4F2EA

Crystal structure of the streptococcus pneumoniae d39 copper chaperone cupa with cu(i)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
b'GAMGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGMNMMHGKMIVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CupA
molecule tags Metal transport
source organism Streptococcus pneumoniae
publication title A new structural paradigm in copper resistance in Streptococcus pneumoniae.
pubmed doi rcsb
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4f2eA00
3PXLA 4BDVB 2X87A 3U25A 1I53A 1J5DA 1MG3C 3TBBA 4BWUA 2PPCA 3CG8A 3QJVB 3EH3B 3FT0A 2PPAA 2J55A 2HX8A 4F2EA 5D4JA 2ZWNA 3NJMA 4AKOA 1PLCA 3S3CB 3T6XA 4GP4B 1GY2A 3CDZB 1WS8A 3AG4B 4G71B 5B1KA 4HZ1A 4G7RB 3AY2A 4E9WA 2CAKA 4HAKA 2CALA 1KDJA 2VM4A 2PLTA 5B1AB 1JXGA 2UXVA 1SF3A 1OCCB 4HCIA 1ID2A 3ASOB 3CDZA 3FU8A 4A67A 2QDWA 1JVOA 2FQGA 2XV2A 3NJIA 1ZV2A 4AI7A 2EIKB 4M4RB 1KYAA 3S3BB 2GI0A 3X1GA 2XWZA 5B1JC 3X1BA 2IDUA 5F7BA 1AZCA 2BP8B 2HZHA 1NICA 2HLEB 3S8FB 4M3HA 1BXAA 1M57B 2QPEB 2W88A 4KNTA 2UXTA 4YL4A 1IUZA 2LLNA 4AZUA 3TA4D 2ZXWB 2UX6A 3FYEB 1ET7A 2IDFA 4KNUA 2J5WA 3X1NA 2GHZA 1ASPA 2BO0A 3T9WA 1E65A 3PPSA 7PCYA 4Q89A 2YAQA 1IKOP 1QNIA 2FQFA 3X2QB 4HCFA 3EH4B 1WA2X 2BP0A 2FJSA 3NSDA 5I6MA 3X1EA 2PP7A 2BWDA 3FU7B 1L9QA 4A2HA 3NSYA 1AG6A 1KBWA 5TK2A 4E9XA 4DP4X 2AZUA 2QDVA 3CVDA 4CSZA 2GBAA 4PCYA 1WS7A 2FT6A 1OOWA 2UXGA 1V55B 4NB7A 1SDDA 3N2JA 1BQKA 3PLYA 2BP8A 2PP8A 2CJ3A 3FQYA 4YSRA 4E9RA 4NERA 4AKQA 1X9RA 1F56A 4RH4A 1L9TA 1TEGA 3AG3B 1NDTA 3IE9A 1AZUA 4N8UA 1OCRB 1JERA 2I7SA 4HIPA 1PZCA 2FT7A 1J9RA 2IDQA 1N70A 3BVDB 2YAPA 4YVUA 3QQXA 1TKWA 2DWSA 2I7OA 1JZEA 1E5ZA 3NP3A 2Q5BA 2GC4C 3NSCA 1OE2A 3FS9A 1ET5A 5B3SB 3H4FA 2Y1AA 4A68A 2XX0A 4P5SA 1NIAA 4W1TA 2YAMA 2BHFA 2IWEA 1JOIA 1GS7A 4YSQA 3SBRA 1PNDA 2UXFA 4YSUA 4NAJA 2PCFA 2EINB 5I26A 1WA1X 3NSFA 3QPKA 2MRYA 2H5UA 1M56B 1PF3A 2AVFA 5I6KA 2UX7A 1ZDSA 1AS6A 1PNCA 5B7MA 1KCBA 4BDVA 1GY1A 4MFHA 3DIVA 4DPAX 5ANHA 1FFTB 3MX0B 5AKRA 1PLAA 3DKHA 4YSOA 4YSTA 2VW7A 4ENZA 1CYXA 3S8GB 3WKQA 1GS6X 3OMAB 1AS8A 1KBVA 1A4CA 5B1JA 1JXFA 1NTDA 1SF5A 3V9CA 3OD3A 3FSAA 4KOCA 2DYSB 4A2DA 1E30A 1GW0A 1IBYA 2XYBA 1ADWA 3IN2A 1ILUA 2N0MA 1W6LA 1GS8A 2XXGA 2VMJA 2YXVA 5I6PA 2WSDA 2H47C 3NJFA 5D4IA 3ABGA 2BZ7A 1MDAA 1J9TA 4JHUA 4DP5X 1ASOA 2OJ1A 3NJKA 1JZFA 3T6ZA 5A7EA 2YARA 3QJQB 4W9ZA 1HAWA 4BWTA 1CUOA 4EF3A 1WAEA 1ET8A 3SBPA 2I85A 3KW7A 2IH9A 1AANA 2CUAA 3D12B 3FPYA 4E9SA 8PAZA 4G70B 1ASQA 1BXUA 3ABLB 5E9NA 2QT6A 4E9YA 3PAVA 3EF4A 1AZNA 2FWLB 2JKWA 3H4HA 4FA7B 1PAZA 6PAZA 2PP9A 4YSCA 2B08A 1ZIBA 2P80D 2XX1A 3WG7B 1CC3A 1VLXA 4BXVA 4DP8X 7PAZA 1FA4A 1L9OA 3ZIYA 1PZBA 4DP2X 4E9QA 3OMIB 5B7EA 2R7EA 3NJNA 2FQEA 1GSKA 1KV7A 3G5WA 1GYCA 4YVNA 4DPBX 4QLWA 1RKRA 5I28A 3AG1B 2NRDA 3NT0A 1HFUA 5AZUA 1JXDA 1XB3A 2E86A 5LDUA 1DZ0A 2XV3A 3NJGA 1A4BA 1FWXA 1BAWA 2CCWA 1IBZA 2EILB 3KW8A 2FQDA 2FT8A 2DY2A 1A8ZA 2PPDA 4GY4A 3UAAA 5I6NA 4HALA 1AOZA 1JZHA 5FC9A 2HX7A 2BW4A 9PCYA 4KO6A 1OCZB 2IH8A 2DV6A 3MBWB 4BK5C 3WNIA 1SFDA 2IDTA 1BYPA 2W8CA 2J56A 2XUWA 3UAEA 2A3TA 2QPDB 5PAZA 4YSSA 5F7AA 1EZLA 2BW5A 3UGEA 4ZK8A 1JVLA 2YAEA 2AANA 3SBQA 4AX3A 2XVBA 5EHFA 2P80A 1QLEB 4QKTA 4G7QB 3NJHA 1YLBB 3IEAA 3IBOA 3EH5B 4YSDA 3FSZA 3ERXA 2GC7C 3H56A 4UANA 2RACA 1J9QA 2JFCA 2XV0A 3JTBA 2H3XC 2Y69B 3QJRB 1DYZA 2FNWA 2MTAA 1PZAA 1CURA 2YQBA 1OCOB 1RZQA 3ABMB 3FSVA 4HHGA 5TK4A 1NPNA 1WA0X 1AIZA 3GYRA 1SHWA 1J9SA 4KNSA 1ILSA 2J57A 3CZUB 3OM3B 4DP1X 3DTUB 1SJMA 2AFNA 5I5MA 1KDIA 4JHVA 1OF0A 4G7SB 2Q9OA 3UACA 3NJLA 2OV0A 3NJJA 5I5JA 4A2EA 2BZCA 2IWFA 1BYOA 2PPFA 1A4AA 2JXMA 1AZBA 1MG2C 3FYIB 1KGYE 1NWOA 2OCCB 1ZIAA 1JZIA 2YXWA 3FPXA 4CSPA 1EHKB 3T6WA 4DP7X 2HXAA 1NIEA 3L45A 3T6VA 1T5KA 3CVCA 4K9JA 3V9EA 5B7FA 4BXSV 1NZRA 1X9UA 2FTAA 4DP6X 1N68A 1SFHA 4FAAB 2TSAA 2EIJB 4HCGA 1AQ8A 2TSBA 1PY0A 3HEIB 2VSMB 3UABA 5PCYA 1PLBA 1BEXA 3NYKA 3ZDWA 3UADA 4F7KA 4TXVB 4A2FA 1ZDQA 3PAZA 3RYMA 1A3ZA 3N55A 2VW4A 4HHWA 2HX9A 2PCYA 1BQ5A 2YAOA 3NP4A 1XMEB 3S3DB 4GP5B 3GDCA 3AZUA 3GXUB 4A66A 1W8EA 2HRHA 3ASNB 3SQRA 4KO9A 1M9WA 2IWKA 1V10A 1OE1A 2BWIA 1OV8A 5I6OA 3FU9A 1JZJA 1SNRA 1TEFA 4DP9X 2GB2A 1AG0A 3HB3B 4WKXA 3AG2B 4DPCX 1AACA 4YSEA 1NIBA 3EHBB 4BWWA 1NWPA 1OE3A 5I6LA 2CBPA 4N4YB 4KOBA 2DYRB 4UAHA 1XB6A 1ZPUA 3TU6A 3FSWA 3FQ1A 1AAJA 2VN3A 1BQRA 4X4KA 1KCWA 1NINA 3ABKB 3FQ2A 2B3IA 2WO3B 1E5YA 2DWTA 4KO7A 1R1CA 1TU2A 2IAAC 3QJUB 4UF7C 2AZAA 3QJTB 4E9VA 3IN0A 3WIAA 1V54B 5IY5B 3CVBA 2R7EB 4PAZA 1W6WA 1UATA 1L9PA 2IDSA 3WNJA 1NIDA 4Q8BA 2VSKB 2BP0B 4JKNA 4YSAA 1NIFA 1BXVA 3T71A 1E67A 4GP8B 1AZRA 4G72B 3OMNB 1NPJA 3C75A 3AW5A 1AS7A 1PMYA 3ZX1A 2HRGA 1A65A 4AKPA 2YAHA 5B1BB 2VM3A 2VW6A 1B3IA 1SDDB 5AFAA 6PCYA 1GR7A 2XXFA 1CYWA 3PAUA 1IC0A 2PPEA 1L9SA 4P5RA 1QHQA 2WO2B 4YSPA 2ZONA 4GXFA 2GSMB 2GIMA 3FU7A 4E9TA 1J5CA 4A2GA 3TASA 1PCSA 1RCYA 4WTQA 2X88A 3OQRA 4L0PB 3WI9A 4F2FA 4DP0X 5D4HA 4GYBA 1SHXA 1ETJA 2XU9A 1HAUA 2XLLA 3X1FA 3ZBMA 1RZPA 1URIA 1XB8A 3WKPA 3QJSB 4KO5A 3PCYA 1MZYA 3JT2A 3BQVA 3TBCA 2EIMB 1AR1B 2YAFA 2ZOOA 1MZZA 1JZGA 1L9RA 5I5IA
