4F2HA

Structure of the minimal ste5 vwa domain subject to autoinhibition by the ste5 ph domain
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
191
structure length
191
Chain Sequence
STVDSIQSVLTTISSILSLKREKPDNLAIILQIDFTKLKEEDSLIVVYNSLKALTIKFARLQFCFVDRNNYVLDYGSVLHKIDSLDSISNLKSKSSSTQFSPIWLKNTLYPENIHEHLGIVAVSNSNMEAKKSILFQDYRCFTSFGRRRPNELKIKVGYLNVDYSDKIDELVEASSWTFVLETLCYSFGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational control of the Ste5 scaffold protein insulates against MAP kinase misactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Protein STE5
total genus 61
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12194 Ste5_C Protein kinase Fus3-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11070 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f2hA00
4F2HA 3FZEA
chains in the Genus database with same CATH superfamily
2GERA 2JLCA 3UEOA 4DUPA 3FETA 1MRSA 1RSZA 1VI6A 2CFTA 3MK31 4MWZA 1HE1C 1TIKA 5BQXA 5JY6A 2D06A 2O7RA 3GUZA 3HS3A 5BRJA 4MW5A 1O6CA 3U1TA 3B9BA 3AU9A 5CT4A 4FU0A 4Z0PA 5IYZA 2PL5A 1RAHA 4RTPA 2O2ZA 3DR3A 2I2BA 2ZIGA 1L5RA 2C5FA 3V2UA 3OKFA 2DU8A 2G63A 4J16C 5LD2C 4NAHA 1FMCA 1XZ8A 3JWJA 1QFXA 5BW8A 4TTVA 3TLBA 1VCNA 4LX8A 2PUVA 3EWSA 3LX5A 4EW6A 4Z49A 2FPWA 3G0GA 4QVGA 3COSA 4F2PA 1UDBA 5J4VA 4L7QA 5SY6A 1N57A 1PJAA 3AI3A 1FVXA 1FXSA 3N07A 4AJ1A 3V8VA 1B8UA 2C2KA 1Q0HA 2ZWMA 1L2TA 2W8BA 1NQUA 1WJGA 4MYTA 5KTYA 4AKGA 1E2UA 3U09A 2HPAA 4JA2A 2DXIA 1YK0A 1E9EA 2PZKA 4TTAA 1CY1A 2Y2UA 5DNYB 2Z3VA 2BFNA 3V7FA 1G5TA 1G8AA 5HE9A 1YFKA 2GD1O 1WD7A 4P54A 2VXBA 1OIXA 4KQGA 4QRDA 4GAEA 4XPZA 3RS5A 4I55A 4QQNA 3QKSA 2W4QA 2XMPA 2LDBA 3N87A 3CR7A 1TO6A 4BV8A 2CXTA 4EHDA 3LWDA 1YDHA 1E9VA 2OCIA 4HLUA 2WT8A 3DHNA 3IV6A 3UICA 2YVKA 