB 2P45B 3U4AA 1NAKL 3O0LA 3ASWA 5SWZD 3HJ0A 4YMPA 5B1AB 4BE6A 4CMHB 5A3IC 2R1WA 3FZUD 3LZLA 6PAZA 4WY7H 1Q0YL 3K74B 2Z91B 2XICA 4MWFB 3WNKA 4OQTH 2GTWB 1XGPA 1FG9C 3EZJB 2CJ3A 4JRXD 1OAQH 1RK1B 3SJVA 4KDVA 2Q87A 4YBQD 4NJAL 2X12A 3V0WL 3IFPB 2P4AB 5DQ9A 3PWPB 4M7ZC 3H3BC 4NCDA 3GSVA 4ANXA 3I9GH 1YCSA 1MHEB 3HNSH 5DK0B 5HI4D 4BFBD 1DQIA 4XC3H 5DHDA 2EYTB 5AAMC 3W3BA 4M02A 3RIAK 5KBMA 1A9EA 3IGLA 4BK8A 5KVEE 2ZOTA 1DDTA 5J11B 4HUUA 3BAKA 3RGVB 3PV6B 4J6RL 1NMBL 3KPRE 4TL4A 4GFXA 4OLVL 1HL8A 4JM2C 4ZS6C 5ETUB 1NEUA 3N9GL 4FF9A 3QUYC 4OZ4A 1AIFB 4UOW1 4FXGC 4OI9A 4XX1G 3HR5B 3TVMD 3UDWA 2YO3A 1KIQB 1WYJA 3L9BA 4P0DA 4ADGA 2WUCH 4IMKA 1BD2D 4Q4EA 2X0WA 3GMLA 2Y07L 3P4OB 4FLRA 3HI6L 5HHPA 4L8BA 1IAIH 5CLTA 3WFEH 4J4PA 3QJTB 1SN5A 4UV7H 2FWOA 3VFGL 5SX4I 3QAZB 2UZYA 3BW9A 3GSUB 4LSTH 3DVFA 5C08D 2H0JA 3UGUA 4ACTA 2E7BA 5GGSA 3C5JA 1F00I 4QF1A 4JDVA 2B77A 4GKLA 2IBZY 2JJVA 3TWCH 4EN3A 3QZWA 1SYVA 3IYLW 4X9YA 3TCXA 3NFSL 1G87A 2DQTL 1ZJAA 2HTKC 2ZSWA 3BQUD 3W9EA 4HOZA 3N0AA 4M3HA 1E0OB 1F4YL 4RBPK 1XVSA 5DDHB 3V9EA 3FSWA 1XGQA 2WKLA 2AABL 1A4AA 4UWQB 1HKLL 1OAXH 2Y3NA 4YSCA 5E5RB 4GKZB 2I85A 4D0CB 1QFWL 2Z92A 1TJIL 3AU1B 4IHOB 5AKRA 3UX9B 3W0WD 2J6WA 2H1PH 2BIOA 2VQ1A 1FORL 5GGVY 3D8MA 3OB0H 1CGTA 3SE8H 1S5IL 3PAUA 5IFJB 4JO1H 4LHJB 3VE0A 1J5OH 3BKJL 1D5ZA 1KFGA 3GDBA 3VNZA 1A66A 3FUDA 1ZTMA 3NABL 1BHGA 1U8MB 3KS0H 1A3LH 1PW3A 5J5EA 3J8F7 3ATBA 4PJBE 2DMBA 4X6DB 3CBRA 5TE4L 2MTPA 1HTYA 5CO1A 2VR6A 4MB3A 4PD4K 3RUGB 1IC7H 1PFOA 2V7NB 5ADPH 4G2AA 5BW7A 3GEFA 2V37A 3GTTA 3O6FD 3FUKA 4MJ4A 4FABH 4R96A 2WQ8A 3OKMA 4ZFFB 2DQFB 4F92B 2AJXL 4HIXL 2VQTA 5KSBE 3WBDA 2J8UB 5HGHA 3DX6B 2NW3B 3H3PH 4KBPA 2XWTA 2CNYA 1YNKL 1JHTA 3B37A 4YDIH 2XNAA 2YMTA 4PM1A 4Z3TA 4KXAA 3RX9A 3MBWB 2NY1C 1C1EL 4RZCB 1OLZA 4MMXC 3FRPA 4AX3A 3KWWB 1ZVYA 1N2RA 3SJVD 4TULL 5C3TA 4JCWA 3D85B 4FNLL 3V5DA 3RL1B 2Z93A 4JVPA 4G5AA 4KKAD 3T2OA 4PCKA 3G6AB 3I02A 1I8MA 1MCKA 4HC1H 3GUFA 4L9DA 1O7DE 3TT3L 3D06A 4G6AC 1QNIA 3Q06A 2QGBA 4J3WA 4DGVH 1TZIA 2FEDD 4FNRA 1PZ2A 1DDHB 2GAZB 4LCWB 1R9FA 2DF3A 1BA9A 2R8SH 1QX1A 1J8RA 3NP3A 3NSFA 4LCCA 3L3IB 2WW8A 4JY5L 2IG2L 1I9RL 4PJ8C 4K7FA 3GSNB 3MRJA 3QNYA 3D39A 2BVPA 3CBKB 2F7IA 1FQ9C 4E42A 3ZIMA 5DC9B 3V6OE 3CWGA 3ZE0B 3EO9H 4Y5XA 4X8CA 3RRQA 1NCHA 1NLDL 4CBZA 3TN0A 3BH4A 4LCYA 5EORH 1M71B 5GISL 4J4PD 3ECBB 2P43B 1MFUA 3BYTA 3IFLH 3E6HB 3LJ3A 2QHLA 3JYCA 3OX8B 4Y1AE 2WSKA 3FB8B 5F9WC 2J44A 1H3UA 1Q0EA 4JFPA 3D09A 2V4LA 5IB2A 4PIBA 1X4ZA 3GM0A 4E0RB 2ZF8A 3OJ2C 2A77L 1JGEA 3GBEA 1Q90A 5F6HJ 4HJ1A 3CFIC 3UACA 1M42A 2A6JB 5EPMB 3IDNA 4LOEA 2CIIA 5DTFB 1RULL 3LB6C 3U1PA 4HULB 2DLGA 2F58L 4FEIA 4ODSH 4XWGH 4OCXH 4I9WE 4FQIH 2W9EH 4AL8C 5E6IA 1TKWA 5IBUG 4LVEA 3WTSA 3VB9A 5FECA 3FQXA 3HNTL 3DX2A 4X9FA 2PWEA 5E4IA 1GY2A 1QATA 3L7EA 4HFWB 3VVVA 4F7TA 4E41A 2WBJB 4I5BB 4IJ3C 1YY9C 4LHUA 5DJ0A 1VGKA 3SDDB 1FO0B 2CDEB 3QISA 4LLQA 1Q9WB 4JQXA 4FQPA 2VLRA 5E1HB 2B0SL 1FVCB 1XH3A 3IDIA 3TIEB 3P4LA 2BOCA 4TF4A 4M43L 3HKZA 2EXSA 4J12A 1CVRA 2BZCA 3OKDB 4GFTB 4TSAH 3PABB 1XL4A 3PV7A 4DP7X 3LKPA 4Q4IA 1U8LB 2HLEB 3L08A 4PJHF 3T2PA 4DZ8B 2R4SH 4I2XE 5FAAA 3BSGA 4R83A 4RVBA 3AG3B 1T03L 3BUBA 1FGNL 2FGWL 3LIZL 2AJZA 2OJZL 1RAMA 2JQAA 3QP3A 3T2NL 1GJWA 4QXGH 3CQPA 1K6QH 3QPKA 4XBEH 4M1DH 5D1QC 5MENB 2GEEA 4TRPL 3HG3A 3US9A 4YHML 1QTPA 1M56B 1SHSA 2P5PA 1TTAA 