4F27A

Crystal structures reveal the multi-ligand binding mechanism of the staphylococcus aureus clfb
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
331
structure length
331
Chain Sequence
DAKGTNVNDKVTASDFKLEKTAFDPNQSGNTFMAANFKVTGQVKSGDYFTAKLPDSVTGNGDVDYSNSNNTMPIADIKSTNGDVVAKATYDILTKTYTFVFTDYVNDKENINGQFSLPLFTDRAKAPKSGTYDANINIADEMFDNKITYNYSSPIAGIDKPNGANISSQIIGVDTASGQNTYKQTVFVNPKQRVLGNTWVYIKGYQDKIEESSGKVSATDTKLRIFEVNDTSKLSDSYYADPNDSNLKEVTGEFKDKISYKYDNVASINFGDINKTYVVLVEGHYDNTGKNLKTQVIQENIDPATGKDYSIFGWNNENVVRYGGGSADGDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clumping factor B
publication title Crystal Structures Reveal the Multi-Ligand Binding Mechanism of Staphylococcus aureus ClfB
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion/blood clotting
total genus 90
structure length 331
sequence length 331
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f27A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f27A02
4F20A 2Y7NA 4B5ZA 2VR3A 4JDZB 2RALA 3IRZA 4MBOA 1R17A 2Z1PA 4RMBA 3IRPX 4B60A 4F27A 3AU0A 2YLHA 4JE0A 4LEEA 2Y7LA 2Y7OA 5IHWA 3AT0A 2Y7MA 4LE8A 4F24A 4BBWA 1R19A 5CFAA 3ASWA 2F6AA 4MBRA 2F68X 5CF3A 4FJ6A 4Q6KA 3V10A 3IS1X 4JDZA 1N67A 3IS0X 4LEBA 4F1ZA
chains in the Genus database with same CATH superfamily
2NY2B 3E6HA 5G4OA 2Y25A 4DP6X 2I25N 1P53A 4YDLC 2FNWA 1ITBB 3GBML 2JQZA 2IDCA 4FKEA 2AJZB 3TYGL 4Y4FD 1BM7A 4GIPD 2NW2A 3KGTA 2NY4C 1ZGLB 3AREA 3OKNA 4KK6C 1OSYA 4FTVD 1UZ6F 2BC4A 2OW6A 3LKPB 4QXUH 4YDKL 5DS2A 3MV7E 3BWAA 2KMWA 3U2JA 5IKCB 2EXWD 2AQRA 4JRYB 4WFGE 4ZXBA 1EZLA 3AAZA 4FLSA 3WIFA 3RWGB 1VA9A 5D70L 4ONFL 5K9JH 3QUZB 5TE4H 5SWZE 3MZTA 4ZQTA 3VW3H 3QULB 4HUWA 4JHUA 4CW1B 2WCPA 4HPOH 2R0LL 3MLSL 4ZW7A 4R4ND 4FKKA 1W6WA 2YMOA 1JXJA 2WLKA 1LMIA 4ZMWA 4MFHA 4DEWA 3A3YB 3EJCA 1MJ7L 2HLAB 4L1SA 1YQVL 3VXTA 3H54A 1MF2L 4P46A 3QYMA 3S4SB 43CAA 4LOEA 1MCLA 1BLIA 4YFLI 3FU8A 3B2DC 1KPUA 2Z8SA 2K9UA 1T1XA 1ZVSA 2Z6FA 3HN5A 3V0EA 3LEVL 4OZFA 1UOVA 5ADPL 3KPQA 5L8KB 4CL7A 4NQTA 1JK8A 1J5HA 1QRKA 4J6RH 4HMEA 2JCCA 1XF5B 3GMNA 4B27A 1RUQL 2CA3A 3C87A 4I1RA 2R2HB 4LLAA 4PGBB 1AS8A 3K2MC 1PY0A 1FFOA 1DUZB 1J5OH 2OCJA 4EBQL 1NCUA 5J1AA 5HYJB 3HZYB 3QJHB 3DRQA 4GJTB 3T0EB 3KGSA 4N8VB 4J4PD 4RAUB 3PWPA 4HC1H 1ZANH 3EJTA 3IPFA 3M88A 4Y4FB 1B4RA 1WZLA 3U6XA 4XP5H 5CP7B 2RACA 2NNAB 5DD0L 1LNUA 3HHSB 4X7SL 4NRZA 1KYDA 3L3HA 5BVJA 5IT2H 2PYFB 1YY9C 2ZKXA 15C8H 5I1HH 2CH8A 4ECNA 1AC6A 2APXA 3E38A 3KVPA 1D6EB 4HX1B 5IJVA 3WS6A 1XWVA 5LQBL 3KYMA 3MACH 4FG4A 2LR4A 3S35X 2P80D 3O6LH 4ZFOL 5C7XH 2VXUH 1P84J 2G5BA 2B59B 3OF6D 4A2DA 4NP4L 4JGNA 2APTA 4MZIA 2XTSA 3SSGA 1E5CA 5C0RL 4CRPA 3BP7B 1OXYA 3QNZB 2GCYA 3N3EA 3FUEA 4RFOH 4R8WL 3TTSA 1HSAB 2GFBA 4DT2A 2D7TH 1MWOA 3WTSA 1JZ4A 3HBZA 3OJVC 3QUMB 3QZLA 1JNNH 3PWVA 2VDOB 3KVQA 2ZICA 4JFPA 4DP9X 1H3PL 1SXNA 2PWEA 2FIKB 1I85C 4XAKE 4S0HA 4U1GB 4XPBH 5CUSH 5MP6L 2OXHB 3WMPA 4ZMLA 3MCKB 3HW7A 4ZI8A 2HJLA 2FX8H 4CJ1A 5T3XL 1T5XA 5AVSB 1LO5A 4ZPTA 2IDSA 3PABB 5TFSH 1CICA 4ODUB 1ES0A 1A7RL 1PIFA 2JELH 3A6OA 1B0RA 3CXDL 4ZFFB 3DO3A 1MDTA 5AB2A 1LD9B 3L5XH 1FUNA 1HXMA 1YDPB 3PXHA 4WZ9A 3VWKC 3WY3A 1OT4A 4ELMB 3EKCA 4KKZA 3QG6B 2FJHA 4Q9BA 5I19L 2HRPH 3OKLA 3LPWA 1NUNB 1QQDA 3N85H 3CDYA 3WTUA 3NMEA 3P0VL 5SWSA 3LEYL 5BW7C 1RZJC 2G4GA 4EN3D 4LT7A 4WKZB 4PB9L 2G75B 5ITBH 1A4KA 2YWYA 1U4FA 5DK2A 4G8AC 4AYFB 4Q52A 4ZUUB 1QATA 5ANMB 1V27A 4HS3A 1VPOH 4QRPE 4HC1A 4M7JH 2G30A 1EBPA 3PS6A 4E2OA 4OF0A 1HTYA 4APXB 5ETUB 4OV5A 1PZ3A 4QCIA 5JIPA 1OM3H 4L9LC 3PHQA 2B08A 1EJOL 1HSBA 1YY8A 3IJSB 2C26A 4JR9H 2HVKA 1IAOB 1KN4L 5F7UA 3BPLB 1YEKL 3QFGA 4XH2A 4HG4K 2JKNA 3F5WA 3U36A 5J11B 4G9FE 5KVGH 3BAXA 2H1PL 3OZ9L 2DQFA 1BFSA 1O9WA 3MLYH 3HZKB 1CU4H 5FA3A 3ULVE 2AKRB 1FH5H 3WNLA 1U3NA 1W6LA 3T08A 1JV5A 5CGBA 1UA7A 3LPGA 1A3LH 1J9RA 1JFHA 3F7VA 3WNJA 4HT1L 4YSDA 2OR8A 1BX2A 2X4QA 2RBLA 4Q4EA 2VZUA 2HFTA 5JZ7D 2IAMB 1HEJC 1OW0A 4PVMA 4XC3L 4YDZA 4CSZA 2CRYA 1O7DC 1T7YA 3GSOA 3FT2B 2I7OA 1J11A 4QHLA 2GK0B 1V7NH 4X98A 5D5MB 4U0RB 2V3EA 3E2HB 5E2WH 1CLZH 4HCIA 3THML 2AV1A 4I48B 4KVNL 1MN4A 2RAMA 5F0LB 5FB8A 2EABA 1KGUA 2ZD0A 4WWKB 3ZTNL 1MCWW 5JHMA 3F62A 3ZZSA 1AGCA 4OD1H 4CVWA 3OPZL 4LEBA 3RNKA 4EN3B 3IKCB 2WPGA 1UACH 5FFOA 4ZDHA 3P1VA 2XSKA 3FQYA 4I5BB 2WB7A 3H55A 5IHZB 1IT9L 1H6EA 3VGAB 2K3TA 3K0WA 1KGYE 4GQQA 4N24A 4N1HB 1U3YA 4J3OG 1JFQH 3O0LA 2IAND 2QADD 5K59F 5L4IA 3FTWA 4OZGF 1OSPL 2CR3A 2L3BA 4UT6L 3D51A 3ULVC 1SQMA 1GZPB 1B3JA 3GBDA 3JUYA 1JGLH 3F7YA 1KENL 5I6LA 2CO7B 3CFKB 2VXTH 4LSPH 4OF6A 5DEGB 2NY4D 3P9WB 2H1XA 4KK6D 4EUPH 2H3KA 3F01A 2EO7A 1CC3A 3VXRA 1CXFA 2QEJA 2QKIB 4ZQKB 1UXLA 4R3SB 2QZQA 1UWGL 1TNMA 3SPVA 3M45A 4NP9A 1EUUA 4P4KC 3OR7B 3BD4A 1QTSA 4LARH 5ENWB 3GSNH 5JO5A 1N8ZA 3ASWA 3CHQA 1DVFC 1OD9A 1CDUA 4RMTA 3BUDA 2C9PA 4IDLA 3RTQB 4DTGL 3LNEA 4FXTA 1ZLEA 5INCB 3QZPA 2PCXA 2MCAA 1JPFB 5GRVK 3AUVA 4OZHE 4APQA 3UGUA 4EQ2A 1KCKA 4AEHH 3W38A 1HC1A 1UZGA 2CHWA 1ZY9A 5KOVC 1X4ZA 2VLLA 1Z9OA 1NDMB 2EIKB 2LFEA 4FMVA 4FQLH 5FYKH 4XZ4A 4A67A 3FUDA 1MEXL 1I4FA 2BZCA 2AERT 4JL1A 5BOJA 2XXGA 2AGJH 3IDNA 5LXGL 3VDCA 1DZ0A 3P54A 1RUKH 