5IVKA 4Q19A 4MW0A 4NVRA 1LBEA 1G3IA 4JENA 1VDZA 2VPWA 2Q41A 4HH1A 4JJZA 2HMWA 2PQ6A 5HZHA 2AJLI 1WLSA 3CLRD 4C7VA 5K2OA 4J9VA 1E1RA 5DGTA 1R64A 1JQ5A 2EGHA 4E33A 1TFUA 4IJKA 5CBPA 4NPHA 4WXPA 5BORA 4CF5A 1VSUA 1PWZA 5A5DA 4A0HA 4KXUA 3J7TA 1CVIA 1NATA 2AE2A 1QG0A 3WKBA 2ZYRA 2GETA 4OEHA 5A3QA 4LN1A 1CZHA 4QJ5A 3GNLA 2HQSA 4I99A 4EUNA 1L6IA 2BY4A 1JLKA 1Y7TA 2I66A 5DBFA 3K70B 3NHLA 2XUHA 1Z36A 2QPLA 1R9NA 2G09A 3OMLA 3ZE0B 3PSAA 5HMLA 5TVGA 4IJ6A 1BW9A 3LPDA 4Q4DA 1WKBA 1OI3A 4G5FA 4LDRA 3T7EA 4WIAA 3WSTA 2H5EA 3IOBA 4CFYA 3IP3A 2FW1A 4BVKA 2ERXA 1XNGA 1QH8B 2QGFA 1U8EA 5IX8A 1EHIA 1GRCA 1QR2A 2C4UA 2H63A 2MHCA 2R66A 2XUIA 2J07A 2XVMA 2YXNA 3BXFA 4TLAA 5IDVA 4YRFA 4GGOA 3BM5A 4FSDA 1D2AA 4ZVRA 5KREA 3I30X 1R4NA 3K9WA 3VISA 3I1IA 2VYND 1A0OA 1J2RA 4RHEA 1SVLA 1J2UA 3UTDA 5LWHA 5IJ9B 5EE0A 4QJ4A 2AKEA 4TSRA 4YEDA 2BSAA 2EHJA 2D2IA 1HGXA 4NPCA 3TSAA 1J1IA 1XNRB 2ODEA 5ITZB 4ZEMA 3OEYA 3MYYA 1O2DA 1Y80A 2G17A 1OWOA 3GFSA 5FI5A 4Q4HA 4YN3A 1GTL1 1A9SA 4Q3EA 1JKMA 1YHZA 2JCXA 3PNVA 2PGXA 2HF2A 1YHYA 4BE4A 2R68A 2X7HA 4LYJA 4D8WA 4DR5B 3WLSA 3TQRA 3MJFA 1BHO1 1T6NA 1U8FO 1U2SA 1FK8A 4R68A 2DGDA 1N6KA 4TL7A 3DMDA 1NUQA 2DE0X 2QJRA 2B6HA 3LX4A 4DV5B 1QPBA 4IG4A 3QMPA 3QVSA 1WCV1 4MIYA 5EZYB 1G20E 3M7IA 1O08A 4YRAA 1JDBB 3AIMA 3TIXB 2WJYA 3W3AD 4UM8B 2NQTA 4RFSA 1VPDA 1R6VA 4U4AA 4W4TA 2UVPB 3RU7A 6CHYA 3QK7A 2A2ZA 4Q47A 1J8VA 4ZI2A 2X2PA 3DBRA 3JARA 5I7SA 4MQ5A 2EEZA 1E2FA 2W2LD 2RFLA 3N5CA 4G36A 1PSDA 4JEMA 4KFRA 3TMYA 3H16A 1GN9A 3SQOA 3PVSA 2ZVJA 3O83A 5TR9A 1KYWA 4H6PA 4XVCA 2P2CA 1W34A 2YFYA 3L6BA 1KXZA 4B83A 3RW9A 3PNLA 4XD2A 2GVZC 2XODA 3KUKA 4PN7A 3CNBA 3KCQA 5HGJA 5KNDD 2OYSA 2HA2A 1SC9A 2OLEA 5ICMA 1FUUA 2VP4A 3FDXA 5CX1B 3WR5A 4CXMA 4R2XA 2WAOA 3KHKA 1CU1A 3GRUA 1MC4A 