3SCMC 2BSTB 4J8RA 3PGDA 3AADB 1I1AC 1KLGB 5DZJA 5FGSA 3MHZA 4ZYKA 2CLVA 1E4KC 2IH3B 3GT6A 3EBHA 1A65A 4ODVH 4UILL 3B9KB 3QXTA 2VMJA 2YK1L 4TSBH 3RX5A 3MDJA 2IPKB 1FNGB 1G7HA 1JXDA 5BRPA 4I48A 1MJUH 1UXLA 3D39D 2F1AA 2XBDA 1IILE 1G5AA 4JRFA 2Q86A 4CMHC 3NSCA 5I1CH 4WDIA 2WHVA 1AHWC 4N3UA 1R3LA 1KY6A 2EDDA 2APSA 8CGTA 3TN0D 5L2KB 5E8EA 4ZUWB 4J39A 4NQUA 5HY9A 3QO1A 1S7VB 2VDKB 4FNSA 5IVXE 1HJBC 3LEVH 1J12A 1LQBC 4QRPA 3RURA 2R23B 4ZFQA 3RZWA 1ZOXA 3EJSA 2OBGA 4XMPL 2JI1A 2VXTL 2QPUA 2IFFL 3EOBB 4M29A 4PJGA 3TLRA 5AB2A 1KDIA 5J12B 3S37X 1BV8A 2ZWLT 3ZRSA 2D3JA 4QTHA 5JIMA 3ETSA 3JYBA 1WD9A 3N42B 3Q0HA 1Z0NA 3MNDA 2LABA 4JUTA 4XCFH 4FNUA 3OTTA 4J1UB 1RMFL 4B6ZA 1B6DA 5KBLA 2HFFB 5A2BA 2RTTA 5J11C 3U36B 4IW4C 3KPNB 5AW0B 5EEXA 3SHSA 1R3KA 3C6LB 1WUZA 2RCSH 1MCOH 1VFAA 4Q8BA 3GSRB 1V10A 3IFNH 3UJIL 4I4WB 5TF1H 5E6ID 4Z7IA 3ILPB 2V3FA 3U9PH 2NY2C 4AE1A 3RKDD 1O6SB 3ES6A 1Z9SA 4E41D 4JE4B 3APFA 4JVUA 4LHUD 4E9XA 3QAZC 2XG5B 1CO1A 2GHZA 2O26U 4N87A 1C5DB 1V55B 2VLRD 3TCLA 1NFDF 3JVGA 4KJQD 4JJ5B 4YXKH 4ODUA 4CL7A 1YEJL 1R24A 3WHE0 1FF5A 3OJDA 1KSRA 5JXAH 3GSOB 2XDHA 1MCHA 3FS9A 1R5IA 2WNWA 4HUXA 2YN5A 5H2BB 3Q6GH 4UV4H 1YUHB 3HUJB 3GSQA 4HZ1A 3FT0A 1ZA6B 3S35H 2HRPH 2JELH 4A2EA 1TJHL 4UT6L 1NDGB 3KR3L 4PBDA 1CFTA 2IGFL 3ZL2A 5DUMH 3DETD 2GJJA 4JG9A 2ENPA 3SYAA 2H2PC 3LRHA 3C08H 2ZX9A 4FP8H 4Q2ZA 1IRAY 4HWNA 4H25A 4QYOA 1QBML 2IPUG 5IB4A 4M1CD 2GKIA 3WD5L 4PVMA 2DWEA 5C0GA 1CFVL 1J11A 4I1NB 1ZV2A 1NPJA 1FLRH 5MEOA 2ZKHL 1XCWA 3IRZA 1B3JA 4DIXA 2YFNA 4PJ9B 4U7SA 5F9AC 3V5HA 4OKVA 2HT2C 1Q0XH 4DVBB 3VXSB 2Z4QB 2D31A 3IGUA 3CHPA 2C9XA 4YAQB 5C0CE 4DP0X 5JPNB 3GC3A 5LN8A 1MHHB 4HJGB 4NBYB 4BM7A 1S5HB 3HC0A 1KBGL 2EDXA 3AS3A 3QORC 5HJ3B 1INEH 5GS0C 4P3CH 2E27H 3W81A 3QQNA 3FQYA 3CFDB 3OAYH 2I69A 4FKKA 3IJ7A 3KPQB 4PRDB 4HOXA 2OL3A 4LEXL 3HRZC 3V9CA 3D51A 4YO0B 5D7IA 1P5UC 4QRPD 4G6FB 2GBAA 2ZCLH 1L9QA 5CU5A 5K39B 3O9WA 1PLCA 1JVLA 1EVUA 1D2PA 3RWGB 1KFAL 2PR4L 2P52A 3QWRA 1UKTA 4H1LG 2XYBA 4R7LA 4AZ8A 1RJZA 1NBQA 2XV2A 4LQ1A 2LW3A 3VWJA 4LP8A 5JTWA 1JXKA 3I6GA 4UOZA 15C8H 1GKOA 3WN5B 3QQ9D 1HXYB 1G7JB 2A9DA 4HBQA 3LZNA 5F1IB 4KKZA 2AXWA 1LE5A 1AE6H 1TPXB 4JFDA 4C47A 5ITFA 4KVCH 2ICEB 2AXJA 4NDMA 4V1DB 4ELMA 3QZBA 1IBDA 2EIJB 4L48A 4NHCL 1PZBA 4PJHE 4I18A 2G5BA 4M6MH 3HHRB 1QW9A 3O41A 3TBWB 1WEJH 1SJMA 5J6GA 2WLMA 1X7SA 1KN4H 1LNUA 2J8OA 4TYUA 1BECA 2VISA 2YAOA 4HG4J 2W81C 3JUYA 1X5HA 3KNBA 1TU2B 1MNNA 2FR4A 3V4LA 1CLYH 2VRQA 3IJ8A 2ZYSA 1SLWA 4MQ7A 5GGRY 4E2OA 4NT6B 3UAEA 4N4YB 3WIFB 4Z77A 1AGEB 4TLTA 1MH5B 1P7BA 2HFGH 4PJEA 4OCLC 1DEEB 2BSSA 2C9AA 1JWMB 2R2EB 2H5UA 2OFQA 2A83B 1JN6B 4AYSA 5CBEA 1UACH 3GI8L 3IJEA 1FA4A 1KT2A 5TE7H 4UU9B 1LK2A 4FX5A 2X70A 4XXCA 2F61A 2WXIA 4E9RA 1AI1H 3D18B 3FF8A 1HHHB 1AD9A 3GJEA 5E94B 1RFDH 5T8IA 5JW3H 1E9PA 4HF5L 3DSNA 2K3HA 4O2CB 1FFRA 2H6PA 2AV1B 1AJ7L 4NO0A 1S78C 2OXHB 3FU8A 3NSYA 5LG1A 2B9BA 5CLWA 4XNQA 2OA9A 2WTRA 5LG6A 4ZD3H 1D7FA 1TT6A 4K3HA 2CJTA 2P5WE 4FQXA 4P2RB 2Y7OA 1YQ2A 5E7BA 4OV5A 1PLGH 3QUMB 5EZJA 3V4UL 1SVCP 3QR1A 2IAMB 2WWKT 5KOVC 5EHFA 1UB6A 4LVOB 4M5SA 2XWRA 4PJDA 3PWUA 3NCMA 4DGVL 3QIBB 5AENA 1KGJA 1PF3A 2ZTBA 1MCWM 1MHPL 1DL7L 3C2AH 3VXNB 4R2GD 1DP0A 1FWXA 4MKMA 4RMBA 1BJ1H 4HYTB 1UKQA 2WP3T 1CU4H 2WUBH 2ZXCA 1GZPA 2Y23A 4NN7B 2ERJC 3GMOA 4G6MH 2BW4A 2ZUXA 3K4DA 4EMZA 3AUWB 3TBBA 3MGOB 1GA2A 