chains in the Genus database with same CATH superfamily
3CSYA 4K15A 1LQSR 3BGMA 2EO1A 5ICUA 4JY5H 3FCTB 1F4XH 2PCFB 2QVMA 3TVMC 1GPOH 3WUWG 4QRQA 3SD5A 2EUWA 3RVUD 4F2EA 4WU5A 2X6BA 3TYFA 4WKZA 4AKOA 3IJ8A 3FMGL 1Z9LA 3EO9H 4M02A 4YX2H 4XN2A 2WYTA 5I1EL 2EAEA 1PVHA 1BAFL 1WBZA 3RVXD 1NUNB 1HWHB 2YD9A 4FFYH 2ZXAA 1CXKA 1OSZB 4D9LL 1KN4H 3R1GH 4EN3A 5AVXB 3T3MF 4XE5B 4ZMTA 4G8IA 2X05A 2R1YB 3WKNA 4B96A 1ONQA 4JFDB 2XNAA 3KM1A 3GTNA 2XWZA 1FAIH 3UG4A 4XCFL 1KFGA 1OHZA 5F7BA 3U0TA 3SDCA 1P84J 2WWNA 3IAGC 4U1IA 4JG0H 3UYRL 3B2VH 2DIBA 3ZDYB 4M5SA 3IDIA 4JUTA 2AQPA 4WV1A 5M94B 5C08E 1WHPA 3ZMRA 3T2QA 2V9UA 3U6XA 1K9TA 1S3KH 4N0FA 4KNQA 2UX6A 2VDQH 1P7QB 3FUEA 3D51A 1T0MA 4N5UA 4DN4L 1EJFA 1GAFL 4FJYA 5HSFA 1G7PB 1D6EB 5EO1A 4Q89A 3BXNA 2YAQA 4R90L 5GS0C 3MDJA 5E4IA 4RGOH 1MY7A 1J0KA 5T1DH 1ZT1A 3HHMA 4N8PA 4FXGC 3L1OH 1G9MH 3V7AG 3SE8H 1UOWA 4MQXD 1NCAH 2F5AH 1XGYH 3U4BL 3G6JA 1BD2B 5BQDA 3X1EA 4AIZA 3BN3B 3HS0C 3IJYB 1L9QA 2XA8L 3K6DA 3Q1EA 4JGJA 3LSOA 4JO3H 3UBHA 5DK0B 4A2HA 3D0LB 1IGJA 5DURB 3DETC 4IGBB 1JWSB 2D31B 1MVYA 2H32B 1YQVH 1IV8A 5CLYA 3LKSB 2C7UB 1RPQA 2CJTA 3B8SA 5IEKB 5I1IH 1RHFA 3F2LA 2X2IA 4FA6A 5C0BA 4ZMOA 2WD0A 4OF8A 4B95C 1L7TH 2CJ3A 4HCRA 1J5HA 1QNZL 3Q3GB 3UBXA 5KYXA 4L0YA 4AKQA 1YN6A 1Z5HA 3JUZA 1TEGA 3UROR 5IJDC 3MRDA 3ZGIA 4AY0A 3ZQXA 3IMBA 3Q8AA 1FUNA 4IK7A 5ALCL 4HULB 1SJHA 2IDQA 4LESA 4HC1H 3RWDA 1E2WA 2C9QA 3D09A 5T5NF 3OSVA 5E1QA 4XGZB 2BNUA 3RGVB 1GZQB 4JFHD 4OR1A 2OK0L 15C8L 1CK0H 2J2ZB 4AQ1C 3KVPA 2FEDD 3REVB 2BHFA 3C5SB 4PRHB 4XB8A 2OMZA 3NESA 2ZUWA 2HKHH 3GIVB 4Z3IA 3GSRA 4NAJA 5D7JC 5EWIH 3BQUC 3HRZA 5IBLD 4OVVA 1M4KA 3PY9A 2GQHA 1Y1UA 3CFDA 4ANUA 3OZKA 2BXZA 4TQEL 4HGMA 1T0OA 1JGIA 2IAND 3HR5A 3HMXA 3OTTA 2GJ6B 4L3CB 4U33A 4H1LH 5DUPH 4DPAX 5LWYH 2E47A 3ARBA 2OTWA 3LXCA 1X4ZA 2IAMB 2QQQA 1CYXA 1A7QH 4ISVB 4GS7B 4P04A 3S8GB 4RGMB 1M3JA 4XP4L 1AS8A 4LVNC 3UBFA 3MRCB 4Y19A 3UPRA 1DEDA 1PYWB 4HH9A 4UNVA 1MF2H 2C4XA 4HKZA 3NH7H 4YHNA 3G3LA 2FIRT 2H9GB 4JFSA 5AYQA 5HYEA 3MROB 2VR8A 2XYBA 3N5AA 2EDQA 5KJ4A 2HG5A 1J5OH 2OBGA 2JIXB 1K8DA 1ECYA 2ARWA 4BK4A 5BV7L 2OYLA 3MRMA 4O2EA 1IMHC 4PV1C 2JCCA 4P06A 3FQNB 4BQCA 1ND0B 3W56A 3BSHA 1MSPA 4OGXH 4LCYA 1KCRL 4PJFE 4NGHL 1HHKB 1INQB 3MCKB 3QJQB 3G5XA 4QRPA 4LNVA 3EO1A 3RZCA 1PBYA 2DL2A 4NKOA 2AXFB 4D0CA 3JWDL 2DMCA 2Q8AL 4I18C 2NTFB 2CDFA 3ULVL 4YO0B 2CR6A 4X6DE 2J8OA 1M9SA 3DK2A 3IJ9A 1QEWB 4XI5C 1RUQL 3N85L 1PG7W 3RWCA 4HK3J 1U58A 3ECBA 4NN7C 3I9IA 4WWKC 2DJ4A 4LVEA 2P48B 4NBZB 4XVTH 1IBHA 4JN2A 1QTPA 1LILA 2EDBA 3M1OA 3NCBB 2YMOA 2A74B 1G9HA 4HJJL 4YLQT 4TUJA 2DWXA 4QXUL 2Z35B 4E9QA 4PRPE 4MAYB 1M2OA 3MPCA 4XNYL 2IALB 5J12B 1QSZA 4CDHA 3ARGC 5KZCD 1T6BX 5CKGA 4DPBX 5C0NC 1S9VA 1RKRA 5H35B 2NOYA 5C7XH 3MRFA 1FP5A 1ZT4A 3ZUCA 4BKLB 3AY4A 4XNZC 1OW0A 1NCBH 4ONGL 1M7IA 2XWDA 4B41A 2OP4L 3ZT6A 1OZTG 1KTBA 3FN0H 4JJOA 4CKQA 4UBDC 1QSED 2UWEE 1FO0H 4UTCA 5D1ZC 3L9RA 3C87A 1FCGA 1QD0A 2NY6B 3BIKA 3EO0A 2A1WH 1LO4L 3N42B 4GSDH 4JX0A 4TUKL 1Q9LA 4FQ1L 4YDKH 1FORH 1VCAA 3SQOH 2NDGA 4HALA 2IPUK 4KKAC 2A9NL 3GSWA 3F05A 4PJXE 4I87A 3L9RB 4XOEA 3FQTA 5SWSB 5CEZH 2C1OB 4W9IC 4JGUA 2J8UA 4L3FA 3SYCA 4QDGA 1CGWA 3VD3A 4PGCA 5IB1B 4TTGA 5HGBA 1QA9B 2ICWB 4FI8A 3ZGHA 2DD8H 3MRFB 4QT5B 1PY4A 5K9OB 1J8KA 1S9VB 3D4CA 3HI6H 5L4IA 5T1JA 5AOIA 3LS5H 3WGVB 1N5AB 3E1ZA 1ZWIB 2XVBA 3HNVH 1X4XA 1AE6H 4HW6A 3DHJA 2VXSH 2Q3XA 5DHEA 3CFKB 4Y16C 1NSNH 3CWGA 4XMWA 1S7TA 1T6WA 2J88H 5AYUL 1AHMA 2RACA 2JFCA 2NYYD 3ATDA 1TJIH 5AQ0A 2VOTA 3JZ7A 5IFAL 1IFRA 2FNWA 3BGAA 3D2UA 3WHE0 1KULA 1F1AA 2EABA 3LV3B 1OCOB 2DYPA 3CK0L 5I16B 3DYMA 3DROB 3GHBL 4JFFA 3DRTB 5DT1L 3X13A 3CHRA 3GJFK 4AL8C 3GFUA 2ZYSA 4NQDA 1AIZA 2CDFB 4APQB 4ZFFB 1ILSA 2BP3A 4XNQB 1BAGA 3SCMA 3VRLF 1KDIA 3GSQB 2WZ6A 5CP7B 3MKKA 4MZIA 3EO1B 1B0IA 4FX5A 4HLJA 3P1VA 3MRIB 3Q9PA 3RILA 3UACA 4NIYE 3G5XB 5D7IE 2EIEA 3MCKA 1CFBA 2RFXB 4FQJL 4V33A 3O6FD 1WFOA 1NQBA 1BSIA 5KVEL 1A6PA 2HVJA 3D2TA 3S97C 3ZHDA 4ODTH 1NWOA 1X5ZA 2ICWA 4OFQA 3MYZA 1OO2A 3HI5L 4NQQA 5IB1A 1UH4A 2D9CA 2H9GA 5CF3A 3C8DA 4YE4L 4UM9D 4R5TA 2C1OA 2C9VA 2B3RA 1MI5E 4P4RA 5T3XD 4BCXA 5A7BA 4KAQL 1YNLL 1LK2A 3P4MB 5I71C 1TTGA 1A9VA 4DQOL 5IOPB 2WLJA 1KLFB 4R7LA 3JTSA 4EDXA 3WHE1 1A7PH 1PLBA 2FD6H 5A2KH 1CLVA 2OJEA 2E7DA 4XMTA 1J8HB 3L2LA 1M7IB 1NANH 3FT9A 1ZDQA 3LIZL 4LLMA 4UT9A 1GZPA 1ZT4B 4BKLA 4LARL 3SYPA 4LEOB 3JZYA 4PVBA 3GIVA 3WO4C 4KI5D 2VJ8A 1CDIA 1OARL 3S3DB 3WXWL 3REVA 5EOCH 5GSVA 5T8IA 1MVUA 2FO8A 3IVKB 2AMUA 2IWKA 2Z31A 4LP5A 2VDMB 1LGVA 2EXYD 4O9HL 4NPKA 5BVJB 1I8MB 1IKNA 1TEFA 4RNRB 1F97A 1I31A 5E8EA 3WJJC 3O6LL 1U58B 1X5HA 3WMSA 1KENL 5E6ZA 3N1MC 4OUUB 3WL9A 3DXAB 1FZMB 2XG4A 1BFVH 1U8OB 3B5HA 3Q1SL 4LDEB 4D0CB 1UH2A 2EYTB 5C3LD 5D1ZD 4OV5B 4LMQI 2EP6A 5JXEA 1IAOA 1XSOA 3ABKB 4JRXE 4QRPB 2H6UA 1EH9A 1E5YA 3AT9A 1WJ3A 1HQ4A 4XRCA 1CGUA 1INQA 3VFRA 1HJCA 4ZX5A 3WIAA 2D31A 2WUBL 3IWVA 3FQNA 2JCCB 1OB1A 5TE7L 5DK0A 2NY5C 4G9FE 3AJ7A 2QSCL 3L17A 1I9RL 2JIXA 4LLVA 4AIZB 3G6JB 1HH6A 2BVOB 3UTZA 4GRMA 3OWRA 4EAEA 4GJTB 4HKZB 1P5VB 2R83A 4OSUL 2VISB 1UT9A 4MRBA 3MACH 4ZS6C 