4F2EA

Crystal structure of the streptococcus pneumoniae d39 copper chaperone cupa with cu(i)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
98
structure length
98
Chain Sequence
GAMGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGMNMMHGKMIVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CupA
publication title A new structural paradigm in copper resistance in Streptococcus pneumoniae.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Metal transport
total genus 21
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2012-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4f2eA00
2HRGA 2YAFA 4Q89A 1MZYA 1AOZA 1QNIA 3ASNB 1I53A 6PCYA 1PZBA 1V54B 2IAAC 3H4FA 2VW6A 3DKHA 2YAEA 1JZIA 3EH4B 1NICA 2FQDA 2JFCA 3HB3B 3PXLA 2AFNA 1XMEB 1A3ZA 3ERXA 3UABA 5AZUA 3FU8A 1AZBA 1KV7A 4G7RB 4A2DA 3CVDA 3T6WA 1DZ0A 4JHVA 3FSWA 3TA4D 1ZIBA 2YXVA 1SDDA 2OCCB 2Y69B 4QKTA 2VM3A 3FU7B 5D4JA 3X1FA 3UGEA 1OCRB 3ABLB 4HALA 1E30A 1E65A 2W8CA 1ASQA 1NPJA 1OE2A 3TBCA 1J9TA 1AG6A 2J5WA 3ZDWA 5B7MA 1GR7A 4BDVB 5I6KA 2UXGA 2H47C 1GS6X 5A7EA 3ABMB 1RCYA 1SHXA 1NIDA 3X1GA 1ASPA 3CDZA 4G7QB 5FC9A 2I7SA 4KOBA 1OF0A 2TSAA 1URIA 4NAJA 3FPXA 3FT0A 7PAZA 1ET7A 1A8ZA 5B1JC 1IBYA 3NSCA 3ZIYA 1JVLA 4EF3A 2XXGA 2XV3A 1TU2A 2FWLB 1OCCB 2DYSB 1OCOB 2BP8B 3NJLA 1KBVA 2PPAA 4AZUA 1PF3A 3QJRB 1JVOA 2UX6A 1RZPA 3D12B 3AY2A 1KBWA 2X88A 2WO2B 4Q8BA 2BP0B 2IWKA 5AKRA 1SFDA 2IDTA 3AG1B 1L9SA 2HX8A 1WA2X 4KOCA 1DYZA 1JXDA 3X1EA 1IKOP 3JTBA 2WO3B 1QLEB 2GHZA 3ZX1A 1PZCA 2VW4A 3PCYA 4DPCX 2P80D 3EH5B 3ZBMA 4BWTA 3BQVA 3NSYA 1E5ZA 3L45A 4BWWA 5I6NA 2UXTA 4GP4B 1WAEA 3NSDA 4NB7A 3ASOB 4YSQA 2FT6A 3NJIA 4FA7B 1AZRA 2DY2A 2LLNA 2I7OA 1AZNA 1ZV2A 3UADA 3NJNA 1M9WA 2RACA 2IDQA 5B3SB 2R7EA 3IE9A 4BWUA 5AFAA 2GSMB 4PCYA 3UACA 3X2QB 2AVFA 2CUAA 1FWXA 1PCSA 3PAZA 2VW7A 3C75A 4K9JA 4DP9X 4E9TA 3KW8A 2HX9A 3OMNB 1NIEA 3N55A 3S8GB 4KO6A 1KYAA 2BZCA 3SBQA 1L9TA 3FU7A 2BO0A 5I6LA 2QDWA 4G71B 3FSZA 3NP3A 2P80A 2GC4C 1QHQA 1CURA 2FNWA 2IDSA 1WA1X 1IC0A 1BXAA 1GY1A 2YQBA 5B1JA 3SBPA 1JZHA 2J56A 3QJQB 3GXUB 1OE3A 4BDVA 4E9XA 4E9QA 2B3IA 1JXFA 1JZEA 1BYOA 2Y1AA 2IH9A 5PCYA 2W88A 1L9PA 3GDCA 3T71A 1ZDSA 3FQ1A 8PAZA 1SJMA 3HEIB 9PCYA 4A2EA 5I6PA 2GC7C 1OOWA 4HHWA 2R7EB 2CJ3A 4DP0X 1MG3C 1OCZB 3NJHA 5I26A 4KO5A 2BP8A 3AG4B 1R1CA 3FSVA 4E9YA 5D4IA 3OMAB 3WKPA 4BK5C 2HRHA 4L0PB 1PMYA 1KDJA 2XV2A 3DTUB 2XWZA 4WKXA 2YAHA 3NYKA 4GP5B 2UXFA 4F7KA 1A65A 2BP0A 1EZLA 3V9CA 2FQFA 2QPEB 3FQ2A 5F7AA 2H3XC 2ZWNA 1ADWA 1XB3A 2GIMA 2FQGA 3IBOA 1L9RA 1GY2A 1NIFA 3NJJA 2UXVA 3BVDB 4DPBX 4YSCA 1V55B 1NDTA 3TBBA 2FT7A 2HLEB 2EIKB 1BYPA 2BWDA 4TXVB 3X1NA 3DIVA 3S8FB 1BEXA 2PPEA 5I5JA 4AI7A 2YARA 2XU9A 2YAOA 1EHKB 1UATA 3MBWB 3NT0A 4WTQA 3IN0A 5B7EA 4GY4A 1J5DA 3CG8A 3QJSB 4ENZA 2XVBA 2HXAA 1ZDQA 1ET5A 2PCFA 2BZ7A 1N70A 4A2HA 1NTDA 1FA4A 1KCBA 3FS9A 1IUZA 4A66A 3QJVB 4UANA 4N8UA 1GYCA 2AZAA 2DV6A 1XB8A 1ILSA 2BHFA 2AZUA 4G72B 4YVNA 1X9UA 3FSAA 1BQ5A 1TEGA 5EHFA 2E86A 2B08A 1XB6A 2QPDB 4HAKA 4UF7C 4YVUA 4KNUA 1SHWA 1SNRA 2FJSA 1NWPA 1JERA 3NJKA 3SQRA 4A2GA 3CVCA 4M4RB 3FU9A 2YAMA 4P5RA 3WG7B 2BWIA 2EINB 2IDUA 5TK4A 3CVBA 3QPKA 1AIZA 1V10A 1NINA 1X9RA 5TK2A 4DP4X 1KGYE 3PLYA 4FAAB 1T5KA 2NRDA 1CYXA 3OM3B 1J5CA 2UX7A 1ID2A 3AG2B 1L9QA 4A67A 5D4HA 2PPFA 2N0MA 2OJ1A 2PPDA 1MG2C 3PPSA 4YL4A 4F2FA 1MZZA 3NJGA 3UAEA 2JKWA 1PAZA 2IDFA 1E5YA 2ZOOA 1JOIA 3X1BA 4YSPA 1MDAA 4E9RA 2J55A 4G7SB 2XXFA 3FYIB 3WIAA 1KCWA 3IEAA 3TASA 1KDIA 3MX0B 3PAUA 1AS7A 1AZUA 4GP8B 4KNSA 2TSBA 3U25A 1J9RA 1F56A 2VMJA 2Q9OA 2HZHA 1L9OA 1WS7A 5ANHA 2WSDA 3T6VA 1ETJA 1NWOA 4PAZA 4DP1X 1GS8A 4CSZA 2QDVA 5I5MA 1AACA 2OV0A 3AW5A 1AZCA 4MFHA 1VLXA 2VM4A 2VN3A 1AANA 4N4YB 4G70B 2CALA 5B7FA 4BXVA 1SFHA 3FYEB 1AS6A 4KNTA 4YSAA 1JXGA 1ZIAA 2YAPA 4QLWA 2PCYA 1NPNA 4JKNA 3QJUB 1PLCA 3TU6A 4YSSA 4DP8X 2AANA 3IN2A 2GBAA 4AKQA 1OE1A 2CBPA 2PPCA 3QJTB 5B1AB 4HHGA 4UAHA 4W1TA 4E9WA 1BXUA 4DP7X 2CCWA 2PP9A 2DYRB 2XV0A 4HIPA 4HCIA 5F7BA 1WS8A 2YXWA 3H56A 3NJMA 3OQRA 1E67A 4GYBA 1PZAA 3WNIA 2GI0A 3NSFA 4YSRA 1JZJA 1ET8A 3T6XA 1A4BA 1GW0A 3NP4A 3N2JA 4GXFA 2QT6A 1SF5A 1YLBB 1FFTB 1AQ8A 1W8EA 2VSKB 4BXSV 2I85A 1AAJA 1W6LA 2ZXWB 3OD3A 3AZUA 5I6OA 2IWFA 2BW4A 1HAUA 2EIJB 2XX0A 4JHUA 1PY0A 1ILUA 3S3CB 3WNJA 4E9SA 2XYBA 3T9WA 1BQKA 1IBZA 1GSKA 1NIBA 3GYRA 1JZFA 5E9NA 3H4HA 3ABKB 1BAWA 1NIAA 3EH3B 4A2FA 4YSDA 1M56B 4E9VA 1AR1B 2DWSA 5PAZA 2EILB 2IWEA 3NJFA 3JT2A 3AG3B 3SBRA 2EIMB 1TEFA 2YAQA 2CAKA 3KW7A 1BQRA 1A4AA 1WA0X 1SDDB 2FQEA 1W6WA 2XUWA 4YSUA 1HAWA 1B3IA 2X87A 4AKPA 3CZUB 2PP7A 3OMIB 1PNDA 4AKOA 4DPAX 1J9QA 1A4CA 3G5WA 1OV8A 1BXVA 3PAVA 3ABGA 4YSTA 4YSEA 2FT8A 4DP5X 1RZQA 4CSPA 3CDZB 4RH4A 5I5IA 3EF4A 1ASOA 4W9ZA 2Q5BA 2MTAA 5IY5B 3WI9A 2XLLA 7PCYA 1N68A 2DWTA 4AX3A 3T6ZA 2FTAA 3V9EA 3S3DB 2ZONA 3S3BB 1J9SA 1PLAA 3QQXA 1M57B 1GS7A 1SF3A 1TKWA 2A3TA 2XX1A 2MRYA 5I6MA 3WKQA 1PLBA 4DP6X 4M3HA 4X4KA 3RYMA 5LDUA 6PAZA 3UAAA 5B1BB 1AG0A 3FPYA 1RKRA 1CUOA 2J57A 2HX7A 1PNCA 2VSMB 4NERA 1CC3A 2IH8A 2PP8A 4HZ1A 1JZGA 1ZPUA 4YSOA 2PLTA 3EHBB 1CYWA 2BW5A 4HCFA 4HCGA 4KO9A 4KO7A 2GB2A 4F2EA 4ZK8A 5B1KA 1NZRA 4P5SA 3FQYA 2H5UA 2JXMA 5I28A 1AS8A 1HFUA 4A68A 4DP2X
