4F2EA

Crystal structure of the streptococcus pneumoniae d39 copper chaperone cupa with cu(i)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
b'GAMGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGMNMMHGKMIVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CupA
publication title A new structural paradigm in copper resistance in Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal transport
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4f2eA00
3CG8A 1W6LA 4AKPA 1SNRA 1V55B 4WKXA 5B1JA 1L9SA 3ABMB 1JZIA 2PPEA 1TEFA 2AZAA 1NICA 1NTDA 1SFHA 1ZDSA 2IWEA 3N2JA 4A2GA 3OMAB 5I6LA 3FSWA 2BZCA 2YAOA 1E5ZA 4JHVA 2WO3B 5IY5B 4GYBA 1PNDA 1AG0A 3IN0A 5B1JC 3NJGA 2RACA 1BYOA 3NSDA 3CVDA 3NJMA 2PPFA 1L9PA 2MRYA 4DPAX 1A4CA 1CURA 4YSSA 1JXGA 1AG6A 1JZEA 1AANA 4F7KA 4NERA 3ERXA 3AG2B 5AFAA 3NJKA 1GYCA 1IC0A 1A4BA 2FJSA 2PPDA 2DWTA 5TK2A 2QPEB 3IE9A 4HZ1A 1XB6A 1XMEB 4YSRA 4BWTA 3NSYA 1ZPUA 3GXUB 1I53A 2FWLB 1MDAA 5B1KA 1JERA 2IWFA 3U25A 2I85A 3X1FA 1BXVA 2BZ7A 4GP5B 2GC7C 2FQFA 4DP9X 2GB2A 4E9YA 1CC3A 1J9RA 1WA1X 2B3IA 1NWOA 1KCWA 4BWWA 3D12B 1WS7A 2IDUA 3T6XA 5AKRA 3ZDWA 4KO9A 2HX7A 3KW7A 4DP6X 4E9TA 2R7EA 3T6VA 1KBWA 3RYMA 4AI7A 2BWIA 2FT8A 1B3IA 1WAEA 2X88A 2FTAA 3EHBB 4GP4B 1RKRA 4Q89A 2UX6A 3QJUB 2BP0A 2ZWNA 3ZX1A 4HCIA 3PCYA 1E5YA 3JT2A 4YL4A 1JXFA 4KNSA 1KDJA 4E9QA 3NJFA 2UXFA 2VW6A 1E30A 4JHUA 1GY1A 5I6PA 3OM3B 2BP8A 2TSAA 4MFHA 2AVFA 1ILSA 4YSEA 3PAUA 1OCOB 3OQRA 9PCYA 3FYIB 1ASOA 1WA0X 2XXFA 3DTUB 1KGYE 1PAZA 2DYSB 1AZRA 2W88A 2GSMB 2FT7A 4X4KA 1NWPA 3L45A 2HRHA 2YAHA 4UF7C 2IH8A 2W8CA 2PCFA 2XYBA 3WNIA 1KYAA 3AY2A 3NT0A 1ETJA 1URIA 3PXLA 1NPJA 2QPDB 2XV3A 1VLXA 4YSPA 4L0PB 2YAFA 1JZFA 3QJRB 2XVBA 4PAZA 1BXUA 2P80A 4F2FA 3CZUB 1HAUA 5D4HA 4E9VA 1GY2A 2HZHA 3V9EA 3OD3A 2XV0A 1NIAA 1PLBA 4P5SA 3SQRA 2BHFA 4HCFA 3X1NA 2FQEA 2ZXWB 3WG7B 4W1TA 4A2EA 4KOCA 4HHGA 5PCYA 1KDIA 4KOBA 1QNIA 3AG4B 2UXTA 4KO7A 2HXAA 2VM4A 4EF3A 1MZZA 2GC4C 3FSVA 2GIMA 1BEXA 1TU2A 3CVBA 5I6MA 1AR1B 3CDZB 1PZCA 1V54B 3FPXA 5D4IA 3X2QB 3FU9A 4DP5X 2PPAA 1WS8A 4YSQA 1ET8A 1QHQA 3T71A 2YAMA 3S3BB 1AZCA 3AG3B 4BXVA 3EH3B 1GSKA 1ZV2A 2YXWA 4QKTA 4JKNA 3UACA 1X9RA 4ZK8A 1HAWA 3WIAA 5B7FA 3NJNA 5I28A 1TKWA 3TASA 8PAZA 5B7MA 2QT6A 3NSFA 4A68A 5FC9A 1N70A 2ZOOA 4NB7A 2AZUA 1W8EA 4ENZA 1OOWA 3QPKA 1NINA 2EIJB 2MTAA 4DP8X 4YSUA 2TSBA 3GYRA 3PPSA 2H47C 1L9TA 1PLAA 1CUOA 3TBCA 3G5WA 1SDDB 2OV0A 1ADWA 3TBBA 1JZGA 2CCWA 1SHXA 3UABA 3UAAA 1OE3A 3ABGA 1IBYA 1PNCA 1N68A 2VM3A 2J5WA 3FS9A 1EHKB 1AZBA 2IWKA 2J57A 1R1CA 3BVDB 1A8ZA 3QQXA 2H3XC 4F2EA 1OCZB 5TK4A 3T9WA 1GS7A 3ZBMA 3NJJA 1PCSA 2BW5A 4QLWA 3NP4A 3NP3A 2VW4A 4G7RB 4YSTA 1JZHA 2EINB 4NAJA 2BWDA 3FU7B 2IDTA 1KCBA 4DP1X 1GR7A 4BXSV 1NZRA 3EH5B 3ABKB 3CVCA 1EZLA 4HCGA 1XB3A 1J5CA 2QDWA 1BQRA 1M56B 2DWSA 1AAJA 1MG3C 1CYWA 1SF5A 3GDCA 4A2HA 1OCCB 2AANA 1ASPA 1KV7A 4BDVB 4M4RB 3S3DB 3UADA 2YXVA 1MZYA 1HFUA 3SBPA 3AZUA 1NIBA 5D4JA 2FQDA 3H56A 2GBAA 4DP4X 1PY0A 3EF4A 4AKQA 2OCCB 2EIKB 2YQBA 3BQVA 1WA2X 4P5RA 1XB8A 2XU9A 4HHWA 2IH9A 3FSAA 1JVLA 5I5JA 2HLEB 3NSCA 1E65A 3UAEA 1BXAA 5LDUA 1JVOA 3JTBA 2DY2A 1PLCA 3KW8A 2CBPA 4E9RA 2Q9OA 4A2DA 3X1GA 4AX3A 4GXFA 1FA4A 1AZNA 1J9SA 2CJ3A 4G7QB 6PCYA 3AG1B 2CAKA 2I7OA 3ABLB 1A3ZA 1W6WA 5B7EA 1OV8A 3H4HA 3QJSB 1A65A 1CYXA 5I5IA 5I5MA 2XXGA 1NIDA 3FSZA 4BWUA 2BW4A 2GHZA 5B1AB 1ID2A 1J9TA 1AIZA 3HEIB 1M57B 1BYPA 3WKPA 3OMNB 1OE2A 1SHWA 2JXMA 3CDZA 2P80D 4PCYA 1PZBA 4HIPA 4YSAA 3NJHA 1FWXA 4HALA 1L9OA 1ZIAA 1T5KA 4RH4A 2CALA 1ZIBA 4YSDA 3QJTB 2A3TA 5I6NA 1MG2C 2EIMB 2B08A 4E9SA 2EILB 4YSCA 2VSKB 2VW7A 3IEAA 2XUWA 2OJ1A 1NPNA 1RZQA 1JZJA 1RCYA 3S8FB 1BQKA 1L9RA 3ZIYA 1ILUA 1UATA 1KBVA 4KO5A 4DP0X 1JXDA 4KNUA 3SBQA 1IKOP 4BK5C 2WSDA 5I6KA 2FT6A 1SDDA 1A4AA 2HRGA 2PCYA 4G7SB 2Y69B 1AS8A 2XV2A 4UANA 1J5DA 2PPCA 1YLBB 5F7BA 2IDFA 1IBZA 3X1BA 3DKHA 4UAHA 4FAAB 2LLNA 3QJVB 2NRDA 2UXGA 1AACA 1AS6A 2YARA 3S8GB 2N0MA 2XWZA 3QJQB 1OE1A 2IAAC 1QLEB 4TXVB 6PAZA 1X9UA 3EH4B 1SJMA 3SBRA 5B3SB 4E9XA 2X87A 4YVUA 5PAZA 3FU7A 4A66A 1NDTA 1DZ0A 2GI0A 4N4YB 1F56A 2UX7A 3V9CA 1J9QA 1SF3A 1NIFA 3PAVA 2XX0A 2J56A 4AZUA 1E67A 2XLLA 2H5UA 5A7EA 2XX1A 4DPBX 4DPCX 3TU6A 3H4FA 2HX8A 1AQ8A 1ET7A 2PLTA 2QDVA 4BDVA 1PMYA 3PLYA 1GS6X 2UXVA 2I7SA 3FU8A 4G70B 3ASOB 1DYZA 4A2FA 1FFTB 3HB3B 3ASNB 3IN2A 4FA7B 2AFNA 2CUAA 1SFDA 1GS8A 4AKOA 2YAQA 3WI9A 2JKWA 2IDSA 3FYEB 4W9ZA 3S3CB 2ZONA 2DYRB 1OF0A 4G72B 1ET5A 2R7EB 7PCYA 5I6OA 2IDQA 2Y1AA 4G71B 3FT0A 3AW5A 5F7AA 2HX9A 3OMIB 4GY4A 5ANHA 1AS7A 1IUZA 2PP9A 4CSPA 2BP0B 4K9JA 3T6WA 4DP2X 4DP7X 3PAZA 2YAEA 3UGEA 3FQYA 5EHFA 5I26A 1V10A 3NYKA 3NJIA 1PF3A 1ASQA 1BQ5A 1TEGA 4Q8BA 3WNJA 2BP8B 1GW0A 2VSMB 2Q5BA 4N8UA 1M9WA 4GP8B 3DIVA 3NJLA 2VN3A 2E86A 4M3HA 7PAZA 1RZPA 1OCRB 3X1EA 4KO6A 4E9WA 3FQ2A 4WTQA 1AOZA 2BO0A 4YVNA 2DV6A 1JOIA 1AZUA 4YSOA 2PP8A 1BAWA 3IBOA 3MBWB 2PP7A 2VMJA 3FPYA 5E9NA 2WO2B 3FQ1A 2YAPA 3N55A 4HAKA 3MX0B 4A67A 2J55A 4CSZA 5B1BB 2FQGA 1NIEA 3TA4D 3C75A 4KNTA 1L9QA 2FNWA 1ZDQA 5AZUA 3T6ZA 2JFCA 1PZAA 3WKQA
chains in the Genus database with same CATH superfamily