3O41A 4KV5F 2CBQA 2HWZL 2ESVB 1N59A 3EAKA 3U36B 1O7SA 1U6AL 3L6FA 1J86A 3HR5B 3L13A 4MZ2A 1R5IB 2F2HA 4XTRC 1JP5A 3BMVA 5LUMA 4M1GH 2HB0A 5D7LA 3T5WA 3VXTA 1R9FA 4DETA 3D48R 1SDDB 5E2TH 1CD8A 3HBGA 4FQXD 2WZ0A 2MKWA 3GSRB 3QQ4B 2WO4A 1IC0A 4U1SB 3X3FH 1L9SA 3BO8B 1QHQA 4POYA 3IKKA 4JQIL 3EG9A 3UDWA 4Z7WB 4KRNA 4PBVC 4PWEA 5B3NA 5BO0D 2YUXA 1FAKT 5ILTH 2CJUL 3MXVH 3SGEH 1GZQA 1PCSA 3BQUD 2JELL 3CLEH 5CUSL 3OQRA 4EN3B 5KVDH 2IH1B 1YNTA 1E5BA 2JK5A 3SOTA 4PJGA 3LKRA 4GIPD 4I9WE 4LCCB 2GW5A 1QYGH 4PGDB 3B3IB 3U0WL 4NO3B 5AB0A 4AMXA 2V0AA 2FLRT 1G94A 4HEME 4X0KB 2Q8AH 1KYOJ 4UV7L 3OGOE 3PGDB 5DS8B 2P7TA 4X7EC 4IRZL 1AGEA 3MV11 4PJHE 3CZLA 3WN5A 3ULUD 5IHWA 5L2JA 3ES6A 5ESQB 4Y0GA 2DF3A 4GG8A 1JXKA 3BVNB 1MRFL 5IW1B 2RB8A 4HHAB 1IGJB 1AYRA 4YDJA 1FL5B 2Z64C 1GY2A 2YGOA 3AG4B 4G83A 2XOTA 4L1HA 4HEPG 4LPYA 2GT9A 5C1MB 4K94H 1A66A 2W91A 3CE1A 4Z7VB 5INCA 4UINL 2PLTA 3BXNB 3QUHA 4UDTA 3VM5A 3EADA 2PYEA 4NPYA 5FAAA 4F58H 3TO4C 2CKBH 3BKJH 1T0MB 4ZUWB 1XGZA 1C16B 1P7QA 3QJFB 4FQLH 4N0FB 2YD5A 3RY6C 2EIKB 1KYAA 2XACC 2YLKA 1EFXB 5CU9A 3X1GA 4YZFF 2VCOA 1TSRA 3IDIB 1NMBH 4F2MB 4MAYD 3KBPA 5IF0A 3KPOB 2CE6A 2O5YL 4M1DL 3SDCB 3VFWB 4PRPB 5KZCB 5TQ0L 1CGSH 1X7QA 2UXTA 4J3OD 2FO4B 3B2MA 1FHNA 2R1YA 1R4XA 1TVBA 3DBSA 3I2CH 3KZ8A 3DVGA 1RPKA 1KJVB 3PPSA 3NEOA 3FQWB 1G7IA 3GSOA 2BVUA 1CFMA 3L5HA 4L5FE 3GSOB 2Z8WC 3EH4B 3QFDB 3RVVC 1AE6L 5F8QC 3UJTL 4NQDE 3NIGB 3EYSH 5DQ9A 1AFVL 3DX8B 5I6MA 3B6SA 1G9NL 5D1XB 4PTUB 4XR8C 5CO1A 3JQOB 3QHFH 3LNEA 2J88L 3ARFC 3QJHA 3GKZA 4G7YL 1W72L 1QI3A 5BUGA 3G6AA 3PP4L 3CVDA 1G9EA 5JIMA 3KWTA 4PRNB 5FECA 3A0OA 5IHZB 5IF0B 4P5TD 1SUHA 3PWLA 4BUGA 4ZFGL 1X3DA 2X42A 3FQYA 4OBSA 3ZTEA 3IGAA 1JUFA 2IGTA 3PWJA 2JF1A 1OT2A 2OL3B 2MOVA 5D1ZI 5E2UL 5ERWB 4DO4A 4XPTH 5GZNA 2NY2B 4K0OA 1OW0C 3BH4A 1W0YT 4R8WL 4F37F 1AHWA 3I3DA 5E94B 5AL0A 1LD9A 1BMGA 3P0VL 3QFJE 3SODB 2XPZA 1CDBA 3AB0C 4KJQD 3OKEA 3C5ZB 4FXKB 5C0EB 3DJZA 4MX7A 3PYCA 4HHAA 2IWEA 1JOIA 5I71B 3VD7A 2UXFA 1N6QL 4MMXB 1JGDB 1JN6A 3VXME 4L37B 2YSSA 1E3XA 3GLAA 3N9GL 5I26A 1VKXB 4N90D 2PMZA 5E7BA 1M56B 3I6SA 3OL2A 3P4OA 4KDTA 3WE6B 3OX8A 3ULSB 3SJVE 5I1AA 5ANHA 3MRHA 1ZGLA 5IIEA 3MX0B 2Q6WA 3BW9B 3I6LD 1BLNA 1C08A 5BUPA 4M3JA 3B2UD 2XN9B 1DQLL 4U4BA 4WHYH 2W07B 3HC2A 3HE7D 4TV3A 3C2AL 4KOCA 5IMKA 4QHNB 1H3VA 4ANXA 4GKLA 4FFWD 4LHUG 3APMA 1JHKH 2PTTB 2ZWZA 3JYBA 1S9XA 1BFOA 4HOWA 3NOIA 1LEGA 2QQLL 1TSHA 4J6IA 2D7MA 5GRWA 4PMFA 5C09E 2TRYA 3CSBA 5BJTB 1BBJA 4QOKE 4X5RA 3F7PC 5D1QA 5C7XL 4RWYL 1SOSA 2BINA 1I3GH 4BWTA 2I85A 3L6FB 1AD9A 1WAPA 4GW1A 4W68A 2XZCL 5J56B 1FN4A 4XB3A 1N59B 4BH8B 3D08A 4EE2A 3EBIA 3DV6A 1MHEB 2AKRA 2NYYC 5CZVH 4PRAA 1NEZA 1PG7X 4PBXA 5IQLA 3SKNB 4Z9KB 5G5DA 1LL1A 4YHOL 5I74C 3QULA 2WXIA 3RWIB 1OPGH 7PAZA 2E56A 3CIAA 5AG8A 1J7VR 2V7HA 3BD5A 3RZCC 4K73A 5BZDA 4HEMA 3L3OC 3BRFA 1BVNT 3QCUL 3NJNA 2OZ4L 2EXSA 1IC4L 4XX1E 1TQTA 3MACL 3QUYC 4IOIB 4D3CH 3H3KA 5D1ZB 1MAMH 1TU2B 4YHYB 2AQ3A 3D25B 4YPGA 1HQ4B 2E86A 4WWKA 1F8TL 4XRCB 3MRBA 4M61B 2VDLL 3D85D 5CR8A 4P3WA 5FUCE 3A6CL 4D2NA 5CEZE 1K5WA 2Y22A 1U91B 5EN2B 4GG6F 1EHXA 1RZKC 2OX5A 3BKCH 3ZKMD 5ANMA 1A7BA 3V6OA 1U8OA 3O3DB 2APSA 3V5KB 2HUEA 3MRKA 3RTLA 5CZXD 4JDVB 4N2NA 1E5AA 2HFFB 4F5CA 3WJMA 4PRID 1JZHA 2GFBA 1PZDA 2HX7A 4RLDA 1H3PH 4L1LA 2E9IA 4TSBL 5KSBF 1D5XB 4QXVA 4GUCA 4PRBB 5C0GB 2E6JA 3BH8A 4W9JC 6TAAA 1R5VB 1KFAH 4XBPA 4K9EH 2A3TA 4KTGA 4CBZA 2YAEA 1S78D 5E6RB 3QDJE 4ODTL 3RB5A 3KJ6H 4XTRD 3OAYK 1NCWH 2LV4A 3E6FB 1MQ8A 2PWGA 3SE9L 2MQCA 4HJTA 4NKDA 4AYSA 3MBWA 3MLTA 3RVXC 1SOQA 3NSJA 1DJSA 3FUIA 2VUOA 2VC2H 1SDAB 1IC7L 1EDYA 1XGUA 2MTAA 3JTSB 1OF2A 4P9HC 5HHPB 4LCUB 3ZRFC 5JPNA 2GI7A 3MRGB 2JKTM 2VDMH 3KDMB 4K7FB 2B59B 5TFSH 3T2OA 4L4JA 3WKYA 1F13A 4Y4FD 4LSRH 3EYOA 5INDB 3LEXA 2DI7A 1K5NB 5LJYH 2IPTL 4RIRA 4ALAL 4GS7C 2PPFA 4QI3A 5CKAA 1H19A 5F7DB 2NY0C 2OCCB 1UB6B 5J5EA 2EDHA 2RFXA 1RZ7L 3ARPA 3WXVH 4KXCA 3MV8E 4I48A 3T6VA 4BEIA 3GSQA 1HILA 2Z0BA 4DGVL 4F9LC 4W70A 4FS0A 3DX3A 2RTTA 4IKIA 2FTAA 4Y2DD 4AUJA 2AQNA 2FX9L 3L3KA 3DRTA 1HHHA 1WISA 3DROA 4BZ1A 5TDNA 5C0FA 4FAAB 4FYQA 2DYPB 5FO7A 4YNYB 5AVUB 2XI9A 3KPRD 1FG2B 1YEFL 3BP6A 4OZGB 5HY9A 3FBKA 4FYTA 4RISH 4TPRL 1LEIB 1GCFA 3QZPA 3TURA 3NGBC 4FQPA 3V2AR 2NZIA 1CGYA 4ZAKD 5DEFB 1AIFA 43CAB 4Z7UB 3N55A 1T0NB 1XL6A 4GRWB 3UEZA 1OTSD 2P47B 4V1DB 3ZSTA 3R0MA 1YJDL 1QFOA 2YAOA 1ZANH 5BZWB 3BLPX 3L9BA 1AFVH 1HESA 2HRHA 3BWUF 2QADC 3WY2A 4PJ7E 1YO4A 4L8SA 4EN3C 4MNHA 4YLCA 3VD0A 4BA0A 2VDOB 3DXAE 4X4ZA 1UWYA 5HDBF 3FOMB 3WCYA 3U6RA 3P30H 1TTBA 2GB2A 5SWSA 3ZKNC 1RZGA 4ZMXA 1OSPL 2P45B 5TTRA 2R2CA 3WMPA 4UYQA 3W11C 1H3WM 2WP3T 1X44A 4CVXA 1EJOL 4FERA 2CLZA 3BX7C 4P2QE 1VACA 3GSXB 2B20A 3UGUA 1XH3A 4FXGB 1COBA 1BQRA 2R0LL 3ETBF 5DI8B 1HSBA 1QUPA 4LLYB 1NFAA 1HDMA 5L88H 4ONFH 4YUEL 3E9TA 4NNYA 4Z7NB 3DX6B 1R1CA 4XPGL 2FZ3A 1N0XH 1IKNC 4R8WH 2GTWB 3ZXAC 1AOHA 2AZAA 4FQCH 5AWNL 5I24A 4QOKA 2ATPB 5D1QE 2CIIA 4JQIH 1FC2D 4X2UA 1PEWA 3V0DA 4OZIE 2PTVA 1OAYL 1LO2L 1OAJA 2Z35A 5LKNA 1KXHA 3H9YA 2JELH 3CLEL 1NEUA 5HGAA 1GGTA 2VSKB 4OM0H 1IFHL 4JN2B 4ZPTA 