3GSUA 3S3CB 1HHJA 4BCYA 3POHA 4FNRA 4Y5YC 3ZMEA 4BH7A 5EO0B 5CEXA 1N67A 3S35L 3N43B 2H9GA 2IPKA 4QR7A 3N55A 4KGLA 5I74B 3D4CA 4EKXA 1KIPA 1SN2A 3N9GH 1YEHL 4FFVC 4PJ9C 4K5OA 5JHLH 1B88A 3HBGA 2O6EA 4JDVA 1OZUA 1RXLA 1P6WA 4FHJA 4YDLB 3TN0A 5J6GA 5IJBC 3MRCA 1Q0XL 5SWZD 1GCFA 5ID1B 2WQXA 4M3KB 3MQIA 4AKPA 1PIGA 1NLBH 1U8LA 2QHRL 3P73A 4TUUA 1CK0L 3LRSB 4NKDA 3VQMA 1YY9D 3ZL1A 2CLZA 4G80B 4PRIE 4H0GA 1M7XA 1FHNA 4EUPA 4PVBA 1JGEB 2BNUB 3Q01A 4KDVA 1ZT4A 3VFWA 4IHOA 4B9IA 1X7SA 5KVDE 2B9BA 1LE5A 3EIFA 1I3RB 3V6ZB 1TXKA 3QUYC 4YSTA 3SY0B 3GSNA 2MPAH 4JGJA 5B39G 4YGAB 3DUSA 2NUTA 2Q2EB 4PJIE 3KWVA 2Y69B 1HH9B 2XWBB 4GXUM 4UTAH 3HI6H 3N1QC 3MO1B 1UJTA 5LKNA 2X4SB 3FQUB 3K2UL 5BO1H 2D3JA 5C6WH 4LLUB 1CQKA 4Q89A 1KTCA 1A9EA 3I2CL 2OMVB 4MCZA 5M95B 1HJBC 1VKXB 1G7QB 1KJMB 3DBXA 1GS8A 1WH0A 3MOBH 5CIPB 5DC4B 2P7TA 4JRXE 2VLRE 3GUTA 2V2WA 4H8WH 3P30H 3C5ZB 3TYFA 2NDGA 2OBGA 4OZGA 3DX7B 4PJ7E 3QPKA 4JM2F 5D7LD 2NUPB 3CFEA 3DPBA 3RWJB 1ZK9A 1MIEL 4QTIH 5JHLA 5SWZB 4NSKA 4WUKL 4XN5A 2WQSA 3BUYB 4FQJH 2WN2A 3OAUL 2J56A 3LQZB 4PJ8A 1KLFA 1E9QA 2Z1PA 3BIBX 1BZ7A 1A6ZB 1MRFH 2JJTC 3NT0A 1DSFH 3DJZA 1FHGA 4LCIH 1J9TA 1GC1C 1SDDA 1Z66A 2XNAA 3QI9B 3UBXG 1E4XH 4Y2OB 4B7LA 5I6KA 1QLEB 1U8OB 4NNPH 5EUOE 1PYWA 3ARDA 1FGVL 3O6MH 1HHHA 1YC7A 2YSSB 2CO1A 2VTFA 4QRRE 4XN4A 3C6SB 4JFZL 4XAKD 4B5ZA 1J10A 2ZOTA 3LNIA 1LEKB 2EIEA 3KHOA 4K7PX 2ZUWA 5HHVL 3RPBA 3MLRH 4OZ4B 4K3GA 4Z5RA 5GS0C 2ZUUA 4M7LL 4OLEA 2BSEA 2XQBH 2EC8A 2RJMA 5AYUL 5IWLA 1QWUA 1P4UA 1KLUA 3IFNH 4XCNA 5HJGA 2EIJB 4UTAA 1NEPA 4B9PA 4D9QE 3L1FA 5HGDB 1FZMB 4KZEH 5IG7A 5E95B 4X8JA 4DETA 3HKZA 1YMMA 5LO7A 2FD6L 3T0BA 2C3VB 2VN6A 1THCA 4JFVA 4QRPD 1N2RB 3CHRA 3ZZ1A 3WY4A 2ROXA 3CH1A 3E6FB 1QHPA 4OGZA 3MLVL 2DN7A 1PD0A 4O02H 2WTRA 5HDBE 3RWFB 4FF9A 5JYMA 1ONQB 4XMLH 1G7MB 2WBKA 4B6ZA 4PN6A 4G9FD 4NHUA 3REWA 1N6QL 2F19L 2FRGP 4O51B 2X41A 3QA3A 2VLJE 2EDFA 4FHKA 4AZ8B 1OGAE 3ULVD 1V3JA 3QORD 4L9LB 4PUBL 5D8JH 5E99H 3SDAB 4JMNA 3RURA 4JFOA 3WGVB 3QO1B 1A9BB 4AKQA 1S9XB 2EIZA 1MY7A 2OCCB 4WU7A 3IMTA 5I75C 5I76A 2DH2A 3OC8A 3OZLA 2EDRA 3MYJA 5L8LB 2V2XB 2CG9X 4KJQC 4GSDH 4KY1L 1XGQA 3FF8A 5C0IB 2N1TE 3EFOB 4FN0A 2Q76A 1YC8A 5DURD 2VITB 3KDPB 2BDNH 5DMIL 3KPNA 4K2UH 3UFIA 2FL5A 2V5YA 4PGJA 2F9BT 1ETB1 4P4KD 3E3QE 1SF3A 1IKOP 3IMRA 1L7TH 1W80A 1NDTA 4PM1A 5SX5H 1E5BA 5DHYB 4DVBB 4OCMC 2XKSA 1DVFD 4FCHA 2X6UA 4ANVA 4AITA 1J0KA 2CLVB 1RU9L 4ZSOE 3EYSH 4PWEA 1JRHH 2BOBB 4X4YA 4YHPB 3WO4C 5CCHE 4WCYH 1DANT 1KG0B 4WTQA 3WV0A 4Z9KB 3TJHC 3W3BA 4UB0H 3KWUA 5D1XA 1E0OB 1EDHA 1E7UA 2DKMA 4KO6A 3RDTA 5I8CB 3D6GA 4QRPB 4F8QA 4XBPA 1OSZB 5IJDC 1U92B 3CC5A 1LYQA 1QAWA 4OAWB 1XO8A 4QT5B 5I1LA 4A2FA 2BNQE 3PWNA 4Y2NA 5H35B 3HA0A 1AQKL 4GT0A 1MQKL 4KUCD 2VSCA 5TK2A 2WYIA 4P57B 1DQJA 1BQLL 5I8KL 2LQRA 2OMUA 4G9FB 4G1MA 2GI7A 5HGBB 2O61A 4KNSA 3BPOB 4Y16A 4O02A 3TBVB 1RHFA 3T2QA 3P3SA 3MNVA 4FFVD 3T1WA 3MGOA 3QORB 4PJ9D 1S7TB 2ZCLH 3HTLX 3V2AR 5B1BB 3DIFA 2XWCA 4PSPA 4Y1AD 1OL0A 3H6JA 1UD6A 2KHAA 3LOWA 3DHJA 4Q9QH 4IEFB 1E6JH 3IETA 1T04B 3E3QC 1MDAA 3CVHH 5DD1H 5HYSG 5JPMC 2Y07H 4PCTA 5CINH 4BE6A 5IB2A 3N50A 5KSUA 2XG4A 3GBNL 5DURB 4MCNA 3L3JA 3QPXL 3RGVA 4C56A 3SDYL 4ZTPL 2L04A 3QDAA 3Q0HA 3B9AA 4P4KB 4F24A 5F0JB 5BRZE 4PJGF 4P5RA 4EVNA 1DVFB 2VM3A 3MXVH 1S9VB 4TUJA 1H3UA 2BNRD 5ECJE 3QUYD 3D85D 3NUKA 1DQMH 1B6UA 1Q0YH 1UJ3B 5HXMA 3MRIA 1EERB 4PJHF 1KDJA 1F3DJ 2XKNB 1QZNA 3LDBC 4XMKH 1QUNA 3DV4A 1QA9A 1UATA 5JR1L 3BQUC 4MASA 5E8OB 4V33A 4M8RA 2NY5L 2UZXA 4DZ8A 1VFAA 1OY3B 3AS3A 2PLTA 4OLVL 3OKOB 5C0AE 5ESVA 1IAII 3QS3A 1D2PA 2OTPA 4LSQL 4RQQB 4URTB 2LVEA 1ET5A 1S7XA 5DYOB 1NC2D 3PHOA 5JDSA 3LD8B 4UMSA 5JLZA 3FN3A 1WZ1H 1E67A 1Q0EA 4YXLH 2XACC 2DQTH 4YSSA 4OD3H 1JPGB 1QVOA 4GKSA 5C1MB 4HD5A 4PJ9B 1HXYB 3KPOA 3QUXA 3X1FA 5CJQH 5FYJL 1Q72L 4R83A 3R7RA 4GQRA 2E76C 4PRID 3L9BA 3QJVB 2WKGA 3ECWA 1OF2B 2VDKH 1CL7L 3V4PH 1M6OB 4K7PL 1A6PA 3ES6B 3MRPA 4OCSL 1MWAB 4DZBB 3RWIB 5L7XH 3VFGL 2I32A 2K6WA 2Z93B 4YVNA 3QH3A 5E8PA 2WP3O 3UOAB 3CVHA 3RL1A 5MERA 4LEXH 2V3DA 2YEVB 3ZL4L 4IOIB 2F53A 2XI9A 3G5ZB 2E0PA 1DBBL 1K4CA 3J2PA 3L5WA 3MUZ1 4M4RB 4S0SD 3NIDE 5CCKH 5HPOA 2YOCA 4OZHB 1E40A 4G8IA 5EBGA 4LGPB 2YAFA 1J1OH 3KYAA 1BFOB 1BD2A 2R2BA 5HI5C 3LPOA 3QISA 1FSKC 3QUYB 3D85B 2AQ1A 1WWAX 3QDMA 3NJXA 1IGYB 3CK0L 3FT4A 1JZ6A 3PAUA 2XVKA 2O6PA 1YNKH 5BVPL 5GS0D 4V1DE 2DEWX 3O6KH 1B2WL 3GK8L 5EC1B 2EZ0D 2VLRD 1VFBA 5BRQA 2FLMA 2R0KH 2DWSA 5T1KA 1AOHA 1AKPA 4DCQB 4F92B 1TCRB 1S7VA 3L9RB 4GAYA 1ZV5A 3MOAL 2VDPH 2N7BA 1E8YA 2YKKA 4Y5VC 3TT1L 1MVUB 4WUUE 1NC2B 2GJ6A 4DN4L 3BAYA 3ZHLA 2IH1B 3C2AH 3H0TB 4M1CC 1BF8A 4C57C 4HXBH 3BC9A 3PHSA 4Y7OC 3DX4A 4JM0A 4KRNA 2W9EL 2DPKA 2HLEB 4G8GA 4IMKA 4JO4L 4DPCX 2BFVL 4PRIB 1QLRA 2AEPL 3TC9A 3TT3L 4MDIA 3G5XB 3KMDA 2YAHA 3G5VA 4G6KH 3KLHC 3NRFA 1S46A 4F2MA 5DS1A 2J1XA 5DTFA 1L3WA 4U6YB 2VDQL 1PLGL 5F71A 3V4PA 1JHTB 1HT6A 4QRRD 1UM4H 3KWTA 1M4KA 3MCG1 2CKBH 3QSKB 4EI5A 4UQBA 1KTBA 3EUUA 2GEEA 2X2JA 3AS0A 3F6IA 2R69H 5GRZA 7PAZA 2YUXA 3OAWA 3IWVA 4PJIB 1F1GA 4Z7WE 1KIRB 1GCYA 4D3CL 4TL5A 4OUOA 4F9PC 5DRNB 4S1QL 3ZYIA 1KCWA 1AD9B 2V9RA 3FKUS 5D7IF 3B9EA 