1JF5A 3D07A 4LBEB 1T20B 4X6FB 4JM4H 3L4TA 2LFGA 4ZW8A 3FTWA 1A0QH 3O9WD 3BPLB 2A6IB 3NCBB 1I7ZB 4TUKH 3QWRD 3PNRB 1S7UA 3WFHB 5F1KC 2N7BA 3PDOB 2MMXA 4GAFB 3V8OA 1AQDA 3VWJD 4FA8A 3ZIYA 4JGNA 1ZT4B 1EPFA 3B9KC 3EOAA 4GKSB 4G11A 4MS8C 1XGYH 1LP9B 1BIIB 4HA1A 4JFDD 2DKMA 1HSAA 5ISZE 3VMPA 3WN6A 1GS7A 2R1YB 5E8DH 2ZNWA 4WI8A 3BIBX 2VLMD 1HH6B 1TYJA 1X5AA 4XOBA 1HAUA 1EH9A 2JKJA 2EH8H 3EFOA 3P2BA 1JVOA 5TDOB 5IREA 1LO3L 3BUIA 4A55A 4DKFH 1O9VA 1QSFE 4NAMA 3ZMNA 1P9MC 2OMTA 1WCBB 5IQ7H 5GRJH 1CF1A 1N70A 2LR4A 5IBLC 4M00A 2O6PA 5I66A 2Z0UA 5EFIB 3BE1L 1CD1B 5GS3A 1A3QA 5DD1H 2XWJB 2CSPA 3DVIA 5AAWA 4NP4L 5I6KA 4B9FA 2UVFA 1KJVA 1FAIH 3AB0B 4OQ1A 3K8LA 2WCSA 1UJTA 3KPOA 4FXLA 1MRCH 3NIFF 4LPVA 4X4KA 4KWUA 1S7RB 1XB3A 5I2IA 3QARA 5B1JC 1YY8B 3ZKXC 1K8IB 4WWKA 1A6UL 3L1OL 3RPBA 4JHAL 1ETA1 2AF2A 3C6LC 2DLEA 2Y6SC 1B0WA 2E6JA 3KYMB 2ZUUA 5EIIB 5JMRA 1IGMH 3OKYA 2O30A 4K2UH 1QR1A 3L2MA 5FGCE 4HKBB 3Q6FA 5TFSL 1CFBA 3FO2B 1BOYA 2Q6WB 4MJ6B 1DBBH 3CXFA 5CGBA 3WUWG 5E51A 3TEZA 3ET9F 4PVNA 4B7IA 1Y07A 5DEFB 4NO0D 5LO7A 1W72H 3SGEH 5JW4N 1KGIA 4UZUA 3MXVH 4JG1L 1WGOA 4U49A 4FQXD 1WWAX 2ZCZA 4JANB 4WU5A 2N1TE 3IN0A 2VSKB 4TQPA 3OHXA 4M61B 3P9LB 1E27A 3VDBA 4NUQA 5B38B 3MNZA 2XQ0A 3UADA 5BQ7B 4GB9A 3AM8A 4P2OA 5KVDH 3RPKA 3UEZA 3B2DC 5HHQB 5IQ9A 4Y0GA 4Z0XA 2DQGL 4NNXA 4YR6A 4CJ1A 2CAKA 1JXFA 2H3KA 4YNYA 5TH2B 1VCAA 3KWTA 1XDTT 1HSBB 5K9QG 3PGCA 2YJQA 3S5ZA 1T2QL 4XP1L 4ES9A 1JPSL 4HMDA 1T7ZA 4JRYB 2QVFB 3NFNB 1CL7L 1DBKL 3UZEA 1QABA 2MKLC 1QWUA 4Q89A 2IBBA 2EABA 3CTTA 4R84A 5J3HC 4HX1B 1JGDB 4KUZL 3STZB 4I3RL 1BF5A 5LAXB 3PHSA 3FFOA 2FD6L 5D1ZC 4H1LA 3ARRA 5FHBH 3KLLA 1MAMH 2YEQA 3NG5A 4WFHD 2R0WL 1MQKL 4FQCH 5GXBB 2WLKA 3N3EA 1ZLEA 2K4AA 3ZRCC 3DX0A 3ZTEA 1IAMA 4XP4H 5DHYA 3EYVB 1UCBH 4M93B 2F8XC 1O9ZA 5HHOB 1QSEA 2YD7A 3SGDI 1FO0L 4DESA 3AWFA 1F86A 2E5EA 1S3RA 4G7VH 4N68A 1UWXK 3MRDA 4XO9A 5I1HL 4HK3J 4HWZB 4KXBA 1WV7T 3NQIA 3VX1A 3TBVB 1FYTA 3DROB 5EWIH 1AXTH 3NA9L 2KC0A 1B90A 3BP5A 3NZUA 5I1JL 2YZ1A 2OV0A 4NLAA 3ZVVA 2R0ZH 3C6EA 4PP1C 1JPFB 2OZNA 1JWUA 1J87A 1UCTA 1SDAB 5DA0B 5KAQF 1N59A 4UT6A 2FBOJ 2YPVA 3EYQD 4ZZKA 4P9HL 5MERA 4A2HA 1MELA 5CCGE 4ODWB 1HZHH 1ECZA 1JUFA 1F90H 3IMSA 5DURD 1NFKA 3QUZA 4OVUA 2OTPA 1TPXC 5ALBL 4WWKD 1VAHA 5HI5C 2NNXA 1DCEA 5A2IH 1FBIH 2ICEC 1CXHA 2YLHA 4F9PA 3B9DA 1QVOB 5CLYA 2FYYB 4UOJA 3GK8L 4KROC 5IGXL 2ZX7A 4X80H 4GG6F 1BLNA 2ROYA 3O3UN 3UZQA 2XN9B 3DJTA 3T0EC 5L6YL 4PV9A 1E65A 4WEBH 5DA4A 3L5WA 2AVFA 1MFBL 3D0VB 1O9WA 5C09B 1Z2KA 1HFUA 5I24A 1C16A 1YHPA 4GO9A 5E1GA 1IEAB 4TLKA 4XMTA 2FB4H 2FWSA 4KZEH 3OKOA 4KDTC 3EF7A 4NI6A 4D7BA 1V54B 5FHAL 1EMTL 4DK3A 2VDKL 4P2OD 1KCUH 5F3FA 2F54A 2AQNA 1PAMA 5DK2B 4KRPD 1P4LA 3NJHA 4GRWF 1FG2B 1KACB 3F5WA 3ULVD 3G04B 1M1SA 3C60D 3WUZA 4D8OA 4DKAA 3U46B 1E4XL 5AZEL 2BHUA 3VD9A 2GK2A 3D39E 2IAAC 1CXFA 1DLFH 4EI6A 5ID1B 2DLTA 3CAFA 3CX5J 1PZ5B 1WZ1L 2C7UA 3QAQA 1C7TA 1OP9A 4P07A 3TASA 3G6JA 1NCBH 1WD8A 5J1AA 3STLB 1RV6X 2HJLB 1J8HA 1BX2B 3V6BR 1WITA 5FW7A 5IJCC 4LVOC 2OMZA 4O9HL 3JUZA 5K1NA 1OEZW 1KIUA 3B7RL 4YQXL 1D7CA 5I8KL 5KVDE 1QSED 4RDBA 4X6CF 4GRWH 4O58L 5BUPA 1BIHA 3CFKA 3L3HB 2VO8A 4OZFG 5GS1B 3K1DA 3E0GA 3G5YA 5CF3A 1K8DA 5AUMB 1DQJB 1U95A 4YUEH 4J8QA 5C0RH 5FM8A 3CFCH 4UDTA 2I9LA 2WYTA 1LD9B 1X9LA 3KPSB 1FYTD 5GGSY 4BSJA 1BCIA 3FU0A 3C09B 3FTYA 5EU4B 1G9HA 3OJMB 2BZDA 