1KYOK 1KXQA 2B14A 4MBRA 4ZMNA 1ZD6A 2WXMA 3ESUF 1BOYA 5EFIA 3I74A 4IMKA 1V27A 3RWCB 2Y1VA 5B38G 1AGBA 3AW5A 5L2KE 1QLFB 2GBTA 5T3ZE 4X8GA 4D9QE 2ZXBA 5DZAA 5I75B 5J0BA 3I6KB 3MGTB 3FMGH 3AAZA 2FK9A 1TZGL 3FUNA 1IGCL 1I1FA 4HZLB 3HS8A 2PWDA 1VGEL 4ZDHB 1YMMA 4HGWB 5AFAA 2B1AL 2IBZY 3C5ZD 1G7LB 2W0FB 1BZ7A 1O6SB 1P1ZB 2I25N 4LRNH 2WANA 3OJMB 4LCYB 3QQNA 2BVEA 2KDGA 4FFZL 3TCXA 4NQDD 5I19H 2A0LD 3C6LC 4E9TA 4KXAA 4A2GA 3F5WB 1KLUA 1HZKA 1RCYA 4JPIB 4OQTA 4GMTL 2APVA 3QJXA 1FZJB 1OWWA 4YHNB 3AWEA 4MCZA 1HAUA 3ARGA 1PYWA 1TTFA 4HH9B 3MR9B 4UIKH 1HQRA 2VZVA 4Q9QL 3BWUC 1S46A 4ODVH 3KPRE 2MPAH 5JOFB 2Y25A 3FH7A 2IAMA 3SKMA 2X6CA 3PCYA 3ATAA 4X80H 3RQ3A 1I8LA 5FYKE 3VI4F 1S7XA 5EUOB 4E9WA 5I5IA 5IBUB 5KVDE 5E4OA 3U25A 2XKSA 4WEBH 3BP4B 4Y4FC 3I9GL 4UAOC 3HZKA 4HK0A 5DD6B 3I9AA 5DZLA 3H0TA 4PV8B 3U7WL 3FT0A 4Z1PA 3FT2A 1J1PH 3GHPA 4TRPH 2BOCB 5EOTA 1CN4A 2L4OA 2OMVA 3P3SA 5C2UB 1NCAL 4JHWH 2Q76A 4V2CB 1ZPLA 1TDQA 2MKLC 2J2ZA 1D5IL 4UQIM 1CT8B 1XGRA 4MA1B 4XMPL 3QYCA 3TCLB 1OT4A 1MCJA 5C70A 1E4XH 1I8UA 4M7ZB 5C0JB 5I0YA 5I1IL 2DQEL 4OTXL 1MH5B 1YN7B 5E1AA 4IIQC 4IJ3C 1G6RH 4LL9A 3WFZA 3PG2A 3V5DB 3AWFA 2WK2A 3MRDB 4TSAL 1Q9OB 1YMMD 3FFDA 3P9LA 1YN6B 2CG9X 3TBTA 4M4RB 1ZV9A 2W60A 2MHAB 1XF2A 4ZW8A 2IDUA 3S35L 4EUPH 5I30L 3L9YA 4J39A 2ZD0A 3MLSL 4F7MB 4NQEA 3FH5A 5FCUH 4IKKA 5DUBB 3QHZH 5F89B 3UYPA 1HIML 2DTSA 4ZT1A 4WJKB 4U0RC 4XHJD 3RX8A 5KSAD 2HTLD 3KH3A 1KFAL 1I85C 4JO2H 5JHLA 1JZ5A 4KNUA 4XNZB 2J5WA 5JNYA 3IJYA 5FYKU 4N2LA 2GHZA 1F58H 4NQSA 3NSXA 1OIOA 4G42B 3FSOA 1MCWW 1ETZA 4AEEA 1LDPH 4Y16B 5IESL 1L6PA 3X2QB 4QIRA 5GGTA 2F53A 2VZUA 3D69B 3LKNB 1C1EL 2M8XA 3U2SB 2OSLA 4HPYH 3KYMB 3K6NA 1GC1H 1HEHC 3VWKA 2UZYB 2WBKA 1IM9D 1EHNA 3IDNA 5DUPL 1BXXA 2ERJB 5BRQA 3QO1B 4X98B 4G5ZL 1HH9A 3JBG7 2Z65C 3F7YA 4QGTA 1F11B 1OTTD 3CUPA 3II2A 1KCLA 2FT6A 1XF5A 5DYOB 3AXIA 1MFDL 3MJ8B 1U8HA 3QFJD 3HG2A 4JFDD 3F84A 2PP8A 4I18B 4YSRA 3LZRA 4JDTL 5KYYB 3HMXL 4P2YA 3V8OA 2CDGA 2VXVL 3FQUB 1QTSA 3FU3A 5F7NC 4GQQA 2BIPA 3APNA 4GLRI 3F12A 4FNUA 3IE9A 4N8UA 4JPSA 4JEGB 2EKSB 2I7SA 3EYUH 1NBVH 3FO9A 2Z8SA 4FI7A 4JFWA 4OGXL 1PZCA 4BA8A 3BD4A 1FNSL 1OSZA 2ICWJ 2X4UB 2IPUG 4ZFOA 3HC0A 2HT4D 5DRWB 1UT1A 3OHXA 1MFNA 3Q13A 4OF7A 4OZ4A 3WXVL 2RGSA 5F3HA 4WW1A 1YC7A 2ZNXA 4EQ3A 1KPRB 1UUSA 1VFMA 3O4LD 4W9CC 4WKZB 3N1FC 1PNDA 4QRQB 2BOBB 5BZZA 3UOAB 2AS5M 2Y2WA 3RVWD 5DTFA 1KLGB 1CDCA 4HJUA 5I6KA 1AS6A 1KGWA 3VDAA 2VZTA 2WLLB 5DD1L 1BEYL 4Y2DA 5GGSB 3WN6A 2JCCF 4WY7H 1JPSH 3DOSB 5DMIL 4U6YB 1P4BH 3NCMA 4Z5RA 4KKBC 3VFTA 3DKHA 4A6YB 4F8TA 3BZ4A 2F54A 2VW7A 4ENZA 3PL6C 3TFKD 1U8QB 4PJGF 4ONHB 2APTA 2ENJA 4M7JH 2G3XA 1A6ZB 1B6UA 3DRQB 4QYOB 1JXFA 2M26A 3OD3A 5FW6A 4X6EA 4HJGB 4M3KB 2BIOA 2XRAH 4NPJA 4F1ZA 4HQQL 4RAHA 3FTXA 4TSCL 1ZMYA 1OPGL 2X4OB 1ADWA 1WBYB 2DN7A 2J44A 2VXUL 2Y7QB 3IFNL 4X4XA 5HGDA 3T65B 3U9PH 2YHGA 1FNFA 3SHSA 2AJZB 2A1WL 1TCRA 4K7PY 1KJ3L 2D2CC 3KXFE 3EBHA 4FADA 1LLAA 4IBLT 4AVIA 1A3RL 2COQA 4FNQA 3TIDB 1QFWM 4GQPH 4JFQB 5HDQH 4O02A 1NCIA 1SN5A 3ENEA 3GXTA 4BQ9A 1BVOA 1SXBA 4HUUA 2XXMB 2F19H 2R4SH 3BP7A 1V3LA 3JXAA 3AS0A 1AANA 3HOGA 3MA7A 3HVDA 4PI0A 4A7QA 1NC2B 1KB5B 5L88L 5T3XE 2EKJA 3KLLA 3E8UL 3ETBJ 2G9KA 3ZE0E 3B2XA 3W37A 4GKNA 4I9XA 2J6EA 4Y1AA 4ZO9A 3CFBA 4B6ZA 3LS5L 5IQOA 5FKPA 2D0HA 4FQCL 3T2LA 4YSCA 3DUUB 4DESA 3ULVE 4H5SB 1VLXA 5T3XL 4Z0XA 4OCSL 4K23L 2AXGB 3WTTA 4MA7L 1DSFL 3FB6B 1ZVYA 5GGUB 3RUGE 3DO4A 3EXLA 3L3JA 2NZ1A 4UOW0 4UM9A 4Z8FL 2E59A 4G6FD 3T2NH 4CNIA 1ORSA 2YFOA 3DUSA 5LDUA 1LMIA 1XB3A 1PSKL 3NIDE 5DT1H 4Y5YA 1QO3B 4WK4B 4M62L 5J3HD 1E9OA 2CCWA 4JM0A 2QQKL 3J2PA 2CO6B 2IF7A 3KW8A 4YWGL 3V95A 1TXKA 3STLB 4BSWB 4JFEA 3IETB 4PHZA 4X8JB 1WZKA 3AGVA 4AM0Q 5D1XD 2ZZUT 4Y9FA 5JXEC 4OFDA 3FU0A 32C2B 2AQ1A 1U8JB 3CDGB 4YDZA 3B4NA 4JFFD 3PV7A 4OJFH 1J11A 2E6PA 2XPGB 3FFOA 3TO4D 2A6IB 3L4UA 4GMTH 4UILH 4F7TA 2QPDB 4WI9A 2EYSB 5DC4B 4X7SL 4PJ8A 3VM7A 3TBVA 1PG7L 1EX0A 4MMZA 5F88B 4AC4A 2VIRB 4RMRA 1QRKA 1UCTA 3WNPA 3NMEA 3S6CA 2OMYB 3CXDL 1TYJA 1YLBB 2X70B 4BUQA 1V3MA 4YSDA 4HKBA 1S5HB 5SWZA 1OK8A 1I7ZB 2X28A 3ZKSD 2APFA 4X6CE 1I3RA 1T83C 2VERN 1OAKH 5CU5A 3RVTD 3KAAA 4KRPB 2ARJB 2AQTA 1OAQL 4ZUUB 2ZAGA 1CURA 1Q1JH 2H3NB 1FYTB 3ABMB 3TC9A 4ZOBA 3QXVA 3NUKA 3VGFA 5TF0A 3BUIA 4M29A 5T1KB 1A02N 4P3DA 3CN3A 5EU5B 3P40A 5D96B 2VMFA 2DLIA 2OV0A 4UOQA 1AGDA 2ICEC 4NWTL 2WVVB 3F04A 3D30A 2H26A 4NQEE 3WKMH 2A83A 4Y1TA 4LSSH 1T22A 3HE7A 1P5UC 1W8NA 2YXWA 1I8KA 1JZIA 3E1F1 3FPXA 4PJDA 3SO5A 4MJ6B 4F3FB 1WSST 1TVHA 2KC0A 3WY4A 5IB3A 1AGFB 1BFVL 3L45A 4XZUA 2CK0L 1UB5B 4LPTA 5D93B 2O6CA 3FT3A 2VR9A 4YH6A 4DGIL 4WHTA 3MMEB 2PTUA 2KBGA 2P5EB 4FI6A 5AW7B 1JK9A 2JCWA 2VL5B 1SXSA 3U83A 1WRFA 4B9JA 4KKRA 4G1MB 3C12A 3FQXB 4MNGB 1JPFA 3HPJB 3K5RA 4WFED 1RIHH 1W91A 4HUWA 3GZKA 3NZHH 1I9RH 4AOFA 4CA4A 1FV1B 5D2LB 1KCUL 3C8KA 1XFPA 3L7EB 3GHEH 4X7FC 2EE2A 5DJDA 3UPCA 4ANWA 1WD8A 3UTPE 3P0YL 2F61A 4ZPVB 5KSVB 4GOSA 2VLJA 2Q3ZA 4M8RA 1QBLL 2Y7MA 5IGXH 5DLMH 1MOEA 3L95B 2WOBA 4LHUA 4LVOC 4RMWA 3SQRA 3BGFC 3D0AA 3FUFA 5EF3A 1MCFA 1ACYH 1BVLB 3CZGA 3S35X 4AYBA 5E2WH 1MW0A 