2IV8A 2N7BA 5CF3A 3GTTA 1NTDA 1SFHA 2CR0A 4OCXL 2ZT9C 4NKOB 2XZAL 5D7IA 4ZUVA 3FCSA 3L8QA 3OMAB 2WNXA 1QVOA 3FO2B 4NZRH 1YUHA 5FYLE 1DBML 1QUNB 2BZCA 4IU2A 4TUOB 1WFNA 4ZZKA 3A67L 5HHMB 2H8PB 4M8UA 4ZUWB 4U4BA 5A2AA 3CVDA 5T3ZD 1XH3B 5DYOB 1HZLA 4X9BA 3FCUB 1PIGA 4PRNB 3DOSA 4P04A 3SGKC 1E9PB 3GJFK 1D5BB 3PWPD 1NCDH 3HNTH 3DX9B 4JDEB 3MRNB 3G9AB 1DVYA 1FV1A 1L5GA 2FJSA 4XWOC 3R18A 1QLRB 4UQ3A 5ICYA 3VE0A 4ENED 1NAKH 3I75A 3ZY7A 2DIBA 3QAZC 3KL5A 1N2RA 1NBZA 3B7UX 5MERA 2F5AL 4RMBA 2X4NA 4L8BB 1JERA 4G6MH 4LGSB 4YLQT 4P3WA 3ZTNH 3N1FC 1YEEL 2QSCH 4NN6C 1A7RL 3Q8AA 2N4IA 3J2PA 4Q9RH 1MI5A 4P46B 2XSKA 1WS7A 1BOGA 1UYWH 2COVD 5C70A 3HB3C 3QQ4B 5G5DB 3FSOA 5ID0B 3HG1D 4G59C 4JFOA 3FHQA 4AG4H 5K1VA 1KLUA 2MNWA 3EHBB 3KGSA 1J7VR 4DGYH 3GXDA 4MJHA 3AS2A 1F42A 4MQXD 5BW7A 5DHYB 2L04A 1G1CA 1JHLH 5I1JH 3G6AA 2NY7H 3U0TB 4PG9B 4I9WE 5I1IH 1RQ5A 1BVOA 4Y9FA 2VMEA 2ARJA 5I6PA 1C12A 2IG2L 3LKNB 4GQZA 4Y5YA 4NWUL 2FO1A 2DF3A 2Y7QA 3BAXA 4WHYG 4WKZB 3CZKA 2XXFA 4YL9A 3ZIMA 2ED8A 4UQBA 5DUML 3L95B 5FUZL 3UJTL 1O9WA 3K0WA 5I1EH 4PJHB 1AZRA 4FI6A 2FT7A 2N0KA 1COBA 1FNGA 3L5IA 4PD4K 4X6DB 5JHAA 3HI6H 2HRHA 2JB6B 3SIKA 4A7UA 1IKFH 4IKJA 4XE5B 4EKJA 2APVA 2AQPA 3LV3A 4P2AA 1DQLH 2MSPA 2GT9A 1XV8A 4MZ3A 4NKIH 2QPDB 1KPRA 2VO5A 4JZOB 4YSPA 4IRSC 3E9TA 5IROA 5T1MA 4KQ0A 5D2NA 4HWEH 4QNPF 5IHZB 1EIBA 1J8HA 3JXAA 2XN9D 1BXUA 3FO1A 1WICA 1WAAF 2HZHA 3I9GL 3QH3B 4Y1AB 5L7XL 4ZODA 3WOVA 2FDBP 3FDWA 1M3IA 2EKJA 2O5YH 4FFZH 4UMGA 4A2MA 3G04A 4NNXA 1MJ8H 1QNIA 5FYKL 3AG4B 1W0VB 3NCBB 1K8IA 4XVTL 2WMPB 3U6RB 3PHQA 4JM2A 3TPKA 5I0VA 1UCTA 1DEEB 3HPJB 5D72H 2H1PL 3CVBA 4Z7VA 1GJIA 3B5TA 3C12A 3CDZB 5D7IF 2VMCA 4XWGH 4YQXL 1T0NA 5C07D 3GJFH 4GAYA 3I2CL 5F1KC 1IGTB 2DMBA 5AW8B 5KUMA 2C1PB 3AG3B 3BLBA 3FFCD 1OP5H 1V3KA 5DQJB 4N2BA 4CNIB 2FYYA 4TQIA 4Y4HD 5LXGL 1S7SA 1SHSA 3QDMD 3MA7A 2WLMA 4DUXA 1LP9E 1FYHB 1FUNA 3HOGA 5SWZD 3C8HA 3EYSH 1UB5B 3JVGA 3PY9A 5LAXA 2VSCA 4QCIA 1BAFL 4GKZA 5IFAH 1FH5L 2GTZB 3SKNB 4A68A 1OL0A 5FC9A 5JOFB 4EI5A 4NB7A 2H9GB 3E80A 2XA8L 4KKCC 2VLKD 1H15B 3Q6FA 4RETB 4XO9A 3DDFA 2EIJB 2OYLA 4PGCA 2AJSH 3GYRA 1LO3L 3TN0B 5CFAA 4QAMB 1Q1JH 1PLAA 4CDGC 2K78A 3W0WA 1AXSB 2X1PA 5FO9B 5HJ3A 1ADWA 1A4KB 1AHWB 1GIGH 4J3TA 4EIGB 4PJBE 2J4WL 4X7EC 5HGDA 3WTTA 1NFAA 5DMYA 2ICES 2G30A 2QTEA 4ADIA 4P59L 4L4VB 5F96L 2IWKA 4JY5L 1L3NA 2GUOB 4P46C 3LZQA 4K9EH 1LEKB 5H4ZA 1LWHA 4F2EA 1JV2B 5BOJA 3O6KL 1E6JL 1CPUA 4Y8DC 1N10A 2EDKA 4PJFB 5DRZB 4ES8A 4K3JH 5E9DB 1QATA 4UQEA 2Q8BL 4PGBB 1I3RA 3EHBC 1USQA 1CLYH 1N0XH 2D7PA 2OS7A 4CW1A 1D5ZB 1EZVY 4HKZB 3V6OC 3M8OL 1IM3A 3GS4A 4OJAA 1NFDE 3IFOB 4MXWH 4AH2A 5F97E 5J1TC 3OAWA 1J5CA 4L8CA 4JG1L 4QHLA 1AAJA 4P2RD 3D30A 4PR5A 1HJCA 3H3KA 2ESVB 4UU9B 1UWYA 3VGFA 5TQ0L 2YD2A 1JHTB 1MZYA 1USZA 5H37G 3V0JA 1EAOA 1QZNA 2YD1A 1BAGA 5GGVL 3QUMB 4QLWA 4UT6L 4D8PA 4HSAC 3EF7A 4NC1C 3NCMA 2OCCB 2YQBA 3ZDYF 2VQ1A 5CGYD 3R0MA 5I1HH 4K55A 4L1TA 1AQKL 3BZEB 3MA9L 1AO7D 3DYPA 1ED3A 5TE4L 1UCBH 5LDUA 3X3GL 2AEPH 3JTBA 1LEGB 5I75C 4N2MA 2R2CA 4RIRA 3DX4A 4MYWB 4PUBH 5H37A 1XSKA 4A37A 2WYTA 2WXHA 3POCA 2C5DC 1A6TA 1NFIA 3S5LG 4G1EB 5J7CC 2YOAA 4OJFH 4UIMA 1CD9B 3FU5A 2CAKA 3BAYA 3CBRA 5DLML 5CINH 4ZNEA 1PFOA 1MCPL 3GI9H 1IAII 4HS3A 1NM4A 4AYSA 4BE6A 1ND0B 3FCGA 5JTWA 2PW1B 3DV4A 1EGJL 2D7TL 3NFSL 5D7HA 4QF1B 4FJ6A 2LLGA 3OMNB 1YNKL 3QWOA 3CHRA 3OKEB 3S5LA 3TNMB 2EUXA 1K8DA 2D0HA 4JM2F 12E8L 1MFMA 3QI9A 3W39A 3DX3A 3WN5A 3DOIA 2GUYA 3A23A 2V7HA 2W92A 2YPVA 1QG3A 4Y89A 2BMKB 4KXCA 2IBBA 5C0AD 4F8QA 4Z77B 3MGTB 3LN5A 2MOVA 1YEFH 3RDTD 4RWYL 3N5AA 1A1OA 4R7DA 2JI3A 3QCTH 3LKPA 3QQDB 3SY0A 3HW7A 3ALWA 5EU7C 4ALAL 4OF0A 2ZUQC 3LN4A 3OAZK 5CP7B 5ECGA 1INDL 5EZPA 1ZE3H 4FZ8L 1MH5B 4JRFA 1VGEL 2QR0B 2V5TA 3MOBL 1ORSA 5I6KA 4OQTL 1EV2E 3WJMB 3NPZB 4LKCB 3WV0A 2EDFA 2YN3A 3DX6A 4JFED 4UUJB 2FR4B 4QHKJ 1KN2H 2BNQB 2ROYA 1T1WA 1CFNB 2UVEA 3K6NA 5IQ9A 1RZKL 4MD0B 5F7BA 3IMWA 5DZJA 4L2LA 3TN0C 4KJQC 4MNQD 1FO0L 3GO1L 2KDGA 4YGAB 4FA6A 4UILL 3T0EA 3WE1A 3TO4B 1AHWC 2ZUXA 5FA4A 4ZMTA 4P2QE 1DBBH 2YK1L 2W0PA 3X14A 4PHXA 1U3YA 1RK1A 1MRCH 3UX9B 2Y5EA 3F7LA 3WLBA 5GHWL 5IMOB 3EOAA 2Y25A 4HFWB 3FQUA 4PWKA 1HINH 5ANMB 4YPJA 4JDTL 4ODVL 1IAOB 4Y19D 1CD8A 2ZOLA 3EYVB 3QUXA 3QO1B 4JKWA 3RWFA 3MLUL 3OPUA 4JHAH 1Z3GL 2XX1A 4DCQA 4DVRL 4WGWB 1QSFA 3H4FA 3NABL 1NKOA 3SD5A 3QNZB 43CAB 2PLTA 4RFOL 5CBAA 2MTPA 1OO2A 3FU8A 4AYFB 1X5ZA 1G9NC 1WPCA 4PQXA 2P49B 3K1KC 3QEQA 4AKOA 1INEH 1GPOH 4QXWA 3IF1B 4W9ZA 3K5RA 3JT0A 2K8QA 2GKIA 4M7ZB 4Z0XB 5A6MA 1A2YA 3GSNL 1DVZA 1BMWA 2Y1ZA 3DMMA 3UG5A 2AITA 2Y1AA 1HOCB 3ULVL 1D7BA 3D25B 2PYFA 5AW7B 3VD0A 2RR3A 1A6UL 3ML8A 1R3KA 3HS0B 1PL3A 1Q9WB 1LE5A 4XPTL 2R23B 1CWVA 3OC5A 4NQCD 1IBDA 4Z7WA 5A2LH 3TVMD 3VI4A 4DP7X 3NH7H 3T65A 3CN4A 2H41A 2FO4A 3SCMB 3H3PL 2XTJD 1A3RH 1C5CH 3INUH 5GS2H 5LGJA 3GSUB 4YDMA 1VACB 3RFZA 1UACL 1JGLH 1P4IH 1ESOA 1I9JL 3NFNB 1C08B 32C2A 3DVIA 2V2TA 3PJSB 2BSSB 1NAML 2YR3A 3Q1SL 4P2CG 3TFBA 1PGRB 5AVUB 4ZMQA 3DPDA 5C9JA 1KCVH 5EEZA 1CD1B 2D7MA 2WUBL 4HK0A 4NFCA 2BO0A 3OAZH 4H2CA 4MD4A 4WCYL 3RWEA 