chains in the Genus database with same CATH superfamily
5HHPB 3OKEA 3OBAA 1KN4L 1M53A 1QNIA 1Z5HA 5E95B 4ANVA 2MH4A 3ZE0B 3ASNB 3BZFA 1XXDC 3S4SB 3I75B 3LQAH 4HT1L 2AABL 1FDLH 2ED7A 4FTVA 4KGLA 1EDHA 5DEGA 2H6PA 4ZD3L 2BIOA 3RE0A 5EO9A 1SVZA 4WW2B 3GBNL 3HB3B 1QTYT 1CK0L 2O1AA 4OGXL 4RQQA 5F6HI 3VXRB 1PX3A 1TEYA 4KDVA 4PRPE 2EDFA 2EE6A 3LKPB 1VKXA 1JNHA 1J8HE 1DP0A 3KXFB 5FF6A 2HT3D 5FA3B 4QKTA 3AT0A 1S8DB 1E0OB 3B5TA 3QR0A 3DXAE 3QEQB 3HAEH 1ZGLM 3GLAA 2AQRA 1Q9OA 3Q01A 2ARJQ 3UGEA 4ABWA 3LXBA 3GSNB 4HALA 1E30A 4HP5A 1UXWB 5GRVL 3DV4A 4X9GA 2R4RH 3SE4C 2C3HA 3TBCA 1S2EA 5C2UB 2JXMB 4PEEA 3REWB 4Y4FB 4CMHB 5IOPB 1OGAD 2VDQH 4J12A 1SY6A 4KNQA 4GKLA 3TX4A 4OQTA 3HBPA 5A7EA 2G2RA 2PO6C 1RCYA 3FO0L 4MJIE 3NIDE 4GUQA 3HHRB 4FLQA 2ICWJ 2GG1A 4U1HA 3U83A 3WO4C 2AMUA 5CP3A 4PRHB 1A8ZA 3IAPA 1INQA 1AHWC 1MWAH 2LU7A 3BP7B 3DX6B 3TV3H 4C58B 2A9NL 4O02B 2NY1B 1I8KA 5EO1A 2NY2D 2DYSB 5GPRA 5DR5L 3B34A 1KYDA 2BSSB 3RIFK 1MJ7H 3FBQA 4N2DA 3ZPDA 1KPVA 4OF0A 4NQXB 1VA9A 1AIFB 5CSBA 1W9XA 2BC4A 4HX1B 4FFTA 3O6FD 3GJEB 4ODXA 6FABL 4Z0XB 1DYZA 1OGAA 2E7LC 4MQXD 2E7CA 3JTBA 1DJXA 3SHSA 3VG0H 4ABUA 1GTFA 3P0VH 4G8FB 5I30H 4NKMB 1R34A 2AITA 2DLFH 4XPHL 3HI6H 4IOIA 3FTUA 4U1NB 1T21A 4YXHL 4YX2H 3K80A 2UXTA 4GP4B 4F7MB 5KYNA 1WAEA 4OLXL 2FT6A 1ETA1 5ICUA 1YPZE 2X41A 1AXTH 3FHAA 4ONOA 1M7IB 4HZAA 3QS2A 2VXUL 5EOQL 3S8WA 2EUZA 1SHSA 1IGIL 3QUKA 1JGDA 1KXQE 1NGWB 2AI0L 3NESA 4X6CF 4Z3FA 1ACZA 4ZSOA 2A7BA 5L4MA 3X3FH 3UAFA 4NX0A 3VXRA 3B2DC 4Z0BL 2X2IA 2FEJA 3LKSB 4KVNH 4LKCB 1JVKA 3WJMB 3LKPA 1P4BL 2WUBH 1JF6A 3OKOB 2YSSB 3KW8A 3KXFA 5DQJA 3ZE2E 5FA3A 4KJWD 1ZT1B 1RSFA 2PYED 1OP4A 5C70A 3F6IA 4N0UE 3U0WL 2PR4H 3GSNA 3P2BA 4KVPA 5LXGL 1QHQA 1UXWA 4GQPH 1MKFA 4QLRA 1JPTL 5B1JA 4M93B 4PJFE 3OXRA 4NKIH 2CBQA 3MFFB 1V8HA 5HBBA 3OAZH 4K8RH 1J86A 4FHKA 5HHOB 1IE4A 2JQAA 3MOQA 4NHCH 4YDLC 2D7TH 3GGWA 2J25A 4W9IC 4OGAD 2Q3ZA 3EGSB 4PRNB 5ITFB 2D4FA 4HJ0D 5EORH 2ADFH 5J8OA 2Y72A 3V0VB 3VXPB 2XCMC 3DX6A 3FAWA 3V4VL 3FUEA 4O02A 1NL0L 2ZOWA 2UWEF 2Y25A 3EOTH 1BJMA 2ZE0A 1NBQA 1PG7H 1JYXA 1SJVA 2YPLD 1KIRA 2BNQB 2ID5A 4HEPG 4NQXA 5EIIB 2VERN 1CFNA 1IT9L 3QDME 2GVYA 2HT4D 2YAHA 2YZ8A 1CGSL 2E9JA 4GAGH 3UBHA 4Q14A 3GJEA 2DJUA 4XP4H 4Z0XA 4DN4H 3VFVA 2QPEB 2BCKB 2CGRH 4P2QD 4NC2B 2FIKA 4X99A 5CGTA 4BSWA 4DEPC 5C0BB 3N04A 3LB6C 4TMPA 3TYGL 4G8FA 3OLDA 4WFGE 5M95B 3U1PA 2NXYC 3C60B 4NKMA 4W70A 4HUUB 4MLIA 1DJGA 1MCRA 3C8KB 1HILB 2XJLA 4Q56A 1G5AA 4JKWA 4B0MM 1NGQL 5DFWH 5E5MB 1M7IA 3HE6C 1T83C 4Q6YA 4BV1A 3QNYB 1MRFL 3LIZL 3O9WD 1NGWA 3ZTCC 1BEXA 4I3SL 4ZUVA 5IZ7A 2YAOA 4WTQA 2G2PA 4P2YA 1J5DA 3GKWL 5IHUL 3IF1B 4XWGL 4YJZL 4CADB 3IM1A 1MHEA 3LVEA 4NHUB 4EJ1C 3E80A 4LKCA 2E9GA 4WUUB 1UZ6E 1ZLVK 4F37K 5LXVA 1IARB 2G5UA 4H8WH 1NTDA 4ZMYA 2YSSA 3C87A 3CDCA 4XNXH 2P5WB 4HLEA 4KZ0A 43C9A 4ES9A 5HYEA 4M5YL 1EJOL 5FYJU 2B2XH 2DMHA 1GYCA 5E5UB 1IZKA 2D03L 3GEFA 1VIWA 5D6CB 4OCYH 2FSEA 2Q7YB 3SGKC 3D3VA 5BV7H 5FKAB 4X6DF 2XWEA 2OR9L 2ZICA 2X3CA 2DEWX 5GGVY 1QBMH 4PJGF 4H8UA 4HIJA 4UOW1 4OIAA 2CKBH 1NANI 4JFEB 3MFFA 3IDJB 2VMCA 4XP6L 1FCGA 3VRIA 3MU3A 4I2XA 1FYTE 1PKOA 3ELAT 1GHFH 4F91B 3HUJB 3ULVF 4MHHG 4NQEE 1G9EA 1VEMA 3ZHDA 3E2HC 3OTTA 3EGSA 4PRNA 5EO0A 2VKWA 4PJBF 1BD2E 3BCFA 5DZOA 3MRJB 1KC5L 3GJFA 4OQTL 4R7VA 1X9RA 4NO2B 3U9UB 1LK3L 2X4PB 2XQBL 3DURA 3DIDA 5B8CC 1KGYE 3PLYA 4ODSH 2FO4B 4W68A 1JHTB 1E8WA 2A73A 3WYRA 2BNQA 3QAZB 4P5TB 5EIIA 1D5IH 3KWTA 2WYHA 1LO2H 4XBGB 3EDKA 3I85A 3VSVA 2ENQA 4A67A 2JTYA 3KLDA 2PW1B 5B4MD 1DBKH 1P53A 1GJWA 4Z23A 1CG9B 1CT8B 5G5DA 2HRPL 5G4MA 4FA8A 3FUFA 3M8OL 2J55A 1R9FA 4OFKA 1GGIL 1YVLA 2BOLA 2EDEA 2VOTA 2W60B 5D72H 4ELDA 5IMMB 3RLSA 1GW6A 3E6FA 2VLLA 1J9RA 5CBAA 2VLRB 4JAMB 1WLHA 1NLDH 1OY3B 4X0NA 4X2UA 5D7JD 5DVPA 3TCTA 3FQWB 4Y19D 5ANHA 2WSDA 4YHIB 4AIOA 4XNUL 3O2WH 1GS8A 4JZOB 4MMYA 1MCLA 5GRUL 1K3ZA 2AEWA 1MHHA 5KSUB 1H9VA 4X8JA 2EH8H 4ORGB 4EDXA 2B59B 3N42B 4OD2B 3GIZH 3OGOE 3US1A 1CMOA 5I16B 4NO3B 1OL0A 3N85H 4DGIH 3IF1A 3CQPA 4MNGE 3MV8E 4HKXB 3RWHA 2Z0UA 4ILDA 1KTBA 4NHUA 2F8VA 4YSAA 1JXGA 1NFDE 4QO1B 3TJHC 1F5WA 3VCLA 4WUUA 2EIZB 5JIMA 2IALA 2OTWB 2ED6A 4KUZL 2CBPA 1NEUA 2PPCA 5HJ3B 3CZEA 1FAKT 3IMWA 1EPFA 4IJ3C 2BS71 5IGXL 3WCYA 2AAVA 5FKAA 5JW3H 1YEJH 5DJYB 2Y3NA 4HIPA 4OQ1A 2OXHA 1IAOA 3EZ8A 1MAML 4ES8A 4Y19A 1N8OE 5HGBB 2KLSA 5BVJA 3VGGA 2X42A 3ME0B 3NIFF 2A4ZA 4PJAF 1X4YA 2CGYA 2DZEA 1MWOA 1U58A 4LQFL 4K5OA 1OPOA 3RFRA 3FUJA 3B2XA 4L2LA 5FO9B 5B3NA 4OZFB 4BFRA 1A4BA 3H9HB 4KHTH 1S9YB 4W9GC 3MRJA 2ZXBA 3NK3A 3UAJC 3GMRB 2P8PA 5DHVH 1QYGL 4NO2A 4NKOB 1BAGA 2X4PA 3U9UA 1VFMA 1TFPA 2BVPB 4I13B 4NNXB 5IFAL 3QWQB 3APDA 1BZ7B 4ODUB 5KEZA 1IBZA 4NZ8A 2AS5M 3F7KA 3GFUA 3D85D 4I89A 2HKAA 1TMQA 3COOA 2WW8A 2KMWA 4I18C 3V0EA 3DHUA 1DN0B 1I7RB 2IQAA 3UTTE 4AV4A 4PJ8D 25C8L 1THAA 5GS1B 4WGWB 3TBSA 1MY5A 3BD4A 5FK9B 4UIMB 2VDMH 3EXJA 1GVIA 2GJ6D 3QS3A 4LPCA 2XUWA 4UZGA 1LQSR 3UH8A 5EU3A 2WQUA 2RTTA 3FQWA 2X3BA 5DJAA 2QJDA 4OCWH 1AR1C 4YHIA 2AV1B 1BIHA 2WWMC 3PHAA 2Y7QB 4G8GD 4JZOA 