3CMOH 4LHQB 5HJ3B 2NW2B 1PKOA 4YHZH 4L4VE 4ZNCD 4PS4H 1HN1A 1RSYA 4JDTH 4OFYD 1GJWA 3HMXH 1FGNH 4OGYL 3VFVB 2EUZA 1GXEA 4ES8A 2KPNA 2AV1A 4HKXA 4S0TD 5CUSH 5KVDL 1CD1B 1IGCH 4UI2A 1RK0B 4G1EB 2CHNA 1JPEA 4R7DB 4HKJB 4NZJA 2VLRD 3PNRB 5JOPE 3THMH 1QW8A 4LQ1A 4KXBA 2IANA 1FFNB 3TPUA 2OL3L 3VD1A 2HFEA 1JDDA 3VI4A 4X4MA 2WWMD 1O5DT 2Y7SA 3APFA 4BYHA 4CW1A 5E9DA 3UTQB 2CCVA 3SGKC 5ADPH 1MVFA 2XIBA 3M17B 5IJKA 2ICCA 3RPKA 2BP0B 1M7DB 2E0PA 2R8SH 1T1WA 1UVQA 4OCRL 4L8BA 5HI3D 4BM7A 4ZX4A 2FJHA 1A9BA 2YEQA 2VXQH 1NL0L 4EIBA 5EEUA 3AMKA 4E42A 3C6LA 5B39B 4P5KB 3MV8B 4N25A 3R0NA 2MQ0A 5KVGE 1YPZA 4ZFZA 1KJ2B 4H25B 4S1RH 3KPSE 3RX9A 1H3GA 2R0KH 3ROOB 4Z7OF 1IKFH 1S7VA 3DJRA 2N0KA 4N2EA 1WGVA 5AB9A 1A6VL 3C5JB 4FNPA 2CKBL 2WO2B 4DGWC 1NM9A 5KVGL 3IDGA 1UENA 4U0RB 4HQQH 1J0ZA 4TSCH 4GXFA 2GSMB 2XWXA 4UQBA 4BBWA 4FQLL 1JWMB 4OFVA 3C2SA 3WI9A 5GISL 4BUHA 5IT2H 1IGMH 3MYJA 4DP0X 3QIBD 3MRQB 5ESVA 3ESVF 3FOLB 5MI0B 1SJVA 3LRSA 5IB4A 5C9KA 4JREB 3Q6FA 3GNML 4XVJH 2FJFA 4YAQA 3KH4A 2Z91B 5CEXA 2YAFA 4DKFL 4ETQA 1W0VA 1WYJA 1S3RA 1L9RA 3FJTA 4XCNA 2X87A 2XY2A 1Q90A 3OGCB 1CO1A 1KSRA 2NW3A 4BWUA 2H6PA 1CYGA 1LWJA 4POUB 4FLQA 4LF3A 4M9OA 4ODBD 1ZHKA 2N7BA 3MLSH 2ATKA 4NQCA 3T6QC 1DDHA 3U1SH 3AREB 3QHZL 3M1BA 1QHPA 3TH3T 3DC0A 3QDGA 5CGBA 5L9DL 4OCSH 5SWQB 1IEBB 3A6BL 4Y2OB 5KSBE 4G6KL 1BV8A 5FYLL 1KTDA 3BQUA 3ZE1E 5LQBL 4Q2ZA 3LTVA 4L8DB 3ME0A 3T2NL 2G2RB 4TLTA 2CAKA 3VGEA 1QATA 2VM4A 3OJDA 4LXFA 4HCIA 3MI6A 4JHZA 1KTDB 2C9RA 1T2QH 3CDZA 1HZLA 4KK9D 2QKIA 3BYYA 3KYNB 3S3BB 3ILPA 3PHQA 4OB5H 5B1JC 4NQCB 2ATKB 3B2DC 5DD5H 5CAYB 1ZHKB 3TBYA 5K33A 2X44D 2YXMA 3S8FB 2DTMH 2XWBB 2EVHA 2QL1A 2CUMA 4FOMA 4R7VA 1MFDH 5C0BE 4QXTA 4U6VH 3GBDA 3LS4H 4WFFD 1MUJB 2CWRA 2IADA 3PJSB 2V33A 3ILDA 4Y4HB 2LLNA 3MVSA 1WIPA 3B1TA 4IOFD 4E5XA 2BS8A 1OZUA 3MRNA 4GAYB 3Q6FB 2HUHA 1P7KB 2VYRE 3ULVF 1QSFB 4IW4C 3SDXB 2BS9A 1QSEE 3FOLA 1QNIA 5J3HC 3BAJA 5EF2A 1A5FL 1WA2X 3HZ3A 3IYLW 1NFDE 4WEMB 4A6YH 3HZMB 1KJ2L 2PP7A 2ZKHL 1I1AA 4JDEB 4RA3A 4F24A 5CJXC 1UXSA 1TQVA 4N1CA 2QMKA 3IDGB 4FKKA 5KANG 2E7LA 2NY0D 2EVFA 2QDVA 5C09B 4KJYB 4PJFF 1AO7A 4BE6A 4LP8A 4CMHC 2WCGA 3G9VA 1V55B 4WDIA 3TBWA 3UC0H 5DFAA 3JT0A 3CVHA 1YPZB 4JVUA 2RD0A 3QDMD 4ZS6D 4LT7A 4O02H 1WQVT 4KRPC 3MNMA 1U95A 4P2CG 1KCVH 1Q94A 2JI2A 2IGFL 3AG3B 2JJWA 4UCFA 1NDTA 3WNKA 5DEGA 2JJSC 2NX5A 4UT6A 2X89A 2C3VA 1QZNA 3N43F 3S4SB 4XC3H 1A9BB 2MQ3A 3LKPB 1MIML 1WCBB 4CADA 1V05A 1DJGA 3TN0D 4U3XA 3MREB 1WAAE 2DMKA 1KB9J 4HUVB 1KB5H 3PXJA 1D6VL 4XPAH 1J8SA 2I7OA 4ZYKB 2XRAL 4KRMB 4TULH 1XQ4A 1OL0A 2M1KA 3O2DH 4CW1B 1FHGA 1TMCB 2G5UA 2OI9B 3MV9D 4I9WD 4JHBA 5C9JB 4A68A 1T5XA 4X50A 3C60B 2VLME 2IFFL 1A6TA 5A3IC 5IR1B 3H6JA 3VU2A 3QI9C 1LNUB 5TH2B 3M86A 3L9EA 5C0RH 3IDJA 3NSFA 5FDYA 5KBMA 4RDQG 1DZBA 2MRYA 1RK0A 4G1EA 2FL5A 2UX7A 5IVNA 3DIDA 3O6MH 3QAZC 5AKSA 3QORB 5I1DA 1ZJAA 1IBGH 4J3UA 5FOBA 2NYZA 5DJXA 4PJBA 1PEZA 4R84A 1IZKA 5FUCC 2BIMA 5DO2C 3WMQA 4PYGA 4ERSH 1HKFA 3QG7L 5SV4A 1LO5B 1G5AA 1QQDA 2YEVB 3PQYE 4OZGF 4GKSA 4KKNA 2WBJB 2IPKA 3OAYH 1AQKH 3CCHA 1KIQA 5IROD 3RTQA 4I0CC 5F1SA 3RRQA 2UVEA 4FLOA 1HHJA 2EEAA 1W6LA 2VN6A 2B77A 2VLRA 3KR3H 1GS8A 3ZMNA 5IQNA 2O26U 2HJLB 2X12A 1MDAA 3US9A 2CHZA 4MYWB 3ASWA 12E8H 4JJ5B 4MXWH 2AJVL 1DBML 1G7HB 4PJ7F 4Z18A 3GS0A 1MJJA 4PJIA 1U33A 3W39B 4BH7B 4PBWD 1FV1A 1H3PL 1I1AD 2E6QA 3LKQB 1JF1A 1CFQA 5DMYA 5BMFL 2AW2A 1KIRA 2GAZA 2Z34A 4JGNA 2R59A 2V7NA 3BFOA 4MCYB 4P23A 4ZTOH 3O2DA 4TQHA 3HUJB 4YHIA 2CDEA 2ZKMX 4IMLA 2XYCA 2Q8BH 2CA4A 3HPJA 3RHWK 4B0MM 4G1MA 1L9NA 4HFUL 4E9YA 3ZTCC 1P5UA 1XAKA 1HS6A 2GEQA 4YHLL 3QNYB 2DLHA 4WF7A 1JHLL 1HXMA 2X4TB 2EH8L 1NCWL 2FSDA 4Y8DC 4WHTB 4LLUB 2YPLD 4U6HA 5IMOA 4BXVA 3MNWB 4Y4KA 1LWHA 2FYVA 2EICA 3R7QA 5ADPL 3AXLA 4GKZA 2IJ0C 4I13B 1CE6A 4J3OF 4MJ6A 3CN0A 5I1EH 3N41B 1HSAA 4QTIL 2A9ML 1OGSA 3FZUD 4WTWA 2FB4H 2YD1A 3VSUA 1XIWA 2XTJB 2XVKA 4Z3JA 4OKVB 3PL6B 2ZX9A 1RZ8A 3P3TA 2YEZA 5I8EA 4HSQA 1IVTA 2FT8A 4PG9A 4L2YA 5MHSE 3O45A 3VB9A 4KMLB 4NJ9L 4MB3A 4ZFOL 2ZX8A 3ABZA 1T04A 1RJCA 2TAAA 1ZK5A 1BX2B 2PNDA 3HZYB 4ZNEE 4HLEA 3FTYA 4MMYB 2AF2A 3QA3A 1T1YA 4DGVH 1AVAA 2HVBA 1S5HA 1FJ1A 2E8YA 1FFPB 1VFUA 5PAZA 5I1JL 3L81A 2VR7A 3LNIA 5GRJH 1TO5A 3L2NA 5AL8A 5EH1A 1ECZA 1NCCH 4G80B 1JPGB 2D7QA 4HIHA 3QWQB 5HHXL 2GUOB 3W82A 3D0VB 1QLEB 1TTCA 5DZPA 1EGJH 2EYSA 3IBOA 2GCYA 3ZR6A 3QXDB 4ZUTB 2VUKA 2ARJQ 4NNPL 1MHCA 2UWEA 1F6LL 4UANA 3HR6A 3LB6C 1GOFA 1OAUH 1T7ZA 3JTBA 3QUYB 4JDZB 1UOKA 2X2YA 1FYTE 2OCJA 2OQJB 2WLHA 1WUNT 3M45A 5CN1A 4OKDA 3O3EA 1TJHH 4MJIA 2OQJA 1IBFA 1BM7A 4N0UA 4PTTB 1WA0X 5F3BB 1J9SA 1GGBH 3HKFA 2BSSA 4N0YL 4PCTA 4ZOCA 2UWEB 4JFVA 4QHPA 2CD0A 4N28A 2CMRH 2Q9OA 1P69B 1LK3H 3V6FB 4ZUTA 4LLWB 4MJHA 3ZDYE 5LGHL 1PY9A 2A9CA 2P42B 3KDPB 4H88L 2KQNA 1ORSB 2ADYA 4P2RB 2VLLB 5EA0L 5EC2A 1AJ7L 2P46B 2ZF8A 1PIFA 3P0GB 4Z7UF 2JXMB 1YHPA 3WTVA 4Z3HA 5HHNB 4Y19D 4B0MB 3S88H 3FB6A 4LCWE 4XBEH 1SLUA 2FX8H 3U30B 2O61B 1T5KA 2Z7ZA 1AP2A 1L5GA 1MCPH 2VDOL 2LFEA 4H5SA 2GABA 5H37A 1NZRA 1X9UA 4YUEH 5IJBC 1AR2A 5DD5L 2HKHL 2WTOA 4OLYL 4NO0A 1CFTB 1L3WA 3PP3K 