1RD6A 2Y6SD 3QZBA 4OVUA 2J5LB 4Z18A 1HSAA 4E2OA 1MCIA 3IBOA 3OHMB 5AAWC 4ZUSB 2IALA 3V8CA 3WS6C 2HVJB 4LCUA 3TXAA 2ADFL 3L3GB 4OJCA 1J8RA 1GC1C 2FEDC 3N55A 3WY1A 5D9SA 5T3ZL 4KKBC 2A0LD 4FEIA 4F27A 2ZE0A 4OF5A 3T8XA 1CG9B 3MREA 3VWJB 3D3VE 5EUKB 2EJ1A 3AADB 3CVHB 5D2LA 3U7YL 1ZLSL 1I7TB 4F1ZA 4J3OF 4N1HB 2CCLA 1XCTA 3ABMB 4H44C 4JFDE 4RFNB 3BP4A 3QFJE 3WL9B 3LKSB 4MAYA 4NPKA 4N90D 5BV7L 5DHVA 3MRRA 1KXTA 2KYIA 2F54E 3K6FA 5I6LA 2NY3B 4IOSD 2IQAB 3FSWA 4FADA 3SGKA 1E5ZA 1DL7L 2CUHA 2YD6A 1VF5C 2RIKA 3GT6A 3KXFA 4PRBB 1QFPA 2GJJA 4G8IA 3DSFH 2F61A 4APQA 4I0PB 1S7TA 1QQDA 4DKFH 4MQSB 4ZX3A 5E8OA 2Y23A 2W0FB 3T1FA 5HGHB 4HG4K 3AG2B 2EYSB 2XZQL 5T3ZE 3T0VA 4F2MA 4QPEA 5KG9B 4H20H 1CK0H 4L29B 5D1ZB 4QRTA 2B9BA 3IMBA 1OTSC 1ZPUA 1F90H 1RHHB 2I9LB 1MDAA 3PWPE 5H35B 5EULV 3VRJA 1E27A 5IHWA 1JGIA 1WFIA 2Z34A 4N6RA 1BLNA 2YMXL 4TQHA 4Z78B 2R51A 4HAGA 1P5UB 4LSPH 2B3IA 5I0YA 4XH2A 4R0LA 2Y36L 2VR4A 3O3BA 2P5WD 3GRWL 4OGYL 4PPTA 4UTAH 3S96B 3G5ZB 1U8MA 2HX7A 1FL5A 4E9TA 5CEZL 5A6IA 4WSJA 2L0DA 3RYMA 3H54A 5T1KA 4UDTB 1O6VA 1WISA 2A9ML 2VSDA 5EEXA 1RUQH 4M7ZC 1SRDA 3TM6A 3NPSB 1XGYH 2BVOB 3PNRB 3Q1EA 1OP4A 3C2AH 3HG1E 3TBYA 3DTXB 2Z91A 3OHXB 4HGKC 3WFDL 5FKAA 2VERN 7TAAA 1LEIA 2QHRH 1IEHA 1B0WA 2V2XB 4Z7WF 2V8MA 1TSHA 3HS0C 1MF2H 2FLMA 2YRZA 2HWZH 1AKJA 4M6OL 5EU4A 5BZWA 1CICD 2NY6D 2C7UB 4L3EB 2YUWA 4QRSB 1GY1A 5EDSA 4WWKA 1MHEB 1O9VA 1IX2A 4Q74A 3SCMC 5LQBL 2GQHA 3CQPA 3H42H 5JUEL 4HJEA 4AQ1A 4KI1A 1E3ZA 2XFXB 5EF0A 3UYPB 4ZS7H 1TITA 3RAJL 4IRSA 3IJHA 2IH8A 1I1YA 4N22A 5J1SC 4GXVL 3GMOB 1PTZA 4F57L 3QFDB 4BINA 1XWVA 2AQTA 1FAIH 2R2HA 4MX7B 4XZUA 2FGZA 3L5HA 3MX0A 2YAFA 2J5LC 3CQQA 4LLMB 4JO3H 1AOHA 3H2QA 4KQ4L 3ZHLA 1LO4L 4HCFA 4MXVF 5IB1B 1MFBL 2AMGA 2X53A 3BKJH 4PGDB 2FQEA 2MIZA 3NJVA 4NUMA 4KOCA 1RSFA 4HHGA 3H9HB 3L9YA 2XN9E 5D2LF 4P07A 3KR3L 3VWJC 1FCGA 4NKOA 3BDYH 4EF3A 4RAUB 4JL1A 4LPTA 4PW9A 5GISH 1B0IA 3FO2A 4U3HA 2GIMA 3IXAB 5HGGS 5IG7B 3SSGA 1QUNA 4HGWA 3RVTD 4TUOA 2DQJL 2ZPKL 3WFZA 4ZUWA 2WLLB 2OJZH 4ONFL 1E5UI 4RFNC 1XH3A 2Q3AA 3BAWA 5DYOA 5J0BA 2ITDB 2AJXH 4HGMA 4EBQH 4M1GL 3SPVB 1IZJA 2FH8A 1KJ3H 4JQIL 2XWDA 4EKXA 2NNCA 2NY3C 4J3UA 4PRNA 3S35H 4P2OB 3D69B 3NQKA 1D5BA 1UXMA 4B41A 1F58H 3JSSA 3MRNA 3ETTA 4JDEA 2JELH 5C07E 3WIAA 2J88H 3NJNA 4RMVA 2EYTB 1EWHA 1T66D 3EUUA 4I0PC 5K59F 1QLRA 4PJ8B 3FFCE 2JV6A 1UZ8B 1X4ZA 4B7LA 4GSDL 4KXDA 1N3NB 2P44B 3QDME 4QLRA 3RX8A 5I1CL 3Q01A 2VDPB 5T5FH 5IUCA 3ZE0E 3MKGA 4L8BA 5SWZE 3KYNB 1RH8A 5IUSA 4E5XG 4MB1A 4AEIH 4BFRA 5BZXA 4P46A 3TBBA 5D1ZC 5GS1B 1SHXA 3A6CL 3QQ4A 5G5DA 5CAYB 2VLKE 2WQWA 5E6IB 3B83A 3DWTA 5AUMB 4FP8L 2WPGA 1X7QB 4ZX4A 4XRCB 5IESL 5A2FA 1P5UC 1PNCA 4J2XA 4LBEB 5FOJA 1OSPL 4KK6D 4B0MB 4HUMB 3BVDB 3MJGX 2H1LM 1MFVA 4KRPB 3C5ZD 1FHGA 1M7IB 3V6OA 5BXFB 4Y9EA 3ZBMA 2HH0L 3NJJA 1PZ3A 3RPKA 5DJ8B 2XN2A 4CRPA 1MDTA 3L5XH 3AXLB 1UA6H 1X5KA 4J3WA 2XIIA 2VUYA 2X2JA 3ALXA 2H6UA 3CFEB 3NPSC 4QHUB 4PG9A 5CIPB 3U0TA 1S7VB 3L48A 3AQYA 3OHXC 4X9YA 1KCSL 2ZXQA 5CJQL 4D0DB 2K7QA 3BEVB 2FVNA 3UTSD 2R56L 4WKZA 3RJOA 2EUVA 5TFSL 2HT3D 3SJVB 5C0DB 3L95A 4BDVB 4PJHA 2I24N 2RALA 2LFEA 1OPOA 4X6DA 5FGRA 1S3RA 4G6KL 1U3NA 2UWEA 1N6UA 2A4CA 2GPZA 5AVQB 5TDOA 2JB6A 3DVNB 3CXDH 4P2RE 3U30B 4PG2C 1BJ1J 4I89A 1RL1A 2OL3H 1JPTH 2EQDA 4ZFGL 2R0KH 2EDWA 4I18B 4JZOA 3RGHA 3VG0H 3VXMB 5CU5A 1BXAA 2ZJSH 2DOCA 3U1SL 2FEEL 1GYUA 5IHZA 2DH2A 4BZ1H 2P26A 1ZLWK 1GOGA 4HIHB 3OVUB 4Y1AA 1YEJH 3QH3A 3VXMD 1SVBA 1AO7E 1WT5A 3M17B 1X5MA 5DURD 2OAAA 2NY5H 3GMPB 1NMAH 3LHPL 1Z66A 2BNRB 2WMPA 1MHCB 3U6RA 3SD2A 1J9TA 1AIZA 1EJOH 2J71A 4XVSL 2HG0A 4GJTB 4J6RL 4TSBH 4EE2A 3HPJA 3CDZA 4JQVC 1CB4A 35C8H 4PCYA 2QV2A 1IGTA 2YGNA 4RZCA 1CD0A 3BUDA 3QIBB 3NEXA 5DQJA 1UM4H 3MN8A 1U8QB 3ULUD 1BZQK 4CNIA 4OT1H 4FFYA 3I6GA 4WAFA 5I6NA 2P1YA 3B2VH 3WEAA 3ZKND 1BM3L 3RTLA 4DUVA 3E2HB 3OKKB 5DDHB 1UB5A 2GYSA 4XBPB 5C97A 5BO1H 1Z9MA 2GAZB 2JQMA 2GTZA 2A74B 2BP3A 2OSWA 3SKNA 4PEEA 1XZ0B 2H9GA 5C0AE 3T0DA 4M8RA 3IWVA 1ILUA 1HCVA 1H15A 2ZKYA 4UQIM 2MH4A 2CZNA 2NXZB 4NO3A 4QXUL 2X1XR 3TN0A 2IH1B 2R2BB 4PJ8C 1KIPB 4DFIA 1ORQB 2TAAA 1QW9A 4XVJL 3RNKB 5FO9A 1Y1UA 1GZQB 1JWUB 4RGOH 2OYMA 4TS6A 5IGXH 4OUOA 2K4AA 3B7TA 1A4KA 1AHWA 4M48H 1LK3L 3ENEA 4WSKA 2WBJB 5BPPA 2IDFA 1ID5I 1MCSA 1WF5A 3DKHA 2HT2C 4LRNH 4OF3A 4L4VA 4QXGL 2C1OB 3RJDA 3MHZA 1X9LA 3LIZL 2GUOA 4JFEE 5GS1C 4X0NA 5E6IC 4YO0B 1LEKA 1AY1L 3TF4A 3K4AA 1YG9A 1JTPA 4AVJA 2I26N 1JV2A 2FATL 1FRGH 2WLKA 4FQ1L 4K3DL 2DZEA 2E46A 4MNQE 4PJFA 5DRZA 5E9DA 3HN8A 3IAQA 4PGBA 1ZHKB 3S37H 3T5WA 5F44A 5BOPA 2WBXA 4Z95L 4XBEH 5TE6H 4KRPC 4Z3FA 1D5ZA 1FC2D 1SF3A 1NCTA 2CM5A 1F4AA 2J56A 3D48R 4J23A 4PJ5B 3O2VH 4PWJA 3DETD 2QQNH 4BIKA 5F2FA 3U7AA 2JKTM 2QDVA 5CD5D 1NGXB 2ZP8A 4QYOB 2ESVA 4UU9A 4Y19E 3WIHL 1E4KC 1Z32X 3CFJB 1JHTA 1CXKA 1D6VL 1UJ3B 1ADQL 2WVVB 3EFDL 5TF0A 2A9NH 3WTWA 1IFHL 5HI4C 3TBVB 1OAZL 1WGOA 3AS0A 4PJHF 3KS0H 4X6BA 5DA4A 4X6DF 3MUY1 1DFXA 4I3RH 3VSVA 4Y4KD 2IGFL 5I0DA 2BX5A 2NZ1A 1A6WL 2DJSA 3BZEA 1H6TA 3LZLA 4DQAA 4YAQB 1VRSA 2WZPD 1DLFL 1LEGA 3KLAB 1KCKA 4DW2H 5IHUL 1UXSB 3BN9D 