4L8LA 1MO4A 1S01A 3E8XA 5G02A 4BEBA 4AS1A 2RKBA 3GZTB 3T15A 1AQUA 5F23A 1KI7A 4PCAA 5CIYA 1E9RA 4TLMB 3ZY6A 1J7KA 3E2IA 4AWAA 5F9HA 5A7GA 5DNEA 3W5UA 4XIYA 2I4MA 2WAYA 3C6XA 5NULA 4F91B 1UFKA 2H9AA 3THSA 4OHBA 2PVSA 5BMVF 1HC7A 2LKDA 3CF6R 4DQXA 1OQAA 2Q8NA 5A5GA 1YTUA 3PJFA 5F2EA 1GY8A 1P39A 2B36A 3HO6A 5EXEA 5K2MA 3RUFA 3LIPA 4ZEVA 1JQBA 1G6Q1 2GN9A 3FUTA 4R84A 3AY3A 4P7FA 5CVCA 2JG3A 1YR7A 2Z8YM 3KSAC 2B2XA 4G56A 2X22A 1TZCA 3INGA 4ND4A 4MQFA 3X1KA 5ICCA 2FLWA 2DEUA 1RE0A 2LRHA 3QEMB 2HA7A 4BMCA 3DBHB 2RK6A 3QXSA 2PM8A 3S1SA 4KW7A 4MJLA 1B0AA 2GHIA 4XSHA 3I8OA 3U26A 3QF4A 1H3FA 3AM3A 3D5QA 1KIMA 1E0AA 5AM2A 5KWSA 3R5KA 2O5RA 4HV4A 1LPNA 4L73A 3UGKA 1A4RA 3C3JA 3RJTA 1ZH8A 4URZR 4A2CA 3NDBB 5F78A 4G41A 2VCYA 4LJKA 2V7VA 4P84A 5L4NA 3L7BA 3CN9A 1LF5A 2XMRA 3NCTA 1TJNA 1IHUA 1H1LA 1YCDA 1BXGB 1TI7A 2FPIB 2NXCA 1G17A 3FTNA 2WAAA 2IEGA 4HFMA 4IS3A 4Q12A 5T4FA 4EG6A 5A06A 2B8WA 4GMHA 1LK7A 1YB5A 4UDNA 2NYRA 5KSOA 2IUTA 2J3LA 1C7FA 3RB8A 1UPCA 4B7ZA 2J9FB 2E3JA 1NVXQ 4FGJA 3PXBA 4MRSA 1YQEA 2QMQA 4LRWA 3U81A 1CUVA 4HATA 2ZT6A 1W7AA 3KYIB 1YMVA 3RS2A 1VE3A 2J7PA 1FTGA 5AHOA 4CG1A 1AE1A 4K9QA 3W5AA 3I76A 3NMUF 3A4NA 2YS7A 5C4IA 1R3DA 4S1VA 1EAMA 4U5XA 4B46A 1R9GA 4BO2A 2XIJA 5DP2A 3GFPA 4OX9Y 3IT0A 3HXLA 4IXDA 1E0JA 1JFLA 4XD7A 1N3BA 5BY2A 2OBMA 3E8SA 5E4TA 3MQFA 1YFJA 3HWX1 1K5HA 3DWIA 1CIVA 4M86A 1IH8A 4RNCA 4TYPA 4X1YA 4KVZA 3LBFA 5DHRA 5JV5A 1QNLA 1E98A 2W2NA 3GW8A 4E5MA 2Q9UA 2JD2A 3VU0A 2AFHA 1JKIA 1GV1A 3O1IC 1EUCA 3IURA 1KA9H 5ELLA 4OI1A 4UVHA 3F5QA 5EESA 2PY6A 3B70A 2LBPA 5AWFC 1I6KA 1MJGA 3CUUA 1CD5A 3GA7A 3ONDA 3R8CA 5K01A 2DSTA 1FS6A 4PX5A 1KAMA 5EMJA 4GLJA 2GZ2A 3DV2A 1IBSA 3NBMA 4EQ6B 5IM4F 2EZTA 1BD4A 2Z9CA 3PR2B 5MN4A 5DLQC 1YASA 5FEUA 1ZWKA 1RBMA 2HB6A 