2XTJB 4LARL 1BM3L 1XH2A 4ALAH 5E4EC 5JNYB 3CU1A 4Z9KB 2IWKA 3MV9A 2VDLH 5EN3A 2FBRA 3BCFA 4M48H 2KZ1B 1IC4H 3QRGL 4N8CH 1UC6A 5EDXA 1U8IA 1KGUA 4HV8B 5T3XD 4UAOC 1QEXA 4M9OA 4ZW3A 2FEEL 3QUZD 3MNWB 4PRPB 3FB6A 3RDTB 2FQGA 2CMRH 1P2CB 4A37A 5DZNA 1T04A 5IR1A 2MCAA 4K0OA 2FZ3A 4IRSA 4HUVB 2D03H 4ENEC 1CYWA 2HN7A 1NAMA 4OD3L 2ATPB 2NR6A 2VW7A 3NRFA 1NLBL 2BIMA 1WSST 3WUWA 4HPYL 1E90A 3DIVA 4PJ6A 1ZSDA 2PYEB 2AHIA 4MA3B 3MAWA 1CVSC 4ZFGH 4CRPA 4XCYB 2G3ZA 3R06B 2VR8A 2OL3H 5JW4M 2FT6A 4GSQA 1UA3A 1OT2A 5GGUB 1JZ5A 4GP4B 3AB0C 4RX4A 3BUYA 5DS8A 3ZT6A 1WG3A 5CSZB 3ARBB 2JJTC 2X6MA 1P4BL 3SODB 4H8UA 4NRZA 2QR0A 43CAB 2F54D 3W57A 2P46B 4P2QA 4RRPG 3TBTB 5DMGC 4F33A 3FT3B 1DUYB 3PFUA 2IALB 5EEZA 2VQ4A 2WN3A 5E1IA 1MFEL 2GBUA 1PLAA 2I5YL 4LLWA 1QP1A 4WU7A 1J18A 3S8FB 1U3HA 2VLKA 3BZ4B 2PF6A 3L3DA 4OIAA 4ZPTB 5F7NC 1UXSA 3MUGB 2VABA 3RPIA 4W9DC 3RTQC 2DBLH 4LRNL 4UQEA 2F2HA 4WNSA 4A38A 1H15A 5JHDB 4GEIA 1LL1A 3BD3A 2MH4A 1J8HD 4HUNB 1BVNT 2Z35A 2Y24A 5EU7C 1Q9KB 1RZ7H 1EHXA 1UA6H 2HLFC 2NY4C 4QRPE 5DHEA 3IVKA 3LQAC 4PJGE 3VSQA 3PUUA 3BPCA 4AUYA 4N20A 4WW2F 5FKAA 2CBMA 4N8VG 4DCQA 4PJ7A 3TBSA 4DQOL 1NCJA 3ATEA 5ICZA 5CAYB 1RJLA 3P2TA 3QZNA 5FYJU 2VR5A 4RAVA 4QKTA 1OCWH 2JCCF 3BO8A 2XVGA 1BG1A 1RK0B 3MRCB 1U58A 1ZHNB 1YMME 4K5LA 4GG6E 4KGJA 1OO2A 5JO5A 3T1WA 2AMGA 2FO1A 3UJJL 3U9UB 2BOBB 3L3GA 1G7MA 2YEZB 1CS6A 3MRPB 4V2BA 1WLHA 5HYQA 2F5AH 3OKNB 3P2DA 5JHMA 1T83A 4YSTA 2HYMA 3MV9D 1RZPA 1E3FA 1CXIA 3L5IA 5TPWL 3QEHB 4IOIB 4ELKA 4HLEA 1GW0A 5DLLA 5I17A 1GH7A 2PXYB 2HT3D 2C3VA 1BAGA 4NRYA 4OTXL 3AXHA 4FQHA 1XIWC 2D7OA 2R2BB 4JKPH 5AYTA 2AS5M 1KEGH 1EV2E 4XNZB 4ACPA 4PRHA 1NGQH 3WLWC 1W0WB 4GRWE 1IVLA 3L4UA 4PGBA 3H9SB 5T1LB 4Z18A 2VNCA 3QUML 2CLRA 2VERN 3BPOC 4IRSD 3ZL4L 3KH3A 4WFEE 2NR6D 3JV4A 5FM4A 2P8LA 4NQEB 4X0KA 3PHOA 1IGTA 1VLXA 5HDBF 3WY2A 4X6EB 2J72A 4GW1B 3B7TA 4LOVA 2VIRA 4AJVA 2Q20A 5AVQB 2UY7A 1YEFL 4FE9A 4DP5X 3LQZB 4TXVB 4RX4D 4HUMB 3RJOA 1G7LA 5H4YA 1NCGA 1PX8A 1MLBB 3L3OA 4KKBD 1ZMYA 1WA1X 1EAPA 2FO4B 1JGLL 2YC1B 3GBLA 5HHMD 3NPZB 4P2QD 3ZE1B 1YNTF 1GS8A 4OB5L 2QVTA 1HI6B 4F9LA 5IOPB 4DN4L 4U3CA 3HFFA 2IXQA 3S37L 2X4TA 1U3HD 2VLKD 3NJJA 1HEZA 1YN7B 4P4KC 4DEUA 1LE9B 5LDUA 3ZX1A 2ICWI 4Z3IA 2CM5A 3SDAA 1KIRA 3S36L 2GJZB 4YDVB 4YFEA 3O2WL 5BZDA 2Z1PA 2JIXA 2EVJA 4B96A 5D5MB 2IIJA 1KV3A 2JTYA 2BVEA 4PWEA 4UDUA 3QEGL 3HVDA 1UT1A 1JV2A 1KGCD 3NZ8B 3OXRA 4GRLB 1FFNB 5FO9B 1F13A 4O51B 2ZOOA 2Y7QB 2OCJA 4K7PH 2F18A 5SV3A 2K6YA 2XA8H 1ZEAL 3N06B 4XZUB 3QQDB 2QDWA 3WFCH 3A0OA 1S8DA 2XWBA 2FLMA 3FBKA 3QWQB 4TUOB 1ZGLA 4J2QA 1HHJB 2PCXA 5G2NA 1Y1UA 2NTFB 3E38A 1ZGLM 4OZFA 1RD6A 2L4OA 5ANMB 4RMTA 1MFDL 3MA7B 1JTTA 1MW1A 4JY6A 5T5NF 3WKPA 5EIVA 2W91A 4PJIB 4Y4FB 5EC2B 5CJOL 2QDVA 5PCYA 2YD4A 3FT9A 3CH1B 3S7GA 1X7QA 1CTOA 2GI7A 1SLVA 1JSYA 4U0QB 5F88A 2WNKA 2EO1A 2EYSB 4U1HB 4WI3A 4XVTH 4Z1PA 1T1XB 1I9JL 3A24A 2EXYC 4BQCA 2NYYD 2HJKA 1XF3B 3US0A 1QUPA 3SOTA 3RHWF 4XAWH 3UXFA 1ETB1 3WTXA 3WHE1 3B1TA 2F8OA 1TTUA 1OAZH 4RFNB 4Y16A 4G1MA 4PS8A 3ZSTA 1MCDA 3LZOA 1QSZA 1YEDA 2A9NH 3RWEB 4UANA 3O4OC 2VQUA 2ADFL 3IJYA 4PRHD 1EZVY 2NRDA 4FHJA 4M7LL 5GS1C 5KSVA 3E1F1 1A25A 1HNYA 2B4CL 2V2XB 3UIYA 3ULVH 3K2KA 3F64A 3Q2NA 4XHJC 2C3XA 2IQAA 4MDRA 3VRJA 5I9QC 4HSCX 3RY6A 2BVTA 3ZUCA 3C09C 3HAEB 1WZMA 1FV1A 5DZLA 3UPCA 1E9OA 1LMIA 5C70A 3MRKA 2Z31A 3FQNB 