3EH4B 1GSMA 4PJHA 1CBVH 5H4ZA 4ENZA 1IO4C 2ZSWA 1SXBA 2VQ4A 2IPTH 2P4AB 4OFYD 3SDCB 3MJ8A 4WF7A 3QWRA 4P59H 1RZQA 1G9EA 3BLKA 4JRXB 2VLRB 1BXXA 3D2UD 1QWNA 4QO1A 2J88L 4YJZL 1II4E 2AXGA 3BE1L 3DSFH 3PLYA 3FCGA 4PJ7B 5IQLA 4FDWA 3GMMA 4AGQA 4M6NH 5LG1A 2VMFA 3UAEA 2B1HL 1RUMH 3QCVL 1BVKA 4OCRH 2ADFH 3RI5F 5FECB 3DI3B 3QEUA 3TJHD 3IWUA 5ESQA 4X50A 1EZSA 3VG9C 4UQEA 4UU9B 4Y0GA 5ICYB 4YO0A 3VXME 5JW4M 4M5YH 2VLJD 2YC1B 2O5XH 4KVCL 3ULUH 3NN8B 1NFAA 1B0WA 3VAEA 1W15A 3U83A 3WDIA 1EEUA 4QHUB 3BFOA 4X4ME 4IBVA 3U0TA 4ZX3A 4JZJC 4OLYL 5EUOB 1MG3C 5KVFL 4YHLH 1Z9NA 2OSXA 3V9FA 3SGDH 1U8NA 5CEYA 4NI3A 2ZWNA 3PUCA 3B9VA 1LK3L 4N8CH 4QRRB 1G7LA 1VFMA 1YEDB 2VZSA 3QRLA 1KB5L 5EIIB 3FQTB 5BRPA 1QWHA 1T7XA 4LBEA 3AU0A 3ZQWA 2R51A 3HC3L 1EO8H 3X3GL 1H3XA 5JW5B 5I75B 4W9DC 3QJFB 1J05A 2FHCA 2WMPA 1R24B 2R69A 5CZVL 3UJIH 5I17A 5E1AA 4J5VA 4DPAX 4D0DB 5C9KA 3RA7H 5GGQL 1QBMH 3TBYA 1LO4L 3FH7A 4B9GA 4NUQA 3ZLQC 2OJEA 2DBJA 1PVHA 5IK3A 3BEVA 3FCTA 1S5HA 2IQAB 1LQSR 1NEZA 1KCRH 1HH6A 5KSBE 3T3MF 2X6VA 3BISA 4TVPE 3HG3A 2EVGA 4KUZH 3G04B 4LVOC 2YGNA 3D3VE 2DM4A 4YDVA 4F93B 3WHXA 1K4DB 4H20L 3CFUA 3IGKA 5IB3B 3AXIA 2F68X 5BCAA 4OIFA 5HDBB 3VYNA 2XQYK 4H44C 3BQUD 2W0FB 3CHOA 4AK1A 3GO1H 3B3IA 1KBVA 1YEEH 2YARA 3QGVA 4ABUA 2MNWA 4PP2A 5D93C 1KB3A 4D9LL 2VLJB 1K8IA 3NH7L 5I24A 1OGAB 5K9QG 1WGVA 1DYZA 3V6FB 4E5XG 5KBNC 1JTPA 4FGMA 2HT4C 4YVUA 4KKRA 4XPTH 3Q13A 1ID5I 3IFLL 5DUMH 1L0QA 3M6DA 2E86A 2WXIA 4HDIB 3ZZLA 4WFEE 2F6AA 1PZUB 4YH6A 4OM0L 1E6OL 4I3SL 4PJCF 3AG3B 4HFWB 1F8TL 1CFVL 2AQSA 4KI5E 3PGCB 3TPUB 5H94B 3GI8H 1X5JA 2R29L 4XGZB 1QP1A 2OJZL 3LKOB 2YPLA 1G1CA 1P7QB 5BRZD 1GGIH 3RKDC 3QWOB 4KXZH 3JWDH 2Z8VC 3FRPB 3EZ8A 4MQXC 1QSEA 1SOQA 3JWOC 4B9FA 4LL4A 2HVJA 4ZSOB 4BBWA 1WYJA 4X6FA 2B0SH 3EDJA 4YR6B 3R0NA 1MG2C 5DLLA 4I2XA 4YHIA 2WWNA 3GXMA 1G5GA 4S10A 1GGUA 3MBXH 5EH1A 3AU1A 4TNFA 5HI5D 1XGPA 1MCEA 4KRPB 4JO3H 4LLMA 1F02I 2DIAA 2QVMA 4YL9A 2ZP9A 4QXWA 4LAQL 4F9LA 2BSSB 1BFTA 5C0AD 4NQXA 4QRUA 4ES9A 1Q9OB 4AYEC 4NO5B 2BNQB 3LDBB 1ZTXH 4HHAA 5EBLA 3UZVB 4X83A 4XBGA 5I71C 3RBGA 3CFCH 3B9KB 5I28A 3H3PH 1C5CH 2F1BA 1UQSA 4HSCX 3II1A 1GR7A 1XHHA 4J3UA 3VB9A 3PNRB 1RIUL 4WTXA 2VISB 4WNQB 2WINB 3V7AG 2Q8AL 2BIQA 5EO1B 3W9EA 4E0RA 4BCXA 1OAKH 1NKOA 4TQPA 5CHNA 5AZEH 3X3FH 3U4BL 3RE0A 1G9MC 2CHXA 3HS0B 1CFBA 1TMCB 2QBWA 2C3WA 4M1CD 1MJJA 3G08B 4U3SA 3EJUA 5FYLH 1SHMA 2HLFC 1W72H 2J2ZA 4XNXL 4AGLA 5LDSA 4XPGL 3NIFE 4JQVA 4QRTB 1ND0A 2OMXB 3M7OA 1PLBA 1NPJA 1OKEA 3W56A 3IMWA 1NSNH 3DYMA 4EZJA 2CUHA 4GRWE 4NM8H 3EYUH 2OXGB 3KLHD 1DSYA 2AI0L 4WV1B 3OHMB 5BRZB 3TZVD 3SKJL 4HV8A 4LGRB 1HKLL 2DQGL 1PKOA 3HMWH 1G7IA 1DUYA 1C16B 2W0PA 4OKDA 1XH3A 5TF1L 3MTRA 4AH2B 1ORSB 32C2B 3H9HB 3OQRA 4BIKA 2O6FA 2V3FA 4LBAA 5FO7A 4NUMA 2KT6A 1EAPB 3SE9H 2UZIH 4HIJA 4BZ2L 3I3BA 3IU3B 5J57B 2FAUA 2OCFD 3HC2A 2VXVH 4Z95L 2N7SA 1FSKB 3FUIA 4YMPA 5K9OB 1FP5A 4K0OA 5C0AB 4FP8H 1TJGH 4E68A 3O2WL 1T5WA 3WTWA 1ZIAA 5AVWB 4WUUD 1NEUA 5C71A 2JCCE 4LSVL 1YYCA 4D2NA 3SGKA 2YQ3A 5HHME 2J25A 2QQNL 3DHUA 5IW1A 4J3OH 1H9VA 4WI5A 1PTZA 3KS0H 1M2VB 1C7TA 1NMAH 5TF0A 2FGWH 2QV2A 3CCHA 4NENB 1GTFA 3TA3C 4E41A 5FO2A 2XRAH 1L6ZA 3S8GB 4ABQA 2LFGA 4XNYL 1HDMB 1N5YH 4NRXA 4ZXBC 3FHQA 4AYMC 2H32H 5JORB 3T4AA 5IHBA 5CN2A 4NUGH 1OP5K 1NUFA 1AHKA 1ZLSL 5CJ8A 3WYRA 1NCAH 3IJ8A 5GGVY 3ENEA 4LSSL 1K6QL 2MCG1 1W72A 2AAVA 3VVVA 2UYLB 5HHNA 4FMKA 3V4UH 1OP9A 3DUUB 4QRSB 4GH7B 3NIDB 3WELA 3WFZA 3B1TA 3TZVB 2HB0A 4GW4A 4GG8B 1N7ML 5DQ9A 5D70H 1OGTA 2HG5B 5DFVC 2XX0A 3BVDB 4TQIA 3NCBB 4FQ1L 5F6HJ 3RGHA 4GXFA 4YSAA 2D7OA 2R0LH 4BFBD 3CPLB 2A9AA 3C5JA 3NJGA 1UXWA 4V1DB 2PCYA 3BAJA 1INEH 2OSLB 4BWUA 1OD7A 2P9RA 2VO8A 1WBXA 3O4LA 5E8NB 3ESMA 4RDBA 1B2YA 1MF2H 2BP8A 5KANI 3N44B 4OM1L 5E2JA 1KCUL 5DJZB 4LO9A 2V5MA 4WUUB 3LEVH 3ZO9A 5ADPH 1E43A 1FAKT 1Z32X 1FJ1A 1VSCA 2ZKYA 3NJNA 3CN4A 2QVKA 3MOQA 6PCYA 4U1JA 5B38G 3AWEA 4LHUD 1Y6KR 3MRFB 3SE6A 3VXMD 3SPGA 1B4TA 5GZNC 1CD0A 2XA8L 3BGFC 3GSWA 3S36H 4F37F 5E9DA 3QZNA 1URIA 5DZLA 3Q8EA 3R06A 1X7TA 2IH3B 4J12A 4EBQH 3A4DA 5SWSE 5AAMA 3NTCH 3VFRB 5D71H 1E5ZA 2PR4L 4ZMYA 2ED6A 4D0CB 5KSAA 3FQNA 5AZ2L 5CD3B 1N0LB 2DMKA 3HIZA 1OZTG 3ARGB 3JWNE 4NFBA 2H32A 3F7KA 1BQUA 5INDA 5DHEA 5DD0H 2R1WB 4RH4A 4Z7VF 4HYTB 2GEQA 1A6WH 2HT4D 2X7LA 1I1FA 1VGEH 2AABL 4JZJB 3WY2A 4B97A 2IGLA 2F7IA 2BHFA 4Z7WB 2BP0B 2JB5L 3JYBA 4NLAA 5FHAL 3ZL2A 3ESVF 3UIYA 4TQ8A 2GAZA 4KDTC 2O72A 3UPRB 5DFAA 2CGZA 2WSDA 5LQBH 3QIBA 3WEXB 5B3SB 3FTXA 4G8EA 4LSUH 1D5ZB 5TDNB 3VXNA 4DGIL 5B3JF 1XAKA 2P42B 3FO9B 4LDEB 4NP4H 3E80A 1OT1A 3WFCL 1VB9A 5A1AA 4J2QA 4HJGB 2X09A 3IBOA 3L4UA 1JNLH 2X4NB 3VWJA 2LU4A 1NMCC 5JQHC 1IEAA 2CIKB 2J73A 3RKDD 3H2QA 4LDOB 1MCOH 4R96A 1QHOA 5E5MB 5DO8A 5F70A 4L0YA 3S8WA 3U0WH 4MQXD 2MHAA 3KLSA 4R5XA 1A3RL 1TZIA 3MA9L 4WY7L 5BMFL 1NDGB 4MAUL 5HYFA 1NKGA 5TE7H 3MN8A 1FE8L 5B1CA 1H3PH 3DX2A 3MX0A 3C9NB 1ZHBA 5FUOH 4A7SA 5I8OH 2YD7A 3M8OL 1E8XA 1A1OB 1Z5YD 1EJ6A 1UEYA 4AUUA 5KYUB 3VXMB 4KMLB 4LVOB 1YN7B 1I3VA 4QYOB 3E1F1 1F11B 1TFPA 5IVNA 3DTUB 3JWNC 4YXHL 3TF7C 4AIEA 1ETJA 1E2ZA 5KN5A 1CDJA 5EDSA 3O3DA 3VYOA 4I0KA 1I9JH 1P7BA 3NJIA 1SVCP 