4QHLB 3ISYA 5F9JB 3VMNA 3OLGA 1HWHB 1PJ9A 1HJCA 2B59A 4OD2A 3IU4L 1B0RA 1MXDA 2O5XH 4OW6A 1WCQA 1XCTB 5ERWB 3Q1EA 2DQDL 5KVDH 4QO1A 2GEEA 3BIBX 4IRJB 3MXVH 2EIZA 4QNPE 2OTWA 2J4WL 4JFDE 3N9GH 4GS7B 2Q5BA 3VQ2C 3SOBH 4TV3A 5ACZA 4QXUH 3A4DA 3B9KD 3TVMC 3TL5A 3S3DB 3KDPB 3S36X 4R90H 3STBA 4HAFA 1YYMH 5DJYA 4FG2A 1TTBA 3DX3A 1BOYA 2L3BA 4N2OA 4CNIA 5E08H 5C7ZA 1G9NL 4P06A 3WD5L 1KUMA 4HH9B 2CRZA 3MJGX 3FJTA 1PNCA 3VGFA 4RX4D 1RUKL 1CTNA 1GYAA 4FADA 2MMXA 2YS4A 5EU6E 1PDKB 5FO9A 4AIEA 2BW5A 1PW3A 1WD9A 2VAAB 3BAYA 3GBDA 5C8JA 2XPZA 5ETUA 5ANMA 4PJEB 5BS0B 3GMRA 3N40F 1P9MA 3BGAA 4YGAB 4BE6A 3TTYA 2V2TA 4DP2X 3DOSB 3PWPE 4NIYE 4QJ3B 2HRGA 3P3TA 4LDLB 1D9KD 1R5IA 2FL5A 2BVPA 2O72A 4Z7AA 3WUWA 3VM7A 5T5NF 3B9KA 4WY7L 2A6JB 1DANT 4X80L 3IMTA 2XN1A 3MBEC 3CZNA 4H1LH 1CN4A 3I6LD 5EZIL 2X09A 3QQ3A 1NICA 4WHDA 3V0WL 3A6OA 4KRPD 2X70B 2DIBA 3D6GA 4O4YL 5KAQF 1DN0A 1I7RA 1LHZA 3HMWL 3ZTJH 2BMKA 4RX4A 3NFPA 4FQIH 5HGDA 4N6RA 4X6FB 4AQEA 1V5JA 2BY2A 3B3IB 3G6AB 4UIMA 5MP6L 1ZA6B 5CR1A 4WCYL 1KCVH 4UILH 3QB7C 3CVHB 1KJ3L 4OF3A 5D4JA 3TWYA 3LRHA 5E6ID 4PJHA 2AV1A 3X1FA 3G6DH 3WLBB 4Z7WB 4QHLA 5FM4A 5F9JA 4L9LB 3K1DA 4FQHA 3S6CA 2DD8L 2LU5A 1U8MA 3IDYB 3OXSA 3DIFB 1GR7A 4OCNC 3ARVA 2CBMA 5ERWA 4Y2DC 2SEBA 1R3KA 1II4E 4M5SA 1T20B 3QYMA 4L3EE 4IRJA 5LJYH 2XRAH 3LZRA 3ASWA 4BCXA 1ACXA 2JCCA 3BT0A 2JTDA 3I6SA 1X7TA 4JY5H 1H3VA 3S98A 2AEPH 5C09E 2ROYA 3JTTB 1BZDA 4ELKA 4Y5XB 2DH3A 1CU4L 4G6ML 1IBYA 3RNKB 4JRXE 3WEOA 3BIAX 3CAFA 3ZIYA 2WXIA 4K5LA 3SE9H 4OZIF 3OHMB 1C5BH 3A6BH 3US0A 1SLUA 1GSMA 4HUNB 4F5CE 1MQKH 3AUVA 1BPVA 4JPSA 1BDYA 1XH1A 4UI2A 4NP4L 4AQ1C 1Z7JA 3RGVB 3D8MA 3VXTB 2L04A 3JYCA 4PBXA 3WJJC 5KZCD 3X3GH 2C1OB 4ZS6C 3UIZA 2QQNH 1GXEA 4WEUD 3P77B 3R8BB 2EXYD 4JN1L 1DQDL 2CD0A 1R0AL 3DOSA 3BQVA 3VFMB 4XVOA 4PUBL 3QJOA 3ULVC 3CFTA 4ZUUA 2A6JA 1RD6A 4KQ4L 5C7XL 2FK9A 3D09A 4M6AA 1CJYA 3AWGA 2VDOB 3EGDB 3PPEA 2VH5H 3SEPA 2AXGA 4JY6B 5FYLD 2R69A 2WNXA 2X70A 3GBMH 1P2CB 5I19L 2CPUA 5C71A 1UA3A 1PCSA 1G7MA 2VNCA 5TTRA 2X1OA 3G6AA 2E5EA 1ZA6A 5KUKA 3RIKA 3UTZB 5JMRA 3DJTA 1KGUA 4D3CL 3GINA 3PJSB 4NUJB 4LAQH 2BZCA 1QPPA 4GXUM 4ZFQA 5LGKA 1Y6NR 3MLRH 4UM8A 2WQ8A 1F11B 3CXHJ 2AHIA 1UJ3C 3B7TA 4L9LA 1UWGL 4FHBD 1SVBA 1CDCA 1FPTL 1M71B 2A6IB 4JHAH 3W0WD 2XPYA 4BFNA 1GY1A 3DIFA 1JGVH 1ROCA 3N1QC 1XAUA 2J1WA 1X5AA 2O30A 4IKNA 2WQXA 3V6OC 4ENEC 3ZKXC 1M42A 2GJZB 3L9BA 1FBIH 3MFGB 3D39D 3MUGA 4N8CL 1FH5L 2W88A 3GDCA 3T0WA 4QHUA 5KVEE 3ZDZE 2NZ9D 2GUOB 2R0LL 4PY7B 2K1MA 4YE4H 1FZMA 1EGJL 2GC7C 4BD4A 4F92B 3JTTA 1HYRC 3TEZA 2QTEA 2CGZA 4Y5XA 3RNKA 3WFEL 4DP0X 1MG3C 2O26U 4TULH 4UYQA 2VM9A 3CK0L 3CHQA 1GAFL 3SCMC 3DOIA 5IHZB 2WLHA 2XY2A 4U1KB 4PRDB 4L0PB 3D33A 3BHBB 4WKXA 4X9YA 5IB5A 2UXFA 1TSRA 4PV9A 1ZLWH 3RPKA 4L4JA 1A65A 3OHXB 2FX9L 5E5RB 3ZY7A 4Z7UE 3T2PA 3KJ4C 2RCSH 3W9EB 5MEPB 3L3GB 1GL4B 4U1MB 1WT5C 3C6SB 3IAQA 3IGLA 4QAWA 3D39A 3IBOA 4RDQG 4K7PL 1P7KB 3VFMA 4NQUA 1AGBB 3Q0HA 5TE4H 2WVSA 1ZEAH 3BVDB 3P54A 4YSCA 4E41B 3QUYD 1KXVC 4FNTA 4GMSL 3SYCA 2OXGB 1ZAGA 4DGYH 2WYZA 4HDIA 5IQ7L 3ULAB 5BUGA 1Q1JL 3FF7A 4DIXA 1RZKL 2UUDH 2ICWB 1A7RH 2XVBA 1AGEB 4JO3L 4WAFA 5JXAH 1I8MA 1INEL 1BF5A 5CEZH 2ZOLA 4JQVC 1LWRA 3ZZ1A 2ENYA 5JHAA 2BZ7A 4NIKB 1CTMA 1MFDL 2GSGB 1ADQA 3M1CA 4E2OA 4NUJA 3PJSA 3NSJA 1RAMA 4G1EA 2C7UB 2YGOA 1IFGA 4CL7A 3LOWA 5DSCA 1PSKL 3OC8A 3JUZA 4LIQE 1RIUL 5KJRH 1FL6B 3SGJC 3QQ9D 3EDDA 4N9OB 5DC4B 1UENA 1NBYA 1U8NB 2QQKL 5FV1L 5EEWA 2HH0L 5EUOB 1F97A 1X9LA 4XMPL 2GJZA 4HJGA 5AL0A 4ODHL 4YVUA 1L4IA 3KYNB 4IRZL 4M6OL 1QQDB 2DI9A 2WQAA 5C97A 1HHGB 1CB4A 1W72A 5BW7A 1OB1B 3DO7B 3HC2A 3WG7B 3QZNA 5IROD 3I9AA 1KLGA 4XP1H 5D8JH 5AOZA 1I8IA 1BWWA 2ZUSA 5F2FA 5C0JB 1K8DB 4LLDB 4ANUA 4OFQA 1VB9A 4XVJL 1FRGH 2RFXB 2BK8A 4F3FA 4OM0H 1TQBC 1LP9E 4XPFH 4BH7A 1MXGA 5D93B 1X7QA 3MRHA 5EA0H 3VG9B 3BHBA 1LYQA 3VUAA 3ECBB 5LAPA 4LVOB 2JKWA 3WDHA 1ZS2A 4QJ4B 1MW1A 3OHXA 4MJ5B 1RURL 2NDGA 3L3GA 1F4YH 4NT6B 4XBEH 3T5WA 3EFOB 4OU3A 1XTMA 3PDOB 1H15B 3MX0B 1WZ1H 3X11B 3NACH 1D6VH 4LCCC 3KVDD 3ALWA 4KNSA 4R83A 4YPGA 1WFTA 5ADOH 2X12A 1KCSL 1L9OA 3QNZB 3D52A 5EIQA 4I48A 4TSAL 4GSUA 3HS0A 1IO4C 4PAZA 5I1EL 1GH7A 3UC0H 5EU5B 3TH4T 2QMKA 5JHDE 4J4PD 3GSRB 2DF3A 9CGTA 2VM4A 5AW3B 1QATA 1UKQA 1X5MA 1TLMA 3BQUD 1XSOA 1AGEA 3QDGB 2WMPA 2YJQA 3FYEB 2P26A 4HG4K 4QLWA 3SKOB 4N20A 5B21A 5AVVB 4JGNA 4QYAA 4PHXA 2YIHA 4AKQA 3DX7B 3U4EB 1XTLA 2R69L 2C7UA 3ISWA 2ADIB 2ZQKA 2E27H 2VXSH 4KQ3L 5K9JL 1HQRB 2G5BB 1F3DJ 4NGHL 4PB0H 1FL6A 3RZCC 1DVXA 5F1KC 3LV3B 1DANU 1S9XA 3CHSA 4YHML 2EXSA 4N0YH 5EUOA 3D4CA 3GB7B 1OSPL 3WLWC 5I0YA 12E8H 4BK8A 4AH2B 3LDBC 4GYBA 3KYNA 2GI0A 1QQDA 4I0PD 2K6YA 3SKJL 2M83A 3LH2L 1A7QH 3HOGA 3DO7A 3VXMA 2F53D 3KBFA 4YUEH 1ZK9A 2NY5C 1SF5A 1HOEA 2KZWA 4FI7A 2Q6WB 4C59B 3HZMB 4RFOH 3BP6A 1AGFA 5C92A 1UURA 5KVMC 4JY4B 1K8DA 4LLDA 4DKFL 5LN4A 5C9KA 3AZUA 4YBLC 5FYLL 2RFXA 3SDCD 5L2KB 5I82A 2H4EA 4E9SA 4N2AA 2XPGB 1UD3A 3T9WA 5A2BA 3O4LE 3SE8H 1RU9L 3ZL4L 3EYUL 1OAYL 1P6AB 3V10A 2X5PA 3K4ZA 2FHCA 4DERA 2VWEC 3L95A 3CFDB 3DLQR 3ALPA 4NT6A 3Q13A 4EI5B 3EFOA 2A9DA 1J7VR 1D5MA 3PDOA 1H15A 