3TNMB 5DMIL 3EJUA 3S2AA 1MG2C 4NQDA 5EUOA 2IWEA 4CC1A 4OLUL 1CG9B 1KYDA 1NC4A 3BWSA 4PJCB 5IQLA 3TV3H 5ABAA 5IESH 5I73B 4OM0L 5E6UB 2EIMB 5I5IA 4H1LH 3B6SA 3DX8A 4QR7A 2K8MA 1S7TB 4RRPA 3W5NA 1YQVH 2NNCA 5AEAA 4PJDE 1AKJB 3WNLA 1IZKA 4RRPM 4G9FE 1ZTXE 1DVFA 4MVBC 1DE4A 3KW8A 2WAHA 4P5KB 5E7FA 5HVHB 3FSZA 1FL6A 1CFNA 1MCBA 4NRXB 1FFOB 3MLVL 3P0GB 3SDAD 4ZSOA 5D7KD 1PDKB 4LLVB 1ZA3B 3JV5A 2JIXD 3EW3B 1F4WH 1QTYT 4OBSA 3WJJA 1A6ZA 3QIUB 3KGTA 3A4EA 4M6NL 4ZQTA 3BDYH 1OP5H 1GJIA 4H0HB 7PCYA 1FZMA 3IMRA 2QVIA 3GSWA 3MRBA 2MEJB 1KBVA 2ATKA 2A73B 3FAWA 3UPAA 2MKWA 4AMKL 2YPVH 4N8VA 3UMNA 1AXIB 2VSCA 2DTMH 2N01B 4UBDC 5T3XH 3OXSB 3DDFA 1U93B 2AV7B 1XEUA 1NKGA 1FNFA 4PS3A 1PSKL 3O6ML 4RGMB 1CMOA 4PGEB 2ZUQB 1XF4B 1QLRB 4IBVA 4G80B 2DD8H 3VXOB 2LLLA 3B5TA 5LKNA 1N6UA 4P48A 1KCKA 4LT7A 1VPOH 3MX0B 1H5BA 2AITA 4J3OF 3DJRA 2X4PA 3BT2H 2AJYL 2DQUL 1EFXA 1AFVL 1J05B 4B95C 4KQ0A 1NSNH 2M2DA 4OIBA 3I74A 1AG0A 2A6DB 2V5RA 1D5IH 4MA1B 5HDBE 4YSEA 1ZHBB 4DVRL 1UB5B 5JIDA 3VI3B 1VFOA 4X7FC 1CFSB 3GUTA 2VKWA 1BPLB 4KKCC 4MXWL 4LLMB 3JTSA 5L4JA 3HCVB 3SY6A 3RI5F 2EIBA 3D3VA 2QSCH 4OGAC 2NZ9D 4FZEH 4GBXA 3EJYD 4Y16D 1BZQK 1W0YT 4F3FA 5IOKA 1ICTA 3W5MA 3S48A 3VGAB 3Q2CA 2BFVL 3ZOAA 5J06A 4GXUN 1E9QB 2ZKYA 2AEIT 1NZRA 5E5LA 3RHWK 2COVD 5C0EB 1RERA 1TYEB 3CBJB 4G8AC 4L0PB 3Q1EA 5EO9B 2IBZX 2VERA 5DMKA 5IW6A 2ZE0A 2Q0ZX 2NXZC 1ES0A 3EO1B 5D70L 4CADA 3S88L 3DX9B 5FW6A 3REVA 1V27A 5JQHC 1P7QB 3SBPA 5SWSA 1XF2B 5AVXB 4W9LC 1ZLWH 4X4XA 2Z31D 5LCVL 5FK9A 4NKDA 2XHNA 1OGAB 4Z7QF 1C5CH 4NQDD 1NC4D 4IIZA 4PRAB 2P8MA 3WJMB 3OAZK 2HCZX 4FTVE 2WD0A 4G72B 5CLZA 5AKVA 5IBTH 1DANT 4RMQA 2WBKA 2LU7A 3QW9A 4U1SA 3VDAA 4Z78B 1HVXA 2CBTA 3EJTA 1ADQA 2E9GA 4ZTOL 1MFCL 3N1GC 1JFQH 1DVFD 3VCLB 4Y19B 1FGVL 4NUPA 3DI3B 2XG4B 3TEYA 3G5VA 1U3NA 3EAKA 4ZT1A 3HS0B 4KGLA 5DWUL 1JDCA 4R7NB 2BM3A 1IMHC 3FOLB 5E0FA 1YLBB 1OGTA 3JWOH 2PYFA 4IM8A 7FABH 1LO4L 4MJIB 4NKMB 3LRGA 4JGMA 2OSYA 1UWGL 4UZSA 3WE1A 4GIPD 4M5YL 2N7AA 2YWYA 4Y88A 1HQ4A 1WJ3A 2E7DA 3EBIA 3MJ7B 3I2CL 4WWPA 1JTOA 1XF5A 1DSYA 1JHLL 1JNNH 1TQCB 2XZAH 1E4JA 3K2UH 1WBXB 5I76A 4NO3A 1I1FB 5JMOC 2YHGA 3FTGA 1Y18A 4F57H 3CLWA 2EXWD 1B4JL 1QKZH 4GAYA 3PP4L 1QSEE 1U3YA 1BQRA 5CEYA 2NZIA 2H6OA 4R26L 1CK0H 4XNMA 1NAMH 5F7HA 1EFXD 1BBDL 1NCUA 2FATL 4XMUA 4BYHA 4ZMOA 5D8JL 1VZIA 2BNRE 4LIQE 2GT9A 4WWOA 1E8WA 1UJ3B 2VDNL 4MJ5A 5ALCH 2Q2EB 3NEEA 5SV4A 3N40P 4GRLC 3UZVB 4JZOB 3D3VD 3RWFA 2D3LA 3JTTB 2P7TB 4GBXD 5FFLA 1C9SA 3D2UA 4UYPA 3ZMRA 4OZIB 3CPLA 4YDMA 1JNHA 4NUGH 3PY9A 5D6CA 3RI5K 4L9LB 2EICA 1DLHB 3UBXG 4B9GA 2D2CC 1OCOB 2G9HA 3BGMA 2WVTA 2BRRL 5C0AB 1IKOP 3RE0A 3U7YL 5ESAB 3W2DL 2ZONA 2GSGA 4HAKA 3QG7H 1MWAL 3ULUF 1Q1JL 2BHFA 4IQHA 5C07B 4Q9CA 4NC1E 3KJ6H 2MJWA 4KV5E 4Y4FC 1BGXL 5C0BB 2OI9B 5IEHA 1L7TL 3O8XC 2EO9A 4P5TC 5SWSD 3D69A 1NOAA 2EIZB 5EU3A 3HPLB 5HVWA 1ZHKB 1I3UA 1LO2L 4I87A 4Z7NF 2BIQA 4NZRL 3X3FL 4NM4L 1KB5B 4G1EB 5CIPB 2UUDK 1P1ZB 5ICXB 1RHFA 2ZOLB 4QT5A 2P80A 4Y4HB 4F2MA 3EFFA 3NFPA 4F91B 1BQLH 3W9DB 2JQZA 1BFTA 3K3QA 4YHYB 1F6AA 4G83A 4M7KH 1SXSA 3QZLA 4HFUL 5F6HI 4ZUSA 3SPVB 4P9MH 3GKWH 4XMXA 2ZP8A 4GUPB 1ZE3H 3NCCB 3CZJA 4JFHD 5I5RA 3NN8B 4PB9H 3E8VA 1IM9A 4BUQA 4M8QB 5ELIA 3SPHA 3PL6A 4JL1A 4OLYL 4X6CB 5DRNB 3RWHA 4AITA 3QRBA 1YJDH 3X13B 1ND0A 1TQWA 3LNHA 2WTOA 3CSYA 4KKNA 4DUXA 3PHQB 2BNUA 2FSEA 5EUKA 1Y0LB 3JTBA 