4LO9A 1KBGL 1S7RB 3MLYH 4XP6L 5E99L 3RIFF 4G1EA 3AQZA 3KPTA 2CPCA 4I18C 3TS8A 4H7VA 4L8DB 4V1DD 5EU5B 1U8OB 2NNAB 4NM4L 4YHPB 2L7QA 2YAEA 1MAKA 2O6CA 2X4PB 2PW1A 2WNWA 3CFBA 4FQCH 2BY2A 1LE9B 4B3EA 4QF1A 2QZ5A 2CR6A 3D4ZA 1CBVL 4K7PY 3HNSH 3OKEA 4PJIA 3TNMA 2IF7A 4LEXH 1CXEA 1B0GB 1XHHA 1IAIH 3V0AC 2FJGB 1NBVL 2ZTBA 3EG9A 1GW0A 4XPAL 2BRRL 2EDYA 3DJTA 2XTJE 1DBKL 5AAWA 3WS6A 1V3LA 4DKDC 3K4ZA 3AROA 4FFVD 4KO6A 2DQCL 4Z77A 4XPGL 2C9XA 2P47B 4NIYE 3RLSA 3NA4A 3VD1A 1IC7L 5KS9B 3QIBC 2DBJA 2CHWA 3QQDA 5BRPA 5BMFL 3O2DA 5CP7A 5I66B 2CNYA 1MH5A 2FJFB 5F3FA 4D9LL 2WO2B 1GZPA 2B4CC 3ZHFA 1A0QL 3C60A 4IRJD 1PEZA 3NCXA 2A74C 4LKCA 1SLXA 2AJVL 4PLNC 2FR4A 4UUJA 4KNTA 2KZBA 2XDHA 1OCWH 3RUGE 4HZLB 2BNQA 3DUSB 4MD0A 2NXZC 4AV4A 3F3HA 1E3XA 1QRKA 3FBQA 5DD3H 3VNZA 2I60H 3O4OB 2OSYA 2D7OA 2HVKB 4JUTA 4F80A 5A2IH 2JMRA 2HRPH 2ISDA 1QPPA 5AW6B 5EO0B 1WO2A 3TO4A 4BJLA 1ZLUK 4MB5A 4XPBL 3VD2A 2EIDA 3PG2A 2WBJC 2X4OB 4AC2A 4TMPA 4P8QA 2ADGB 5AVSB 4KKAD 2G5BA 5K9QI 1JSYA 2Z92B 4HFWA 3EZJB 1D2PA 1BF8A 1MSPA 4BSJA 2MRYA 5ITFB 4N90E 4PJFF 1IAOA 4XXWC 3OGCB 1T1ZB 2K9UA 2E3VA 3EYVA 3T1WA 3QO1A 3WJJC 3RTQB 1AANA 1BDYA 2A77L 4ODHH 4LF3A 4BK8A 2F8XC 4WJ5B 4RESB 1NLBL 3PFQA 4KJPC 3NJKA 1IC0A 1A4BA 1DCLA 3DI3B 1ONQB 3QNZA 3O41B 4KXBA 3U4BH 43CAA 4B9CA 5CSGA 1KEGH 1IGIH 2WP3T 4X8XA 1OARH 3NSYA 4AYFA 5INDB 2IWGA 1MJJB 1AFVH 3GXUB 1HIML 4OY9A 2HLAA 4Q0XH 1EBPA 1TJIL 3F8UB 2BIPA 1RZJC 1JF6A 3MC0A 3Q2NA 3QPQC 4CVWA 2GB2A 3C6LB 3QUMH 4Z9KB 3WIIL 2N3JA 4B9PA 5J3HD 4DKAA 2ZCHH 3IF1A 4RSVA 4DN3H 4XNUL 4WW2B 5L88H 5KAQG 1UJ3C 2W81C 4Z0XA 5I1GL 3LQZB 1PCXA 2DWDB 2EXWC 3VWKD 4LASH 1T2XA 5JW5A 2E27L 4EMZA 4F58L 3KPRD 4UBDC 1BZEA 1HOCA 1SEQL 2B3RA 2EH7L 1WTLA 4Y7OC 3N40P 3D25A 5E2UH 2P5WE 4OLWL 4QRAA 4GP4B 2X7LB 1Q9WA 1UASA 4UZSA 4EZJA 2MQGA 4AEHH 3NTCH 3VM7A 2ZAGA 2R23A 4AJYV 5JXED 3N50A 4JL2A 3HR6A 3W9EB 5MEND 3SCMA 1NUGA 1JIBA 3MODH 3MROB 3U46B 2CRMA 2QQLL 3MFFB 4YHIB 2VR3A 3GSUA 1KFGA 1VACA 1XH2A 2JKSA 3NFNA 3FQRB 5LBSH 1C08A 2TSAA 3OM3B 1ZLDA 3PJSA 2O6PA 2BSSA 4KK5D 2G5RA 2ITEA 9PCYA 3B37A 4JPWH 4X7SH 1D5RA 3LS4H 3SODB 4HIXH 1BM7A 1DQTA 3BD4A 3OZ9H 4XP1L 1NWPA 4ACTA 1EFXD 3UTZB 1GC1H 2XYBA 1NCBH 4PTTB 2WBKA 2DQEL 3KEDA 3NT0A 1MIEL 4WRLA 7FABL 2DDQH 4KTDH 4ZUSA 4FYTA 4FTDA 3L3GA 4MJ6B 4P9HC 1EPFA 1RUPH 2ZKHH 4ELME 5AW2B 5C71A 2Y7NA 4G42B 2DIJA 1VJSA 1U42A 1I8AA 2FIKB 1OQOA 2HFGH 1BEYL 3IDNB 1CG9A 3VWJA 4JPIB 1NOAA 4LSUL 2X1WL 1T3FB 3RY6C 1S8DB 4P5SA 5EUKA 2NUTB 3CVHA 1F4WL 1RFDL 2GEEA 3BGFB 1ZLUH 1I7TA 1QHPA 3LQAC 1DVSA 1YNTB 4CBZA 4NQQA 3WL9A 3LKSA 4JO5A 4QD2E 3BUIA 2BIHA 3EOTL 2IQAA 5E0QA 2GABA 1M7DB 1IL1A 3O45B 5J1AB 3O4OC 4PRBA 2J6EH 4ZMZA 2DICA 1ZHNB 5BJTA 1WS8A 2QVFB 3GLEA 4I0PA 4AK1A 2OJEB 5ABAA 3S3BB 2CXKA 4S1RL 5EOQH 4RGMB 4JFXB 3BRDA 2ZOKB 4LEEA 2W0FA 2YXWA 5E5UB 4KMQA 3BISA 5HGHA 5C3TA 2QVMA 3ARBD 1MJUH 4KVPA 1I8KB 4IOFD 1YC8A 5F7WC 2EYSA 4MXQD 3O6MH 5JIMA 3GXMA 4LZKA 8PAZA 5E08H 1O7DE 5KG9A 4X5XB 5DHXB 2AV7B 4L29A 5D1ZA 1OGAD 1I7UB 2JNZA 4JN2B 3RTQC 1RHHA 2I9LA 5H35A 3VXPA 3E0GA 2EKSB 4LU5L 4M02A 2OK0H 3GRBA 3APDA 4Z78A 2WXKA 1P5UA 3VMPA 4DUWA 1E43A 3HA0A 3LHAA 2YQ3A 2CBMA 3S96A 3G5ZA 1HWGB 5LNGA 3BC9A 1HCZA 4M3JA 1GGIH 5FLVA 3C6LC 4UDTA 4FF9A 2DJ4A 4FFWD 4WW2C 1R1CA 1OAQH 5L8KB 2R0ZH 2BVOA 3R1GH 3QCVL 3MNVB 5SWSD 2Z64C 3HI1B 2DLIA 3DTXA 3OHXA 5DVNA 2J6WA 1I4FB 4EUPB 2Y22A 5FS5A 1TETL 4J5VA 1FAKT 2V2XA 2GVYA 4OFPA 4ZW6A 5KAQF 1PX8A 2C4FU 3GSXB 5KUKA 1BJ8A 1ITCA 1VEOA 3CH8A 2C7UA 3OX8A 4L3EA 4QRSA 1SYVB 3TBTB 1MHEA 1Z0NA 1WC7B 1QACA 2RFXB 5L2KD 3VD5A 3TV3L 4K3EL 5IP4A 3ZZSA 1QA9B 4PG2A 4OW6A 2R1XB 1R19A 2QQKL 1ZSHA 3I3DA 2D9QB 4AXWB 2PWFA 2LGNA 2XFXA 5HI3C 2YXVA 3UYPA 5MEQB 2H2SC 3UTSE 1MRFL 3EYUH 5E00B 5E6RB 1PY0A 4PJXB 2VDQB 3GMOA 4GXUN 3F83A 2VKXA 4J39A 3QFDA 1WA2X 3NN8B 3O0RL 1WIOA 1GJUA 3AMKA 4MX7A 5KSBA 1QLFA 1R46A 5FWQA 3E1ZA 3DIFB 3MBXH 4OSUL 4GRMA 2A9CA 4MS8D 4LLMA 1KLFB 4LP4A 2XBZA 3BYYA 4NI3A 3LCYA 3MLXH 1OXYA 4I3SL 4AX3A 4I2XB 1TLMA 1FA4A 2GJ6E 3ULUL 4KH9A 1K9TA 5IB1A 3PDOB 4PGDA 3UDWA 4EN3B 5LUMA 4TNWK 1XIWD 4WO4B 5HTSA 1CYXA 5GS0D 4TVPD 3H9HA 3QORA 1BECA 1MFAL 3SDDB 5L4MA 2DBLH 1KULA 4XVUD 4RAUA 1J1PH 3ELAT 3B7SA 3AY4C 5IG7A 2JIXD 3BGFC 1SHWA 1SXCA 4NGHL 4XZ4A 2WLLA 5HI5C 1FJ1B 1PS3A 1YYCA 3LH2H 2IBZX 2ITDA 3BSZA 1KIUB 2CALA 5BRZD 3SPVA 3CMOL 4PJCB 2NQDA 3B9KB 1XF5A 1TQSA 4P5KB 3UBXB 4ELKB 1XTLA 4P2OA 3D69A 4FYSA 1FDLL 2B7DT 3QBTB 1MFEH 2VZOA 3AACA 1JG9A 4YDJB 4IS6B 1MCHA 2BFVL 1J8SA 2EYTA 4RRPM 3DJSA 2PXYD 4PJ8A 2VW7A 3ZK0A 3DXAB 1UZ8A 3T2OA 4RGMC 5D6DC 3ULUE 1JAEA 1N3NA 4P9ML 1L9RA 3JWNC 4FQJH 4FERA 1CS6A 3RIKA 2V9RA 4X6FA 3D85B 1V5JA 4GRWB 5D7JB 3MCLL 3KYNA 4WU5B 3P0YL 2VDOH 3UROR 2HRGA 1J10A 2E8ZA 2XVGA 4G7SB 4BFIB 2ZZUT 4Q9CA 2Y69B 5GS1A 5JYMA 4RAVB 4FNUA 3TEWA 4PJ9D 5E6IA 3UAJD 5LN8A 3BCDA 3HMXL 1X7QA 1ROWA 1ZA3B 3MOAH 2WB1A 4P4KB 4LBEA 5HDRA 3UIYA 3LKQB 1DSWA 4TSCL 2WLYA 3GMQB 1BBJB 3HRZA 3QARA 1KELL 2Y7LA 1AQHA 1QLEB 1M7IA 3TZVD 1DANT 1X9UA 4QRRD 1H3TA 3POHA 5DJ8A 1RIHH 3ECBA 4PMEA 1M05B 3AXLA 1A47A 1AI1H 3VFNB 3ATBA 3CN1A 4LQ1A 3CFEA 