1SWVA 1N2EA 4LDZA 2RHLA 3LC7O 3T3MB 4BFTA 1TLLA 3GA5A 4FYYA 5FF9A 5LQRA 4Z4GA 3ILXA 1KI6B 3CZRA 3OPYA 1MOQA 1H0KA 1KH3A 4CM1A 4KR2A 3LQYA 3JD3A 4UHBA 1X87A 2QL9A 3EK2A 1XTZA 2BOVA 3GGJA 2C2ZA 5JTUA 2P2ZA 3AV0B 4LJ8A 3HBNA 2HRDA 1V5IA 3WQHA 3OQNA 1VECA 2UVPA 1I01A 3FBGA 1PT9A 5HDQA 3KHTA 4QVKA 4J2OA 1BCRA 3EXAA 1SJ9A 4P98A 4D42A 3F74A 1N2CA 1GUFA 4LYDA 4G9GA 3AUKA 4U2DA 3P2YA 3FXAA 3ZTWA 4OLBA 5I8ZA 2QUAA 5K3FA 3SN6A 1ADBA 1C3LA 1F2UB 2ANBA 4P9NA 1QE5A 2F3SA 5K0SA 1ESDA 4R9RA 5FORA 2O8EA 4HJXA 4FOLA 1M5TA 4QLAA 1CR0A 4AW9A 4ZT4A 3ZDBA 5BMOA 1I2MA 3TUIC 3Q10A 5FAXA 2HJ9A 1WSWA 2H48A 1BKDR 1C41A 2FR0A 3K09C 3OUTA 1Z26A 5DWVA 4LDAA 3PWKA 4TXLA 3DFMA 1W8DA 4ETWA 1RR6A 1RQ2A 3GGCA 2AB0A 2PRYA 3O8OB 3OF3A 4IV5A 1RRVA 3L6CA 3KJQA 4KYVA 4WINA 1KWKA 1PGOA 1XWFA 1EAYA 2L19A 2PIAA 4IIDA 4U7HA 3WKAA 1JG3A 3REFA 2HJRA 5TLSA 5KU7A 1QHGA 1XRQA 3QI2A 3SZ3A 1DO0A 2QP3A 4MLPA 4P4SA 4MUKA 4KRXA 4CN8A 1RIFA 1YOVB 1V9SA 5LP1A 2QLTA 4AJNA 1J9EA 2OVFA 1H22A 1I2DA 3UATA 4MUEA 3VDMA 1H6BA 5AW3A 4TYWA 2UUCB 2YOGA 4F2WA 2ODWA 1I32A 1CP3A 1HT0A 3UYLA 1GQFA 1YZLA 1EIZA 4H0NA 2JFUA 1D03A 3JALB 4KGXA 3KZCA 1LK5A 3VVMA 1GNQA 3CH5A 1PJCA 1YS7A 3OFND 1C1DB 1MJFA 3RVJA 2ISSD 4MVJE 2XTZA 1HT2E 3W4IA 1JDBC 2P9YA 3O5AA 2LCIA 3VSDA 2P27A 3IMGA 4RETA 2WNSA 3KKNA 2QZPA 1JB9A 1QONA 3DHYA 2V0NA 4DCMA 1SUPA 1B76A 4RKFA 3B7WA 3DW3X 4TLCA 3K3PA 2JJ1A 4LRXA 5BN5A 3ZZUA 4R5HA 4G2TA 4IOJA 4W1PA 1I3CA 3AVUA 3CH7A 3EXG1 3UXMA 1DU4A 2QB5A 2HJGA 3RQIA 2XI4A 3Q3VA 1T4BA 3GC6A 2HEIA 1C4XA 2BR3A 3FLBA 4FFNA 4KLNA 4MZXA 1TVKA 1LUAA 4PZUA 1WTCA 2ZRGA 3GEGA 1MQSA 2ZE5A 3KKOA 5FOTA 3A06A 3AFMA 4JXJA 2GN0A 4ZDKA 3EW7A 3VDNB 1YE3A 3SC3A 3OF5A 3OZEA 2AJTA 1OD6A 3OJEA 3ZYCA 2HJSA 1QJ4A 4Y0AA 2R1VB 1QFSA 5EP3A 2VXOA 5E6RA 5TPWA 4CKEB 