1JV2A 1TKWB 2ZAGA 3P0VH 4CILA 3MKGA 3GMQB 1G9NL 4GW1B 4PB9H 5HJ3B 5DFWH 3DJTA 3OLGA 4WFED 1TITA 2VRQA 2J5LC 5DJ0A 3RPKA 2F7QA 1FVDA 2Y1ZA 2RFXB 2WKOA 1ACYH 4AQ8C 5D9SB 3CPUA 3K4DA 2VDNL 1KV7A 2CO3A 2YRPA 5CEZL 4LCYB 5LG6A 3W2DL 1E4XI 1EJOH 1SJHA 4FNSA 2HLFD 3DNKA 1EHNA 1UADC 2FX7H 3O6FB 2IALB 1XGYH 5GGRB 2EDJA 3BCDA 3WFBL 3WENA 2G60H 3JTSB 5KVGE 5KYYB 1DE4A 4R7NA 4KVPA 4P04A 3VXRE 1OW0C 4N26A 3F7RA 2F5BH 3VM7A 4EAEA 4I8DA 3OPUA 4WWOA 4O2CB 4OFQA 2ZPKL 5KSBB 5B39A 5ILTL 1A25A 3OB8A 3ZRFC 3UMTA 2AJSL 2OZ4H 4B0MB 4ZFZA 4HUNB 2MPVA 4O9HH 4EZMA 2X4OB 2DWDA 1MCIA 3D3VB 4IIQA 4NPJA 2YPKA 3NACH 1S8DA 1O6SA 3IS1X 1T83A 3TPKA 3Q2LA 4GRMB 4V2CB 5G55A 2EDYA 1S7RB 3UTTD 2NQ3A 2ZP0T 4EQ3A 1C5DB 4RGNC 3HN3A 4QXGL 2AP2A 2HJFA 4JPIA 2LLLA 4KZCA 1EPFA 5CN1A 4GP4B 4UYPA 2FWSA 2KC0A 1MNNA 1DBJH 1CXEA 3ATFA 3O9WA 2VSMB 4FQQB 4R7DA 3ZTNH 4YXKL 1I7UB 1FZJB 1BZOA 2NPLX 3GHPA 2P49B 3OPZH 4XWGL 3QUKA 3PQYA 3BWZA 1EGJH 3H2PA 1LMKA 3P4MB 5LB1A 4EO5A 1G1KA 4Z77A 4Z7VA 3TA3D 2VJ0A 5FA4A 3WE6A 1G7JB 3CFDB 4XO3A 1AXIB 2IMNA 3BPCA 3TV3H 3HNSL 4NUJA 4L3CB 1YUHB 4ZXBD 3UADA 5HPMB 4AT6A 3UBXA 1IM3D 3CLWA 1KCBA 4IKJA 3SDXF 5IEHA 4JFYA 3RTLA 2X9YA 5IB5A 3H9YA 3HPJA 1OHQA 2EDQA 3P2BA 1D9KA 3QQ3B 3SKUD 3LPPA 1REIA 1KBGH 4U7MA 4NAQA 3VFMB 3OKYA 3ZR6A 3H3KA 2XV0A 4CDGC 4KQ4L 1TQVA 1B0GA 3HZ3A 3CVBA 1WGOA 3QEQA 5DFVD 2O6DA 3COOA 4M9OA 1S6NA 1LDPH 3LKQB 2KDYA 3NJVA 2L0DA 4F7MB 1E9PB 3RWHB 4IDJL 5I66B 2KQNA 1FNHA 4PBWD 5DMYA 1SN5A 2BERA 3V52L 4UV4L 4U6VH 4KJWC 1DANU 1MHHA 4NFCA 3MGTA 3RWEA 2TAAA 1JTTA 5FGBC 3HZVA 1UUSA 5SWQB 1WFTA 1GJIA 1G7HA 4KNTA 2DQCL 5F9WB 5J9PA 3PWUB 1FNGB 3S37X 2WYTA 3WNPA 3CGTA 4XN8A 5GS3A 3GKWL 2FH6A 2VB5A 3E6HB 1BOGA 1KXQA 4W6WB 2CXGA 4RFEB 1ZSDA 3TN0C 2WLHA 4ISVA 4MJJA 5DDHA 3ZKQD 3NIFB 1MW0A 2NW2B 2OZNA 2XFGB 1ROWA 1W16A 3QWNA 2B39A 3OKNB 2ZYHA 3TA3B 4IYKA 2BC4B 2CA4A 3GXNA 4GAAA 1EGJA 1T4WA 2NSQA 2QDWA 4GRWB 4ONHA 4RGOL 4ZXBB 3WXVH 3AAZB 4K71C 3WIFB 4DW2L 3RUGE 3WKNA 5KVEL 4NQVA 4JEGB 1E5AA 1GA2A 2X87A 5I16A 3QCUL 4PGZA 1KPVB 3S3DB 3T2PA 4HUWB 1T0NB 4YX2H 1OVZA 3MRKA 2ZX8A 1JPSH 2A5UA 3UPCA 3EBHA 4OJCA 1QI5A 5I6MA 3GJEA 3V5KA 3FAXA 2DJ4A 4S11A 2VC2B 3ZHKA 1KBBA 1SOKA 1TTCA 4EXPX 1SEBA 3B2UC 4O4YL 5LBVA 4ZS7H 1J8RA 3CFIC 43CAB 4N87A 5DR5H 3MRRB 3ISYA 3V5HA 5J5EA 3T3PE 2OKMA 1KPUB 2QQQA 1H5BA 1T1XB 1ZVSB 3RX9A 1USZA 2NYZA 2WQVA 3KPQB 1IFGA 4GKNA 1JK8B 1MFAL 1OB1A 4E9RA 1INQA 6FABH 2JCCB 4G5ZL 3GMNB 2CBOA 2FWUA 5LAPA 2WWKO 2JFCA 4PTUB 5HHMB 2DOCA 4A04A 3U48A 4MA7H 2OL3H 3KBPA 1AFVL 4P2OC 5J8OA 4LE8A 3GJFK 1HE7A 1TPXB 4AWJC 2YGVA 5J1AB 1RURL 3DRQB 4KXAA 5T3ZE 1OPGL 4WGVB 5FPIA 5SWSD 4D0BB 4U6TA 3JBG7 1YMME 2M8XA 3CHSA 4GG6F 2XN0A 2HUHA 4QUOA 3ZE0E 4FXKC 3ZSTA 3QXVA 3BGFB 3PL6C 1LNUB 3QG7L 3STZB 2VN5A 5ITFA 4NRZB 4NXSA 4TUOB 3L3HB 2OR7A 2UY7A 3R7QA 3ZR5A 5CJOH 3QIWC 3VQ2C 2F5AH 3OXRA 4ZOBA 2FE0A 5IJVB 3U7YH 5KW9L 4HKXA 3KYMB 3SO5A 3EHBC 3H7BA 5HGGS 3UO1L 2G5BB 4HW6A 5HYSA 3SE8H 4KNQA 1SDAB 1KXVA 2GCYB 3LQAL 4L1HA 1CDCA 1DN0A 2HYMA 3MODH 2A1WL 1KACB 3ZT6A 2Y7QA 4JG9A 5JOEA 3BVWA 1RULH 3PWVB 4MZ2A 4PLNC 5IWLC 4I1PA 4JFPB 1T2XA 2F08A 1FGVH 3L9EA 3KPMA 1T7VA 1W9XA 1S9WA 2CGYA 2HJLB 3INUL 4I1NB 4N0FA 5D7SH 1EZVX 1UXSA 4ZPTB 1J1XL 1NMCB 2NZ1A 4MS6A 2BOLA 5EU5B 1CICB 2CDEA 3T8MA 4C4BA 2FBJL 2EDMA 4LLQA 1B0RB 3EOTH 2HFGL 4J27A 5F7FA 4PIBA 1PLAA 2AV7B 1HXMB 4MBOA 1NINA 4G71B 4FZ8L 2V0AA 4JHWH 2FJHB 3AQXA 3K7UA 4ETQA 3NCFB 3OKLB 2FB4L 4MJ6A 4A6YH 3QJOA 1QQDB 3FB5A 4X7TA 5SWSB 1DP0A 3ARBA 4AXWA 1C08A 2A74C 1P2CA 1PPIA 3WNKA 1NOFA 1A4KB 2DQJL 4MXQC 2ZUYA 5EN2B 5DK2B 1HILB 1FO0L 1HVXA 2J7LA 5D1XE 5AW2B 1H19A 4HS3B 3AY4A 3FH5A 2C4FU 3HKFA 4BWWA 1NANH 2XBZA 2XTLA 2E8YA 3AG2B 3OLDA 2ZWKA 4QCIB 3PHQB 4HH9A 1FGNH 1WICA 1YY8B 2R4SL 4LLVA 2YA1A 3B83A 3BKMH 2HVKB 2VUYA 4PWHA 4XH2B 4BUQA 1CE6A 3U36B 3F5WB 1Y6MR 2DM3A 4ALAH 4BRVA 4Y9FA 4AW4A 2ZXGA 1QTYT 2X3AA 5KWYC 1H3WM 5FA3B 1D5IH 1S5IL 1JZHA 5TDOA 4DQOH 1JV5B 2SEBA 1PCXA 1KCVL 4J2XA 3MNWA 3TH2T 2CMRH 1JZEA 1T03H 1BX2B 2IG2L 2A73A 1F6AA 2KDGA 3K4ZA 3WY1A 4L4VA 1ULVA 4GAGL 5CSZB 1AH1A 3AWGA 1BHGA 5BV7H 4XCEA 1UZ8A 4YLQT 5IROC 4HG4J 2VW4A 3RJOA 5E8DL 3CX2A 4LEEA 3CXFA 2P48B 2DMHA 1JWUA 1VHPA 4XXDB 4C56E 4QOKD 3GSOB 4L1BA 2Y1AA 4RMUA 2ATAA 2XIIA 2R0WH 3HHRB 5DMIH 1T21B 4QHLB 3O11A 4X98B 2H3NA 1OP3K 4WVRA 1NCOA 1HHIB 4HIPA 4XVTL 5D1XC 5FM8A 5EIVA 4MMXC 3BN3B 2X53A 4X9GA 5FB8B 5F3BA 2BRQA 2A3TA 3A4AA 3OG4B 3CZNA 3ECBA 1UWEL 3CJJA 4GUPB 1AGCB 3BUPA 3I9AA 3VQLA 2NT1A 4KJWD 4GUQA 3MJ9L 3RNKB 1KDIA 2LVCA 1KJVA 3GXPA 4JFDE 4PRNA 4QYAA 3PIQB 4ZDHB 4A6YA 3BAEH 5I1KL 2X0VA 2Q7AA 2BO0A 1CYGA 1IBFA 4J8QA 3VXUA 1JCVA 1Q9WA 3DSNA 4NBXB 1E27A 3TIEA 1HOCA 1RZ8A 1JP5A 2IGFH 2Y7MA 3DOSA 1OOAA 2UUDH 3D69A 1I1YA 3MCYA 4JY6B 5HVGB 1JVKA 1N59A 4FQXA 5JW4Q 4H1LG 1JXDA 4D8PB 1KCLA 2CNZA 4L8SA 5AOIA 4Q2ZA 3TN0D 1J8SA 2D03L 3FRUA 5A16A 3UG5A 2CKNA 4Y4HC 5MEQA 3TO4A 1BQLH 2WWOA 5IBUG 4DGVL 2NYYC 3LX9A 4OY9A 3NVQA 5JW4R 5CJBA 2BSBA 3G9AB 3RG1C 1G7PB 5LN8A 3VXRB 3MRDA 1XSJA 3HS8A 2Q7NA 4N4YB 4X5WA 3CBKB 3QW9A 3U30B 3ESPA 3EF4A 1ZVNA 3SPVB 1AG0A 3TJEL 2PCPA 3RHWF 4AVIA 2V9UA 3KWXA 4LPCA 2XCMC 5JO5B 