3NDYE 5CIPA 4B9GA 1S7VA 1ZJBA 4CC1A 3VXSD 1E4KA 3BKYH 2CGZA 3N06B 4D0DA 3FRUB 4NWTL 5ACLA 1O5PA 5ADOH 1Q72L 3BEVA 4MCNA 4N2HA 3VFOB 1QO3B 5C0IB 1BZDA 1T2JA 4YXKH 4R97B 5FCSH 4F20A 3SJVA 1AQ8A 1EDQA 5BUAA 4ODSL 4BDVA 2L4OA 1SHMA 1CQYA 4OLZH 1INQB 3F84A 3HTLX 3DVNA 1NCUA 1JPSH 3ARWA 2O93L 2OW7A 4M5YL 1GKEA 3PV7A 4FJYA 2ZONA 3VFPB 4I18A 3VXMA 1IC4H 2Z35B 4JANB 2PWDA 5FKPB 3MRIB 5JA9A 1T7WA 4FQIH 2QEJA 3SDCD 4ZUTB 4HIHA 1DVFA 2ZICA 3FUDA 1N7ML 3SGEI 4OVVA 3N9GH 5SX5K 5EZIL 1J1XH 1WCBB 1MLBB 3M17A 4FGMA 2GY7B 1NSNL 3PAZA 4XNYH 1M9SA 3QUZB 2XRAH 1MHCA 4GO8A 4CU6A 1AIFA 1UZ6E 4QY8B 1WH0A 1PF3A 4V1DE 4EN3C 2G0KA 1VAHA 2EXSA 4GAGH 4WO4C 3GD1C 1P7KB 4HWBA 3FTGB 3BT0A 4KKQA 1RP8A 2VSMB 4HOZA 3QC5X 3QIBA 3EOBB 1U8QA 2BSDA 1KWKA 4PYHA 1BD2D 5HYSG 2R29H 2VN3A 3UYRH 1G9MC 3B9VA 3EH2A 1TIUA 3M6DA 3OKKA 5DDHA 3SDXE 4YXHH 1UC6A 4XBPA 4QEGA 1L0YA 3NZHH 2GAZA 4YSOA 2A74A 3MBWB 1XZ0A 3B9KC 1FFPB 2PP7A 5D71L 1ZVHA 2O5ZH 3GZQA 5DT1H 1AH1A 3LIUA 1J9CT 3NCEB 4NZTL 2IOIA 2VDPH 3VFSB 3EGSB 2IH1A 4H40A 2R2BA 1KIPA 1CDIA 3RNKA 3C75A 5AZ2H 1GZQA 1JWUA 1QFOA 4HA1A 4RMSA 2LR4A 3T6ZA 4A1RA 5I8OL 1TXKA 2WBJA 4XOBA 2W9EH 5D7JC 4NHUB 3KJ6L 3BJ91 3UC0L 2XKSA 1T2QL 1XQ4A 2C1OA 3D6GA 4CBPA 1CJYA 4AK2A 2VQ4A 4FLSA 1T1YB 4XODA 2ICWB 4W9EC 1Q94B 4KRNA 4XXWA 4YO0A 5K9QG 2OP4H 4HU8A 1MCKA 5DSCB 4IM8A 1KXHA 4YLBA 1RPUA 3TESA 2VAAB 3WJJA 1WYJA 3LX9A 3NJGA 1TLKA 4P4KC 4DNLA 2PABA 3NJMA 4XP4H 1W0WB 1NCHA 4H4NA 4UOW1 2ZYSA 2N7AA 4GO9A 4RMUA 4YSSA 3KYOB 2ZSVB 1HX0A 4ZXBD 4BGLA 4GW4B 3T0WA 1RIUL 2C8NA 4PJ5A 2P24A 43C9B 1HT6A 1MNNA 1YJDH 1OM3L 3RI5F 2QPEB 2DTML 3MUGB 1YQ2A 1NGXA 4QYOA 3BEWB 5CCKL 2QMJA 3GSOB 4YSRA 3WENA 1Z9PA 1JS4A 4JRYD 3CFJA 1Z5YD 4AIZA 1UJ3A 2WVVA 3TBVA 1IM9A 1S9WB 1OKEA 5E2WH 1YEIH 3RU8L 3U25A 5MP6L 5JZ7C 3PGFL 4R97C 5LWYH 2QPFA 1JFHA 1U8HB 3KPLB 4X4YB 1X5HA 3ARFB 4BWWA 3JWDC 4TVSa 1RHFA 5HY9B 4YAQA 1TTFA 4TRPL 3KLAA 5C2UB 1UXSA 4FFTA 5SX5H 3HI5H 3RX9A 1HHKA 1AD0B 1S7RA 2WQUA 4BHUI 3WNOA 2OZ4L 4QMEA 2AK4B 4KZEL 2NYYC 2D4FA 4L8DA 1FC1A 5EU5A 1SMDA 1U8OA 2NNAA 2UY7B 3OGOE 3KPRE 4LGPB 4YHPA 4ZFOB 3UXFA 1CVRA 1QEXA 2X4PA 1AP2A 2CJTA 3MRHB 4JO2L 1LE9A 4KNSA 5FB8B 5DTFB 3DVFA 2VLJD 1MQKL 4K2UL 4Q7DA 4TNFA 1B0GA 3OWEA 2WYHA 4Y2LA 4HWZA 2R8SL 3ECVA 4KXAA 2FJGA 3U9PL 4LCWB 5EEVA 3QUZC 5MENE 2BRQA 5HHNB 1A4JB 1PZ2A 4YHML 4R26H 4CSSA 3SDAB 4X4KA 2VWEC 3OB8A 3JYCA 3L1OH 3PU7A 4Z7OE 4HSQA 1J5OL 5KS9A 5B3SB 4O9HL 2QLYA 3BKML 3EJJX 1FE8L 3OKDB 4JFPB 5I66A 2DD8H 1W72A 3RY6A 3MV7B 2IJ0C 4NJAL 3DO7B 4L0PB 4WIQA 2XI9A 2NXYD 3AS1A 4PRPD 1I8IB 3A5VA 3X3FL 3AU0A 4NQUA 5DQ9B 3U48A 1N8ZB 3Q06A 1MWOA 2XVBA 2Z0BA 3CZUB 3GHEL 1QBBA 5AKSA 4HZLA 4PJGE 4ZAKD 4LLUB 4FFYL 2XV0A 3DUSA 1A7QH 5L4IA 2EC9T 4TNVF 3U7WH 4OM1L 3VU1A 4G6JL 4OGZA 4M43L 4J3BA 4N8VB 5M94B 1I31A 3V5KB 2VR5A 4KO7A 3O2WH 2B20A 3ZO0A 1LHZA 2C3GA 2RQ8A 2X4OA 4X42A 3T04D 1BEXA 4IYKA 5KSAB 3PJNA 2ADGA 2JXMB 3W82A 1AR1B 3F7YB 5FF6B 4EIBA 2VERA 5ITFA 1AZCA 3OGCA 1T1ZA 3QIUD 4R7LA 4I8DA 3BE1L 5EIIB 3N42B 2ZCKL 1XF2B 1AC0A 2H32B 1FBIL 4R8WL 1EUTA 3RTQA 3UACA 2YGPA 3CLFH 4WJ5A 5C0CB 3GBML 4A7GF 3WSQH 1HI6B 5DRNB 1ONQA 3VSQA 3O41A 3GBNH 5BUPA 1L6PA 1HHGB 5LCVH 4WI3A 4OLYL 4ZOBA 5INDA 1MJJA 1MHHB 4YXLL 3VXUD 5KVDE 2VZ3A 3HLKA 3DI2B 3GMMB 5C08B 5AALA 1QYGL 1ZCRA 3II2A 1OHZA 5E03A 1KTLB 2MCPH 3OJVC 1DJHA 3C6LA 4K94L 1JXJA 1XCQB 3MRDB 1K6QL 4WW2A 1HXMB 1JZGA 3V4LA 1OGAE 3K4DA 4OQ1A 5CN3A 4O4YL 5TQ2H 3LQZA 1X7SA 2DWDA 2W94A 5AB2A 2E76C 4M8VA 2VC2L 1Z3RA 4KZDH 3ZTEA 3F12B 4S0TD 4IGBB 4LXFA 3FB6A 2J5WA 4XAWL 3FS9A 4XOCA 1EHKB 4WGVB 3ARFC 1A8ZA 2OTWB 2VN4A 1HL9A 4LSQH 2JI1A 4ZD3H 4RNRB 4AVKA 1G6RH 5KSVB 1F4YL 2OX5A 3FHAA 3NP4A 3JUYA 3JWOL 1SOQA 2AJYH 3LEVL 5FDYA 3W9EA 4AYID 3MROA 1CF8L 4NUGH 5EA0L 3U46A 3BVNB 2FWOB 4YHIA 4NQDD 2ICCA 1KCBA 5SWSE 2CJUL 4LESA 4XMLH 5BQ7B 4HCGA 2J1KA 1XB3A 3FQRA 2QL1A 3P54A 3EFFB 5ILTH 3S8WA 5IVNA 5C0BD 1RK0B 1W9XA 4WEBL 4QYAA 4TULL 5ITBH 4FCHA 4YBQD 4OB5L 1WWWX 3S97C 5C86A 3B3BA 2BC4B 4P9HH 3SBPA 4NZFA 2XG4B 3UTZA 4XPHH 4FG6D 3D0AA 4TVPL 1O5DT 1MREL 2LAAA 5I71B 2B1OA 1GGCL 3C08H 4K23L 2XQBH 3DYOA 5I23A 5KS9F 3VFRB 4MJ6A 3SDAC 5GRJH 1NCOA 5GQBA 1EXGA 4U1SB 4U1GB 4G42A 3ZHNA 1QBAA 2DY2A 3FH8A 4ODTL 1YVLA 3LQAH 2CBPA 2FIKA 4HUUB 3KLDA 3IDNA 1TT6A 2EDMA 2LQRA 1IQWL 4H8WC 4JPIA 1ETZB 4GG6B 1R6VA 1T3FA 1S8DA 3VI3B 2R0WH 2PN5A 2NUTA 3AY4A 4DAGL 1IBHA 1A3ZA 3P2BA 4KKLD 2J72A 4XTRD 1U92A 1YNTA 2BNUB 3HHMA 1J0IA 5IEKB 3ULSB 5D5ME 1RJLB 3B2PA 3V0EA 3B2XA 3JWNG 1ID2A 5IROD 3CLEH 3FTVA 5LG6A 1JPGB 1M7DA 1J8HD 3O45A 5J1AA 2E6PA 1UVQB 2DJUA 2MEJB 4AZ8B 4UTBA 4L37B 1RJZB 4TVPE 3MRKB 2KLRA 4OCSL 4MDRA 4MA8H 2OJEA 2RAMA 2KLSA 3B8SA 2YWYA 5D6DA 2EDNA 2ZOKA 2EO7A 2IEPA 3RILA 2G2NA 5KSAC 1AR1C 2I9TB 3VFGH 3A4FA 2FZ3B 4PHZA 3IKCB 5IBLC 5BRZE 2XNAB 2VH5H 2XUWA 4X5XA 1MCJA 2AV7A 3WDHA 2WQXA 3P1VA 3QRGL 1I7UA 4JN2A 3QW9A 5E7FA 4XNXL 1MIML 2WANA 3ZGHA 4TPRL 1KBVA 2EKSA 3ZT5A 3DK2A 3TGXA 1YEHH 5FM5M 3BJLA 1CGYA 3DRQB 3N6YA 4WY7H 3V5HB 4PRHB 3ZO9A 1JDDA 3SDYH 4EUPG 1YLBB 5IFJB 4MJ5B 1WFOA 1A9EA 3VYPA 3N41B 3KLQA 5AZEL 1IBZA 4WW2F 