1VDMA 1OXKB 1Z13A 1YC5A 4QU9A 3LTEA 4EY8A 2PBFA 3P5SA 3CVUA 2FWRA 5FTLA 4Z6KA 1BOFA 2BIFA 1M2OB 4B34A 3GT3A 3PRYA 4WJKB 4WOKA 1LTQA 2FZ5A 1BA3A 2PPLA 3K1YA 4LYYA 1S8AA 2ZB2A 4HDMB 1PJQA 1Q1GA 5TGTA 5C5DA 3AW8A 5HCNA 5GONB 2O54A 4H1TA 4HUQA 3WSWA 4HL6A 5CK5A 5CTAA 3KZXA 2ZWAA 3A2LA 4JI2B 2WZQA 1VTKA 3KZKA 1G3UA 1EVIA 3FYCA 3QEKA 3F8WA 4X1OA 4Z4EA 4G5OA 5CFMA 1ISRA 2IIQA 5EWMA 2Y6UA 1EDZA 2IU0A 2NSHA 3NTXA 3D5EA 3UM9A 4DEXA 2C7RA 3D3EA 2IJGX 1ZD5A 1NFFA 2IU6A 3HB7A 5TQJA 4EM6A 4NYJR 3C70A 4FEAA 3K5PA 1A4IA 4KAAA 3ZQJA 3DTVB 3IT2A 3JATB 3ED5A 4DLBA 4F84A 5H9WA 4DT1B 4BGIA 3P9SA 1QP8A 4I55B 4R7GA 2XB2A 4BVEA 3QLVC 4OKSA 1YMUA 1E6MA 3MQ2A 2V8OA 3VTAA 4MEJA 5A05A 3MFYA 1LY1A 1DP4A 2ET6A 1J8FA 1FS4A 3B85A 1KY5A 5DCUA 5AM4A 1KETA 2EW1A 4NJMB 2HIMA 2YKGA 5BP7A 1TAGA 3SQXA 4U39A 2H4ZA 1R16A 3JQFC 5JSQA 3NH9A 1PBTA 3CCCA 3BAZA 4JHXA 4WL0A 2HFKA 2WSSD 3C5CA 4IRMA 3GH1A 4O2AB 2R47A 2D0DA 3R3ZA 4RH0A 4X1IA 3CUYA 4NJEA 1DNPA 1XMXA 3EEOA 3MHPA 2DOKA 3NONA 4ZCQA 1OBFO 2I33A 5A6SB 1USVA 1ZM4A 3EEFA 1Z5GA 1P2FA 3D54D 4D79A 1XXHA 2OGUA 1C4OA 1Q0QA 3R6DA 2R6FA 2Q5EA 1L4YA 3GCZA 4L08A 2H08A 3H6KA 3WDLA 4GW3A 5DASA 5HF6A 1QJCA 4I5FA 3KQTA 3D2LA 4UZSA 3PFNA 1BFUA 1HRKA 1YV9A 2OCYC 1GL7A 1A2OA 1YU6A 1ADJA 2FLKA 1CIPA 3QVKA 4RLFA 4YXFA 3R7WA 121PA 1E3EA 3PGVA 3WK4A 4AKEA 1STOA 3RG8A 5AUPB 1C80A 3F9IA 4HNAB 5FUBA 2EBHX 2PR2A 5KQSA 1DV1A 1OLOA 1Z5UA 3C2QA 4O2BF 2JEZA 1YB2A 1X80A 3FNGA 5H68A 3UA3A 3Q7QA 1BNCA 3HFJA 4TWBA 3T9CA 5G1NA 1SG9A 1Y8QA 3KJIA 1QQ7A 2GJ8A 3UZUA 4GI1A 4P93A 1GD1O 3O82A 1IWPB 4C87A 1T26A 3A6LA 4FEYA 4UBOA 2IDJA 4IQ4A 4PC2A 4GT1A 4PO9A 2BDUA 2REBA 5E6SB 2ZXFA 4UXHA 2W6OA 3AESA 3D6FA 3AVPA 5AVYA 4HWSA 4PVDA 1EVZA 2XGSA 3ZC3A 1RLTA 3DYBA 3DMRA 3IO3A 5CTJA 3GRRA 2ZTSA 4M54A 