1ZDQA 3GLZA 4XODA 2DF3A 2BVYA 2B77A 3BSZH 1HQ4A 3CFQA 1CLVA 4XO9A 3WOVA 1FA4A 2F53E 2ADYA 2J4WL 2VABB 3B2UD 4JAMA 3TURA 2W91A 1CGVA 3MR9A 4APQB 4F27A 5JIIA 3L1EA 3UYRL 1HYSC 5ACZA 5DT1H 2GT9A 3DROB 3PE9A 4ZMPA 4H88L 3IFOA 3QRGH 3QDME 5F7BA 2C9VA 1NA8A 3KE0A 3G6JA 1I4FB 1PJ9A 1RJLA 2BVPA 3IDNB 1IC1A 2ZXCA 3FUJA 4X6EA 3GSUB 2EIMB 4QRBA 4YE4H 5EU4A 3MBWA 3S0PA 4XP4L 2PCFA 3QPQC 1AQHA 3VU1A 3EGXA 5JR1H 4P2OD 3JV0A 2IPKB 3EBGA 1I9RH 4PJXF 1PEZA 2NY5H 3SDDA 2FWLB 4ZZFA 3QUXC 4K23H 2WO3B 4JDVB 1A7QL 4NZUH 4ZUTB 1OF0A 2JI1A 3TN0B 1J12A 3B9DA 5J6GB 4QRAA 3MRCB 3ML9A 3TGXA 2WK2A 4N5EC 3WMSA 4JZOB 3QWQB 3ARPA 3BKCH 3C75A 4CUCA 1K85A 3UTSA 3B7TA 5L2JB 4X8XA 4D7PA 1U8LB 3STBA 3VUAA 4G8GE 2Z31C 1N64H 2Z8WC 1SM3L 4NKDB 3AADB 4K71B 5A43C 3PWJB 5KEZA 4FRWA 1DQLL 4KRMB 4EUPB 1F2QA 5BXFA 3QAQA 2L7QA 1Q9LA 4LSRH 5B1JC 5DVNA 3EHBD 4XP1H 4HOZA 3VGEA 1ZT4B 3VFWB 2FATH 1CDBA 1X4XA 5K93A 1CL7H 1CFNA 2FX9L 3OB0K 4IHOB 4OCSH 3WE1A 1LE5B 2HKFL 1VEPA 3D50A 4KXZI 2Y72A 3VFGH 1K5NB 2PWFA 4JHZA 3S2AA 3ILQC 4I9WE 4H5SA 4MAYA 2NUTB 3BSZA 1PY9A 4C4KT 1J86A 3Q8AA 1DBBH 2PETA 5F89A 2HTKC 3VX0A 4F20A 1HCFX 3JVFC 1RJZA 2WVSA 2Z1KA 2BLFA 4YAQB 2XN2A 4MCYA 5E2TL 4HZAA 3MBEA 1A9EB 1FLRH 1MFVA 1DLHA 5T3ZD 4JFQA 4PWKA 3GINA 5HY9A 1YMMD 5KG9A 2P7TB 3PY9A 3A67H 3GUTB 2V2WB 3T2OA 1KEMH 4P2OB 3EO9H 3TYFB 5AVUB 2JKWA 1JZ7A 4MA8H 1UOLA 3CFEB 1DVUA 3U6RA 2VAJA 2OK0L 4IMKC 3BFQG 3ATEA 3JTTA 2H0PA 3RUGB 4E5XA 4WI2A 4MZRA 4MXQD 5JA9A 4NSKB 2XN9D 4UM9A 5EZLA 2HFFA 3MXWL 1SYVA 5IHUH 1KLFB 3B6SA 2I27N 3BRGC 1BZ7B 1KN2L 2J1YA 3AT0A 4R5VA 1SDDB 3GXDA 4N8UA 2XNAB 1MCDA 2WNGA 1K72A 1RKRA 3RVTC 1BBDL 2HFEA 1MCHA 4NQSA 1ZJAA 5GISL 4ORGA 2MSPA 1ZXKA 1F6LL 3TT3H 3EHBB 3ARDB 2R15A 2IEPA 1GAFH 1HHHB 2QPSA 1BXVA 5T8IA 3T3PB 4Y1TA 1JYWA 2MFNA 2Y4SA 1VERA 2JVUA 4QKTA 5KS9B 1XCTA 4PWIA 4BGDA 4HPYH 2YR3A 3ARWA 3F6LA 4JZNB 1JZ8A 1PZAA 1GW6A 3HR6A 3WFDH 1INDL 1IGMH 4RLDA 1T4KA 2D3NA 2FVNA 1EMTH 1XSOA 4PYHA 4UILH 3L2MA 4X4KA 1TZOA 4X7FC 1AO7A 1KLUB 2YS4A 5D2NA 3N06B 7FABH 5IROD 4HCRH 4XCNB 2YK1L 1BVLB 1NIFA 1H8OA 4PD4K 4X8JB 2W0LA 4Q9CA 3SY6A 1YMMB 2QMJA 3OKMA 3T2LA 4AJ0A 3CQQA 4GQ9H 1GGBH 3OJMB 3U1SL 1CF1A 3FRPG 4UUJB 3DHPA 3ZE0B 5D1XD 3K5RA 4IBLT 3RQ3A 1HINH 4JPVH 4PJXA 1GGTA 2CE6A 2FR4A 4EMZA 2JTDA 2DJUA 3CH1B 3A23A 2WM0A 1FN4A 4CKQA 5C07A 1NCCH 1DEEB 3NCMA 2VR4A 1IKFL 2WTRB 3QCVH 5AOJA 2XN9B 4J3VA 4P5TA 5DXWA 3RB7A 5F6IC 4NHUB 3REWB 3W9DB 3IRCA 2HZHA 2NCEA 4FYRA 3WLWC 1DUZA 3HG0A 1LO2L 3T1FA 4U05A 3KCPA 2JKIS 4HJJL 3GRGA 4PY8I 4JFOB 3ULUE 3HRZC 3KYNA 5DGQA 4MXVF 2XWTB 4N8PA 2VLME 4WU7B 5I76B 1P84K 9PCYA 4Y4HD 2H0FA 2YUVA 3GLDA 3MYJB 4OLYH 4BFGA 4XB8A 2NYYD 4LDLB 5FUZH 2IAAC 3E9UA 4M43L 1XGQB 4FQ2L 4FTVA 1ROCA 1XF2A 4DO6A 2FO8A 3O3EA 1S3KL 4PTTA 3ZT7A 4C56D 5ICUA 3AQDA 3HC3H 3ZKXC 1YSOA 4HX1A 2C9RA 2R8SH 3MLZL 2YPLE 1D5XB 2CZNA 2I9LA 2Q9OA 2GBUA 4ZTOH 2E75C 2K8QA 4FOMA 3KGUA 3NEXA 1QSEE 3MKKA 5CZVH 2B59A 4YC2C 3QCTL 5CFAA 4X4YB 4HCRA 4L3EA 4H8UA 2CRMA 4NZ8A 4JFDD 1L4IA 5JXAL 5D1XB 2ZYRA 2EICA 3RFRA 1AXTL 1ML0A 3CC5B 4JQIH 1U36A 5CXPA 5CILH 3CQFA 2IH9A 3WUZA 2IIJA 3PJNA 3HLAA 3PWNB 4FA6A 4AMKH 3DGDA 2UVEA 4QNPE 35C8L 5JQ6L 3PABA 1TVBB 4IJ3B 2PW2A 1DQJB 2O61B 2JJSA 4WI6A 3QPQD 4G1MB 2R4RH 4ZFFA 4A7QA 4Y16B 1BZ8A 4O02B 4N3TA 3OJ2C 4XVSL 3TX4A 3JT2A 2RCSH 3MNVB 2FO1A 3MGOB 2EVFA 3QUXD 2VIRA 4MD5B 3RL2A 3DIFB 5AVTB 5ERWA 4RETB 3BX7C 3OR6A 3TFBA 4J4PA 3MV9E 1MRDL 1DFXA 3ERXA 4N5ED 1Z5HA 2Y1YA 1NJ9B 4Y4HB 3IETB 3IK2A 3X12B 1CR9L 1F4YH 3H85A 1T22A 4FYTA 4OQ1A 4C54A 5F9JB 3P0YL 4ZD3H 5KSUB 2D73A 2Z31D 3N43F 1E6OH 2XG4B 4Z78B 2E6QA 3N2JA 4APXA 3EOYG 2NLJA 1TEGA 3VSVA 3L3JB 4WKXA 4C56B 4NB7A 2FECI 5A6IA 1AQ8A 1WFIA 4ODSL 4UYQA 2P80A 3SZKC 4OF8A 3D05A 5E7FA 4P05A 2O5YL 1WUZA 1XF1A 2CM5A 3KL5A 4MYWB 3MRIB 3ILQD 5EZPA 1UGKA 3MI6A 3Q43A 4JFDB 5DQJA 3DV4B 2HTKD 1QA9B 3DX6A 2JKXA 3IJEB 1UD5A 3MNMA 4J7RA 2OQJB 4RX4D 5E5LA 3S48A 2G9HA 2UZXB 4DZ8B 1VFAB 1MFNA 5T1KD 1ZV9A 5B38A 3V10A 4MAZA 4HOWA 1YEJL 1F42A 3BGAA 1RVFH 2GY5A 3SPJA 4LIQL 4JQIA 3EBAA 4E9YA 5I18L 5I26A 4N0UA 2HPOA 1S7XB 5D2LE 1BIHA 3MLWH 4M8UA 1JL8A 2AJYL 5C0JB 5JDSB 4XNUL 5D72H 4HIXL 1ZXQA 2C9QA 2AJXL 2NCMA 3KPOB 3QUML 3QUXB 4YS4A 2XLLA 4G8GD 4TPRH 2VDOL 4ODXA 2XZZA 1BQSA 1NCDL 2AMUA 3UBXI 5IR1A 1JI1A 3IKCA 1NLDL 3ARYA 1QASA 1QNZL 1A4JA 3MRPB 5GIRA 4B9KC 1URLA 2BCKA 5T1DH 2PWGA 3B3BA 2VXQH 2JWYA 5DVKA 1OQOA 4M03A 3NP4A 2Z31B 3QH3B 5E8PB 2VDRL 4XPGH 5FYLE 3BWUF 3RL1B 5MERB 4Z3JA 1GZPA 3JWDC 4JG1H 2XTJC 4GOSA 2F53B 3RVTD 1K4CB 3L5WB 5I73C 1F5WA 3DK2A 4GSQA 4KKAC 4PW3A 4Y9GA 4G8IB 1OOWA 1W8NA 1IBHA 4E9QA 1WS8A 2WCGA 5EOTA 4PRAA 3QDMB 2C4XA 2XZCH 3BWSA 1NM9A 3FT4B 4G42A 2FBRA 1QFOA 3QWRD 2YA0A 1FIGH 3NSDA 3SKMB 3O4LE 4K3JH 3RJDA 4BZ2H 3SGKC 5T1KB 1T89A 4OJAA 5EULV 1P4IL 2JSFA 4GAYB 4OLUH 4UQCA 1QR4A 3M17B 5HDQH 1NGPL 4FAAB 4P48A 3QZOA 2KH2B 4KDWA 4ZMAT 4GMTL 3WDJA 3T4AC 3CXHK 1QBLL 2VCOA 1A7PL 2QQNH 3BKJL 4G8GB 5E9DE 1TJIH 3GHBL 2C3XA 5T33L 5IVZA 2LW3A 3FH8A 1BREA 1QLRB 4A2HA 3D7PA 2DQHL 2WQUA 1G1OA 3NIGE 1XCWA 3G5VB 2MCMA 4EDWL 2BMKA 3QEHA 4LHUG 4EIUA 4XVJH 2X2HA 4W9GC 5DTFB 1OAXH 1WJ3A 1YCSA 5EO0A 1U3JA 