4AIEA 5IVXA 5GSVB 1SGKA 1UWXK 2W1NA 4EI5D 5E2TH 2IH3B 4AE0A 1RUKH 1K5WA 3APNA 1P4LB 5DZ9A 3MNVA 3HI1A 1N5AA 4K7PH 2QGBA 2WNGA 3MMEB 3W0WD 1I4FA 4EUPA 4PLKD 4IGBC 3SBRA 3TT1H 4A63A 2L3BA 4YHZH 4FNLH 2LU3A 4QI3A 5HYJB 3HPLA 2RQEA 1P4UA 5DXWA 1E7VA 4EDWL 4QRRE 2QFPA 1SYVA 3MLZL 3TBTA 5L4JA 1WC7A 3L2LA 1F3DJ 2RFXA 1GAFL 5E6UB 3TU6A 3ZR6A 4KJWC 2LU7A 2W0KA 4HIJB 1QA9A 5DZNA 2R1XA 1YECH 1F1GA 1PMYA 2YKLL 5I18L 4AXWA 3VXSE 4G70B 5MEQA 2KS0A 1I9IL 2FD6L 1SFDA 5E00A 4PP1D 4PJXA 3L3OB 5C9KA 5I8EB 1IJNA 1TJGH 3NN8A 3MV8B 1B2YA 4WHDA 1FGNL 2NY1D 4LSRL 3DIFA 3V4PH 1IU1A 5E4IA 3PYCA 4PBXA 4DIXA 2WQSA 4PN6A 1KLFA 1XF3B 4XNAA 2HTKD 3AQDA 5I71C 1N26A 5KVEE 3AT9A 3AW5A 3HFMH 4BSVA 4I2XA 4EI0A 5F9AC 4AMKH 5LGYA 4NQVB 4U1GC 3PDOA 4EN3A 4PM1A 4WO4A 3ZL4L 3G6JE 2VDLH 4G8FB 3SDDA 4K8RL 2HG5B 4O2FB 3UBXG 3MLSH 1F3RB 3FQYA 1D5XA 3Q3GB 1YNTF 2R69H 2ARJQ 2NY0B 1QNZH 2ZQKA 2DEYX 5GGTH 3HBGA 3FOMB 3IDMB 2AEOA 2YFNA 2BP8B 1FJ1A 4PBDA 5I82A 2M2DA 2O5NA 3GI8L 2GFBB 4KU1A 2B16A 1KIUA 3BRFA 1J5HA 5AAPA 1NUNB 1YY9C 4PJCA 4BZYA 2FB4L 3JTTB 4PB0L 5IT2L 1KV3A 3B9KA 3OMZA 1IO4C 3WDJA 4UMSA 3UBXA 3WHXB 1EDYA 2BK8A 4ELKA 4QOKB 5T3XL 1M7XA 2XPZA 4A6YL 4GSRA 4LEOB 1ZT1B 4IS6A 3RNQB 5GS2D 1L7IH 2B39A 1U95B 5DMKB 3F6JA 3DXAA 4Y1SA 1TZGL 2DQHL 4KROB 5CU9A 4HLJA 4TNGA 3VRIB 1T0PB 2NR6D 1BD2E 3ULAB 2ZXDA 2VMJA 3F7RA 4DGWC 4XX1E 5I15L 1HYSC 5KBMA 1TSRA 5D7JA 4N9OB 4NUPA 1QR1B 4WU5A 2IAMB 2JCWA 1UM5H 5DGQA 1CGWA 2R4SL 3QUKB 4LARL 3S48A 1JZ5A 1MHPL 2E47A 4ZFQA 1PG7H 1UWXH 4BFIA 5IFHL 3HC3H 4RAVA 2K3HA 4S1QH 3HNVH 4MDIB 1PZAA 3B1TA 4M03A 4U1MB 1HKFA 1CXLA 1V55B 1ZA3A 3CUPB 4WKXA 4NOBA 4NZRL 4P4KA 3T2NH 2PPEA 2E9JA 3LKQA 1NICA 1ZDSA 4FTVB 5GGVY 1ES0B 3GNML 2H0EA 3GMQA 5DU7A 1BBJA 1PY9A 2C9VA 5GGRY 3V0VB 4HXAH 3L4XA 4D8OA 1Q1PA 4M5SA 5AOJA 1YEDB 4NI6A 2WO3B 4U2ZA 1GTFA 3IN0A 4DQOL 3EGDB 1P7QB 2RACA 4AC4A 1M05A 3NSDA 2Q86B 3VFNA 1NCDL 3HNTL 3SQBA 5L8JB 4PBVC 1JXGA 2WTRB 5GZOC 3V79C 2EXYC 3DPBB 4ZJ9A 1NAKL 3VFOA 1QO3A 5C0IA 3L3JB 1DQDH 1RXLA 4FQLH 4FC3E 4PJBB 1GYCA 2B0SH 3LEYH 4X6CB 5TE7H 5C0EB 1U3ZA 5T8IA 4TTDD 3HC4H 3MACH 4G6ML 4YC2B 3ZTNL 4JJHA 5M95B 2QSCL 2X1QA 2D3VA 1JGEB 1H0DB 1INQA 5B1KA 1TQVA 4XN8A 2I85A 1UYWL 2BZ7A 5E2JA 2GC7C 4EO5A 4JJOA 4E9YA 5DEFB 2Q8AH 2QVKA 1IGFH 2G9KA 4M9PA 2HKFH 4JRYE 4YBLB 4PJXF 4XAKD 2NCEA 5T1DH 3VFPA 5DJDA 3MRBB 3UPAA 4AG4L 3G5XB 2NY2D 2CBOA 4J12A 5HJGA 3W2DH 4ELDA 2Z35A 3OZLA 1Y0LB 3T6VA 4UT7H 4JANA 1HTYA 4NLAA 5FKPA 3MRIA 3L3OC 2BWIA 4ZUTA 3IFLH 1IE5A 3L9RB 4R7XA 4DGYL 3ESVF 3WTXA 2C3HA 1EO8L 4JGJA 1MCEA 1WCBA 1IVLA 1MLBA 5I1JL 5IB3B 2CGRH 2E6JA 2WQVA 3AT8A 2NY7L 5D1XD 5AVRB 3QUZA 4RMWA 2WLIB 1JXFA 4QY8A 3SGEH 4KZ0A 1A7PH 2V7NB 1ZSDB 4MD5B 1L0PA 3UEZA 4B53A 5H8DA 1P7KA 2X42A 3DHMA 3FTGA 1RERA 2XA3A 4HH9B 5DC4B 5I1EL 4I77H 4RFEB 4YSEA 3OQRA 1TMCB 5CXPA 3EOBA 3HI6L 3QPXH 3L81A 2NY0C 2VLJE 1CN4A 4MKTA 1PFCA 4GAJH 5CCGE 2NLJB 3PGDB 4PJCF 2DH3A 1OZTG 3D2TA 5GZNC 1QAWA 2K70A 3V0DA 1DQLL 2X44D 2VLMD 4NKIL 3S3SA 1LO0L 5F1OB 2X6BA 4XT1C 4YDNA 3MBWA 4LLDB 4LB8A 4HWEL 3PXLA 3MTXA 4S1SL 1LDPH 4J6IA 3K8LA 2IPUG 3SBWA 3VFSA 4P3CH 1YSOA 1H19A 2H3NA 3EGSA 4Q97A 1JZFA 1OTUD 1V3JA 4ZMLA 2WM0A 4KROC 3BSZL 5DMJB 1OLLA 2D73A 2O5YL 3QXAB 4FFZL 4GRWF 4ANWA 3KLHD 1YNLH 3MLWH 4E9VA 4Z3EA 2ZUVA 3FH5A 4X7DC 1MJ8L 1NIAA 2QKSA 3OPZH 1EUUA 2V9UA 3SQRA 1KWGA 1BJ1H 4FS0A 3VM5A 5JW4R 3NIGB 4JFHD 1U8PB 3WIFB 2IAMC 4PRPE 3ABZA 4G7VH 5L8LB 1AQDB 3OG6B 4KOBA 5D72L 3NFPB 4FG4A 1T1YA 4XWGL 3VDCA 2ICWA 3BKCL 1Q94A 4WJKB 3J07A 5DSCA 2P48B 4DGIL 4UYQA 2VAAA 2IPUK 3FPXA 1RLWA 2H4EA 4P5TB 3FU9A 4G9DB 3SPIA 4YK4B 4QNPE 1W0WA 4BXVA 2GITA 3EYSL 4XNQB 1QEWB 3QQ9D 3ESUF 4N20A 3KYOA 3IVKB 5IFAL 4AQOA 1T4KB 1MCOH 1X9RA 4ZK8A 3L4ZA 4HS8L 43C9A 3TP4A 4BUQA 3MUGA 3BEWA 3GSOA 1Q1JL 4HUXB 2HFFB 5AOMA 5AW3B 2F2HA 1OOWA 4LLYB 1P1ZB 1S9WA 4YSUA 4K4KA 1JWMB 4P2QB 2WOBA 2ZWYA 5D7KD 5CZVH 5I74B 1F2QA 3TT3H 4YC2C 2HPTA 3KPLA 4X4YA 1II4E 3ARFA 4JO1H 3VGHA 5HVFB 2X3CA 2CCWA 4IEFB 5HY9A 3VXUE 2VDRB 1XCXA 3F7PC 4IU3B 3V10A 3A4DA 3T4YB 4OCNC 4K9EL 4CKQA 3V95A 1AD0A 3EJZC 3ZR5A 2VM3A 3HB3D 2AK4A 3N40F 4YBLC 4HP5A 5INCB 4K3JL 3QSKB 1BG9A 5GJSH 5FO2A 4UZGA 2UY7A 1CLYL 1N0XL 2Z7ZA 1TTAA 4ZFOA 2BDNL 4YBHA 3MRHA 3WEXB 1FO0B 2BY3A 4OD1H 4MXWL 3QZLA 5FB8A 5DTFA 1N9PA 1OQXA 4N2EA 4QIRA 1A7NH 5IK3B 2QPSA 1R5IB 1EZLA 4BKLB 2DI9A 2D8KA 1BQRA 4LCWA 2XG5B 5GRVK 5C0GB 4JCLA 2GBVA 5FUCC 5ISZB 4A2HA 3DUUB 1KGXA 1A4JA 3F00A 3T2QA 4NQDE 4M4RB 3S2AA 3ZZQA 1PIFA 4HT1H 3SDAA 4DK6A 1HWWA 3ISYA 4UT9A 4HVBA 3BP7B 1JYVA 4DO4A 5C0BE 1AKJD 2WWMC 2Q0ZX 1BGXL 2AEPL 1MVYA 3OKDA 4CADA 1OIOA 1TJHH 2WINB 4JFPA 4MJID 1QSED 4PUBL 4HKJB 5KANG 3GRGA 4FXGB 2IVFC 4N8VG 3TC9A 5KBNC 4OIIH 3DO7A 3FUIA 5AB9A 1PYWB 4OJFL 3S98A 5IVOA 3VTMA 4LIQE 1I8IA 4OCLC 4DF9A 5DQ9A 3O8XB 1N8ZA 1XF1A 3IAPA 3RHWK 1WZKA 3APMA 5CINL 3O11B 1BJMA 3GXFA 3TJPA 4LLUA 3GI9L 3GPSA 2CRIA 3TJEL 2MCMA 1C5BL 1EH9A 3H4HA 3WNMA 3UBFA 3MLVL 4N8VA 1RZIB 3FO0H 3GSNB 4N9GA 4PLJC 3V5KA 3WKMH 4AE1A 3MCG1 4KX9A 4LEBA 2XWBB 2AK1L 3FN9A 5KSAA 4U1KB 2JXMA 1QBMH 3ZSSA 5F9OH 3BIKA 1JNNH 4JZJB 4TSAH 