3CPUA 4NENA 5FM5M 3V6ZA 4OUUB 2V5TA 4HWEL 4GQQA 3TO4B 1DJZA 3A6BL 4GRMA 3HMXL 4N3TA 4ODXA 3BYYA 1SXBA 2JKTM 4BUHA 5I73C 1EHKB 4HJUA 1AG6A 1IQWL 2WQSA 1MJJA 3QNZA 2RD0A 4LNRB 2XJKA 3TJHD 2IDUA 3C8KB 3O6LH 2FX9H 1J0IA 3PWNA 5DJXB 4OY9A 5FA3A 1PZSA 1D6EA 2OW7A 3DOIA 3X1BA 2Q7NA 1OE2A 2VXVL 2C9VA 4JB9L 5D7HA 1LVEA 5IVOA 3P69A 5E6RB 1BFSA 3QI9C 5KYXB 2ICWB 1E6JL 2NY6B 2H2SD 3JWDC 1J8KA 5H94A 5HVHC 1UWYA 2KPNA 4M8VA 1R3JB 5GRWA 2DLFL 4RISL 5FYJH 5KS9B 1CT8B 1JRHH 1PIGA 3MLRL 3KWUA 1LILA 4HUWA 4EI5B 1ZRUA 3U2JA 1TVHB 1RUPL 4UI2A 3ARGB 1XAKA 1RP8A 3T0WA 3VXRA 4OH2A 2P5EA 3GS0A 3QIUC 1U42A 3EJJX 3BN3B 4PPTA 1HH9B 3GEWB 5BOZG 3AUVA 4A68A 3ARUA 2IPTL 3QO0A 4ONGL 2YAMA 4QGYA 3BLKA 3CZFB 4Z7QE 5I0VA 3IAQA 3ATAA 1XB6A 4PB0L 1SJHB 3SGJA 3D2UD 3LEYL 4ODTH 4K07A 1RZJC 3V4VB 3TFKC 2ITDA 3KPPB 2WGNB 3OLEA 3QE5A 3BGFB 4ZX5A 1PNCA 4HIQA 1BQ5A 4YGAB 2GYSA 3PIQB 3F58L 2MQCA 3HN8A 4GXUM 1NMCB 3D12B 2ZUQC 1A1NA 2BMKB 5F7DB 1F11B 4R0LA 4E9QA 1MRFH 3P77B 3LHPH 1OV8A 3QDAA 4UQ3A 2DBJA 4FEMA 4KI5F 4U4BA 1N64H 2DJMA 4WEUD 4Z3EA 1BREA 4DEPB 3UO1H 3EZ8A 1TZHB 4WI6A 1TTRA 3UAJA 4X4YB 4C57C 3QDGE 2R9HC 4KKLD 2XZCH 2LTQB 2JB6A 3U4BH 3M46A 2NYKA 4W4OC 1MI5B 4XH2A 4AH2B 1WC7A 1JS4A 1L4IA 5FO2A 2Z7ZA 3IRCA 1WP6A 2GJPA 2P80D 4MX7A 4BSWA 4LLDB 3MNVB 5F3BB 3KGUA 1EAJA 3RFZB 2C7FA 4YDKL 1ZLDA 1F1AA 3VGAC 4YPGB 1E5AA 2IQ9L 4EUPB 1FDLL 3ZJAA 1R1CA 4LU5L 4ANWA 3G5WA 5DJDA 1CYGA 1TVDA 2B2XH 4HEMA 4ADJA 3FB5B 3AG2B 1IM9D 4P2QE 4UTCA 4KY1H 1QWHA 4KNSA 4BFIA 5GJSH 3TO2B 3PL6D 4Y5YC 3WENA 4O02H 5IP4A 4G42A 4OZFH 6CGTA 3LD8C 1TZGL 1S9WB 1SYSA 5E6ZA 1CFQB 1JBJA 1VIWA 2G0KA 4P8QA 2VLKE 3RWDB 3M86A 1UUSA 4XPAL 1AS7A 2H1XA 2OYPA 4FXKB 1AP2A 1G6RL 4QHUA 3MCLL 1QNZH 3UYRH 1ONQA 4OM1L 4QOKA 5CEXA 3IKCB 4MD0A 5DRXB 1OCRB 3IEAA 4ZG1A 5H37H 2V5SA 1SXAA 4ADIA 2J6EL 2RH0A 2ADGA 2AW2A 4XCEB 2EDJA 1FZOA 3ARZA 3D52A 3WGUB 4CDGC 3HLAA 3H2PA 1WBYB 2YJLA 2H26B 4H88H 1WF5A 5E99H 3GMQA 4AWJC 1E8XA 1CLZL 2WJ7A 4I0PB 1S7WB 2J1YA 2HJFB 4ZOAA 2BX5A 3ABKB 5KTEH 4PJ7E 3NIGF 5GZNC 3NZHL 4OGZA 5FOJA 4I0KA 2Y7SA 2W0KA 4QXUL 4MA8L 3TU6A 5M94B 3F6IA 2ARJA 4GUOA 2EDOA 5DR5L 4WVRA 2UWEF 2I24N 4MRBA 5DRWB 2NY0D 4Y2OB 4DKEL 3BGAA 3HS0C 3LPOA 3VXRD 4PJAA 4F7CB 3IBEA 4UNTA 2G5RA 2P5ED 2YBRB 3MJ9L 1XCXA 3VFSA 4TVSa 4PP2A 2AAAA 1UQSB 1M2VA 3L4VA 4HXAL 5GS2D 4F93B 5J1TC 2XV6B 4AENB 3C5SB 5LGHL 1DQDL 4U6XA 3MODL 4JPKL 3CN2A 4KAQL 3WLBB 32C2A 2GIXA 4G8EB 2Y5TA 3ARDB 3HZMB 5BO1H 2XY2A 2A6KB 3PG2A 4MD5A 2XKNA 4PRBB 3UBXA 3VJ6B 2CHXA 2YR3A 1EDYA 4XPBH 2BNQE 1J1XH 5I1LB 3KBFA 1JIBA 4N28A 4JFFE 4NAQA 5ID0A 1IKFL 4ZFOL 2I07A 2HFTA 4EZLA 3TWYA 5CD3B 2PPFA 3LNDA 1FVDA 5FYJE 5KG9B 5IB1B 3QDJA 1VF5C 3B5HA 4M6OH 4XCNB 2EVHA 3UAJD 2GBTA 4QCIB 3U9WA 3QSKB 1FFQA 5J6HA 3T77A 4DP2X 4GSXA 3MV8A 1DSWA 5E23A 5B39B 3KWVA 1EJOL 3C87A 2OSLB 1SXCA 3MFFA 2XFXB 5BVPL 4Q0XL 4ZXBA 5F2FA 3J07A 1ORQA 5KANG 4HGWA 1AVAA 4IS6B 2Y5QA 3QJVB 1BAWA 1HXMB 4JRWA 4M5ZH 3DOSB 4DKTA 1RU9L 1NCCL 2YWZA 3HPJA 4HK0A 4WI9A 4Y4KA 4XNAA 5BV7H 4CKQA 3LTVA 1QQDA 4EZJA 1DVUA 4L9LC 1KTBA 5FWRA 5T3ZL 3FCGA 3L9RA 4XVSH 1NIEA 1N3NB 5IVZB 5JR1L 4DAGL 1UURA 1MKFA 2DDQL 2YUWA 3D9AH 4YVUA 1DSFH 5DD3L 3SDXF 3KPMA 3FO9A 2HT4C 4FXTA 3WE6A 1RZJL 1JOIA 2AAVA 2QBWA 2OI9C 5IHUL 3H0TA 3FUMA 1S6NA 1XQ4A 5A6LA 3FCTB 4AJYV 5HYSA 3PUCA 5F44A 1CBVH 2AK1H 2QKSA 3GRWL 4LQFH 1N0XH 1MVFA 4GKNB 4R5TA 