2VDKB 1I8AA 1JZJA 1KJ2B 2RQEA 4UDTB 3ZU8A 2IANA 3WLWD 3LS5L 2XZAH 3L4WA 3BP4B 5DC2A 4EI5B 1U8MA 4CGTA 4HIIB 1MCKA 1ZVHA 1L9NA 2MQ3A 2VXQA 4LSSH 2LAGB 5E6IA 3UROR 1PMYA 3BUQA 2W65A 2HTLD 3QHTC 1IGTB 4XHQA 1QI3A 3GFUA 1PSKL 1N7MH 2FBOJ 2WYHA 5EZOH 5K1NA 4HUUA 3OHXC 4QJ5B 1QLEH 3BDBA 2YXVA 3HRPA 2ZSWB 1KELL 3ZBMA 4AIXA 5GHWL 1Y18A 2QMKA 3OVUB 1YG9A 5D7HA 2BNUA 5CZRA 4AGNA 4QO1B 5HVHC 3H53A 4BFFA 3S34L 2VR5A 2EE6A 2AXGB 1CVSC 5LCVL 1G4RA 3DTDA 4WNSA 3VDAA 3RPIB 5H2BA 4F8OA 4LRNL 3GMMB 4BZ2A 1AGFA 3SY0A 3OJDA 1RIHH 4J3OC 3C5SA 3UXFA 3UMNA 4RIRA 4KMTL 3EUDA 4KHTH 2VDPB 4EPSA 1ACCA 5ESQB 3ZYJA 4Q9RH 3SBQA 5I5JA 2APBA 4G5AA 4YO0B 2XN1A 1IFHH 3GUFA 1XB8A 3HOGA 4HA1A 2X4SA 2TSBA 3ZRCC 1BVNT 4RESB 3X13A 1F3JA 1X9UA 2OMVA 2Z64C 3NPSB 1G7QA 3U0TB 5D1ZC 4G6FD 4YPJA 4FTDA 4GP5B 2VLMD 1BVNP 1U8NB 1KB9J 3LZPA 4HWNA 5CEYB 2NY3C 4EDXA 5LJYH 2KERA 1S9KC 1G7LB 1RI8A 1RZJH 5LAXA 3CIAA 2VH5H 1BQ5A 1ZLUK 3EZJB 5D4QA 1IZKA 4U1SB 4MRBA 5DWPA 1AZVA 2X4UA 3PHAA 1T3FA 4HQQL 2HWZL 2XWEA 3HE6C 5DUPH 5SWZA 1J05B 2YPLD 4K3EL 4H7VA 4E9TA 4X8GA 5I17B 5AYTA 5E1AB 4HF5H 5TQ2H 2GABA 4IKNA 3AUWB 4TRPL 3BP6A 1A6ZA 1TYRA 5DLMH 3HMXL 5I8EA 3SPHA 3TBYB 3CVIL 5LN4A 4HWEH 3ULVF 2ZXAA 1DBAL 3CN3A 4ZUVA 5ADOH 4XNZB 1N6VA 5CU5A 4NQCD 4Y2OA 3ZKXB 3FCTB 3WFCH 1NEZB 4P0DA 2BVEA 4JM4H 3HNTH 3VXOB 4K9EL 1U8OA 1RMFL 1TQUA 4LLWA 1KBKA 3I9GH 4YC2B 4XAWL 1E2VA 4YDVB 4Z7AA 1A3RH 2EH8L 2YZ8A 3OC5A 1AKJA 1JPEA 2IPUG 1XTMA 1YEFL 1FE8H 2C7FA 5KJ4A 1IMHC 5EWIL 1NGXB 5FW7A 2E27L 1NBYA 4PLOB 4KK9C 3B3IB 3BEWA 4L5FH 1U6AL 1A0QL 2BINA 1A65A 2ICCA 4PP2B 1I85A 3VFUA 4NZFA 3QHZL 4I85A 1NAKL 3CWGA 5GRWA 5HGDA 1FZMA 1K8DA 3LKSB 2Y22A 4UV7H 5EU6A 1AE6L 3MV9D 1FZOA 3MHZA 4P9ML 4XNQA 4BSJA 3KEDA 3AVEA 3R8BB 1F97A 1XEUA 3KYKH 5GSRB 3VWKA 1G9NH 3CZSA 4M1DH 3PDDA 4FQCH 4ZG1A 5D7LA 4KV5F 4HEPG 4TVSa 4Y88A 2LTQC 4PCKA 5IFAH 2WBJC 3AJ7A 1CE1L 5DJ6A 1KXHA 4KUCF 5CEZH 5MHSD 1RSYA 2YHGA 2YPLB 1ONQA 5DD6A 1EX0A 5F2FA 2IBZX 4CDHA 4FLRA 1QSEB 3O0RL 4XI5D 4CMHC 1HYRC 4IIQC 4L9LA 2VZ3A 2XTJD 4X6FB 3M7FB 5I30H 2G0LA 1T83C 2AJ3A 5L4MA 3KHQA 3IYLW 3QO1A 3KM1A 4AL8L 4KO7A 3O3BB 1I8UA 3QEQE 2J1WA 2M2DA 1XGPB 2DYPD 1F41A 5ILTH 3U9UB 4LLMB 2AJSH 3CIQA 3U4KA 4H8PA 1R3IH 4QRUB 3EFOA 3ARQA 5DZ9A 2HT2C 2VITA 4HHAB 3EFDH 4KOBA 4HJUA 4XBGB 4ZX5A 3O9WC 5E5UB 3ETBF 1DJSA 5I1JL 1QFUL 2B2XL 2Y24A 4OZHF 1A7NL 4MVBC 3UDWA 5DHYA 4TLTA 9CGTA 3W9EB 1BAFL 1I53A 3AGWA 4TF4A 2X4TA 4YFLF 3KG5A 1P69B 4IRJC 5CHNB 5FGRA 1UKSA 1RK1B 3MV9B 4NWUL 4G7YL 1KXQE 4YHPA 5B21A 3WIHH 1AAJA 1SYSA 4OT1L 2H6OA 5AYQA 3SIKA 2A4CA 1A14H 5E1GA 3KLQA 3RILA 4N25A 1MJJB 4U3SB 4YXKH 2J2ZB 5IBTH 3ABKB 3VXSA 2BW5A 1AHWA 2XUWA 4NQEE 3IJ9A 2CBPA 4LMQI 4QRPA 1ETZB 1ND0B 3W11C 1SXCA 4UI2A 3QK0A 1HX0A 4P4RA 4OAWA 4K07A 3ZSSA 1X3DA 2DH3A 3OGCA 1U8IA 4G6JH 1EH9A 1ZHLA 4UOW0 5H35A 3X11A 3ATAA 1HWWA 3VFTA 4HV8B 1R0AH 2QVTA 1F4WL 2CIIA 2SODB 4KO5A 4CVZB 4ACTA 1EHXA 5DRWA 2Q10A 1G7IB 1DUYB 4MKMA 1XH3B 3NRPA 1W8EA 2GUOA 3T4YA 3W5NA 5FO7B 1GPOH 1UG9A 4J3BA 4XMXA 2VE6B 5DHDA 4KQ4H 2OULB 3QJTB 2ZOUA 2WXLA 2H41A 1T04A 5JMRA 1NGWA 1HIMH 2BRRL 2YRZA 5EF2A 1FYTA 1NMBL 1T6BX 3GJFB 2Y23A 2CWRA 4Q0XL 4BJLA 1RV6X 1NBCA 1T5WB 3CBRA 3VFVA 5JOFB 1J9QA 2R39A 2XV3A 3P3RA 1S7QB 4JQXC 5D2LB 4AYSA 3S8FB 5L9DL 4P4KA 1M1XB 3D39A 4XR8C 2AJVH 4PJIF 3GQFA 5BPPA 5LDUA 1DVFA 3WUWG 2DQCH 1TYJA 1PG7H 3CCHB 4HSQA 5E9DD 1ZRUA 2BCMA 3FCSB 4H1LH 4J3OD 3VG0H 5FEBA 5D6DC 4N1CA 4NRXB 5AWNL 4O2EB 4MDRA 1AJ7L 3ZTEA 3N1MC 3T4AB 4JO1L 1ASOA 2DI7A 1Q9KA 4DNLA 5TPWL 4Z3EA 3EYQC 3MRNB 1S9YA 1W72B 3OKOA 4GLRH 4PJ7F 3MNDA 1QEXA 4M48L 5HHNB 1WLHA 2LE9A 1EQWA 4N2DA 2A4EA 1I8IA 4RQQA 4YHKH 5D1ZD 2E4FA 3I6KA 3JV5A 5GPRA 2A9BA 4GW4B 1SLWA 4Y5YA 3L08A 5DQ9B 5KVEH 3HCVA 1OGTB 3K71B 3SYOA 3GGWB 2YD3A 2NY3D 4YHMH 2WQRA 1JPGA 4FA8A 1FDLH 1OCRB 4K8RL 3KJ6H 3O45B 4XMUA 4PJ9A 1HQRB 1ZE3C 2ZUQB 2KLRA 4YSRA 1LQBC 4F58L 4AG4L 5EZIH 1PDKA 4Y1AA 1UXWB 2BSDA 3CV5A 4HEMA 3REVA 3MRHB 4ZX4A 2EO1A 3NG5A 1HE8A 3ES6A 1WBXB 1GC1H 3O4LB 3EYVA 4OD2A 5EUOF 4S1DC 5KYNA 1JYNA 25C8L 2R56H 2X2UA 3ZQXA 4Y1SA 1IQWH 3QR0A 4W9KC 5IVXA 1P0SE 3CVDA 1QUPA 1ERNA 2YN5A 4QLRA 3VD1A 3MLUL 5MEOA 2ATPA 4IOIA 1FL5A 2FT7A 3L45A 4ZAKA 4ZMOA 5HVHB 1NCHA 2DZEA 2EQDA 1FJ1B 3K2KA 2DM7A 5E2VH 4U1JB 5EU3A 2C9XA 4B3VA 4PBVC 4NM4L 3GSWB 3WJJC 2BNRA 3NFNA 3J27A 1F58L 5E9DB 5GS0H 4AV5A 3QAZB 1IC5H 1IGCL 3R06B 2X4PA 5K9QI 1OO2A 1CZ8L 1R5IA 5A3IC 1RURH 3DRTB 3L6FB 3EH3B 3ATDA 3GMOB 3GZPA 3NIGB 2FWOA 2CD0A 3C6LC 4HHGA 3BPNB 4MB1A 4TSBL 4U33A 4H1LA 4KK9D 1BQRA 2NDFA 3FQNB 5LWYL 4MB4A 8FABA 4X4XA 5EMYA 2H32B 2HA1A 3B7UX 3UZEC 5INDB 4TOYL 1TCRA 3DARA 2EH7L 2KQMA 5KJRH 4EKJA 3U2SA 4G7VL 1RZKL 2X7LB 1E42A 1OHZA 5FYKU 3QR2A 1MVUA 2P24B 3QXWA 4DUWA 2YD2A 4G43A 4YWGL 3P2DA 3U9PL 1NFDE 5HDBF 2XU9A 2Q3AA 2YMXL 2GAZB 1TUPA 2GTZA 2NY3B 3QQ4B 3PU7A 3QIBB 5JOPE 3T2NL 3SOBH 1H8NA 1O5PA 3APNA 2EDHA 1CL7I 4K94L 4LPWA 3VXNB 5T5NF 1U2CA 1IGFL 1XGTA 1YLBB 3CSYA 3LV3A 3MV8D 1R34A 4L48A 5AAWC 2OR9H 1LILA 3NAAL 3O2VH 3G5XA 4ABWA 5I0VA 4W9JC 2WGNB 4I77H 4R96B 4F7PA 2IXQA 2A0LD 2WLIA 1XF4A 4L4VE 4U6YA 2MHAB 1A6UL 4BGLA 1TZIB 2JJTA 5AG8A 3QZWG 1YJDL 3IMBA 