2IXQB 4J6RH 5MERA 3L3DB 3QUXC 5AYTA 5TD4A 1BQRA 4ZMOA 1OT2A 4PJCA 4HEMA 1AD9B 1C8PA 1EO8H 2EP6A 1E9PB 2F53A 2L7QA 4BM7A 2EDOA 3QNZA 3QRLA 1I7ZA 4HEPA 5E8EB 5IR1B 3V4PB 4HCRA 3KLSA 3RB7A 4LSRL 3VDCA 5FIEA 1RZ8B 1FNSH 2H7WA 4ISVB 4DPAX 4PJ9C 1SJEA 3GSRA 2FEDD 2IAND 3QFJB 1PZ2A 1QFUL 5C6TH 3Q2LA 5HHME 1CF1A 1CICB 1J1OL 4JHWH 4LPWA 4U6VL 1DLHB 1DVUA 4F57L 1U30A 3C5ZB 3V6BR 4N6QA 4F8PA 1A7NH 4E5XG 3SKOA 3UTSD 1PD0A 1B6DA 4BFGA 1ASOA 4UT7L 3DX7A 3B4NA 4KTDH 1A1OB 1RK0B 4WUKL 3T6ZA 1HQ4A 2ADIA 3LRLA 3TESA 4N87A 1P4UA 4XTRC 4P3CL 4Y4KB 4LEXL 2OSWA 3TT1L 4C4BA 3S3BB 5CFAA 4GI9A 1WBXA 2G5BA 1OAXL 2EO9A 4FNUA 5T1JA 1SF3A 4PJ7B 3BSZL 2MRYA 2XT1B 3MR9B 3UBFA 5I1IH 2XVLA 1I7UB 1PLBA 3LV3A 3BPOC 3ECUA 3TT3H 5D6DC 4H88H 2G75A 1FC1A 3GB7A 5E1QA 1KBKA 2YD0A 3PL6C 4HWZB 4HU8A 1SBSL 1WTLA 4X7DC 2PLTA 4D9RD 2Z8RA 3U4BL 4TVSa 1J8KA 5E99H 5K93A 3FU3A 4NQDD 1KIUB 4ALAL 2E56A 2EYSB 2CK0H 3UZQB 1FAIL 4XWOD 4KKLC 4FTVE 1HESA 4XB7A 2X4UB 4QXTA 2VLME 5BJTB 1K72A 4XP5L 4TVPE 2OBGA 4ZW5A 3UPAA 4D0BB 2B5IB 2CIIB 4HJSA 3ZO0A 2XPGA 3UG3A 2WBXA 4QHNA 2VW6A 4WI3A 2ZTBA 2J6WA 2HAZA 1OP9A 2BNUA 2O6CA 2YAEA 3MNMA 2E46A 3QI9C 2P1YA 4LRNH 3IGFA 4G6JL 1XMEB 4QOKB 3CFDA 1ONQA 1KJ2L 3DBXB 3N1PC 4PU2A 3PP4H 2IXQA 3FH5A 2C9XA 4P9HC 3L3DA 4R4BB 2OCCB 4C56B 1JWMB 2VDKL 1E9PA 1Q72L 1MREL 1UT1A 2AK1L 4FQPA 3T2NH 1YNKH 3L4VA 5DD0L 5E8EA 4NS0A 2O93L 4LCWE 4X7SL 3MLUH 1I3VA 2KT6A 2JH2A 4K71B 1F3RB 1RZ8A 3HNTH 2R29L 1NC2D 2GFBB 1L6PA 3GS4A 3HMXL 1D6EB 3QFJA 3NGBC 4GFXA 5LGHH 5GXBB 3MRBB 1CICA 5D7IF 1DLHA 3C5ZA 3CFJA 1E4XH 4CU8A 5HHNA 5FM5M 1EEZB 1J87A 2QEJA 1OF0A 4U1GC 1OEZW 1OGTA 4AW7A 4ZYKA 1A4KB 3GO1H 1CBVL 1UT9A 3MNVA 1U42A 3L1FA 1QHPA 1E6JH 5CJBA 4Y4KA 1JVLA 1C08A 2F7OA 4YS4A 3PWJA 4AGNA 3B9VA 1I7UA 4TOYH 3II2A 5AW5B 1D3CA 3K46A 2CR6A 3HTLX 4FZEL 4WNQA 5EWIH 4HWZA 2X88A 5HVFB 2WO2B 4H2CA 1U91B 3WNOA 4ZUTB 3VE0B 1SFDA 1I1AB 1WA2X 3QIUC 2A74C 5D7HA 3D2UB 1IBGL 1NUNB 3ZE0E 4WGVB 1KLUB 1KIUA 3LH8A 2EYSA 4D0DB 2R56L 2JMRA 3DARA 1JRHL 1WEJL 2CSPA 2F61A 3MRFB 1U8OA 2BSBA 2X4UA 1JL8A 4F58H 3DVGB 3ZE1F 4UUJB 5LBVA 4FA7B 4KKAC 4TLKA 3VXRE 1HT6A 4I1RA 4RA3A 3K5SA 3PWVB 3WFDH 2RACA 2IDQA 2FR4B 3KPRD 3IE9A 3KXFE 3LEXB 2A9AA 1QO3A 2Z4QB 3DBXA 1HSBB 2X6BA 5EC2A 5J11C 3GIVB 2O5ZL 2YO3A 2ZPKL 3QEQE 4R4BA 5TPWL 2YKLL 2B20A 4K9JA 5HI5D 4F9PA 5IB2B 4L18A 4C56A 4YBHA 3C2AH 3S8GB 1JWMA 2LQRA 2WBJB 3PDDA 1KYAA 1N5YL 2QLVB 2XG4B 3FN0L 3IFLH 2ODIA 3TWCL 3H7BA 5BO1H 4PWJA 3ULUF 3GXMA 1BFVL 1QRND 4G71B 2FZ3A 1P6WA 4FL4B 4ODVH 3UMTA 4JPVH 4JZNB 5CS7A 3W57A 4LHUG 2J20A 3WY4A 4ONFL 1RUAL 4OCXH 3SBPA 4S0HA 3V79C 4OB5H 2ZUWA 5F89B 1W16A 4P4KC 2WP3O 4PRHE 2DLHA 3IAGC 2VSCA 4OR1A 4OZHF 1BYOA 1P84K 3N1MC 4ZQTA 4FFYL 2C9AA 2K3HA 1EEZA 5ENWA 1KACB 3T71A 4KKQA 1A4KA 3KEDA 3QH3A 4U6XB 5E2UL 4R0LA 3CFIC 1V3LA 3HZ3A 2XDHA 3LTVA 2ITDB 1QBLH 5I9QC 4N1HB 4KU1A 4ZTPH 4OD3H 3L2MA 3AREC 4UNVA 3FW6A 1FNHA 5TDNB 4MA3A 1QRNA 1HH6A 1I82A 2NCEA 5BMFL 3MRPA 2Y07L 4O2EB 1EX0A 5C0NC 3T8VA 4FQ1H 5HDBB 4WHCA 3WDJA 3K2UL 1I1AA 2XOTA 1BIIA 3WMSA 3GSUB 1F4XL 3D2UA 1CZ8H 5T1LB 2BJML 5I15L 5HI3D 4ZX3A 1H0DB 2PUQT 2GIMA 5FECA 3MRFA 3TM6A 3RDTB 2X9YA 2OMTB 2WO4A 3WXWL 3I3DA 5CJQL 3EJZC 4K23L 1R5WA 5I0ZA 3O6LH 1CDGA 3QJHB 2NW3B 5F72S 4GBXD 2ZUQB 3SQOH 4I8DA 4OFYA 2A1WH 3I3BA 1JPFB 4ZMTA 1N0LA 3PWVA 1HXMB 2OMYB 1MFNA 2FR4A 3FH7A 1C1EL 2W38A 1KWGA 3MBWB 3HAEG 3LEXA 3KPMB 5B7EA 4ENZA 4XCFH 1HSBA 4BZ1A 3GIVA 2KI6A 3MO1A 4K7FB 2R23A 4MD4A 3P11H 4XC1L 3WIHA 4APQB 3P30L 1LWJA 1LMKA 2BSED 3O3EA 3HN5A 4CN4A 4UTAH 4A6YB 5AD0B 5IB2A 5D1QB 3GTVA 1ZANH 5C08D 3MUZ1 1KCBA 4A7GF 3BE1L 2N4IA 1IUZA 3LCYA 2HRLA 1GGTA 5AVRB 2DV6A 2BHFA 2VC2H 2XWDA 4JZNA 4KMTL 3VU2A 4G72B 5HHOE 1HOCB 2FIRT 3GI8L 3BUBA 4YVNA 1GGYA 2B4CC 1L0PA 4HC1L 4DKDC 3L9RA 1QFWH 4GBXA 5F89A 2HLFD 2QPUA 3VGHA 4AEIH 3SDXA 3U9PH 3HRZC 2OSYA 5DHMC 1GJUA 3K81A 4HAKA 3T3MB 4LOUC 3BPLC 5DJCB 2DTML 3SQRA 2ZWYA 3ARFB 1AQKH 1UASA 2NW2B 2BNQE 5C0AB 2Z0BA 4JK0D 3DUUB 3L54A 4R7LA 1V10A 1PFOA 1PPIA 4AM0B 1KCUL 5I0WA 2P8MB 3IDXH 4NNPL 4HK0B 1B4JL 2BSEA 4V11A 4OH2A 3ARXA 1B3JA 3CE1A 5DMIH 3HHSA 2CBOA 1T0NA 3GXFA 4NN7B 5F0LB 3UO1H 1J12A 1ID2A 2ERJC 3SE3A 4NM8H 5TDNA 1JIBA 5C0BE 4MB4A 3QIBC 4S1RH 1UA7A 1T6BX 4O2EA 4G5ZH 3MRGB 4M7LT 3UAEA 5I75C 4GRLB 3GK8H 1HKLL 3PWNB 4PG9B 1MDAA 3GSUA 5BVPL 3V5DB 5HYJD 4DVRH 1TTUA 1M4KA 5T1LA 4NPYA 1H0DA 1Z0MA 2MTPA 3PJNA 3RDTA 5FM8A 2OMTA 5AUMB 3G6JB 5EPMB 1TQCB 3FOMB 5DJ8A 2AEOA 2Q9OA 1E43A 1LK2B 1N2RA 4NOBA 4Q4IA 3K3QA 1N26A 2Q76A 4WI0B 2VISA 4X4MA 5TFSH 1JPFA 4JR9L 1TITA 2OMYA 1AACA 4UM9B 1JWSA 4WUUE 3LNIA 2WOBA 5AZEH 4BE5A 3HKFA 3I02A 3MBWA 2IOMA 2P5WE 4H8PA 5F1IB 2Z31C 3KPSB 3O6FB 4XR8C 5KVGE 4BXVA 2OMZA 4MNQD 4DAGH 4J2XA 4K7FA 4APQA 1G7JB 2Z92B 3V0AC 2XWBB 4R6UA 4JKNA 3US9A 4M8UA 4A6YA 5D1QA 4NKDA 5FOJA 5FGBC 2PMZA 4OLVL 2VLJB 4KI5F 3UGUA 3H6AA 2X7LB 4H8VA 5MI0C 5ESVB 4JFEE 2HMID 3RL2A 1NUFA 2CCWA 1N19A 2W65B 3HUJE 2VGLM 4KFZC 1WHOA 1UGKA 3T6QC 2WSPA 1PGRB 3HC3H 4FI6A 5K1JA 3PGCB 4DKTA 4OGYH 1XF1A 3FZUC 4K3EH 3L3IA 2X44D 4I9WE 4QHKJ 1JZJA 3ARFA 3IJEB 5I0DA 2Z91A 2A83B 5C0AA 3RUGF 