5FKPB 3RAJH 2F15A 1UTDA 3NCFB 4F57L 2Q10A 3NH7L 4LVHC 2VSMB 2YPLA 2C9XA 3BI9X 1THAA 4H0HB 4LIQE 3KWWA 1RP8A 2RMNA 4OI9A 2CO1A 1QPXA 5EBLB 1I8IB 1TPXB 4EN2A 3THML 1JD7A 4G7VH 1Z1WA 1FVCA 4OZHA 4NQCD 4CMMB 5DJYA 3FB8A 1E4HA 1H5BB 3KBHE 1KJ2H 4TLUA 1IGIL 1H5BC 3T65A 4W9GC 2K0RA 2X4OA 2X2HA 1KTCA 3IXTB 3ULVH 3T0DA 1BGXH 1FVEB 3MC0A 2LT9A 5ICZB 1TPXC 1RUQH 1F90H 1SNRA 4KHXH 4MMXC 4PJBE 3GI9H 2H3KA 4WENB 1NGPL 3QNYA 1EEYB 5IOKA 1R46A 3A4EA 1OE3A 4FXKC 2BVTA 4NN6C 3DNKA 2CBPA 3IFOB 3DOSA 4LNRB 3VFTB 4L4TA 3WD5L 4Z5RB 3PV6A 3GUTA 3TA3C 1OTUC 2AJ3B 3MGAA 4L2LA 3PDGA 2OJZL 3W3BA 2QFRA 2VLRE 4WSGA 2IDCA 2VSDA 5GJTL 1G1KA 2WO3B 3MRJA 2NY3B 3I3EA 1NUGA 2K6WA 4ATWA 4JJ5A 1Y7VA 3V10A 4K3DL 2MPAL 2H2PC 1RULL 3BEWA 4KMTL 4OD2B 1NCBL 5IG7A 3VXRA 1NEZG 3GEFA 1XH1A 3U46B 2R7EB 5GPRA 4HJJH 3CHPA 3NFNA 3K2KA 4HIQA 2IDSA 4NAMA 3D39E 5F3HB 5FYLE 3VXUB 1FIEA 2AJXL 3IFPB 3V0VA 3KL5A 4RGNE 1IGML 3I9GH 4FC3E 5DRWA 4QJ5B 1A7NL 1PZ5B 2ZE0A 1M42A 4GKSB 4U1GB 3Q8CA 1KCSH 1MPAH 4L4VA 1KC5L 1MCKA 4K2UL 5DJXB 4A7GF 4OCYH 3HLAA 1JDCA 5K59F 3BPCA 2ZX7A 4RRPM 1KG0B 1L4IA 1T4WA 2BVQB 2UUDK 3KWVA 2JB6B 5BO1L 3MJ8A 2WGXA 1CE1H 2VXTL 4BRJA 2Y6SC 2QVFB 2XXFA 2YIHA 1LNUA 3QIWD 5T1MA 3HI1A 1MLCA 4Y9BA 1ERNA 3RHWF 4Z0BH 1Q38A 1Z6JT 3VFNA 3TPKA 1Z9MA 2W5PA 2UZYA 5CCHE 5HHQA 5EBMA 1U3ZA 3RFZC 4PIBA 2AGJL 1M71B 2FATL 3KCPA 1BPLB 1CXLA 4A7VA 3VXOB 4ZYKA 5IJVA 3CX2A 1S7UA 3QUXC 4QHKJ 5F1NA 4JZJC 3MREA 4UTAA 1RQ5A 3LVEA 1WCBA 3T8XB 2ZOLB 3CHXA 1RUAL 3QIUC 1F3DJ 4BQBA 1A1OA 2XY1A 5CIPA 3T1FB 1AXIB 1Q9KB 5CGMA 1TJIL 4AQAA 3QQ9C 3TBBA 4U3CA 1IC1A 3IDUA 1UEMA 1FRGL 3GO1L 5IB2B 1F4WH 2PPCA 2DTML 1C1EH 2YWYA 5C6WH 2QZQA 3TN0C 3I75A 1A6AB 5F9DC 4DVBB 2W60B 3LS4L 4YHML 2J6WA 2EADA 1GC1L 5IW6B 4IS6A 1Q9OA 3NFPB 3N1GC 1PLCA 2IBZX 4YBLC 3V5DA 2I60L 1DJWA 3VDBA 2BY3A 2LABA 3DURB 1IE5A 3ESMA 1A6UL 1MH5A 4YFLI 4HAKA 2WY3B 4QHUB 4ZNEA 2P5EE 3RG1C 2HT3D 4CGUB 1D9KB 1U8PB 4Q74A 4A6YL 2MCG1 4YXKL 3MRNB 4N26A 1RZJC 2DOCA 1CT8A 1KIUB 1XGRB 4D0BA 1N67A 2VABA 1QR4A 4MS8D 1WF5A 4C83B 1DJZA 1DVUA 1DVFC 2OMVB 1NDGB 3BVTA 4UM8A 2FLMA 4MLIA 4BZ2L 3O3AA 4EKJA 1QP1A 1NGYA 1P4IH 2BP8B 4X99A 5CS7A 1X6NA 1QFUH 3SEPA 3DGDA 3SY0A 4B9PA 5ISZD 5GGQH 4LEXH 4OZFB 3RUGF 3RWFB 4LPUA 3ZKMC 3KYNA 2J20A 3S5LA 4PW9A 5BRZE 3TF7C 4F15B 4X9YA 1KPUB 2DRUA 3D33A 3EHBD 5T1LA 5I1JH 5JOFA 4QY8A 1BQHB 5FYJD 3WSQL 4JG9A 1IEAA 3O9WA 2ED8A 5JLZA 3I84A 3O6LH 4XN7A 2X9XA 5BCAA 3N40P 4U7SA 3TEWA 3VFUA 2XWRA 2HAZA 2CU9A 4WGWB 4XPAL 5HGHB 2LHAA 2DMGA 3F5WA 3ZMEA 4UIMB 1MCOH 3FAWA 4JM4H 4ZMAT 3LN5B 2MOQA 4QGYA 1WVZA 4E9XA 3APCA 4ANVA 3GZQA 1KB3A 4N3TA 1QWHA 3CBRA 1DDHB 2UVFA 1CG9B 1O6SA 1P1ZA 4QTHA 1DLFH 2KLTA 1OOWA 2EIZA 4D9QD 2IAMD 4HBCH 5CXPA 1JGUH 5C08A 2F9BT 1UWGL 4DZ8B 1JGVH 2WUBH 4LCWA 4R4BA 2HJKB 3WFHA 2VZ3A 2X3BA 3OGCA 4XCNB 3AAZB 4PW3A 2CMRL 4C59B 1QLFA 1FBIL 2X1PA 4PRDA 4MQTB 1EXGA 1ES0B 4H88H 4UZSA 1H15B 2DBLH 4KJWD 4R0LC 3UTSE 1MJ8L 1U2CA 2EEFA 5HPMB 4ZPTB 2BX5A 2J6EH 4JFOB 4MMZC 5ESVB 5BS0D 5HGAB 3VSQA 3NBNA 1JWMA 3V0FA 1T1ZA 1UT2A 4I0PB 1INEH 4TM9A 4XWGL 5JA9A 5AZ2L 2KLSA 5FHBH 1U8IB 3ZKXB 4B97A 2AK4D 4YSQA 2GITB 3V7AE 4ZW6A 3TNNB 5A6IA 5AW6B 1EAOA 1R3HB 1PFOA 1YVLA 2AVFA 3SD2A 3WIFB 2R0WH 4AYFA 4BKTC 5B7MA 5KBLA 1NFKA 2ZUQB 1KCBA 3DETD 5EEXA 3GZOA 5ILTL 3UG5A 1VCBC 1YEKH 2CLZB 2Q8BL 3UGXA 1TJGL 1I9IH 3GMLB 3GBMH 1MCLA 4G6AC 4YHLH 4OGZA 4QYAA 3CDYA 2BCMA 1ZS8A 3D9AL 3F7RA 3FOMA 3BAWA 5B3JF 4YHYC 4AXWB 4KJQC 3SDDA 1IBYA 1XTMA 2QQKH 5D9SB 1GL4B 3QI9D 2N0MA 2Y0SA 4PHXA 3QWRA 5K39A 4U1KB 3UZEA 3QUML 5I6PA 4PJ9A 4OJEH 4JY6B 1D2OA 5D7LE 4R26L 1AXTL 1PJ9A 1I4FB 4O4YL 3ARED 5BZWA 2GSIB 3LXBA 2ADFL 4F7PA 2FB4L 1QFPA 4HV8B 1AIFB 2CGRH 5AAPA 1K3IA 1AXSB 4NM8H 3RWHA 2VLKA 4LCVA 1TG8A 1DANU 1E2VA 1HHIA 1CD1A 3OLGA 1GYAA 1UADC 4PRHE 3D39A 4HKXB 1KYFA 1ZEAL 2AV1B 2MNWA 4FQHA 5SWSD 3IPFA 1EDQA 2FEJA 2OJZH 5HY9B 2BNQE 1NBCA 3HBPA 1NM4A 5E9NA 4B7IA 2WLYA 3O4LE 3LZFH 3PAVA 4B5EA 4XCEB 1YEGL 2D8KA 2WM0A 5EDSA 2D03H 3BAYA 2CHXA 1HHHB 1A4KA 4QRSB 4F93B 5I73B 3HJ0A 4BFGA 4FNSA 1W16A 5I5RA 1A1NB 3B7UX 5K9QI 2YFNA 2HN7A 5C0CD 3MZGB 5JR1H 1MRCL 2JCCE 3MJ7B 3PWVA 1OAKL 3ARDC 3GLEA 3HMWH 4K94L 1OAQH 1NMBL 2PCPB 3F8UB 1KCSL 4P57A 4H0GA 5CR1A 2O5YH 2HA1A 1B0RB 3L7EA 5CILH 4F2ME 1JXDA 3N41F 2RJMA 5HJBA 1DZ0A 2PF6A 2N7SA 2DM4A 1M1SA 1FWXA 4UV4H 4JN1H 5J1TC 1QSFD 1XAUA 2B59A 4S2SB 2QV4A 3FO0L 3ZZLA 4EDWH 4HUWB 5FKAB 2Z8VC 1I1RA 3I2CL 3O4LA 4H8QA 4NOFA 3LZOA 4X6CA 4OLUH 2WAQA 2PPDA 1WBXA 3FQXA 4ORGA 2Y5TB 3NCCB 2FWUA 5ITBL 2UUDH 2YC1A 2BHYA 3GINA 5DJ6B 4JKPL 3MCLH 1IU1A 4UU9A 4BD4A 3LDBC 2A0LC 5FC9A 1XGUB 4Z7VF 1HNGA 4I0PD 5TQ0H 1QKZL 3F64A 3DX9B 4CVZB 1HEJC 5EORH 1G9NH 1K3ZA 1A0QH 1MFBH 1NGQH 4FQQA 2OXGB 2CK0H 1AGFA 3FZUC 4MTMA 4UQAA 4KKBD 3C5ZC 1VZGA 1JS4A 3F7VB 4UTAL 1HXKA 2AANA 4LVHB 4PREB 3SBQA 5F9OH 3CFTA 1IL1A 3WTUA 3UFIA 1AGDB 4AQEA 3FSZA 1BDYA 1T3FA 3CH8A 2J73A 2NY2C 1R5VA 3MBED 3P9MB 3FB5A 3NA9H 4M00A 2NNXA 1CDHA 4K3GA 1YYML 5C0GA 1OD7A 2IBBA 1D5XA 3ULVC 2NUPA 4EI6A 4AEFA 3PP4H 1BA9A 5B8CB 2HFFA 4OLYH 4HHGA 1TTUA 2G9HB 4JDVA 5TK4A 3KG5A 2JKXA 3P0YH 4MAYC 