1A3LH 3F7YA 5FF6A 3KBPA 5FHAH 3FQXA 5EOTB 2F53D 2KT6A 3LRSB 4CVXB 5EIIA 2Y06H 1XF2A 1EHXA 5A6LA 3MNMA 2H32A 1J8HE 3CZJA 3QCTL 4OFDA 5TF1H 5E24E 4P5TC 4WUKH 5EBWB 3D3VB 4K15A 4YK4C 5C0CA 2ZXEB 1UXWB 1UG9A 1XGQB 4XXDB 5DRNA 4JGNA 1NAMB 5KZCB 5JMRA 5MEPB 4LOFA 4S2SB 3E1F1 1MHHA 3GMMA 5C08A 5L2JB 4WEMB 4FD0A 3K6SB 1PZUB 1K5NB 2ZUUA 2XXCB 1CDCA 1KTLA 3GLZA 4QHNB 3ZYZA 3AQXA 4KKCD 1A4AA 2PCYA 2ZKWA 4L1LA 4E9LA 4GQPH 1HXMA 3NG5A 1NUDA 3ATDA 3P77B 1AGDB 4N87A 3CZSA 3EAKA 5FGBC 4NBZB 1S9XB 3F12A 4QJ5B 1XMWA 1RURL 2QSQA 3HUJB 5I74C 1DBBL 3GMNB 4MCYB 5JDJA 3K7UA 2FH6A 4Q4EA 3S4SG 1MRCL 1KF9B 4F7MB 3NDZE 2OTWA 2XWZA 4ALAC 3TV8A 15C8H 1HINL 4OFIA 6PAZA 4RNRA 1MELA 1SY6A 4QO1B 4P46D 3RG1C 4QHMA 1H6FA 4X9FA 3CV5A 3MI6A 3BLKA 3BVNA 1T1XB 2FWOA 4Z7AA 4X4XB 4HDIB 1KB5H 4WDIA 1FZJB 2JB5H 1F1DA 1OAKH 2CHXA 1YPZB 5BQ7A 5BV7B 3W0WE 1A6PA 2X0WA 4U2YA 1RZKC 2H5UA 5A7EA 3EFFA 4L0ZA 1IBFA 2NYZA 2YXMA 1NGWB 4M1CC 1RK0A 1DBJH 1HU8A 2DLHA 5DJAA 3HC0B 4H0GA 1W8NA 2WBWB 4OGXL 3UCQA 4IHBA 2UXVA 2I7SA 4GIAA 5F7KC 5ALCL 1INEL 3QDGD 2F7PA 3CC1A 3QXWA 2BC4A 3CSYB 4NP4L 4AW4A 3HG1B 3AU1B 1KBKA 3L6FB 3MJ9H 3PGCB 2XKUA 4JGMA 2YA1A 3BH9B 2NYKA 3VFRA 5CLZA 5B3NA 1KENH 5LN4A 2B1AH 5FA3B 4HCRA 2ORBH 4U1SA 5I16B 1M2VB 2X4QB 4HD9A 1EMTH 3DSNB 2B59B 1GCYA 3RZWA 3ZTJG 2Y5TB 1OGTA 4HUUA 5FO8B 1BVZA 2G60H 1JGUL 1ETZA 3TIEA 4GG6A 3VI3A 3NH7L 4FXGC 1GGBL 5F1SA 2P9RA 1Q0XL 3CFNA 1SLVA 1C5CL 2JLLA 4E42B 4P23C 3O8XC 5IEKA 4LL1A 4ODWB 1UKTA 4GW5B 4DETA 1HDMB 1M1SA 1JGLL 1P4IL 1WHPA 3F5WB 4Q6IB 4E41B 1LD9B 3VSTA 4U0QB 3JV5A 1W72L 2OSXA 3PIQB 2AJUH 1BCIA 2P7TB 2Y07H 1JPGA 4NUJB 2EDLA 2BOLA 3OKYA 1TEGA 1UVQA 4AZ8A 1Y6NR 1IMHC 4L37A 1RJZA 3MRKA 2EUWA 3X13B 3D39D 4GMTH 3VW3H 3K81A 3ULVC 3WNKA 5FFGA 5DJCB 4C83B 1MW2A 4FL4B 1S5IH 1YN7B 2JJVA 2I9TA 1TQTA 4JZJC 4MNGB 1G4RA 2HFEB 3N42F 2FZ3A 3IKCA 2VDMH 4POUB 2XNAA 3VB9A 1UKSA 4PJ7B 3MCKA 3O4LD 4ZNEE 2DPKA 1DQJB 1LWJA 3RURA 2GK0B 1OY3B 2DS4A 2OCFD 2E74C 4LL4A 4JM4H 1MNUH 4MQTB 3I6KB 5AW4B 2D3NA 1V7NH 4N5UA 2HLFC 5GRZA 4GRLB 5HYEA 1G7JA 1SXZA 3DRQA 2VDNH 4ODXB 5IOKA 2LVCA 4PRHA 3H0TB 4DT2A 2DJMA 5IFJA 4MJ5A 4WWID 1KNOB 3ARQA 4JKMA 2WLJA 2OKMA 4AKPA 5GSVA 5AB0A 1AGFA 1YHPA 2IH3A 3H9SD 1GYAA 1A14H 4Z8FH 1O6TA 2EIZB 3D87B 5C07B 4LPVA 3S2CA 1P4LA 3R7RA 5E1GA 2RB8A 1MPAL 4G1MB 3DSFL 3FFCB 3PQYD 4KJQD 5E5MB 3TN0D 3U0WH 4HETA 3MMEA 2JJSC 5GZOA 4DKFL 2BIIA 1KXVC 3QDMB 2BVUA 1NGZB 2W9LA 3V5DB 3K1DA 4PJEB 3O0LA 3ZE0B 2RD0A 2YJLA 5SWZB 4HFUH 2Q20A 1A4CA 5HYJA 1X44A 3CFUA 3QCUH 4BQ6A 1QPKA 2QVTA 2AEWA 4L4VD 4NERA 1CK0L 1UD2A 4YEFA 1N8OE 4C56D 2A7BA 1F90L 1JMXA 4YFLI 1D9KB 1VSCA 4HIJA 5IIEB 2WCGA 4M62H 5KYXB 4H1LG 2DKSA 3M86A 4KVNL 5BV7C 1IRAY 2PUQT 1L3WA 1T5WB 2EO9A 4J3XA 1YUKB 4CUCA 1P2CA 3GTVA 4UTAL 3L3OA 1JUFA 4GAAA 5JNYB 3CVIL 3P4LA 1YEKH 3VJ6B 2LE9A 2WXLA 4LP5A 3BIAX 1TZHB 3MV8A 2EP6A 1PAMA 4UOJA 2IADB 1UH4A 2I32A 1ZTMA 1XF3A 2ZKXA 1NEZG 1XGYL 2Y2YA 3PWJB 3C2AL 1Q9KB 2EEXA 3TCXA 1AGEB 4XAKE 2QHRL 1ZS2A 3IDGB 4NQVA 1JF1B 3IK2A 3ZX1A 1P9MC 4GG6F 3VI3F 3CDYA 4G8FA 2HWZL 2HG5A 4JKLA 4O2FA 3HE6D 5HYFA 4GQ9H 4YIQB 1HXKA 1FF5A 3Q3GA 1ZMYA 1Q0YL 3ROOB 4ECNA 5IBTH 4P2RB 4U7KA 4WI9A 3ZTJH 3IE4A 5IHLB 4MAZA 4CVZB 4CL7A 3H42L 5A16B 3FOMA 3IDMA 4N0RA 5D1XE 2BP8A 1BF2A 2LTQB 4FQ2H 5GZNA 3U79A 4OZFA 3L16A 2NQ3A 5DC2A 3D08A 5B8CB 5BNXD 4Q6IC 2HMID 1YQVH 2YMTA 3HS8A 4X8JB 3JTTA 1URZA 3B4NA 1PAZA 4I9XA 3ES6B 3WHXA 4HX1B 4QOKA 1NJ9B 1S5HB 3TWYA 3M1CA 3R4RA 2APBA 4LEOA 1ZT1A 2A9DA 2ARWA 2Y1VA 3S0PA 1FYTB 3RNQA 5KEZA 2V33A 1U95A 5DMKA 1FAIL 3QR2A 2EH8H 3RQ3A 3VRIA 5FGCE 1WEJH 2LABA 1M4KA 3E3QC 1S9YB 1BMGA 1HESA 3X17A 3E8UL 4ZTOH 4OI7A 4UM8A 1QR1A 4KUZH 4LMQI 2IAMA 2VLME 2LU5A 3U6XA 1RZGB 2BIMA 1HE8A 3BKJL 4I88A 2P80A 1WWBX 2ZG2A 5D4HA 2FEDD 4N2KA 4MDIA 1DJZA 4DGVH 4U1MA 2ZXWB 3BDYL 3CZFB 4NBYB 2PF6A 4KKBD 3V4UH 4GRLC 5GISL 3VCLB 3CUPA 4X9IA 3WG7B 3QRLA 4GS7B 2VXQA 8FABB 2WXOA 3N41F 4FTVA 1ES0A 1DUZB 2WZ0A 4DK3A 3TEYA 1OT2A 5HDOA 3K2KA 2OJZL 3GIZH 1UGKA 3V0VA 5DQDH 4L5FL 2AJXL 4HIQA 4EBQL 1WBZB 1YEDA 3BOVA 4JFHE 1KJ3L 2CD0A 1P7QA 2L7EA 4BH8B 4RLDA 2Q86A 4FHKA 3S35L 2BNQD 1ET8A 2B5IB 2CKBH 5HHOB 3CC5B 3MUHL 3RDTB 1F58L 3QDHA 3FONB 4H8UA 2JELL 3VMNA 5IR1A 2WTRA 3AXHA 3DPBA 1KMGA 3AVEA 4MXVE 2ZKMX 2Z4QB 3L3JA 1T89C 5CCJA 1I7RB 2CBQA 2VXSL 4PJBA 1DBMH 3WD5L 1H3XA 2AABL 4X6CA 5T5FL 5C0EA 5KOVC 1OT4A 1DN0A 5HHXH 2YD9A 1JGEA 1VCBC 1H0DA 4FCAA 4AEIL 1X3DA 1E2VA 4ZMXA 5HVGB 4HEMA 2WXIA 4JRWA 4TLUA 1D9KC 5DEFA 3FO9B 5FW7A 3D50A 3HHRB 2QELA 2VJXA 3HJEA 1SOXA 2QZQA 3MRBA 5B38B 3G5XA 4HK3N 5DUBB 4AL8H 3FCSB 1M6OB 1Y0LA 3I6LD 1QVOB 5DZVA 1YUHB 4NFDA 2E7HA 5CM1A 4H1LH 5D7KE 3I50H 4ODUB 1IBYA 5I1LA 5K59E 4OIAA 3L9RA 2EZ0C 1TVHB 4CGUB 3R06A 3VXTB 3L5XL 3Q5TA 3IPFA 1GHFH 3ARGB 2OXGB 3L1FA 1UA6L 5IB3A 2ZSWB 4F2ME 3QA3B 1JE6A 1UD4A 2JH2A 1JGVL 4NT6B 5I30H 2WLIA 2EINB 4BK4A 3CSBA 4XI5C 5DD6B 2V7NA 1ZSDA 4Z7UB 1GR7A 4MD5A 1TTCA 2VXTL 1T4WA 1NBZB 9CGTA 4HH9A 4GUOA 4RFEA 2VMDA 1F0LA 4QJ4B 3U36B 1OCCB 1CLOH 3AMLA 2AANA 1B4LA 3CXDL 4XNZB 5KBDA 2P28B 2NLJA 4FE9A 3PGDA 3MOQA 1LK2B 4M6AA 3SCMD 