3DUUA 3KJ6H 1AQ8A 2N01B 2VSKB 3LHPL 3PAYA 4BXSV 1F58H 3QGVA 4XH2B 1NMAH 3QQDA 5IWLA 5SWSB 4KROC 3RTQC 1AYRA 1RFDL 5FAAA 1YRKA 4FCAA 4JM0A 5DUPH 3S88L 4AYSA 5CIPH 3SPGA 1RZFL 3KLKA 2BH0A 4M1CC 1M2OA 1UM5H 3D87B 3ABKB 5DWUL 1NIAA 4BZYA 4GRLA 3A5VA 3OQ3B 4F8LA 3PWNA 4ZMWA 4YDIH 4PG9A 4ACPA 4X7TB 3V5DA 4FA6A 1QABA 2VLRE 5KSVA 4LMQI 3E1ZA 2DQCL 4XO5A 1A1NA 1X5ZA 4WI6A 5DT1H 4EBQH 1HX0A 1A4AA 3P0YH 3QUZB 5EG6C 5AUMA 3G6JA 5JDSA 5EPMA 3FOMA 2JJTA 3ZZLA 5M94B 2CJUL 5BO0D 1YC7A 3H3KA 2EEAA 4WI0A 2IO5A 2NXYD 2QKSA 5ABZA 1U33A 5IVOA 1C12B 4UM9A 3VH8G 1TJGL 1HH9B 2QGEA 5ILTL 5MEQB 3CU1A 2BFGA 1BXVA 3FRUB 2FYYA 4HIHB 4P2RD 3RAJH 4YSTA 4FQJH 5IT2H 5AWNL 3KPSA 4QWWC 4W9DC 2GT9B 3DBSA 5IF0B 2Z92A 2YPVL 2XWBA 3IPFA 1UWEL 2EYTA 4O2CB 2FCBA 5EZLB 2DWXA 2MTAA 2WJ7A 1RIVL 1WC7B 2K4AA 5EZJA 3THML 5HD8C 3T3PF 1UXMA 2EZ0D 5DVKA 5T5FL 3QPXH 2X7LA 2FTAA 5EC1B 1DSFH 1I9IL 2CJTA 2NXZC 5IVXB 3WIHL 1Z3GL 5T1MA 3LD8B 4PW9A 4JKKA 4Q0XL 3WKQA 2F54B 2QADD 4PJIA 1HK6A 1JHKL 3AITA 3KL0A 4FI8A 5B1BB 3LRSB 5E4AA 5JNYB 4JANA 3M1BB 3FKUS 5CZVL 3QJZA 1MHCA 2KH2B 1KEMH 1J5HA 3F62A 5TE7L 4NQSB 3BWUF 5E23A 2IH8A 1S4IA 4YHOH 3ULUC 1LD9B 1K4DA 3EHBB 3JZ7A 4UT6H 1HINH 3IJEA 2D73A 3U2IA 3IYLW 4HIQA 4QHPA 5DYOB 4P23B 1F2XK 1Z9OA 1Q4NX 2OR8A 1A9BB 3KNBA 4KI1A 4MDJA 3K72B 5DK0B 3Q2VA 4I5BA 4XN2A 1NAML 5EOCH 2XNAA 3O8XD 3MJ9A 3T0EB 1LE9A 2BXZA 3V6FB 4PLNC 1FFRA 1MCWM 4AM0Q 4AYBA 3VD1A 2GQHA 5AVTB 4HJEA 3DKHA 4ZAKA 1NC4D 1JZ6A 5FO7B 4XN7A 1E5UI 5AW9B 3BO8B 4AQ8C 5KANG 2X4RB 2AFNA 4X7TA 4R84A 1NDGA 5DTFB 1A6WL 1CE6B 5I73B 4Z18A 4JFWA 3KVPA 4JW3A 2H0EA 5GISH 4CRPA 1E7VA 3EGXB 4R2GB 4G3YH 1VFAB 3FSWA 3QUZA 1TMCB 1XGYL 1G5GA 3QR2A 4GINA 4RAUA 5HYIA 2CU9A 2DDQH 2KL6A 2Y36H 5B39G 1CGYA 4XNMA 4ZXBC 3S5ZA 3DK2A 2MNWA 2W94A 5AAWA 1P69B 2B77A 4X5WB 3QIWC 3WIIH 2V37A 5D1XC 1E65A 2K9FB 1HHHA 2AXFB 1HH9A 5MEQA 3V0IA 1ZTXE 1GYUA 5B7MA 3A67L 4W9CC 4AQZA 4QDGA 1HCZA 3GNMH 2GT9A 1KB5A 3OKMB 1OAQL 5D5MA 4HKJA 4DTGL 5IF0A 2OK0H 1SDYA 2XYCA 2GSIB 1GYWA 2BIMA 5FC9A 2J3SA 1AXIB 2BVQA 2I26N 3FTSA 3NFNB 5I8OH 1WC7A 1QLRB 3VGEA 2AJUL 4JM4H 3QCVH 2QKIB 3WE6B 1HWGB 2VTFA 5LG1A 4P2OD 3RPIA 1H5BC 3FQNB 4P5MB 2R0KL 3ARSA 1VACB 2NNFA 2XXGA 2FWLB 3R0NA 2W9DL 4NPKA 2XA3A 1UD8A 3GMPB 4JDEB 1U3ZA 2HPTA 4AZUA 2F54A 5CGYD 4FJYA 1T1XA 3D0LB 3LRSA 4CILA 5BZDB 2COQA 3M1BA 3EJUA 4G9DB 1JVOA 4Z8FL 4DW2L 4PJEE 1OPGH 3STZA 5BS0E 4HULB 1KIPB 3MNZA 3CX5K 1GGBH 1ZS8B 3FO1A 4GXVL 1G7PA 3T08A 1LD9A 2DMKA 1XEUA 3P4OB 3Q44A 5CO1A 4YPJA 3V7AE 5IQ9B 5ISZD 3EAKA 2EDDA 4XVSH 4XAKE 1FVDB 3DUSA 4S11A 5DYOA 4P23A 1MI5D 2F19H 3VA2C 4IBVA 2B14A 3L3JA 3ZJAA 4BFKA 4JDTL 1U3HD 1LLAA 1DQML 3V6FA 2CA4A 2DJMA 1X5KA 1OP5H 3L4ZA 4BK5A 3FB8B 2Z93B 5DI8A 4RGNB 5F0PB 5FO7A 1NOAA 5M7QA 2G60L 3BO8A 5AKSA 4ZAKB 1CBJA 2BVUA 3EUUA 4BGLA 4XXCA 1G4MA 3D06A 5DTFA 4BWUA 1CDBA 2XZAL 1CE6A 2F1EA 1A7OH 3B2VL 3QG6B 3P0GB 4LLQB 5JIHA 5E6SB 2AVFA 2R2EA 3DO3A 3EGXA 2YA1A 4HF5L 5FO2A 5E8NA 3HI5H 1VFAA 4KTGA 3TBYB 3VACA 5KBMA 4Z7WE 5ECGA 1FL3A 1PAMA 1CDIA 2EYRB 2NTFB 2CHDA 2P7TB 5ISZA 2GTWA 4P3DB 3MLTA 3TPUB 5I18L 1W8OA 2VR9A 3KH4A 2D0GA 3OPUA 4POYA 3QHTC 1KYFA 4M7KH 4ODWB 4QRRD 5GIRA 3W5NA 2FJFB 2FNWA 2AXFA 1U3HA 1BXAA 1DDTA 1KBPA 5I8KH 4W9HC 4W6WB 2H1XA 3BKJL 2VDLL 3EW3B 4DK6A 1A14L 4GAAA 2PW2A 2H2PD 3KL5A 4N25A 5SX5K 2ZAIA 1W0WB 3GBLA 4YFDB 3FQ1A 1MEXL 3FMGL 3HEIB 3NFNA 9PCYA 5C3TA 4ZFGH 1XR8B 4IOFD 1PZDA 4PJ8B 2QKIA 3WE6A 4P9HH 3MLSH 2E7DA 3BH8A 1Y7VA 1IC4H 2ZP9A 1VACA 3NJHA 5EH1A 4L8SA 4OF6A 2QR0B 3DTXA 1LO3H 3GMPA 2R1YB 1FORL 4JFFB 3U2SA 2HRHA 4KDWA 2H9GB 2WLJA 4XPTH 1I9JL 2BOBB 2VUYA 4RMQA 4Z3IA 4LBEB 4RWHA 4QRRA 4DO5A 1UYWL 4LAJH 3W37A 1KIPA 4KI5C 1ZS8A 5DC2A 4E5XA 3B7RL 2E4TA 3P4OA 2J2ZB 4XMKL 5AW2B 5IQ9A 1R46A 4TNWK 1FVDA 3AM8C 2KHAA 1VENA 2D2OA 4LNRB 3D18A 1JF5A 5KS9E 1DFBL 3VVVA 2NT0A 5I1GL 1RZIA 1QR1B 4EN2A 1QBBA 3ZTJG 2NDFA 5GZNA 2I32A 4HZLB 1FNLA 2P49B 4NWTL 2DQFA 3HZYB 3FB8A 2Z93A 1Q8MA 5E8PB 1KIQB 3VAEA 5AB1A 1OTTD 4XMWA 1AD0A 2EE9A 2EIEA 4YLCA 1NMCB 4UBDD 3MRLA 5IUCA 2BCMA 3FT4A 3QG6A 4UNUA 1MFAH 3HNVH 1RK1A 2JK5B 4LSTH 4TSCL 3SZKC 5DZAA 4MRBA 3MODL 4HS3A 1G9MC 3RWCB 5IIEB 1OWRM 4MJ2A 3QZMA 4ZNEE 4IU3B 2EYRA 2NTFA 2P7TA 2YUVA 3UPCA 4GRWB 3RL1B 3TPUA 4AVKA 2AF2A 2DBLL 1IGYB 5DFVC 5HDQH 2VXVH 2EDJA 2GJJA 2FJGB 4ODWA 2UZIL 3KCWA 5L4FA 1X9UA 4JFVA 1Q1PA 5LN8A 5DEFA 2YBRA 4UT9H 4YZFF 4LQ1A 5DMKB 5CLYA 1QLFA 1WZAA 2FECI 4Z7QB 4KX7A 1S5IL 2WNGA 3VFNB 1MFEL 1AO7B 1W0WA 1WIUA 4WI2A 3TBWB 4F8TA 3EFFA 5L9DL 4L0YA 4OF7A 1WD8A 3PQYB 4FABH 3KS0J 4ZMVA 3RWIA 2BWIA 2VQUA 1XR9B 1KB5L 2NX5A 4NZFA 1NCOA 2Y5EA 4XCYA 4OLZH 5DUJA 1AY1L 1Q0XL 4JFFA 5E6UB 5CGMA 5KYWB 2R9HC 1Y1DA 3PFUA 1XF2B 4M6ML 1D5ZB 2BOBA 5IW1B 2PPFA 1A6ZA 1B9KA 4M7LH 3EYSL 1SYSA 2IDFA 2FBOJ 3I84A 1JOIA 1P5UC 4NO0B 4RMWA 5ALCH 2PWDA 1JZ5A 3U48A 4E41E 2R59A 5DD3H 3TZVA 2RB8A 3DJSA 4QD2E 1TJIL 4PCKA 3W9DB 1QR1A 3GXDA 4DKEL 4ZS6D 3RFZB 5AKTA 5KANI 4ERSH 1CS6A 3T0XA 3BWUC 4F7TB 2OZNA 4TUOA 3MTXA 4X42A 3EO0B 3IE4A 4PYHA 1F0LA 4WIQA 1X4XA 4BINA 4W4OC 3BT2L 3D9AH 3U4AA 5E8PA 3O2DA 2OV0A 3CSGA 1ZHBB 1A6AB 1YMMB 3CLEL 4FNLL 3SGDH 