1JHTA 4NBYB 3VCLA 4HUMB 2J6EL 2YD6A 1GGCL 1ZT7B 3MX0B 3N5AA 4PHZA 1ZHBB 1JMZA 3IDJB 5KBMA 3FUNA 2FT6A 3WD5H 3HPLB 1IVTA 5CM1A 4JJ5A 4Z3FA 4OCYL 3D87B 4URKA 3QQ9C 3RNQA 3NJFA 5T3XD 4NT6B 1MWAL 1AD9A 4JMXA 4CADA 3AABA 5B8CA 4NWTL 3NCYS 3Q9QA 2HT2D 2JJVA 4FZ8H 5KN5B 1SGKA 1TZGL 3O3DB 4N2NA 3O9WD 2FLBT 3B2XA 3TO2A 1JV2B 2CQVA 2IQ9L 3RIAF 4MVBD 3VXUE 1NFKA 2EACA 5DJ0B 2NW3B 1FVDB 3KL3A 3BT2L 1OK0A 1RHHA 4PG9A 4AMWA 4IRJD 2IOMA 1FZKA 4A1RA 1MXDA 5EEZA 1WT5A 5IW3A 4MRCA 1FFNA 3T9WA 1WTGT 43C9A 1OSEA 3FO2A 4BZ1L 1KULA 1CYXA 3PGDB 1SJHB 5PCYA 1UD4A 3O2DL 5HDLA 2B20A 4EZKA 1GOFA 5ICYA 1RZ7H 1LO3L 1WAAA 2P52A 3W11D 4LMQE 5C8JA 3RI5K 4WW1A 1DE4B 4R7NB 4AEIL 1S5IH 3V95A 4P23A 1GYCA 3K6NA 5JUEH 1WVZA 5B39B 4N28A 5EUOA 4GBXC 4IKKA 2Q86B 4AQ1C 2EECA 3GI9L 3E8UH 3QEQD 4X6CE 3BZEA 3BZ5A 4ZFZB 3UBHA 3WKMH 1U3ZA 1N5AA 1NFIB 1ZOXA 3CFNA 2DWDB 1L9QA 2BIOA 2PTVA 4QRRA 4G9DA 4IIQB 2I85A 1NGQL 1U9KA 1S8DB 1PCSA 1O6SB 1CD9B 1I3UA 3BQVA 3ZKMC 1OB0A 3BVTA 3S37H 2CGRH 5JW5A 3O81A 3M1BB 4ERSL 3UP1A 2IJ0C 4X8CA 1FFTB 4PRPD 3CN0A 2EIDA 4YDMA 2EP6A 2WW8A 4D0DA 1RK7A 2L7EA 5KVMC 3IMUA 1E4WL 1OAYL 3PP3H 3G6JE 5JQIB 3R4RA 2AMGA 2EUWA 3O9WB 4FQXC 1GIGL 1ZHNB 3LVEA 4YHOL 3OTTA 2IQAA 3FONB 1MFBL 2WP3T 3D2UA 4JN1H 2BZDA 3I3DA 3NA4A 3QUKB 4XZUA 4LVHC 3BRDA 3HFMH 2CK0L 5I1KH 4X6BA 4NQED 3TO4C 3ZY7A 1J8HD 4Z77B 1FNAA 5FA4B 3WE6B 2ZCHL 2ZX6A 2AQ2A 1F90L 4HK0B 2FCBA 3BPCB 3D07A 2CHNA 2IFFL 1MJUH 2WV3A 5E4OA 4NUJB 4YUEL 3UBXB 2VO5A 4S1RL 5IREA 4RDQF 3H42L 4FYQA 4A66A 5IEHB 2W0FA 1N19A 4JFYB 3KPSE 2Z91A 2D03H 1CFTA 2DWXA 1CT8A 3UTSE 4NZRL 5IB5B 1ZA3A 2MJWA 3HPJB 1L9OA 5KZCD 3EYQD 2VLJA 4RA0C 4B9JA 1UA6L 3N1GC 4HLZH 2HT3C 1D3CA 1U42A 3I6LE 3JVGC 4JGUA 2X1PA 1B0GB 2EIBA 5BQDA 3DO7A 4LCWA 3TWCH 2NZIA 4W4NA 2EDLA 5LGYA 3QEQB 4HDIA 3CX5K 4YGVB 3OSVA 1UVQA 3MV01 3VFOA 2F8IA 5EUKA 5TH2A 3VI4E 3QEGH 4LVEA 4N9OB 4WIQA 2MRYA 2V37A 4YPGA 3TPUA 3JT0A 1ZD6A 1Z6JT 3RDJA 3PYCA 5H94A 1ZHKA 3L17A 2ZQKA 3NBNA 3RGBA 1XIWC 1MHHB 3ML8A 3RWEB 4PJEA 3CH8A 3NIDF 1T1ZA 2PXYA 3HZVB 4S1DD 3BW9A 1G7HB 5JPMA 3QWOA 2C7UA 4XMPL 3TF4A 2P1YA 3FRPA 3UP6A 3UYRH 2D4FA 3VH8B 2EYRA 2XVGA 3SDDC 4KXBA 3FCBA 5CR1A 4X0KA 1BOGB 1ZSDB 5JMOC 1BG9A 3PDOB 1I8MA 4JDTH 3KW7A 5E2UH 5JXEC 4ISVB 4KOCA 4WSGA 3K6FA 2VGLM 3X1NA 4ZS6C 5DDHB 4DFHA 3ATBA 4NQEB 4B9YA 3TU6A 3A6CL 3ULSA 5GJSL 3BAKA 4H0LC 1KGCE 3N44F 4FYSA 4HUCA 4W9CC 5A3ID 3V4VH 4M6OH 4ONHB 7CGTA 3C6LD 3VD3A 2P43B 1A7QH 2BY2A 3S96A 4NQVB 3BQUA 4K5LA 5I16B 1YYLH 1GSKA 2HUEA 1PBYA 2DW5A 4ZFGH 2M26A 3FTZA 4WNQA 5KZCB 5EEYA 2JNZA 1QABA 1BG1A 2ZWZA 4Q6IA 1R19A 1A1MA 3NFSH 3ARVA 4N2HA 3GJEB 3V5KB 4NJ9L 1FORL 2JK5B 4HAFA 4POYA 3LMJL 1SEBB 3O8XA 4KHXL 1X5GA 1DQLH 1G0XA 4QJ3B 3KLKA 2WXQA 3CDFA 1J48A 1ZEAL 1IBGL 5FW8A 5LLIC 1MFEL 5GJTL 3BVNB 1QW9A 4OCNC 1FV1A 1IBBA 4JPWL 5HDOA 3NCWA 1H5BB 3U7WH 4GKNB 4HU2A 1GJWA 3DX9A 4ANWA 2ZSVA 3H9ZA 1INQB 2OP4H 2OXGA 1MNUL 1TETH 2ILLA 3LAFA 4Z7WF 2RR3A 2X2YA 4IBUA 3TBSA 1AO7E 5HD8C 5JHDA 5D2NE 1I1RA 1C16A 3A4EA 2I9TA 3EYFA 3Q6FA 4AH2A 4S0TD 1XDTT 3H9HA 3CU1A 5E2TH 2V4LA 1JPST 2BH0A 3FT9A 5I1IH 3RVXC 1BCIA 3QFDA 2NY5C 4UIMA 1EXHA 2DQEL 3QQ9D 1OARH 4CKVX 1CDYA 3VGGA 3VGHA 1JHKH 1OCWH 4NKMA 4PJXE 1MUJB 3ZX1A 2F8XC 2A9NL 4WW2C 3WIAA 3I50L 5C0AA 3TH4T 1H6UA 1YN6A 3LEXA 3ZKND 3V7AE 2WXPA 4NLHA 1EBAA 2UY7B 5C07E 3E8VA 3C6LB 3OXRB 1RUAL 1TLKA 2OK0H 1JGDB 4M9PA 4HKXB 3V4VA 3TJPA 1FYHB 3B7RL 4HIEB 2JXMB 1H8SA 4JM2C 1BM3H 5JOPD 4BQ6A 5JA8B 2WBXA 2DTML 3F65A 5IFHL 1TOXA 2BP3A 2DJSA 2NY6C 3LZFL 4Y5VA 5AKTA 5IOPB 3KPRD 1CF8L 1HDMA 2HXAA 3H1ZA 4QKXB 5FW6A 1DN0B 1HZKA 5IHWA 1UM5H 3G6DH 4HPHA 2Y7QB 5AW8B 4WEMB 4G72B 1C7SA 2W07A 3GZOA 1JVOA 1EZUA 2Y06H 4FNUA 4FTVE 3C2SA 4XPHL 1DDHA 4FX5A 1S9WB 5DVOA 4IHBA 1UXSB 1WEJH 3SB3A 4ZOCA 2DQUL 5IQ7L 4RMRA 1ZDSA 1INDH 4LLQB 2D2CC 5FHBL 3MA7A 2QFPA 1JS4A 2Z35A 3T6XA 4PW9A 1ZLWK 4ZT1A 4B96A 1A7OH 2BWIA 1NCBH 3ZIMA 2LLGA 4ETQB 4MJ6B 5EN3A 4QF1A 1ZWIA 4TNGA 5GGUB 4ELKA 4QY8A 3ZKMD 2YK1H 4L3EE 3CPLA 4X7TB 1MCSA 3ARBB 3W57A 1C08B 1MKFA 1P2CB 4UTBH 3V9CA 4QRFA 4HHWA 5KSBF 1MHCA 4P3CH 4F9PA 2X3BA 4RMVA 3ETTA 1BZ9A 3PG2A 4MD0A 4ZNEA 4HD9A 5I1GL 4I3RH 2EADA 1U8JA 4FQXD 2Q20A 4HH9B 4G2AA 4XE0A 4OCLC 4LLVB 4WUUA 5C0CD 3WSQL 2EXYD 5JW3L 1CE6B 1NFDB 3UZQB 5IQ9A 1IKFH 1T5KA 4DGWC 4IS6A 3TO4D 3VFSB 3RU8H 1TZHA 3VFPA 3P02A 4M7LT 3S5LB 2NNRA 2PP7A 1AZRA 5TDOB 4Z76A 3SKOA 1SBSL 2SEBB 2B1AL 2IH3A 2VXSL 2DMGA 3MNWB 3W0WD 3LNDA 4JNXA 2XXFA 1ORQB 4LXFA 2V2TA 2LU3A 2QR0B 4D0CA 1MAMH 3POCA 1J18A 4M1GL 4F37K 3L54A 2WXRA 3VRLE 4L4VB 1ZPLA 3BJLA 4OB5L 4TNWF 2B4CL 4F91B 3F85A 1QKZL 2NZ9C 4NFDA 2GSGA 4XCEB 3TBWA 3CMOL 4M43H 5JDJA 2HT3D 4KI5F 4RRPG 1WAEA 2XIBA 3G7TA 1K5WA 4R4FH 1IBYA 4HKZA 5DEFB 5H4YA 5KTEH 4XCYA 2YJLA 2BP0A 4P2RA 4WEBL 3M1CA 1YEIL 2VMDA 2J44A 4PY7A 1WWWX 4LEOA 3WEXA 1RZPA 4FZEL 5F3BB 4U7SA 4HCGA 3ECBB 3LZRA 4NGHH 3UJTH 3KBEA 4W68A 2P28B 1XIWD 2PMZA 1IC7H 4FFZH 1KJVB 2IWKA 4PRNB 4S1SH 3JWOH 3PF2A 4A6YB 4RMWA 2IADA 3NZHL 1NGYA 3CDCA 4M5TA 4UT9L 2AJUL 2JJSC 3VXUB 5FFLA 2JIXD 2JQAA 1Q9WB 3DSNB 3TIEB 1E27B 3CZLA 1FAIL 4P9HL 2HKHL 2YKLH 3DOSB 1EAJA 2EE0A 2B3RA 3SDDD 3D69B 4ZODA 1I1YB 