4MD4B 2OA9A 3L3DB 1O9WA 5DMGD 1AQHA 3Q01A 3V5KA 1DBJL 4PWKA 2WBXA 5AOJA 3DTUB 3U48A 1VIWA 5EN2A 1U91A 2I60H 1ZXQA 4GBXC 3GMQA 2WTRB 1XR8A 5I5JA 4B60A 1A6UH 2FSEB 4IMKC 4MJ4A 8CGTA 1AZBA 2IOMA 1NH6A 1ZA6A 5IHHA 3S5ZA 1ZHBA 1DFBH 4PJFB 4HOMA 3DARA 2YMXH 3TWCH 4G8EA 3GLDA 1NOLA 4XO4A 3VYOA 1GZHC 2DMHA 3PWNA 1I7UB 2B2XH 4WIQA 1ZLUH 1TJXA 4JNXA 1XCTA 4LLAA 3DJTA 2Y1ZA 3LZPA 4H0IA 3UMTA 2HG0A 1U8JA 3B7TA 3CDGA 5D6CB 1NEZB 2WCPA 2ADJB 4HCGA 5GGTH 3RDTC 1WZAA 4BFFA 1H0DB 5JXAL 5A16B 3HA0A 3D85A 3KYOA 4JFEB 4Y7OC 5J13C 1BF5A 3IM1A 1R0AH 1Q9WB 3WD5H 3STLA 4BSWA 5HD8C 2V9RA 4NJAL 2XWJB 1GIGL 2XQYK 5LAPA 1UC6A 2XJKA 3GMNB 4N5ED 2YPVL 4G9FB 4RBPK 5HHVH 2QADD 3HN5A 3H55A 3T4AA 3WSQH 5D1QB 2D7NA 4M8QB 2Q2EB 1EPFA 5BJTA 3IDMA 4CNIB 4F9PA 1GJUA 2HPTA 2DQCL 2A73A 1XMEB 4RWYH 5ALBL 3VRJA 4A66A 3ZK0A 5IHUH 4LHJB 5FYJU 2NY5L 3FB7B 2DQGL 2WKOA 3W38A 4JM4L 1G7MA 4ZW3A 4ECNA 4Q4EA 2YLHA 4QHNA 2XZCH 3GUFA 3HNSH 1NCHA 2W07A 4S1RL 5IMKB 1ZRUA 2VDRL 1MKFA 2WLNA 4DPCX 3BT2H 2IC2A 3LZQA 5HDBE 1UZGA 1MPAL 3IXAA 2O93L 2JKJA 3NJVA 2ZSWB 4GAFB 1KB5A 4OCYL 5L2KA 1ZPUA 1NA8A 3E8VA 3OX8B 4R97B 3WEBA 3PABB 4HUUB 1TR7A 4M6AA 3AT0A 3FU5A 2OZ4H 5GSRA 2KZBA 5GS0H 4O02B 2YGQA 2ZCLH 4D3CL 2YSSB 4XCCL 3RI5K 2OYMA 4I5BA 1JHTB 2DKMA 3IKCA 4LCCC 3BOVA 4FZ8H 4FXKA 3JTTA 4MJ5A 3VJ6B 3ZTDC 4TKWA 3LH2L 4ONOA 1FC1A 2YKLH 1UA7A 3DX0A 2SODB 4UT7H 3BPOB 3PNWB 2EO9A 4LQFL 4XWGH 3U0PB 1KYDA 2R1XA 2EDRA 4UOZA 3TTYA 3QP3A 2KT6A 5JW5B 1BFSA 1G4MA 2IV9A 4G43A 3SQBA 3T0ED 1X5FA 3RA7H 3HE6C 3NRFA 5FGCE 3WFBH 3U1SL 1NMCB 1NPJA 2F54B 2A77L 3A6CH 5JHDE 4LASL 1R6VA 5F7LB 4U6YA 5L9DH 3ZX1A 1LO0L 2IH3B 2A6JB 4UMSA 4XNMB 3CFIC 3ILEA 5AALA 5K9JH 2ODIA 3BKCL 4XPFL 5GGSA 3HB3D 4AKPA 5FYLH 1LYQA 1UUNA 4Y5XC 2D7TL 4L29A 5C0AB 2BSRB 1QW9A 3D05A 4X7TB 3X14B 1KLGA 3UC2A 5IHZA 2C1PA 3GSNA 1CXFA 2R29H 4PRNA 4GW4B 4U1NA 5FGBC 2AJUH 3CVIL 4N0RA 3UZVA 5A1AA 2D0FA 1TZOA 3VVVA 4MLSA 4YFDB 4NO2A 1T2QL 4N24A 3DGCR 1DE4B 5J4MA 4KDWA 2OR8A 4NHUB 3AROA 4MDIB 2BNQA 5IBLC 2BZDA 3EGXB 3F7LA 2MIZA 5CNHA 1A21A 4FTVB 4BQ8A 4ZZKA 4L1SA 5DUML 4AJYV 2XU9A 1EK3A 4JM2F 2XIIA 3X1FA 3L8QA 1RZPA 1XGQA 3RKDC 4AQ8C 1UKSA 3DVGB 1FNHA 5F0PB 2XWCA 1MWAB 4AM0B 1AQMA 1ZEAH 5FXCH 1QBAA 1C5BL 3QR2A 4LSRL 4EVNA 5C3TA 5KYYA 5DXWA 4GI8A 1I53A 1CLZL 1X7QB 1ZE3H 2PCXA 2QPFA 3KHOA 5ENWA 3OKYA 4BZ2H 5FHAL 3N50A 3VD4A 1BMWA 1EUUA 1KELL 5J1AB 1NCOA 3CSFA 4IBVA 1XF5B 2NCMA 3PUUA 3W0WB 3V4VH 3WYRA 4MKMA 1FF5A 2H2PD 4RGNC 4N6RB 4QHLB 2VDKB 3LPFA 1CWVA 1WDAA 1SEBA 5TFSL 2QVKA 1IT9L 4G71B 2NY7L 5B1KA 1GAFH 4HZ1A 2Z93B 2ITCB 3UEQA 3AY2A 2R51A 3RWJB 3B2UC 1E43A 1F6FB 3LKNA 3U2SA 5LO7A 1JXGA 5CILL 4HP5A 4KY1H 3AADB 3BIAX 3QUZA 1Q72L 2K1MA 3OPUA 2ZUSA 3SPVB 5T3ZL 1JVOA 2XA8H 4JO3L 5E08H 2DQFB 2IGFH 5KAQF 1U92B 3RJOA 5KTEL 3HIZA 4JJHA 3ES6B 5ESQA 1HKLH 1UA3A 1FL6B 1G5GA 1WWAX 1P9MC 4NQEB 5H2BB 3ZR5A 5KS9F 1DLFL 5KYUB 2WQWA 3ZU8A 3WN5B 2O5ZL 1N6VA 3IPEA 4LAQH 3OJ2C 4AV5A 5C8JA 1JGVL 5KOMC 3PGDA 3ULUH 3VFOA 3D4GA 5D2NB 3O2DL 5CIPH 3HCVB 3E6HA 1MJUL 4RFOH 3X1NA 1XT5A 5A2CA 3A5VA 1KIPA 2WWKO 5DVOA 1BP3B 4UTAH 1AD0B 5ALCH 3X11A 1IM9B 2HRLA 1IKOP 4LCCA 3VI3B 2WQVA 4YIQA 3LNFA 2P5WB 4M5TA 3ZKND 1RURH 4Y89A 1ROWA 2VMEA 2W65B 4BSVA 4Q9RL 3OZ9H 1RH8A 4PN6A 1GJIA 1NFIB 3WS6C 2OK0H 1J10A 2NY3D 5AB1A 3FTZA 5IUCA 4Z7WA 1INEL 2DLGA 1DVTA 3EG9B 1R24A 4IOSD 4HGKC 1RZIA 4U1SA 1N12A 3GMMA 3QQ4A 4OM1H 1UWXK 4ZMWA 4GO8A 4F7CB 2BFVL 2ZG1A 1WS7A 3BCFA 1N0XL 1DN0A 2YXFA 4RZKA 4NB7A 1SDDA 3N2JA 3TH2T 1BQKA 3BP4A 3VXTB 5LXVA 3FFCA 4IRJB 1OAYH 4JFDE 1RMFH 1A47A 1QTYT 1R5IA 2F8OA 3TNMB 5I1GH 3K80A 4D7BA 5D5MA 1MI5D 3WFEL 3U36A 5LWYL 4KJPD 1PZUB 4X5XA 3O41B 2FT7A 3ZYJA 2V5TA 5HJGA 1ZLSH 1HE8A 2BRRH 5DRNB 3PQYA 4PRIA 3H9HA 4YHKL 1KGIA 4GRMB 4N2MA 4IBZA 4M7KL 1KLUB 2B2XL 3ARRA 1R3KB 2ZUXA 3KWUA 5BNXD 1OB1B 3W0WD 3ATBA 3NIDB 1VZIA 2OSWA 5D7LD 4FDWA 1S78C 2WQRA 3BVVA 3EZJB 2EINB 2Z7WA 4WAFA 2JNZA 4CGTA 4KVPA 4HGWA 5D2LE 4OV5A 1XXDC 4ZDHA 1KPVB 4ZQTA 5J57B 2NY6C 4IHBA 3WE1A 4B9KC 3T0EA 1MCWM 4MFHA 3DXAA 4OUUA 3V4UH 3WL9B 2EXWC 5FGSA 4KH2A 5HHVL 2AV7A 4YSTA 1UM5L 2XWEA 2JKRM 4PB9H 5ACLA 5E8EB 4AEIL 4M43H 4L0ZA 4GUQA 2W0KA 1UACL 4LRNL 1SF5A 4HWBL 2LFGA 5LBSA 3VG0H 4D7PA 1I8MA 4A2DA 1R3IL 1N3NB 4ABUA 3MFFA 1DBAH 4JFZH 1JMZA 5AVTB 2F5BL 2EDJA 2XXGA 1EZVX 3JV4B 5GSVB 3AS3A 4XNYH 3V6BR 2B1OA 2CIIB 4GSQA 5LAXB 4TNGA 2VDRH 1J8HD 1BF2A 4JY4A 3ZQWA 1IEHA 3GMPB 1T5WA 3HBQA 2IQAB 5DQJA 2JKLA 5AOLA 2FBJH 4C56D 2OMXA 4X6FA 3QPXH 3HG1B 3MV7D 1MWAL 1TNMA 2ZXCA 4NN7B 1J8HA 4ONGH 5DI8A 1S7SA 4WEEA 1T89A 2G4GA 5E99L 2Z92B 1HNYA 4IBTA 4E9SA 3O3UN 3QRLA 2BCKB 5FW7A 4KK9C 4EDXB 4JLRA 4WEBL 1E4XL 4KVCL 4NC1E 1AZNA 2I9LB 2JKWA 2O5NA 5A2JH 3P4MA 1DFXA 1PAZA 6PAZA 1KBKA 1MXGA 3WG7B 1CVSC 1WTLA 3KPRA 4FZ8L 1AZZC 3VH8B 4URKA 2IOOA 4CJ0A 1D5IH 5IVXF 4HJ0D 2Q7YA 5CSGA 4Z7OB 2J1ZA 2FQEA 3RDTA 3MO1B 2X4NB 3KXFA 3S35H 4WWID 3S3JA 4I4WB 5I28A 1Y1DA 5F9OL 5CD3B 3WFBL 4KI5F 3WS6A 4LDLB 3RJDA 2F1AA 1J8RA 1DVYA 4HH8A 5CP7A 5K9JL 1TEYA 4C54A 4DKDC 2EIBA 4XP9H 5J8OA 1GTFA 3ARQA 5AYUH 4ZFFA 3IRZA 4OV6F 4B3VA 1GYVA 2WXNA 5ITFB 3INUH 