4XNQA 4WO4B 2VN3A 3UZVB 4KY2A 3QCTH 1VERA 3ULVD 2H2SD 2J6EA 4YWGL 3K6OA 2JK5A 1EAPB 4KY1L 3T65A 3NH7L 4HXBL 2PCYA 3OVUB 4PRIB 3RWCA 1JFQH 5E51A 4R9HA 4IU3A 2VQ4A 4EEEA 2DQUH 3KYKH 4LVHC 4PLJC 5F88B 1N3NA 5CSGA 4W1TA 1IAIM 3IFPB 3U7AA 1XF5B 3QHZL 5EUOE 1ZVHA 4M61B 1LO0H 4OJCA 4PTTB 3TJEH 5LAXA 3I6KA 1JZ4A 1Z9PA 5GS3A 1K85A 1YDPA 2EDKA 5F7MC 2JWYA 1PG7X 4HSCX 4YDKH 1QBAA 3VDBA 1CF8H 1YNLH 1AJ7H 2IQ9L 5L6YL 1U8LB 3IGUA 4U0RC 4Y1AB 2O61A 4ELMA 2V9TA 3RVXD 3ARZA 3PGFL 5HVWA 5I1KH 3GM8A 3TBWA 4OIIL 1PLGH 3H3BC 4HBCL 5D71L 4L2YA 1NCBL 1A6VL 2VDQB 4J8RB 3RA7L 3RWEA 1MLCB 5E9DB 2G9KA 4NRZB 4ENED 1XR9A 2JI1A 4NZDA 2XTJD 4PJDB 5LHDA 4R7XA 1R17A 2P5PA 4OZFH 5EEZA 5AQ0A 4LT7A 2Y2TA 4LHUA 5KYWA 1GOHA 4GAJH 2OCJA 4TUKH 3OZ9H 4KKCC 4LU5L 3UEZA 4AV5A 1CQKA 1XF2A 1MWAB 1D5ZA 5IW1A 1YN7B 5TQ2H 5AW0B 3FQRA 5KYXB 4MD0B 1U8CB 3K6FA 5ITBL 4JG1L 5KSBB 1NIBA 3VFRB 4K3HA 5K9OB 3RWFB 3TA3C 3ZSTA 1HE7A 5GRZA 2EE2A 2XN9B 4EMZA 4XOAA 1RXLA 1FYHB 3AG3B 5CLTA 3PP3K 3NA9L 3WFZA 5L0QC 1N59B 2YMXH 3OF6D 3SD5A 3MRNB 4TUUA 1DVFD 4M5ZH 1WVZA 2OTPA 1YEKH 4F7PA 3RFZA 4ONHB 1U2HA 4BQ6A 1YMHA 2HUHA 3NIGB 4IIQB 3FQ4A 4XPAL 15C8H 4F7TA 3W5MA 1W2KT 3ARBB 3EO0A 2A4EA 4OCRH 3QDGE 1UFGA 3T1FB 4BA8A 3QJFB 3MLWH 2AJXL 1A6UL 2EECA 3HKZA 1K3IA 2APWA 5IBUG 3MLZH 3VNZA 1OV8A 3ETBJ 3QHFH 4HS8L 4NN5B 4WO4A 4WHTA 4WWOA 4F8QA 3JWDC 4PLKD 2F5AH 1AGCB 1Y18A 5CHNB 1H19A 4XCEB 5KSAB 3BAWA 3QCUH 5E94A 1EAPA 4L4VD 1QWHA 3GD1C 4RH4A 4XI5D 3BI9X 4PRIA 3NVQA 5I6XB 4W9ZA 1L5GB 4OZGB 1VESA 5FHBH 2AGJH 2LAAA 5F88A 4G8AC 3IFPA 1ZTXH 2XBDA 1UOVA 4M61A 2Y23A 1DVFA 1CQYA 1JV2B 3PUCA 3NSXA 2HJFB 4XPBH 3DX2A 3QUYB 4ZZKA 1VGEH 2YGNA 3HAEA 1DL7H 5FPIA 1RKRA 4XN1A 4P46B 1L0YA 4Y1AA 3IDIA 1Q38A 1YEHL 1SYVB 4MMXA 3MOAH 2FGZA 1RZJL 1BM3L 4PWGA 3V52L 2NY7H 4J8RA 2Y7OA 1KN2H 2VE6B 3PWLA 5F9DC 5F7HA 5L2KE 1YQVH 1AGDA 5E9DA 4QRQA 1SJHB 3NZHH 1Q94A 2WUCL 4PJDA 3FCGA 2D31A 2N59A 4HK3J 1YEFH 3FOLB 3BKCL 1V7MH 1KJ2B 4NYLA 3SJVB 3RY6A 2AVGA 3TYFB 4M43L 1YN7A 1V54B 3E1F1 2J44A 3L6FA 4JGMA 4IBWA 3H9SD 4Q7DA 4DEWA 1CD1B 4OV5B 3VFRA 3ZDYF 5K9OA 4JFOB 1U8JB 1HDMA 1B2YA 2UVEA 4ETYA 2JFCA 4TQ8A 1MFUA 1JDCA 2XN9A 1DO5A 3ARDB 2D3JA 1FV1B 4E42A 3MA9L 2IBGA 3WJLA 2FWSA 3AU0A 4O9HL 1NMBL 3CVDA 4JPWH 1CDYA 4AMWA 1T5WA 1N59A 1UOLA 3MRNA 2F0CA 1JPSH 1MVUA 4KZEH 1FFNA 4ONHA 1F41A 5CUSL 4GUCA 1AH1A 3QFJE 2R0WL 3VXQB 5JIPA 3ARBA 5A16A 1WV7T 2X9ZA 5FEBA 2JE8A 1JZ3A 2IPTH 1T1ZB 3T1FA 5IJKA 3QJFA 4YDMA 3AY4A 3R0MA 4E0RB 3CVHH 2PR9A 3KAAA 1S7SB 2Y7SA 4J3WA 4XC3L 4HOWA 2VDPL 5CHNA 1YUKB 1KELL 5I6KA 5KSAA 1JZ8A 1NBVH 2V8LA 5E7BA 2CRIA 1J0ZA 1D7DA 1A0QL 1DQQA 3LN9A 3ZLQC 1MFBH 3K8KA 3BCDA 1PS3A 3IJ8A 1KENH 4PJ7E 7PAZA 2OTUA 4Z95H 1ET7A 4Y1SA 1SEQH 3T3PB 2VDRL 1S7VA 3CNKA 4AGPA 1JV2A 4LASL 4GO9A 4TPRL 4X5LA 3NCBB 2Y4SA 2R0ZH 4JPKL 3V55A 3CHOA 2BVOB 3M88A 2H26B 1IAIH 1O7DE 3D12B 5BV7B 1JPEA 1KFAL 4C4UA 4DN3H 2FDBP 4QTHB 1RULL 2BP0B 1XWVA 2C9SA 1YN6A 2ZJSH 2CKBB 4KVCL 3OAYK 2VE6A 4LEEA 1IRAY 2CHXA 1NAKH 1HL9A 2WO3B 1ZGLB 2ADJA 1X5XA 2PABA 4IM8A 1U0QA 1ZY9A 1E5ZA 4CSTA 4RGOH 1N0XL 4DCQB 3NSDA 3SJVA 1WWCA 3BIKA 3CFKA 3ULVL 2YXFA 2ZWLT 4NJ9H 3SY0B 4N0CC 4QOKE 4YGVB 2X89A 2A6DB 2EABA 3BYTA 1CD1A 4K07A 1JF1B 5JR1L 1GZPB 4WW1B 3S3PA 2AXWA 4EVNB 2IH3A 4XO4A 4Y8DC 5HY9B 3ARDA 3U0TA 1XDTT 5DA0B 4JMNA 4C56E 2D3NA 3FU0A 3MRQB 1ZLUK 2VDOH 1T4KB 4OUUB 4J39A 3BAJA 4LLWA 2ZUTA 2CUAA 4IBZA 1T3FA 2VDNH 3O4OC 4LPVA 1S9VB 4QJ5B 1XAKA 1PQZA 4NM4H 5E4EB 5SWZB 1OQXA 4BSJA 1JI2A 4HJJL 3DHMA 1QFHA 2AJYH 3VXQA 5T33H 2DQHL 4S0SD 4WDIB 3ECQA 2HT3C 4GT7A 4Y89A 4J3XA 5HHXL 2AJVH 1RHFA 2N7SA 3E9TA 4E0RA 2X1PA 5C3IA 4K55A 3B56A 3GLZA 1RUPL 2F15A 1ECYA 1BFTA 1E2WA 4G43B 4Z3TA 4QTIL 2BNRD 3LN5A 4FNPA 5IEHB 4KH9A 1INDH 1E4HA 1L9PA 4GI8A 1E7UA 4JG0L 3VXOB 2DQIH 2QVTA 3BKYL 3QE5A 4PGEA 2KBGA 1OTSC 1OOWA 1QSVA 2D0FA 2MQGA 3OMZA 5C0RL 2CJ3A 3WTVA 3FT2A 5B39B 4HPYH 5SX4I 4GSQA 1TYEB 2NY0B 2NNAA 3LMJL 4KO5A 1BECA 5DS1A 2AJ3B 3VH8A 4JVUA 1TZHA 4FLOA 2NY2C 2BVOA 1HL4A 1QSED 1ZA3B 1BCIA 1Z2KA 3BAXA 2H26A 4MX7B 2DQJL 3T4AC 1TZIB 2BP0A 3BZ4A 3VFGH 4OBSA 1UACH 1RUQL 4WWKB 4LBAA 2X3AA 2CKBA 1T03L 4QXVA 4CVUA 1GRWA 4BZ2H 4DSYA 1XGRB 4LDEB 3IJYB 2R4SL 4M7JH 4MQXC 1CR9H 4HKZB 1RIHL 3NJJA 1NFIB 4HHAB 3ZSSA 2GJPA 4HA1A 4O51A 4DCQA 4PGDA 2UXVA 1KCRL 1PD6A 5D1ZB 4XPGL 3SY0A 4YGVA 2A6DA 1WISA 3L5WB 5D7EA 3U82B 4BGDA 1PJWA 2WWKT 4N90D 4B5EA 3Q6GL 4OM1H 1LEIB 1GZPA 2PPEA 4EVNA 4I1PA 2PWEA 4XNYL 1HIMH 2YARA 1AR2A 2ALAA 1NCAH 2ETWA 4AGMA 1LDPL 5CEYA 4ADJA 3QZWG 3INOA 3I50H 4GEIA 4OT1L 4PJ6A 3OB8A 3WE1A 5B3JF 5JA9A 1T4KA 1XZ0A 4ODTH 4ZMQA 1TXKA 4J3OH 1S9VA 3OPZH 3PJLA 3QI9D 3FULA 5SWZA 2WBWB 5DK2A 1O7SA 4EUPB 3S3JA 4NCC1 3Q1SH 2VERA 2AK4D 3HE7B 4NQDB 4Q2ZA 3ZIMA 2CHZA 3KLQA 1C9SA 1I75A 1UH3A 5CM1A 5I1LB 4DK3A 4KJWC 4YHKL 2BOCB 2VDMB 2RH0A 3H55A 1A3QA 3AADB 3GSXB 3NRFA 3FSAA 1MCOH 2BY0A 4G59C 5FOBB 1TEGA 3E7JA 1I3RA 5HJGA 3P0VL 1TLKA 2C4FU 5K59F 2K3TA 4PJHF 5IEHA 2GYSA 2J8UF 3BFWA 3D48R 3HI6L 4U7KA 1IJNA 2DS4A 2KDGA 1BQLL 1HEZA 2WQVA 4KXZH 1UFUA 3FU9A 3K6IA 2WQRA 4B0MB 3S5LB 3PY9A 4OIBA 3WUZA 1AIZA 4HIXH 5B39A 1LVEA 