4CSTA 4IGBC 3G08B 3II3A 3PNWA 5TDPB 1QLEB 3TZVB 4F7MB 5MEPA 2VUKA 4JHBA 3T65B 4QOKD 4AXWB 4QRSA 3NGBB 4FTDA 1XBDA 3M7OA 4NHUA 3SY0B 2I9TA 4PUBH 2AXFB 1A47A 1YECL 4N2GA 3LKSA 2WQWA 1J1PL 3GRGA 8PAZA 4YHYC 4HKZA 4DHLA 3NJMA 2J2ZA 4MYWB 4LPCA 3V6FB 4AM0B 3V2AR 1TJGH 2ZOKA 4XVSL 1MFAL 3BSZL 3U48A 1R0AL 4XOCA 4IMLB 4OCWH 3QWOB 3GJFB 1R5WB 3LQMA 4C54A 5B4MC 1C12A 4OT1L 3VTTA 4Z7WA 5HDLA 2DMKA 5DT1H 3PJLA 1KEML 4OAWA 1AGFA 3BN9D 1KMGA 1RHHB 3MRRB 1NMAH 1U8NA 3HZVB 1MREL 2QQNH 4WF7A 4QTIH 3TO4C 3HBQA 5D2NA 1MWAA 4HIIB 4BZYA 1ETZA 2J4WH 1EANA 2W5PA 3Q8AA 4WI0A 5JDJA 1GTFA 3NJFA 1AGCA 3T8XA 1EDHA 1UEYA 5HHNA 2HUEA 3PJSA 5G4MA 1IBGH 4RAHA 3MROA 1RURL 1M7DB 3TCTA 2DQMA 3QFJE 3AWGA 4NKIH 5CMAA 5IB5B 4CMMB 5I18L 2NY6C 2ZWSA 1ADQH 2KDYA 4HWBL 1JK8B 4JO8A 3TEWA 2R15A 1RUAH 1CFMA 1T1YA 3G5ZA 3QDJD 5FFOA 1CF8L 3UERA 3A6OA 3CK0L 3QUXB 1FP5A 2NCMA 2HVJA 2QLVB 1MCQA 2SEBB 4BK5A 3MV8D 2NQDA 5IMMB 1A6WH 3FCSA 5E2TH 2OTWA 3JXAA 4HZLA 4JM2A 4DFIA 5BVJB 3ZKSD 3AGVA 1Q94A 1GIGL 3E3QC 4NQDE 4OD1L 5EUOE 4ZXBD 1BYOA 2WCGA 4QXTB 3SBWC 6FABL 5AW4B 4Z76A 4DP4X 5I8OL 1WT5A 3BGFC 1BEYL 4Y4KD 3DRTA 2VLJA 3ZW3A 3N41B 1WHPA 4HSQA 3D4GA 5F7KC 1NMCC 2V5MA 1GPOH 1KCBA 1OB1A 3LKRB 3F84A 5ICYA 3NIGE 1OSEA 4Q14A 4JN2A 1G4MA 3NCYS 5IHLB 3TA4D 5ESVA 2IDQA 4LL1A 4X5QA 4JO2H 1UT2A 4P4RB 2QGEA 4RA0C 1ZXKA 4X50A 1TLKA 4OJEH 2Z7WA 4LSRL 3WFBH 2QHRL 2VW6A 4ZSOE 1JGUH 4MNGA 4I13B 2VOTA 1RZGA 3DX7B 3P40A 5HD8C 2FL5B 3RQ3A 3ARSA 3MFGB 3O2VL 1X5ZA 4RGNC 4X0NA 2FX7L 2IF7A 3ULAB 3BH9B 2WKGA 2K78A 5ESQA 3K8MA 5JOFB 5IHZA 1KTKE 1D5BB 3N91A 2UYLB 5CILL 4Z7OE 2HPTA 1JF1A 4EKJA 5D6DC 1QR4A 1U4FA 1WIUA 1SFDA 3CVIL 4GYBA 3BZEB 4WW2C 1U8HB 4L8SB 4LVHB 5BRZA 1YMHA 4HAGA 4KXDA 2WINB 4TVPH 3NESA 4FN0A 4KK5D 4YLQT 4YLBA 2XN0A 2WKOF 4Z3JA 1X5MA 1JZ4A 2VCOA 2VT0A 3MLZH 5D7LA 5CBAB 4ZNEA 4LSVH 2FT8A 5C0FA 4UM8B 2PTTB 5EDSA 2QPDB 4F58H 2JXMA 1HWHB 3DDGA 4GKOA 3QG6B 4WTZG 3X17A 5K9KB 2ARWA 5MP6L 3IMVA 4L18A 5DHXB 1M7IA 3F7QA 3FQUB 1T2JA 2VXQL 5ENWB 3QFGA 2XWCA 4K3EL 2Y7MA 2FJUB 3CX2A 4KHXH 4MCYB 4NWUH 5A3ID 3ATFA 3SKMA 4DETA 4I89A 1YEGL 4Q7DA 5DD6A 5KW9L 4ZUUA 2NDGA 4HPOL 4KX9A 3WY1A 4MMXA 2XIBA 3GINA 4NEHB 5K5YA 5DGRA 3LS4H 5F7FA 3O11B 1T7VA 4I0PC 5FIEA 3Q2WA 1KB5L 2GCYB 2R7EA 2VL5B 5IFAH 1REIA 4EIBA 3N85L 1IBYA 2FHFA 4I88A 5GSVB 5IVXB 2VB5A 3FO1B 1WIOA 3BHBA 2XQYG 4OIIH 5IEKB 1SEQH 5JIKA 4GS7B 3SDCA 3T0AA 2AXGB 4PJ8A 5GZOC 2OULB 1G9NC 3KL3A 5SWSE 1FNSL 2WIIB 2X2HA 4PV1C 4XNYH 1HYSC 1MCPL 1BZ7A 3KYKL 4P59H 4JM2D 4ZS6D 3VB8A 3AW5A 2O61A 4LNVA 4A7GA 3KVPA 1UTDA 3IDMA 1L3WA 3QIWA 4K5OA 4L3EA 5AVSB 1GHFL 3ARDC 5GGRB 4QHMB 4WGVB 5L9DH 2EACA 2MHAB 2VLJD 1MZYA 4FNTA 3VFOA 1G6RA 5FV2A 4XNXL 1USQA 3HHSB 3GHBH 3GI9L 3MOBH 4FKHA 3FNKA 4PW3A 4Z7VB 3KXFA 1BFOB 2HVKA 2WVVA 5ACMA 4MCZB 2P24B 3EOTL 1JK9A 2EDEA 4TQHA 3EH4B 5AZ2H 3P0VL 2V0AA 4XGZB 1G9MH 2WLIB 5DZPA 1RIUL 1XV8A 2E6QA 1LO0H 4JMNA 3I50L 1CTMA 2HTKD 2QKIC 5DFVC 5SWQA 1QBAA 3FU7A 4TNGA 5INDB 2F19L 2R56L 3RY5A 5DHMC 5CJXC 1JPTH 4O4YH 4NZFA 4YE4H 3FU6A 1KJ2A 3SDYL 5I1KL 3C9NA 5L88L 4HKXB 4IKIA 2HB0A 1DANU 2AJVL 2X5PA 3CDGA 1L7IH 1TIUA 1U8CA 2RMNA 2D73A 5GS2H 3QFDB 2FIRT 4FGMA 4YSQA 3SE4A 2XZQH 4HQQL 1VFBA 3HB3B 1NPUA 1AD0B 1D9KC 4PJXA 1FNLA 3LN4A 1XHHA 4XMLL 2PCFA 1I31A 1IX2A 3MJ9A 1G0YR 1G7QB 4L4TA 4X6BB 4BH8B 5HDOA 2EDTA 3N5AA 4UUJA 3HW7A 1WWBX 2ITCB 4PW4A 