1DVZA 5I16A 4Y4FB 3CN4A 5HYQA 4R5VA 3R19A 2NLJA 4Y4FA 3ZE2F 5TDNB 1FI8C 5FCUL 1T7YA 3KE0A 3L3KB 3IS1X 2FWOA 4AUYA 3S88L 3O8XC 2OYPA 2VJ0A 2A9BA 4W4NA 2D3NA 4PSPA 3WNIA 1SFDA 2QGDA 2IDTA 4DAGL 3CFKA 3KD4A 5F7AA 1RAMA 3UGEA 5CD3A 2WQAA 1LEKA 1X6LA 2ED9A 5EO0B 4ZK8A 2GEEA 3VGGA 3NZSA 4NZRH 3ZTJH 3WAKA 3MO1A 5DS2A 2VZSA 3BN9D 1L0PA 2IQ9H 4E0RB 5CEYB 4N8VB 3TWCL 2BMKA 4FQXB 4ODUB 1H9VA 4RA0C 3BAXA 3RUGB 2GC7C 4M6MH 4ZAKC 5FM4A 4F7EA 3VW3H 4YEEA 3V8CA 2GPZA 3SPJA 2V5SA 3EOAB 1TTRA 5GHWH 3CIQA 3CZFB 4KAQH 4NKIL 5HHPA 2I9LA 1Q9LB 1SVZA 4N2FA 1JZ3A 4MS8C 4AQOA 3P73A 2P4AB 5DJCA 1MHHB 4J3OG 2Z92A 3GTTA 5LGYA 1RPUA 5IJKC 3PWPE 2O5XH 3D06A 4UQDA 1GIGH 3QB7C 4GAJL 3MLTB 3UBXG 2ENSA 5D96C 3EIFA 1BGXL 3TM6A 2IQAA 1BQLH 4Z7WE 4EOWH 3LIZH 4HWZB 3E6FA 4A2EA 3G04A 2PWHA 3HG1D 3MV7B 4JY4B 3S5YA 1A4AA 1FNSH 4Y5VA 2J5LB 3EH2A 4NCC2 1MCIA 4YK4B 3GWJA 1CJYA 5D7KD 5LAXA 4D0DA 4ILDA 1CIDA 2Y5QA 3R06B 4MAYA 4IBWA 5T3ZH 1ZA3A 5TD4A 4TUJB 1BEYH 2A74A 2ZXGA 3KJ4B 1BD2E 2BHZA 2EDDA 4JKLA 1P4BL 2DEYX 1VPOL 4BKSC 5EIQA 3BVWA 5J6GA 5GZOC 3BZEB 3WJMB 4YPJA 1DHKA 5BV7B 1UKQA 1CS6A 4QNPE 4UQ2A 1DUZB 3DSFH 2AQQA 2OMTB 1CR9L 1NANI 3IFNH 3QNXB 3U9PL 4XP5L 1IAKA 2WXRA 3LZLA 1JPSL 4H20H 3CSTA 4RSVA 2DLTA 3W57A 1KJ3H 4J3SA 3HPLA 3LQAL 1F3RB 5I18L 1Y6MR 3OKNB 4ICXA 4QPEA 1ZSDB 4ZMPA 1CXEA 2QADB 3SN6N 1P2CA 3E2HC 2YK1L 3N43B 1R3JA 2YA2A 4PRIB 3RWIA 1XTLA 1OE1A 2BWIA 1D5MB 5LHDA 3AG2B 3D39D 5FYLD 4X5XB 1A3RH 5CGYC 5DK2B 5GGRY 3DV6B 4I2XB 3OXSB 4J7RA 3ARBB 2X4SB 4UQEA 2NQDA 2AK1L 3VFGL 1AD9B 1RMFL 3K2IA 3T77B 4BJLA 2G30A 2F19L 2R4SL 2XG5A 5I1GL 4R6UA 2OSYA 3FFCB 4IRJA 4JQXC 3BKYL 5DQDH 4KKZA 4NUQA 4GFTB 2N1TE 2LU7A 3E8UH 1CFVL 4JPVL 5D72L 3EBGA 4M1CD 4AIEA 3HRZB 3MODL 5AOZA 2BRRL 3SGDH 5IZ7A 4QEGA 4UF7C 2VLJE 2AJUL 1RZIB 1JIBA 1V54B 5JIIA 3BP5A 3O9WC 3C5SA 4Z7QE 5IJCC 2EH7H 3V9FA 2CZNA 5K59E 4M7KH 1UATA 4MA8H 1B3JA 3BPOC 3K0WA 2BNUB 2K7PA 4YZFE 3H7BA 4BQ6A 3P2DA 3ZE2E 3D1MC 4QRRA 2E7BA 1E4JA 2E9JA 1S7QA 2KL6A 3G6JF 4Z8FH 1F4WL 1G4RA 3VXNA 1E67A 3KGRA 3BE1L 2ENPA 3LN4B 3NJXA 1NAMB 3U1PA 4NBXB 3U0WH 4A55A 2OTUA 2WVSA 1MFMA 2XZQH 4YHMH 5MEPA 4NQTA 2Y7NA 1P6WA 5IWLC 1ZGLB 2JKNA 3P3RA 4K8RC 3EO9L 1AZVA 2AK4A 3Q2LA 4PLKC 3UBXB 1CLZH 4FL4C 2VW6A 3OHMB 1BAFH 3D3VA 5CJBA 6PCYA 3L3IB 1E27A 2GIXA 4KKCD 3LKSA 4NNXB 3S98A 1CYWA 1JGDA 1JN6B 1Y6NR 2A5UA 3V4VL 3HJEA 1R3IH 1JWSA 4KUCF 4MNQD 3M8OH 2E7LC 2CSPA 3L3OA 4MX7B 3LSOB 5DWPA 5G2NA 5DD0L 1EFQA 3LNHA 5CM1A 2JVUA 2MJWA 5E56A 4MNGE 1ZCRA 3MUUA 5EZJB 3HE6D 1XH2A 5E94A 5A3ID 1ZLEA 3L08A 1PG7H 1QOKA 3OC8A 3DHMA 3RWJA 2XLLA 4N87A 3UYRH 2DICA 3HHRB 3CXDH 1VDGA 4QRTB 3ZDZB 3HFML 2J71A 4LCWD 5K9KA 3LH9A 1XB8A 3WKPA 4BSJA 1CGVA 3QJSB 3QQ3B 5C0BD 2OR9L 5FEBA 1E3ZA 1T6VN 1HL5A 1L7IH 2EIMB 3T3MB 3X17A 2CJSA 2EEXA 4PB0L 3V9EA 2JKSA 4N6RA 4QHLA 3V0JA 1A4JB 4Z3EA 5KTEH 2ZQKA 4J6RL 4UQ3A 1LJMA 3F85A 1FVDB 3N3EA 4JM2C 1IM3A 2CNZA 3DBXA 3QJVB 5FECB 4GI6A 2K6ZA 4RGOL 1II4E 1QHOA 3SPGA 4EEEA 1G9ML 1O9ZA 1UA6L 4K3JH 1CGSL 2QZ5A 1AY1H 2K7QA 3NDZE 2DQJL 4O2FA 1H8LA 1HYSD 1MJUH 4RFOL 1WS8A 4FG6C 4JFEE 3MUJA 5F7YC 5LB1A 1N7ML 3WDJA 2ZYRA 3NN8B 1IX2A 3KVDD 3WUWA 1SRDA 3TO2B 1F6AA 4GRLB 4PJ9C 3FQWA 1WBZB 3UJTH 5CSBA 1OP5K 3EYSL 1L7TL 3ASOB 3MLXL 1RIHL 4MDIA 3CHQA 3QHFL 2RIKA 3SDCD 3F6IA 4OH2A 1FBIH 2ZXEB 3O0RL 4NO2B 4OLXL 4TQ8A 3PWUB 4U1NB 5E8PB 2NX5D 4MB1A 2GJZA 1UASA 2BFVH 2HZHA 2C1PB 3B9EA 3GSNB 3VFWA 1AO7E 1ZT7A 5GJSH 3TIEB 2BSRA 4X7TA 1XZWA 3BDXA 4L29B 5D7IB 5C0AA 1H6UA 4ZFGH 3CSYB 5CJ8A 1PL3A 4H0LC 3VQMA 4YL4A 4XO5A 1PIGA 5LCVL 4HD5A 1V8HA 3NZHL 3QJFA 3FYEB 2FDBP 4Z76A 5E2UH 1Z3GL 3W9DB 4ZUWA 5HYJB 1UH3A 2LQRA 1M2VA 3GJEA 4QRTA 1KCUH 4NPYB 2FHBA 1Q0EA 3EOBB 5I6XC 5MHSD 4G43B 5IM7B 3HNTL 4RWHA 4KC3B 1P9MA 1G7QA 2GT9B 3T8VA 3VACA 3IMRA 1QAWA 4OGYH 1FGNL 3VI3F 1BQUA 1FL5A 3JTTB 4MJ5B 3VJ6A 1YEKL 4M7LL 3GDBA 1SY6L 2V9QA 2E4TA 1K8IA 4TVUA 1I9IL 3JV5A 2GBAA 4P46D 3L3IA 1QG3A 3AQZA 5L4MA 3D3VB 1IGYB 1AGEB 3D9AH 3PLYA 2VDLB 4YHZL 4X5PA 3GF8A 3PWUA 5DMKB 2P7TB 2O5XL 3BIBX 1J5OL 3GSUB 2FO1A 3V4UL 4LSDA 3RU8H 2MOGA 4P3CL 1AXTH 5BOJA 4NO3A 1JTTA 5D2NC 5GS1C 3LN4A 3WFCH 4AJWA 5B4MC 4GRLA 1N70A 3BVDB 1OWRM 3LKRB 2EDMA 2YPLE 4PJGB 4NM8L 5HHOE 5LBVA 1TKWA 2IH1A 5KEZA 4L8CB 1E5ZA 4IRSB 4WK0B 5F7KC 5FO2A 4XXDB 1ET5A 3I6GA 3FB7A 4MYPA 4PPTA 5IVOA 4XE0A 2FH6A 4O2FB 3F00A 1X9LA 2A73B 3Q6GL 4HBQA 5C2BL 3KLAA 3BUYA 3IK2A 1GRWA 3H9SB 3OB8A 2DIJA 4M8QA 3NIDF 4H4NA 4F1SA 3K6IA 2CBOA 1OD9A 2XN9D 3K4AA 2XWJA 2B4CC 7FABL 3EJSA 3LD8C 3RKPA 1WV7T 5F70A 3T77A 1RJYA 2UZIL 4G59C 1C8QA 1NJ9B 1R33A 4CN1A 4EJ1C 3CZKA 3OXSA 3HMWL 5F1OB 5DK2A 3WKQA 4IYKA 3OF6A 4XP6H 4WU7B 4R7NB 1D5MA 4GXVL 2R2HA 4RGNB 2E75C 4P4KA 3SBWC 1PD1A 4I0PC 4XBMA 4XVJL 5I9QB 4F92B 4LKCA 4YHOH 1BG9A 5D1XC 3COOA 5EZJA 1HH6B 2BVOA 3MLYH 1UYWL 4G8EB 3UTZB 3RLSA 3ZOAA 3TBSA 3VXSA 4KY2A 1AC0A 5D70H 4X9GA 2VAAB 2VLMD 5DHVA 2IANE 4FQ1H 3GC3A 4ADGA 4NNXA 3A3YB 1PPIA 1MAML 1XR8B 2FWSA 4YC2C 2NXYD 5E2JA 1QKZH 5HYJD 1KJMB 3WELA 2EYTA 1IAKB 5F9JB 1DBBH 2PXYC 2BIHA 3VWJC 2OMTA 3FPYA 1XVSA 2XG4B 1S8DB 2Z1KA 4APXB 4Q6YA 1DQVA 1DUZA 3DVFA 4G70B