4MKMA 1AHMA 2IGTA 2GTQA 2AQPA 5FYJD 1CFVL 3FQUA 5H37H 1RQ5A 4HJ0C 5F1NA 4AE1A 5D7KE 1KXHA 2QLYA 1XGUA 1CYXA 2JCCF 4WEBL 5T3XH 1J5CA 2AJ3A 2AK4A 5HDBE 2Z6FA 2C1PA 3SDAD 3AG2B 1BLIA 1NKOA 1WBZA 3CDGB 4JS7A 3VB8A 2ZKHL 2WNKA 4KVNL 2PPDA 3EIFA 1DLFL 4F8NA 3TO4B 3NTCL 1KNOA 1TZIA 2NNXA 5IHLB 3V4LA 1PAZA 4BH8B 4PB9H 2OL3L 1IB5A 2V7HB 3J07A 2HT4C 4WWKA 3BUTA 2N7BA 1CFMA 4G7SB 2XXFA 3OAUH 4ZRGA 3BUPA 1XGRA 3U6RB 3IJYA 2TRHA 2JI2A 1G9NC 4BFFA 4M8QB 4HKZA 4Y5VB 2YD9A 1Y1UA 4HHAA 4KKNA 1J9CT 1QOKA 1S9WB 4N2MA 3H2WA 4TRPL 1PBYA 4HIEB 3MRIB 2IG2L 1NGYB 3GPEA 1NWOA 4W9FC 5DHVA 2AEIT 3W11D 1S46A 1OSYA 1XD1A 3SDAA 2W0FB 4PRPD 1UCBH 2B1HL 2FGWL 2WYTA 3H0TA 3HR5B 4OCMC 5EORL 2EC8A 3T8MA 1ZCRA 1B2WH 1OAKL 4PN6A 3O9WC 1BVNT 1J8HD 3TFBA 4H0LC 4H1LB 1ZIAA 3QWNA 1BGXL 1XIWB 1KGXA 4Q6IB 3DXAD 5JORA 3U30B 1RUMH 2GBAA 5DQDL 4DUXA 1GZHA 4U1JA 3PWUB 1FC2D 3GHEH 2R83A 4JM2D 4XB8A 4D0CB 5DC0A 3AFLA 4XP9H 2DYRB 1TKWB 5CR8A 3T3ME 5KN5B 4CC1A 1MCCA 4XCNB 1KTDB 1TZGH 2QQLH 3PHOA 4GUPA 5FOBA 4MJID 4BUHA 3RZWA 4FJZA 3VGAB 2ZWKA 3H56A 5C0AE 1OP3K 3MGOB 3PYCA 1YEGH 3CLWA 1Z3RA 3MUJA 5GJSL 4F7CB 1MCPH 3QC6X 2CH8A 5EUKB 2F9BT 3NCWA 2XVKA 4P4KD 3ZE2B 4L37B 5TF0A 4N5UA 3RU8H 5AYQA 5IHBA 4ATWA 1AOHA 3KWWB 4OKVB 5ES4B 3TXAA 1U21A 3IFOA 5DHYB 1I3GL 5L88L 3DXAA 4JLRB 3RWEB 2ATPB 5JLZB 5TF1H 1PG7W 5FS5A 3TN0B 4YQXH 1PKQB 2NQCA 5E2TL 2XZCH 2XYBA 4JM2A 3VI4F 5AOJA 4ZUSB 5K39A 3TO4A 5HYQB 4YHLL 1QG3A 3QUMH 2WVTA 2X1QA 3VWKD 4Z78B 2V7HA 3G6JE 4H20H 4K3DH 2FATH 4MJIA 3ARED 1OWWA 3DV6A 3ROOA 5B4MC 4G9FD 4YBQD 2IWEA 3SBRA 1I1YB 2EE0A 1J1XH 4G6KL 3SBWC 4ZOEA 3U1SH 1WFNA 2Z8WC 2XG5A 5E1IA 1MRCH 1ZT7B 2RR3A 3BLBA 4FXGB 4M8QA 5C0ND 4ADIA 1I85A 5KBLA 2QBWA 3MI6A 4FLRA 1CLYL 4GW5B 1MNUL 4RIRB 1S9WA 3H1ZA 1KTRL 1L6ZA 1WO2A 3QDHA 4HIEA 1NGYA 4S1SL 2FECL 4U33A 5HYSB 1GHFL 3BUYA 5D7JC 3ZUNC 1SGKA 5CKAA 3DROB 3CIAA 5EBMB 2J1XA 2W0FA 1N6VA 3CVIL 3L4WA 3UTPE 5GZOD 1N9PA 3V4PH 4URTB 4HVBA 3N43B 2XV6B 3UTOA 4YSEA 5A6LA 2VLJE 3TS8A 4EPSA 2NY6B 4G6FB 3VWKA 1LEGB 5EEXA 1XIWA 1DTUA 1MJUH 3FUMA 4Q6IA 3JV6A 5DURD 5IY5B 3NEOA 1D5IL 1LO2L 2UZXB 4HG4J 4NZTL 4YC2C 5E1GA 3K5RA 4D0CA 1ZXKA 2IJ0C 3LYRA 3NRPA 4O5LH 1TKWA 4MAYB 5KN5A 2RMNA 3GXNA 3JT0A 3EOYG 1KTDA 3LZLA 2IAMD 4JFQA 4HWNA 4F8OA 3MGOA 3DX9B 3WSQH 4QPEA 5JTWA 2VN6A 1K4CA 5C0IA 2PP8A 3TFKD 1ZPUA 1R3IH 5GZOA 5SWSE 1BAFL 2AP2A 1OO2A 3ZR5A 4YXKH 4F7CA 5KVFL 5EUKA 3T0DA 5DJ2B 5BRQA 5AW4B 4EXKA 3O2WL 1XBDA 2OPCA 4X4YB 5A7BA 1OB0A 2V0AA 5MENB 3H9YA 3F85A 5JLZA 4HT1H 1MZYA 2AABH 2NY4D 3QDMD 1PYWA 3GIZL 5JA8B 3TN0A 2CXKA 4ZD3H 2DTSA 1NDMB 1F4WL 5DU7A 3GBNH 4ZUSA 1MNNA 4NAQA 4PJFA 5HYQA 1CK0H 5DRNB 4EQ2A 4NNYB 4OGXH 1JZIA 1UM4H 1SN5A 4WFGD 2QHRL 3GZKA 2AEQL 1PL3A 2IAMA 2LFGA 1K6QL 4GFTB 4OSUL 2GITB 3FU8A 5I1DA 4A2DA 2D9CA 2YHGA 1BYNA 2WLZA 1NCIA 3MCLL 1K5NA 4GEJA 4N26A 5E8OB 4JKPL 4K15A 4GW5A 1FCCA 2CO6B 3FTZA 3EO1A 1EFQA 4RIRA 4UTBL 3WN6A 1Y6MR 3ZTDC 2PO6B 2W0PA 1BOGB 1ZSHA 4G7YL 4X5XB 1MRDL 4XCCL 2JJSA 4O2FB 3IGAA 3WO4B 5I8EB 2AQQA 1XQ4A 4IJTA 1AC0A 3GJFK 1UG9A 3ZDWA 2VZ1A 1AHWB 2BHZA 3FO0H 4JFHE 3SQBB 3VWJD 5CD5D 3ZKQD 1E4XI 1KLFB 2UXGA 4EN3D 1GS6X 1XGQB 5FYJL 5IVXE 2ADGB 2QV4A 3TIEA 1ZJBA 2A9NH 2P9RA 1V7NL 2UZXA 2F54E 5DJ6B 2KDYA 2Z31D 1U8QA 5DR5H 1CXIA 3WTUA 4JRYB 1EV2E 1OCCB 1RZKC 3KLAB 5ESAB 2BP8B 2FE0A 5IBUB 3Q05A 2PPAA 3B9KC 1FYTD 2W9EL 2IMMA 3KGTA 4JG5A 6FABH 3DVFA 3ZHKA 4FKHA 2UX6A 3AROA 3NA4A 1JUFB 1BD2D 4QXGL 4RNRB 3MLYL 5EN3A 4HAGA 3SDDD 4KOCA 4JDVB 4MNQB 1Z9SA 3MV11 4Y7MA 1WJ3A 3T0EE 5DJ2A 4EN3A 3SD2A 4YXHH 3U2JA 2YLHA 5A2LH 3NQKA 4X4YA 2OZ4L 1Q9WB 2P28B 2G9HB 2N56A 3KPQA 4OLXH 4RRPG 5C0FB 1VCBC 5MENA 3BGFC 3HG1B 2W92A 5DVMA 5C9JB 5I6NA 2VXUH 2AI0H 4B41A 4TN9A 4AVHA 1VEOA 3BPNC 1XEDA 3NFSL 1D9KC 1ZWIA 5DQ9B 1THCA 1QFPA 1JGLL 1FNAA 5DRNA 5C6WH 4OY9A 2UY7B 4JCMA 3N9GL 2V2WB 1SQMA 1FYTA 3AQDA 4Z0BH 1CYGA 4IBQA 3WNPA 1WWWX 5JOFB 5T1DL 4MXWL 4NQEA 1P4BH 3ZT6A 2BWQA 4PCSA 3BP4B 5DK3A 4ZUWB 1JD9A 2DMGA 4RFEB 4RWYL 3L9YA 3X2QB 1XO8A 3FQTA 5BZZA 2V3DA 3KMDA 1BD2A 2XWJA 4HQQL 4M1CD 4KRPC 4KXDA 5J9PB 4RZKA 1U9KA 3PS6A 5E08L 4GRMA 3SDDA 5CEXA 1NIEA 3U0WH 2JKTM 2A38A 1W91A 1EHLL 5LXGH 3RDJA 3UJJL 4YDLB 4ABQA 2X9XA 3K71B 4TKWA 4LSVL 2MFNA 1F45A 2HP4A 3MV8D 1IC0A 3CX2A 1EFXB 2YQBA 4PJCF 2I25N 5E6IC 2NSXA 3RY4A 3SQBA 4NWUL 2BZDA 3VI3B 2OULB 2ATAA 2Y0SA 1KLFA 3A6CL 1MSPA 3ZRSA 5AENA 4TQEL 4FXKC 2GABA 3KL3A 3V8OA 5ICYB 5GS2D 1KB3A 2ADGA 5I6PA 3V4VH 3V0JA 1NL0H 5DJ6A 4D94A 2YD5A 3QJXA 1AI1L 4K9EL 2WAHA 4HGMA 4G8EB 2IF7A 5ESAA 4RETB 2BP8A 1WSST 3L7EA 1H3WM 3WKPA 4P9ML 5J57B 2BFVL 4KMLB 5AVQB 5T5NG 4M48L 3RJOA 1M9SA 1TNMA 2NXYB 2APSA 1GZQB 2Z64C 1NBZB 3S5YA 1JUFA 4MNGA 4R4ND 2ADYA 2ICEA 3L5XL 2VITA 2HFGL 3TYGH 1NFDA 4P2CG 1KTCA 1G94A 4JDVA 5MHSE 4M1DL 4IKIA 3GWJA 2MQ0A 2ATKB 3HE6B 2ILLA 4X4ZA 1O6TA 3VFSB 5DLML 1CGTA 3H6JA 4XXDA 3S4SG 2G9HA 4H8QA 1NIFA 3HG1A 4RGNE 4GLRH 2QFPA 2WXHA 2EXYC 1MRFH 3LIZH 3TBBA 4I3SH 3DX0A 4B95C 3X1NA 5DQ9A 2YQGA 1EO5A 3TV8A 3GKWH 5IHUH 4MQ7B 3X14A 4XWGH 4AI7A 1UWYA 4JY5L 2VZSA 4YFLI 1WZMA 3CG8A 4ZUWA 1QVOA 2F7IA 3CH1B 3CLFL 4RFEA 3H42L 1ANUA 2Y6SD 