2G9UA 2QVBA 3FLEA 1CJTC 1T9KA 1GZ7A 5F51A 3AV3A 4OQMA 1IQPA 4FNMA 2GK3A 2C88A 2PZAA 3MTGA 3N8DA 2YVAA 3U4QA 4F93B 5KOYA 4N8SA 3VU1A 2YINC 1CVLA 3AIIA 3FG9A 1F8GA 1GKIA 1WD5A 1LWNA 2IOFA 3DEHA 4TLDA 2AK2A 2HCTA 2VHQA 2ZBGA 3NOOA 5ALKA 4L2IB 1P17A 3SFZA 4DJDC 3EDRA 3OJ0A 3D9QX 1J09A 4KP7A 3SZUA 3DP7A 3F6BX 1W75A 4HFRA 1NJ2A 3CJRA 4NH4A 3T0IA 1KU6A 1TIBA 5KOJB 4UVIA 1DDGA 4G0NA 4GMKA 3M83A 2CMHA 4RK4A 3BBPA 5LB4A 1KE1A 3A3NA 2AKAB 2RHCA 1NW8A 4URFA 1A9XB 1V7CA 3LOQA 3OG9A 5JH7B 3CNQS 3ILVA 5CHEA 5FHRA 5T8KA 2EJCA 1SEVA 1E58A 2JATA 2Q5OA 4YP1A 4LYEA 3R0JA 1JJFA 1Y3BE 4K1XA 3PFKA 2GD6A 4I3FA 5IKEA 5B58T 3COJA 4Q16A 4V0QA 4AO7A 2E89A 2GLUA 4FXOA 1SD2A 3FMOB 3MBKA 2NO4A 2F00A 1CZKA 3LKBA 1TU4A 3N0WA 3W4JA 1QVZA 4G0ZA 1EINA 4DIKA 5BV8A 3M34A 4COOA 4W9NA 1LX7A 4RHUA 1KFJB 2EKBA 3GGPA 4N3CA 4OI0A 1F4VA 5JJKA 4JCCA 1RJFA 4PSDA 5EUBA 1FU4A 4YI3A 4L3WA 1RXVA 3P9CA 3SGLA 4XZ3A 5I7UA 2J08A 1M7BA 3AXSA 4JJ4A 1YB6A 2PKYX 4M8KA 2W2QA 2I7XA 4V0LA 1IQRA 5ILGA 1RCTE 1SQFA 3OZCA 5C1OA 4BIIA 1EX7A 1QBKC 3ISTA 1YR6A 2MJLA 4KR6A 5GADl 2V6MA 4IICA 1G4HA 4KMOA 4PGAA 4AJLA 5FR2A 3N2GB 1XDWA 4J1TC 3VR2A 4F1WA 2PG3A 3G2KA 1B6TA 1VPTA 4E5VA 2Z2JA 4UU8A 4FCCA 1ISPA 2X3YA 3A4LA 5KNCD 1Y3AA 2XRYA 4ZOBA 1L8OA 4QUIA 4FZRA 3TOVA 4C4AA 2O1SA 2J0QA 1VBMA 2D0OB 5IXJA 3VTKA 1Q7BA 3BGVA 4CI0B 2FPUA 3K16A 2BFAA 2KWIA 3O26A 3MJRA 4I4TA 4CMKA 2WY2D 4K6HA 5DW0A 1NUHA 2OD9A 1ZS9A 2VHYA 4DV0B 1OWLA 2NYVA 3B9QA 1K3UB 1BXRA 1RVDA 2XCSB 4P0QB 4TUYB 3LKZA 3NHSA 2XNSA 1X77A 1WIWA 5CJJA 1CZNA 4FOPA 1DAOA 3UBTA 2RJ3A 5EHQA 3ZDRA 4LC1A 4XSVA 2X86A 2YFHA 4PIVA 4CTKA 4KR9A 4UTRA 3HU2A 3THWB 1JJBA 2B0JA 1ZZEA 4L1KA 5BW6B 2PUDA 1BG6A 2CD9A 2PIDA 4WXYB 4DUGD 4LNUB 3CXUA 1UBGA 1JR3E 2PX5A 1P73A 3AUXA 3H8VA 1F3OA 4K9PA 2JFOA 3JVDA 