1VENA 5TE6L 2HX8A 1AZBA 1N59B 2A99A 2FJSA 4FQXB 4KWUA 4OCWL 4Q58C 3LH2L 4W6YB 1A6VL 4N0UE 4Q2ZB 1BOYA 4PG2C 3FRUB 4LVHB 5A16B 5JXED 4ZS6D 2KI6A 4YE0A 3NJHA 4IU3A 1VESA 3KPSD 3TO4B 4LHUA 1YN7A 1IAIH 2YD8A 4QYOA 5F7AA 1F11A 2E47A 2C3HA 3II3A 1T6WA 1RZIA 3RIFF 3ZZQA 4U6XB 3MRDB 4KROC 1JMXA 4YN3A 3WIIH 1L0PA 4DEUA 1ZPUA 4DSYA 3FHEA 4N0YL 1TKWA 4KKCC 4OIAA 3GMQA 4X6CB 1GYWA 1KNOA 2EILB 2KYIA 4TXVB 1AGDA 3LHPL 3NIFF 3QNYB 1G9MH 2WWMC 2RFXA 4GPVA 4UAHA 4OI9A 2ZX7A 5T5FH 3P0YH 4AVHA 5F1IB 3I85A 1SNRA 3FU5A 5EOCL 4LCYA 4RISL 1YYML 4GRWF 2APFA 1MQ8A 1LO0L 1J0YA 4PVNA 1EXUA 3MR9B 3Q6GH 1XXDC 4ZOAA 2OI9C 2NY0C 5ACZB 2GT9B 4F57L 5HI4C 3MREB 3L81A 3IFOB 4FE9A 4KKPA 1PS3A 1DQIA 4Y19E 3G6JB 3ARTA 5KYYA 2X44D 2WXJA 1Y1UA 3QUHA 1XIWB 4GEJA 2BVPB 5EORH 3L2LA 4OGQC 8CGTA 4X6EB 5KSBA 5EU4B 5DEJA 3MBWB 1CGXA 2PCFB 2JIXB 3MJ6A 4FFZA 3EGXB 1IBZA 4GXVL 5I9QC 4ZMVA 2YFNA 1KLGB 2Q1EA 4DVRL 4WENB 1KGCD 3SDDB 3U79A 1AY1H 3NOIA 4Y89A 3LS4L 3RVXD 5FUCC 3B2PA 1YEJH 4GRMA 4AC2A 1BGXH 3V79C 1V7ML 1KFGA 5TDPB 5HDRA 1LP9A 5ANHA 3EFFA 2JCCF 2YSTA 3KPSB 5KBPA 4F7KA 3UTSB 5CMAA 1XR9B 3VO0A 1AIZA 3MZGB 3UAJC 2ZOKA 3FSZA 4NO3A 2AJXH 3U9WA 1FPTH 4ZK8A 4OJDH 4HZLA 2P3YA 5TTRA 5AZUA 3WEOA 1CXIA 4FQQA 4WEUD 1OPOA 5BXFB 2EYTB 3ULAB 1NCDH 4WHYG 4IRZH 4LCUB 2NYKA 4HFUL 1QNZH 2W9LA 4JM2D 2QJDA 2BIIA 4OGYH 5I1AA 3LCYA 4HLEA 1XF3A 2IANE 3QHFL 3VI4B 5KYWA 3WO3B 2NY6D 2J12B 2Q8BL 2VDRH 3IDXH 4YZFE 3MFGB 2GC7C 2EEAA 3OZKA 1TSRA 4ILDA 2A83A 4NDMB 4RMSA 1C1EH 5T5FA 2Q3ZA 3HFFA 4OTXL 4UOQA 5F89B 1W0WA 3DGGA 1WHPA 3FMGL 4WLCA 5F96H 1RJZB 4R84A 4JO2L 2AAAA 1AO7D 5IGXH 4ZW6A 1T89C 3GWJA 3SCMC 3WJMA 2J20A 1IE5A 3MRMA 1QPKA 1SLUA 4Z0XA 4AGPA 1UM6L 4JFQB 3L3OC 5HY9B 1V05A 1RD6A 3C8DA 3OBAA 1J1PL 5KG9B 4MNQD 1KEGL 2ZOLB 5GGRY 4HAGA 2XHNA 3BDYH 3LKQA 4NO2B 3ZJAA 2W81C 5FKAA 1CLOL 4XN7A 1JD9A 3U6RB 3ZTDC 4XC1L 3JTTB 3S98A 2H6PA 5C07D 4E5XB 4O58H 4YK4C 3C09C 4ODVL 1NGPH 2DL2A 3UTTA 2WXHA 4F15C 5HVWA 1TJHH 3ZYOA 3GRBA 3G5YA 1SYVB 1N0XH 3B6SB 2OPCA 4WW2B 5E9NA 2VDML 2BSRA 4TVPL 2DY2A 2VDLL 1FNGA 5IMMA 2CDFB 3K6DA 1B4JH 1IEBA 4Z8FH 5E6IC 2VMCA 1F4XL 2HFEB 2JCWA 4HEPA 4NQSB 5T33H 3LNGA 4RFEA 4ORGB 5C0DA 4XMWA 5TJWK 1M71A 2V17L 1R47A 5F6HI 2DEXX 4IRZA 2WSKA 3OMIB 2NY6B 3TA3A 1XCTB 3GIZL 1XGUA 2DWTA 4KU1A 4L3AA 4JKPH 5CLZA 1RK0A 3ZYZA 2OTWA 2DDQL 2DYRB 3O4OC 3APFA 1T4KB 1IM3A 2Z34A 3MCLL 4HWUA 4BDVA 1SY6H 3U46A 2VL5B 2Z7YA 4HJSA 5AOMA 1T0PB 1KPVA 1DLFL 2Y7NA 1AO7B 2NZ9D 5D2NB 4F8LA 1T0NA 4KTYA 1W0YT 1IV8A 4L29A 1YEGL 3QDJD 4RBPH 1JERA 1X5FA 1QTPA 2NY7L 1CCZA 4W9ZA 4QEGA 1D2OA 2IDTA 2VRAA 4P5MA 5AOZA 1DVYA 2ADJA 4L3ED 4FFYH 4ONGH 2A9MH 3OKMB 1KELH 4NN6C 3FTSA 4MJ2A 3UTZA 4OGXL 1MFCL 3GTVA 3PAVA 4ORZC 3F64A 3MRRA 4PJXB 3OGOE 4CGUB 1I7RB 3R1GL 3S34H 2FR4B 4PCSA 4WO4C 2DLFL 5I0XA 5SV3A 1JNJA 4TNVK 1SPDA 1FN4B 5IQOA 5C07B 1G1YA 1BMZA 3QQXA 2E5EA 3FU0A 1WIPA 5HHQA 4P5TB 2ZUSA 1XGRA 5HGAA 1KT2A 1MY5A 4PD4J 2DQIL 4PP1D 4PTUA 3UL4A 3N1PC 4PJAE 2ZP8A 2GYSA 3UAAA 1OAZH 4MSWA 3T1FB 4GAFB 4ZFQA 2F7PA 1D7BA 1YNTA 1FCGA 2K45A 4UNIA 3WS3A 3KCPB 2ZCKH 5EU6E 4GLRI 3AB0B 5CKGA 3KYNB 4XO8A 4YHYB 5J7CC 4D0BA 1AGEA 1G6RH 3JWNH 4XP9L 3UG4A 1C8QA 1DFBH 2NXYC 4B95C 5GZNA 3CN2A 1BDYA 2EC9U 3STZA 4FTVB 1XF2B 4TUOA 3L4TA 5D7LE 3MU3A 3O3EB 4JDZB 5FIEA 1TSHA 4PTTB 4YSQA 5C6TL 4B50A 4OFDA 4AJYV 4KKCD 1MAJA 2UVFA 1XH0A 2VKXA 2ZKHH 2I9LB 4GMSL 4WNJA 1KCSL 5ALCH 1UYWH 5DK3A 1SY6A 1HL9A 4PBXA 2IFGA 1DJHA 4BQ8A 4ZRGA 2WWMD 1DBKL 2EE2A 2WY3B 4BINA 5DQDL 4TRPH 2AXFA 3HMXH 3UBGA 5AW4B 4L3EB 4WTZA 1OLLA 3VNYA 4LAJH 2A6KB 4LQFL 4XMVA 1SOSA 4HXAH 4ZPVB 1WQVT 1WCQA 2NY0D 4KDTA 5I15H 4RMQA 5CGYC 5IIEB 2QGEA 4FFYA 2ED8A 5HI4D 4XXWC 1FNSH 2GSIA 3PFUA 3WUWA 1KJ3L 3HLAB 3TA4D 5AVZB 1E50A 3FSAA 2EH8H 1XVSA 3DK0A 5EU5A 2PW2B 4AUYA 5FM5O 1A9VA 5EWIH 3L3IB 1YNLL 2VC2L 2R59A 5G5DA 3K2IA 5A2BA 1CUOA 2AV7A 1L7IL 3CN1A 1LXMA 4MQ7B 4L5FE 2VIRB 5CZXC 1IB5A 1SZNA 3RL2B 4JRFA 2NSXA 1O7DE 5ERWB 5ACMA 3QHZH 3OR6B 4O5LH 2WZ0A 4J3SA 4KPHH 4PW4A 3R8QA 5EN2A 4HKBA 1HILA 1F3RB 1P5UA 3VXSE 3L8QA 1T22B 1G6RA 4AVKA 2K3HA 3UAJD 1AANA 2WLLA 4KX8A 2DQDH 3BZDA 5L6YH 4DO5A 2CO4A 3DC0A 2NLJB 4LP4A 2MIZA 2J8UA 2YA2A 5FCUL 5JNYA 1JI2A 3W1ZA 3VACA 4NZTH 3RY4A 1KB5B 2ENSA 1PD6A 2ZJSL 5C2BL 1EEZB 1CE1H 3GHEL 3TCXA 1XZWA 5DMJB 5CEZE 1OV8A 1ACZA 3C5XA 3ORJA 4AQ8A 4UZSA 1WFUA 4Y19D 3V0AC 4P5KA 3O0RH 2P8MA 4OQTH 2WTOA 4A2EA 2N4IA 2J8HA 3LRLA 5EHFA 2GTWB 5DQJB 1GKEA 1ZVYA 1P4LA 2G4EA 2NY0B 2OI9B 3DX6B 3HMXA 5TD4A 3CFBB 2J21A 5LXVA 4QXUL 4XO5A 2G9HB 1HEZA 5CSZA 3UDWC 1A4AA 2A9CA 4FERA 3SCMD 3WBDA 4C83A 1FYTE 5B38B 1QSZA 3OKEA 5TE4L 4F3FB 3NPZB 4DKTA 4XXDA 4G7QB 3G6AA 4N0UB 3VW3L 3VMNA 1JGIA 4OCXH 3WFEH 1NZRA 1J5DA 3D39E 1T21A 5I9QB 1CDIA 3KR3H 1HHIA 2CJTA 2GQHA 3L16A 1AHWC 5FO9A 4FL4C 2MKWA 4N0CC 3R18A 4QTHB 4OVUA 5B4MD 3HB3C 4ODXB 4L0ZA 1G9NC 1SQ2N 2XJKA 4GUPA 5IR1B 4X6DF 2EKJA 1A4JB 1N6UA 3PIQA 2CBMA 5GIRB 5FWRA 2BCKB 5KYXB 1CWVA 3RP1A 3N40P 3GSRB 2WO4A 3WXWH 1GL4B 4KV5E 1X5YA 4N6QA 4K15A 4GQZA 3CC1A 2WOYA 2WWKT 3BJ91 4PGCA 2WVVA 4JY6A 5E6ID 4HOXA 4D8PA 1BWWA 2AK1H 1S4IA 5DK0A 3RUGF 2R2CA 2E56A 2E6PA 4WFHE 2WNXA 4X9YA 2YAPA 5EOTB