3EFDL 3IDNA 4R5VA 3SB3A 4M5YH 1EJOH 2FX8L 5JO5B 5T1KD 2XSKA 4ZOAA 5EBLA 3VMOA 3BESR 2C3XA 4UQ2B 3TNMB 3ARUA 2OR9H 4HKBA 4U1LB 2WTRB 4RAHA 2FUTA 3B6SB 3K71A 3E2HB 1N5AA 1BVKA 2B4CL 3GRWL 4XP6H 1QFWI 4AT6A 1XH2A 2H45A 1BQ5A 3T0VA 3JWNE 3VI3A 3WGUB 3WEMA 3RB5A 1A2YB 3IJHB 3O6ML 4NBYB 3NUKA 5B8CB 2OMXA 1XB6A 2A6KB 4Z7OB 4AWJC 1C5CL 5D1XD 3UTTA 4A2GA 1LM8V 4W6YB 4QY8B 4M4RB 4JFFE 1P84J 4LLYA 1LK3H 1JHLL 2YFOA 1MFVA 3F05A 5TK4A 3C5JB 4IIZA 3FU5A 3F58L 2H32H 2NZ9C 2AJSL 3PIQB 4G8EA 5T1KA 4DP4X 1A5FL 3N41B 1PCXA 3MRRB 1G6VK 1YEIL 4C57C 2DQEL 3GBML 4JRWA 1CD9B 5EU6D 4G1MB 4KZDL 4DETA 1GZQA 1NBZA 5F7DA 2HRPH 4HOMA 1MZZA 1BVZA 3M8OH 1YNTA 2AXJA 4TNGA 1E5YA 3AU1B 1GGIH 3FF8A 3KGSA 5FGRA 4A2LA 4HUVA 1I4FB 1SN2A 3X13B 4E9RA 4JFDA 5ACMA 3FYIB 3VD9A 3HE6A 1T83A 3PWPD 1I1CA 4IRSD 4PTUA 4PD4J 1EH9A 1KDIA 3VFSA 1DFXA 1AS7A 3HJ0A 1U6AL 3LNEA 2B0SL 4MNHB 4JQIA 1H3PL 4XNUH 2H8PB 3I9PA 2UZYA 4Y16D 4FLHA 4IK7A 5J1AB 5JW5A 1HS6A 3HN3A 5GRUH 2WB1A 4LKXA 1SRDA 1TQVA 1EMTL 3QA3A 4M3JA 1IIIA 5I5MA 2G3MA 3BVUA 4MQ7A 3MV7B 5D2NC 1S7XB 4ZQKB 2B1AL 4WTZG 4ALAC 5LQBH 4H4NA 3O11B 3BEWA 4IJ3B 5ABAA 4GRWE 5F44A 5HP5A 4KUZH 3RWGA 4NRYA 4MCZA 1IILE 1IFHL 5BW7C 5JO5A 2A4CA 3IU3B 1QWNA 4EAEA 5IGXH 2MKLC 1LO5B 2BSTB 2VZVA 3GSOB 4U1SB 3PWPA 1T22B 3L5HA 3LKRA 2AJZB 2WTRA 4I88A 4NLHA 1XCWA 1LE5A 1AQDB 1VSCA 1T7XA 1MAMH 4Z7QE 3PABA 2PP9A 2NOYA 3JYBA 3GMMA 2RALA 4OI8A 4BKLB 1AO7E 3PG2A 4L1SA 4L3ED 5F7NC 4Z6AT 5CBEB 5HVHC 3ZYJA 1WS8A 4LQFH 4CGTA 3PQYE 3L1OL 3ILPA 1NCGA 3L3OA 3QZWB 3EF7A 3IJHA 2XWTA 5B38G 1IL1B 2DI7A 3DJ9A 5C09D 2UY6A 3GRGA 2P42B 1KPRB 4JRXD 4OJDH 4QY8A 4M4RA 1QYGH 4J5VA 3N2JA 3ZOAA 3RIFF 1I3UA 3AGVA 1TETL 3QO0B 1IVLA 3CZFB 3C5JA 5IEKB 1VZGA 1DQTA 3PIQA 4FXTA 3WHE1 5IFAH 3GUFA 4Y1TA 1TJXA 1R6VA 1NEPA 3BDXA 3L4TA 4I18B 3HS0C 5HGAB 3FTGB 1UB6B 4J27A 2BW4A 4UQCA 2F58L 4G1MA 1DE4B 4UU9A 1EEQA 1BQKA 4NZUL 4M00A 5GGSY 2VLKB 2O6EA 1JZFA 2Y1YA 2CRMA 3HC4L 4Z7VF 3AU1A 2JQMA 25C8H 4L3EA 3QDAA 5J89A 3FB6B 3X13A 1AR1B 1E4WL 2Y1ZA 3IFNL 3ROLA 2CLZB 4N2FA 4YHPB 3ILQD 4X6BB 2CDGB 5KJRL 4ZS7L 4JRXA 4MNHA 3U7YL 4JJOA 1FH2A 1MCNA 5J56B 1HAWA 5J1AA 1YMME 1CFTB 4F5CA 5IG7A 1O6SB 4DK5A 4N8VG 1FP5A 4PS7A 4U05A 3LJ3A 3TURA 3OJVC 3IU4H 5FDWB 4CBZA 5JQ6H 1ZPLA 5I1JL 2G4GA 4JBSA 2DQDH 4OTXL 3IJSB 4PRIE 1E8ZA 1MIEL 1RLWA 4ZQKA 5JHBA 4RSYA 2OW7A 4X6CB 3TVMB 4MS8D 4BYHA 2J4WH 2K70A 5AVXB 4BHUI 5F70A 4J4PC 1O9WA 3CDZB 1A22B 3BQUC 1UD5A 4GJTB 1FGNL 1FRGL 5CZXD 3WI9A 1LO5A 4QCIB 2YA2A 4AX3A 1MY7A 1A4JA 1FVCB 2X4SB 1G9NH 3IVKB 3OSVA 3WD5H 4Y1AE 1J9SA 5I1CL 3OR6A 2CLRB 5I6MA 2EDBA 3K2KA 3GXTA 5IQLA 4JO1L 1Z9LA 4DP6X 1RUKH 5D7LD 3UAJA 3BC9A 3BKML 4R96B 1RHHA 2NYZA 3QZWA 1H3TA 5E9DE 4QXWA 1UB5B 4N2KA 1Z32X 4PJDE 3Q7JA 3ULUL 4MRCA 1CDJA 2YOCA 1ZJAA 3F6LA 5C3LD 3MBEB 3VXSB 5A6MA 2IADA 2JB6A 4I0PC 1T66C 3VJ6B 3SDXF 1F6FB 2P52A 2W07B 4LXFA 1KTKE 3EJQA 3LEVH 5KSBE 4WY7H 1E3FA 3A0OA 4X80H 2UWEB 5HGAA 2Z9TA 4JHBA 5EZIH 2XN9E 5DJXB 4QGYA 5CWSB 5FYKU 1DE4A 4TQPA 5GSRB 1OT4A 3GI9L 2XHNA 3V0WH 4B9KC 3W81A 4Q9CA 2VLKA 1IEAB 1HHKB 1IEBB 5T8IA 4MA1C 2C3WA 3BAEL 4JB9L 2DIAA 3CPLB 3HMWH 3WTWA 3DRTB 5F71A 1UD6A 1H6EA 3PXLA 3QORA 1J88A 3FB6A 1DBMH 4U7SA 3QEGL 1TPXC 5AVZB 5AZUA 4GQ9L 2CLZA 3NIGE 5J6GB 4WCYH 3K6SA 3SKUD 5GRXG 2X4QA 1MJ8L 2CDGA 1SQ2N 1KJ3H 1ZIBA 4PB0L 1NA8A 1I1FB 1AVAA 2YRLA 4AMXA 4Y2DB 3T8XB 4AW4A 1DDHB 5I76B 4R97C 1O6SA 1XF3B 1YAIA 2DD8H 1M7DB 2Y7MA 4HBQA 2J88L 4F9LA 2EDYA 12E8L 2I27N 3CZLA 3ABLB 4BQ9A 5LKNA 4HD9A 1F3DH 2PXYD 5I66B 1VGKA 4F37F 2NY3D 3IJSA 4N2EA 1TTFA 5EEVA 4JQIL 2OMWB 4JZJA 3BDYL 3V8CA 4YUEL 4OZGE 1T04B 4WENB 4ICXA 5G55A 3IXTB 4JN2B 4PJ5D 3CDZA 1CU4H 2MOGA 4IBSA 4G6MH 4HLZH 4QRTB 5JPMA 4QCIA 4XBPB 4AQ1B 5JOPD 1WBYB 3T4YB 4LLMB 5TE6L 4H7VA 2CLRA 5JPNA 5KBPA 4NFDA 1R19A 3ETTA 5MEOB 4NP4H 4AC4A 4X6DB 3GMNB 2V7NA 2P8LA 4PJGB 4OZFG 4J6RL 2VC2B 3O2VL 5IM7B 2PXYA 2C9PA 1UB5A 1DHKA 2IWKA 3V0DA 1BJ1J 4MCNA 5AKRA 1EO8L 1EQWA 5I71C 2GY5A 4JN1H 1MDTA 2RA1A 3PNWB 3X1EA 1R0AH 3SJVE 4JFZH 3VXSA 3EXLA 4PIBA 2Y3AA 2WHVA 5EN2A 4PJBB 1LTXA 2C9VA 1PZCA 3VJ6A 3ARGD 4PUBH 3V0GA 3NSYA 4KQ4H 4LSUL 5C7XH 3OLEA 2CO4A 2E9IA 4EOWL 2FRGP 4XWOC 4YSQA 3F7QA 5GSRA 1MCQA 4GIOA 2PCPB 3OB0K 1IEAA 1A7NL 1IEBA 4G8IB 3UADA 4AVJA 1WWAX 3DK0A 5I19H 1JNNL 3DRTA 2R7EA 4KTDL 2IPUG 4CSSA 3NCYS 3QEHA 4W9LC 5HPOA 1UJ3B 3UYPB 5DZVA 5J6GA 3C6LD 2MOVA 1GJIA 4S1DD 3KPLB 2FLMA 2PCFB 3ETBF 3VRLF 4D3CH 2LT9A 1XSIA 1J1PL 2ZOKB 1KT2B 3DYPA 4U3XA 4YNYB 3WL9B 5IB3B 1I1FA 3U0PB 3OMNB 3RGBA 3TT3L 4Y2DA 3T8XA 1DDHA 1UWGH 2W81C 3IKCA 3ZKXB 1FPTH 4M03A 4X7FC 5FW8A 5JHDD 3WV0A 2XETA 1B0WA 2OJEB 1LP9A 4AG4H 2V5SA 4OLUL 4C47A 1YSOA 1EERB 2P3YA 1BVLB 3NDYE 3G5ZB 2OMWA 4MMZA 1FH5H 1M6OB 2ARJB 4XGZB 5LBSA 1T04A 5HHVL 4YE0A 2A9BA 2OI9C 2R0LH 4EKXA 3SCMB 5I2IB 1EGJH 3IXTA 4JN2A 3T3PE 3WFEH 5F97E 4HHWA 1A3LL 1M05A 3CK0H 3KM2A 1GAFH 1WBYA 3T4YA 2DB8A 4LRIC 4OLYL 5HPMB 2FJHB 2X6MA 3JWNH 4UTAA 4G80A 3P9MB 3KJ4B 2P5ED 4X6DA 4HETA 3NG5A 5CZRA 5EMYA 2XV2A 4WGKA 5JHDA 4RISL 2FX9H 2WXPA 4X5RA 3MBXL 1UUNA 5DRZA 5IM7A 4PV1C 1BFOB 3NIFB 5GGTL 4WI8A 4PJAB 3SGEI 1IC7H 1Z6JT 4P0DA