2LTQC 3AZUA 2F15A 2OL3L 1MCWW 4YE4H 4B96A 5B8CC 1JPTL 1XDTT 3VU2A 4MDJB 3VG0L 2IG2H 4LLDA 2UVFA 1OGPA 4R84A 1OAJA 2ZJSL 3BQVA 4BZ1L 2CGYA 1R5VB 4ZTEA 1N59B 5CLWA 2WK2A 1L9NA 5DUMH 4EIUA 3BPLB 4S0HA 3V4VL 1YEJL 5J4MA 2GCYB 3FTXA 4NQCB 4HJTA 3TVMB 3QXAA 2Q9OA 2NY5L 4MJIE 4UT6A 4Z7IA 1QSEE 1NMAL 4FRWA 2XTJB 4QTFA 3FJTA 4B0MM 5EIVA 1EJOL 1U8PA 3WIFA 4TSBL 1AQDA 3EO0A 2I69A 3NFPA 4OLEA 2BHZA 1Z5HA 2JTDA 2PO6B 4J2QA 1E0OB 3LPGA 1JZ6A 2DQGH 2WXJA 4RMTA 1RJYB 4NCC2 3I9GH 4F8TA 5BVJB 4GS7C 4G9DA 4P5TA 1WV7T 3GKWH 3MRFA 3P3TA 2E4TA 3B2VL 4LSDA 3RFRA 1CDGA 1ZIBA 1U8IB 4XNQA 1QEWA 3IVKA 2Y24A 5BO1L 3SPHA 2WLNA 3REVB 1T4KA 4M8QB 5L0QB 3A6BH 3LV3B 3F7KA 3FKUS 3LRKA 4NDMB 3UOAB 1HVXA 1REIA 2B5IC 2BFGA 3RDTC 2F53E 4JE0A 5D2NB 1NPNA 1KYUA 1N64H 1E4XI 1RCYA 4PJBF 2HFFA 3I02B 4X6CF 2D3JA 1IEBB 1UATA 2FGWH 1P1ZA 4I0PD 4LLYA 2F8OA 4RGOL 4RX4A 5ESVB 5FGBA 4Q14A 1JWMA 4P2QA 4GIOA 3V52L 3A22A 2I25N 2DMHA 4H8QA 1QOKA 1JI1A 3WELA 4AGPA 2N1KA 4UANA 1J5DA 4IEFA 4FQXD 1FH5H 1EHLL 3W37A 4IU3A 4D7PA 1TEYA 4Z7VB 3T4YA 4V11A 3NA9H 5F8RC 1FRGL 4OQTA 1WD8A 2ZUTA 4Y5VB 5INCA 3QJQB 4ZDHB 1AVAA 2NTFB 3CAFA 4AJ0A 3PABB 3VFVB 1J8KA 4XBEL 5TE6L 5FFLA 1FQ9C 1A21A 1MFDH 2J4WH 1FO0A 2AQ3A 1BV8A 3WEXA 4HMCA 4D9QD 3B2UC 2QGCA 5IK3A 1F56A 3ARGC 1R5IA 5F96H 2QQNL 3E9UA 3RWGB 4BKLA 3TNNB 2TRHA 5HJBA 2XG5A 5C0GA 4NC0B 4CMHB 2C26A 5ISZA 5CD3B 3DUUA 2A9NL 3WAKA 2KLTA 1SYSA 1NCAH 1YN6B 4RGND 4ZS6C 1I3UA 1EVTC 4M4RA 2X28A 25C8L 4I3RL 3IN2A 1W15A 2ZG1A 3BP7A 1KTDB 5DHDA 4N2NA 2OLDA 1A6AB 3V6OE 1CL7L 3WI9A 4L3ED 4DW2L 2WINA 1TTUA 4XNZC 1TTRA 4PY8I 1R24B 3X11B 4IQHA 2WSKA 4HKJA 5DZLA 4FXGA 3CPLB 3MLYL 3QDGE 4UQCA 1PYWA 3EOYG 1CXIA 1QWUA 1UURA 3Q5OA 3O8XA 3J27A 4NC2B 5HHQB 3O11A 4J4PC 1LWRA 2BS8A 4GKSB 5GGVH 3A6OA 1CCZA 2FBOJ 1URLA 1IUZA 2F18A 3BPLC 3BSGA 4LLVB 5B21A 4DPRA 4NC1E 1WG3A 3HG4A 3I74A 3TVMC 1RZIA 3HNSL 5TE4H 1JD7A 1E9QB 1JHKH 4GPVA 4LEXL 3TA3B 3NIGF 4X6DE 3U1PA 5BW7C 2F5BL 3L17A 4CC4C 4K3HA 1IAIL 3FTYA 4O2CA 2XWBA 4U1KA 3ZKMC 4P57B 5KSUA 3SPJA 4JZJA 2ID5A 5IM7A 1MFCH 4ELMB 2R39A 3F6IA 5DZPA 4N8UA 5EOTA 2PO6C 4AQZA 3ZJAA 2ZG3A 3LRSA 4JPQA 4CVXA 2R27A 1O7SA 3IJSB 7PAZA 4C47A 1EGJH 2D7TH 4XN2A 3X1EA 2YQGA 2J44A 3D3VA 5EBWA 2ICEB 5C92A 1AZUA 1UXWA 3D39E 1XGQA 4J28A 4XXDA 2Y6SC 1ZTXH 2DL9A 3VYNA 4PS8A 1NAMA 4YH6A 3ZYOA 5MEPA 4S2SA 1DQQB 3CSFA 5L0QC 5L2JA 1MJ7H 3K6SA 1OCWL 1K5NA 2AP2A 4Z3GA 1OP9A 2A9BA 3B9AA 5D2NC 2LAGB 4HPHA 4QRPB 3O4LE 4X4ZA 5DD3L 4RWYH 3P77A 5HD8C 2YIHA 1HNGA 2X0VA 1Z9SA 5D1QD 5KVDH 4PJ8D 4R7NB 1W16A 1EAQA 2JJSA 1WRFA 1S9XA 1INDH 4H8PA 1KXVA 5CJ5A 1VPOL 3TH3T 2DM3A 3GMNA 3HIZA 4MCYA 3O81A 4MA1B 2IWEA 4F7MA 2NZ9D 1MLCB 4MBRA 1Z2KA 1TVDA 2HT2D 3JV6B 2AEIT 3Q7JA 4QO1A 1MVUB 1PNDA 3IJEB 3H9SE 3PWPA 1BYOA 4H88H 4YGVB 5A2CA 2WOYA 5E6ID 1T1XA 4Y5VC 4X4XA 1FO0H 4HDIA 4HUKB 3P69A 4R7DB 4TL5A 1FZJA 1IGMH 3PQYE 5FLUA 1YPZA 4CU7A 2BVPB 1KEGL 3PE9A 1IGIL 1ECZA 1H3GA 3D0LB 4WI6A 1SUJA 4PBWD 3BZFB 1ZHLA 1AFVL 1TKWB 2APXA 4KRPD 4WEEA 1FZMB 1F45A 5TK2A 3L7EB 1J0HA 1LVEA 4GSXA 4ZI8A 4OLVH 1ZPLA 4PWFA 3ZE1B 4L4VE 4MJ2A 3CSYA 2V5SA 4ISVB 4BUGA 2RMNA 5T33H 4DN3L 5IQ9B 4CMHC 3HG1A 5L88L 3X1FA 4C56E 4URTB 4XN1A 4GP5B 3AU1A 3FW6A 3L6FA 4LASL 1KN4H 3BH9A 2EDEA 4PJFE 1TUPA 5HI4D 3Q0HA 5E9DE 3VVVA 3FQTB 5FA3A 3K6DA 1CFTB 5I16A 3TFKC 1M2VA 3UGUA 5E2UL 5ETUB 4OI8A 4D94A 3SJVD 4V2CB 3DSNA 1P9MA 2B59A 1VKXB 3WEMA 4UQDA 4B97A 4PU2A 2Y5TA 3NTCL 4L8SB 2TRYA 4ADGA 5FO8A 4IRZH 2CNZA 4OGAD 2XTSA 2EEAA 1WZMA 2HN7B 3ZHKA 1JWSB 1QMUA 2GTWB 3GRWA 1WWCA 4KHXH 5CJOL 4E42A 2NDFA 3ME0B 4XO4A 5AYUH 4DSYA 4ODWA 4GW5A 1HDMA 3Q48A 3GSNH 2VRAA 3F5WA 3HZ3A 2UZXB 3JT2A 4Q6IA 2DMGA 1LD9A 3CIQA 5LBSL 3UTSB 4E41A 4POYA 4QWWC 2UXFA 4W9FC 3PIQA 4OR1A 3NGBB 4ZO6A 5DEZA 2Z93B 4DVBB 4F7PA 2YS4A 4NUJA 2F1EA 4X7SL 3LS4L 3ULVF 1A6UH 2X70B 3KLSA 4IJ3B 4HIXL 2AHIA 1V05A 2MJWA 1XGTA 4YDKH 3GZKA 3OZ9L 3WS3B 3TA3C 2IIJA 4OKDA 4JKPH 4J1UB 1KGYE 2WLZA 1NCBL 2ZIDA 5DJCA 4NXKA 3QNFA 1YN7A 3SY6A 2FX8H 2GSMB 3ARVA 1WBYB 1RVFL 2BNRD 4MNGA 4JN1H 2DDQL 4KTDL 2HFEA 2WKLA 5AVVB 2ERJB 4AGOA 3UO1H 4MWFB 1CR9L 3ARUA 3DHPA 3S37X 1RUPL 2VN6A 2ZKHL 4PJ7A 1I9JH 3DMMB 5FGSA 1PY4A 5EF2A 1SJHB 3U2JA 4HJGB 2GK0A 1NPJA 2HTLC 2ILLA 4AOFA 3ZZ1A 2PYFB 5GGSB 3U1QA 2HFGL 2ICEC 3I6KA 3EDFA 3FFDB 1OM9A 2MOGA 5C3IA 1V8HA 3DV6B 2V9TA 4GRLA 1KYFA 1LQSR 1YO4A 2HJFB 3H0TA 5DD0H 3G3LA 1WCQA 3UJIH 1W2KT 4KY2A 1EQWA 4P0DA 4YWGH 4WFFD 5J11B 4MAUH 4UIKH 2WYZA 1QI4A 2EIZA 3PHAA 5C07A 4C4UA 2HXAA 3MRMB 2J6EL 3ECUA 2GC4C 3HUJF 4G1MA 3FFCA 3QUYB 1NCNA 5E5MA 4MTMA 1NQBA 2W9DH 4Y4HA 1B9ZA 5EOQL 2A38A 3RVTC 3QDMA 4HULB 4UDUB 1NGZA 1T89A 3V5DA 3DA0A 4PJEA 2PCPB 2PPAA 1TZIB 5SWZA 4XCCH 1MJUL 2Q7AA 1HSAB 3O6ML 4ZOEA 2QSVA 1IIKA 5F9JB 1MXDA 2VXVH 3V0GA 5IBUB 2YRLA 2IALB 4JFYB 5BV7H 5E08L 1MWAH 4MHHG 5CFHA 1UD8A 1YPZF 2BNQE 2Q3XA 1D9KA 1ACCA 1T66C 3DHJA 4EXKA 5IIEA 3NSFA 1WDAA 4I0CC 2OK0L 5KYXA 4JQIA 1MW1A 3GZPA 3MREB 3GXPA 1T5WA 1G9EA 3E6FB 4L23A 3QC6X 1IV8A 2E4FA 3MUUA 3PPSA 4U33A 4N2LA 5JHLH 1UOWA 1G1YA 5JNYA 2EDHA 3VJ6A 3N85L 1TZHA 2XZQH 3OLIA 4IBTA 2IFFH 2W07B 4Y5XB 5T1LD