5BRZD 3NJNA 2EP6A 3X11B 4LDCA 5LXGL 5CR1A 4FG0A 4H5SA 5FFGA 5TQ2H 1OPGH 2K8QA 5DEGB 5D7LD 3U0WH 5F1OB 1R34A 1YA5A 3V4VL 3CX5K 1KYAA 3S8GB 1CICB 2C34A 3FFCA 1NJ9B 2OMVA 2ED6A 4QLWA 2NXYC 1E30A 4LPUA 1OD7A 3SGEI 5CHNB 3GO1L 5JYMA 1D6VH 3TZVC 3KG5A 3VFRA 2WY3B 4IBQA 4QWWD 4ZFOA 3EYFA 5L4MA 4N26A 3NGBC 1GGYA 4F2FA 3EUDA 4MXQC 1ASPA 1HESA 2Y06H 3A21A 4ZBJA 3V52L 3FQRB 4PG9A 2Q7YB 2WM0A 3T3PF 1IE4A 4TNVF 4GSUA 3GPEA 3QZOA 3MV7E 3VXMB 1LWRA 3M17B 4GY4A 5DJZA 1VKXA 4X8JA 5D1QA 3EO0A 3TYGH 3N0PB 5HXMA 5GGVL 4TVPE 5EU6A 4N0CC 3VG9B 4LSPH 3NCEB 4TSCH 4L29B 3SCMA 5EZOH 3OM3B 2ADIA 1I1AA 4WUUB 4G6AD 1SY6A 4XBPA 1E4KA 1JNLH 4HHGA 3QEQA 3NCJL 3G5XA 4ZDHA 5I8EB 3RA7L 1A7OH 3FMGL 1MFVA 2BIHA 1ZVHA 2EILB 3CJJA 3SDCD 3UC0L 4PJ8D 1E3XA 5KJ7E 1RZIB 1N4XL 3NH7H 1AC6A 2YKLL 5GSRB 4ORGB 1M4KA 2I7OA 2KPWA 5FR3A 2QQKH 3FONB 3RNQA 4BA8A 5KBPA 4W70A 4Y1TA 3M1CA 4HHWA 1AHWA 2Y36L 3QIWD 5KBNC 4L3ED 1A7QL 3DVNB 3VI4E 1T5WB 2A0LD 4Q9QL 4OJAA 1KTLB 4A6YL 2GC4C 3APMA 3KXFD 2GIMA 4H2CA 5E1AB 3U2SB 5JQ6H 2D0FA 4QRRA 1P4IH 4IBZA 2SODB 4U1LB 2R2CA 1KC5L 4PRIA 2Y25A 4OCSH 3SKOA 2ZAHA 5HTSA 1F8TH 3AGWA 3M1BA 4DWHA 2IOMA 3F3HA 1FE8L 1F4HA 1O5PA 4PS4H 4EXPX 3QUXC 1IM3B 5E8OA 1GC1C 2LGNA 5CCKL 3IM1A 2WXHA 5D2LB 3LZFL 3HG5A 2R39A 4YHZH 5IROD 1ED3A 1YRKA 3NAAL 1O6VA 2MTAA 4JM0A 3QCVH 2DZEA 4WJ5A 4M7JL 2PNDA 1UXWB 1UZ8B 3AREC 4L4TD 3L95A 5I75C 4XHQA 12E8H 5MI0B 5FYLH 2WLZA 3HEIB 1G9NL 1IKNC 1RUQL 1UH4A 1QRNA 3VQLA 1YY9D 3IJSA 1X6LA 1BVNP 4LSSL 4XC1L 4A7TA 3BZFA 4Y9EA 5SWZB 1XGUA 3O3DA 4ODHL 2FTAA 4RQQB 2VSMB 1AIZA 2H3XC 3HFML 3OKKA 1V3KA 1J9CT 2P8PB 3U7AA 3Q3GB 3LN5A 1YYML 3R4DA 4A7SA 1HCFX 5JDSB 3FFCD 2GK0A 2B1AL 4JRXB 4NCC1 1IGIH 4J3OC 1X44A 3OC8A 2V8LA 3Q5YA 5A2AA 2JF1A 2HG5B 1HOCB 3CN3A 3O2DA 1QEWB 4K8RC 2FX8H 3VXRE 1IGCL 3E6FB 2P5EE 3H56A 2LLGA 5IKCB 2ADJB 3PQYA 4HIJA 4LGSB 4MZRA 4GO6B 5IW1B 4D0CA 2RA1A 4XPGL 4WO4C 1YPZA 3MJGX 4PWIA 1JYNA 2VWEE 2XACC 4NNYB 2Z8RA 5I19H 5K1VA 3IDGB 1PQZA 3RWJA 5I1IL 4NM8L 4HS6B 3FO0L 4M4RB 4L8SC 1HCZA 2IADB 2DIEA 3MRHB 2AI0H 4LVHC 4RGOH 3JZ7A 5D1QD 1S7QB 1NBYB 3QXWA 5EU6D 4TNVK 3HS9A 3P30H 3SCMD 5DS1A 3TVMB 4D9QD 1I1AD 3PAVA 1DJIA 1JZGA 1KF9B 1CDHA 1UM4H 4N9GA 2V7NA 5FKPB 3PP3K 1BD2B 1VENA 3QEQD 1U2YA 3UABA 3WHXA 1JYVA 1MOEA 2HLAA 2ESVE 2WK2A 2XQYA 3HE6C 3FJTA 4KY2A 3ZDYF 4ZFFA 5J8OA 1OAKH 2GFBA 2J12B 3FRUB 3LV3A 4QD2E 5DZVA 2BW5A 2L04A 1T1WA 4XBMA 5CJQL 1F3JB 1VFUA 1J9RA 5C08B 4CSZA 5FDWB 1UOLA 5KVMC 2UZXB 2VITA 5T5FL 5C0IB 4AIOA 3HBPA 1ZK5A 1QWNA 3BQUB 3G6DH 3QORA 2DRUA 4KXZH 1TLMA 1GZHC 5DJ6B 4YDJA 3WXVL 2X4UA 1FL5B 1P7KA 1QLEL 3HRZA 3EDEA 1P5UA 1OF2B 4YHKH 1NC2A 2O5YL 2VLLA 4PR5B 3CCHA 2BK8A 2GJ6A 2R83A 4QRRD 4H8WL 4E68A 3VD4A 4PRID 4Q9RH 1I9RH 2OQJA 1QBLL 4HEME 1CN4A 3W0WB 1T1ZA 2J7LA 3DO7B 2YRBA 3KWXA 3FYIB 3ECVA 3M1OA 1IARB 4IKKA 4LCWA 3VFVB 3NOIA 1X9QA 4YEFA 2A9MH 2VXSH 4X42A 1CDBA 2HTLD 2UWEB 1HT6A 3MLTA 1HWWA 4GS7C 3GIVB 2GABA 2XFGB 1ZKAA 2W94A 3LOWA 5AALA 2CUAA 4KK9D 2PPDA 5DHVH 1F58L 3HI1A 1FZKA 4HPHA 3PREA 1LWJA 1UWEH 1KJ3L 2PUQT 3HBZA 3EUUA 9CGTA 3C5ZC 3KLDA 3UG5A 4TQEH 5AWNL 4OW6A 3O6FB 2M1KA 1BW8A 2APVA 3DI2B 3T3PE 3GXFA 3VW3H 3RB5A 2NY2D 2UY6B 1JZHA 4TPRH 2EVGA 3U4EA 2XTLA 2CDFB 1PYWA 1QRND 5JHLA 2YD3A 2DQEH 2VXQA 4PGCA 5FGCB 4NN6C 1O0VA 3QVAA 3WKMH 1UZ6E 2AQ2A 2XWZA 2NPLX 3BAEH 4PGJA 5JZ7C 2CRMA 3CMGA 3Q1SL 1SHXA 2R1WB 4DK6A