1WX1A 4QM7A 3IEKA 2CWDA 3HL4A 2JFZA 5FI3A 3O8DA 4KDEA 2AH5A 3TIFA 3UCEA 2R97A 3HDVA 4IUYA 4M1MA 3TOXA 3ELUA 3QU7A 4IIJB 2YY7A 4XRRA 1ONNA 5FP0A 4CNQA 4YT8A 2FP4B 1JXMA 3I2GA 3LPAA 3UC5A 2HHCA 1KYYA 1IHXA 1CUZA 1O96B 1UM9A 5HZGA 1VHTA 2OOSA 1WUYA 2VLBA 2PU5A 3I6QA 1U2ZA 4CL8A 2C3OA 1PV4A 1SA0B 4RLQA 2ZJZA 1GGHA 2Z6UA 2ZSBA 3AJEA 4ZT2A 2AZXA 3A2MA 5C4MA 4FFBB 1X92A 2JGJA 4KYUA 2WWIA 1XTJA 1VB5A 1ZUIA 2WYIA 2QTAA 4I2VA 1C7ZA 4FNGA 2A0YA 3RHSA 4BQNA 1D0VA 2SKCA 1A8QA 5J4HA 2EFGA 3FJOA 3RUPA 4Y2HA 4FPXA 2P7HA 3H5TA 2GAFA 4RIFA 2O7NA 4YLGA 2W2KB 2LE0A 2A3NA 4JL8A 4GG1A 2OL4A 5IBRA 1EFVB 1F0PA 1LPMA 2PSFA 2P9JA 1OT3A 1U3UA 2K2WA 5LJLA 3VOAA 5HE8A 2XPCA 2P5YA 2WSIA 4UE2A 4B2YA 1DIOB 2QX6A 4KIFA 1IBMB 2DUUA 4D3DA 2WF5A 4MDYA 1VPWA 1FDTA 4BATA 3RDPA 2BRUC 3KQLA 1NVWQ 1ELOA 3B8EA 2WYOA 5A9SA 3VM6A 2YBEA 2WV9A 1DWOA 4L4YA 3F96A 4RH3A 4RF3A 2PANA 1C3JA 4CTNA 3R0ZA 2CY0A 3JQAA 3ZKWA 4H7EA 1PGPA 3NHWA 3RTGA 1IQUA 1DV2A 3TDNA 4H7IA 4B3MB 3OESA 3KU4A 4NYMR 4Z0HO 4EHHA 5KNCA 3QU4A 2VATA 4FGLA 4JGIA 5LR6A 1JR6A 3DV0A 1L1QA 2D1YA 1DC8A 2XYRA 3HABA 4HGNA 1Z18A 1ZHOA 4EG5A 1U2PA 1JBEA 2NT4A 5ALXA 1FJXA 3BB1A 4X3OA 3U4AA 4D25A 1H1DA 1UCFA 2VJOA 1XPOA 5EQDA 4DV1B 2JAUA 4LBVA 4AMZA 4YX9A 5IWAB 1GUAA 1G4UR 1O6FA 1V8DA 5JZVA 1XLUA 1SCNE 2MSLA 2PX0A 4HTFA 3HY6A 2NSLA 2WQ6A 3HACA 4TMTA 4S0XA 3RABA 1Y9JA 4IHQA 4JLAA 2VWQA 5JCXA 2AFIE 2YYZA 1Q1QA 1Z5NA 1ZPDA 1X0VA 2MR6A 1CUHA 1XNQB 2QVLA 1EA5A 4FWIB 4I08A 4P3NA 4UZEA 3KUDA 1WNFA 5ALMA 4D9NA 1JLRA 4QNNA 2FUEA 1TKRA 2AR7A 2RB4A 2YYSA 3BA6A 2Y99A 4WZAE 5IYZF 1Z34A 2BN4A 2DBZA 2J5XA 4RV9A 3TWOA 5CVUA 5CRIA 2QUZA 2YR0A 3ND8A 4X3PA 4Z86A 5TMEA 5ALUA 4CEIB 4Z9FA 4CCWA 3MWEA 2EFJA 3AM1A 1THMA 4B4OA 3IUMA 3FSGD 3NTLA 1GTG1 3RVPA 5E7QA 1AS0A 1P45A 3EZFA 2H1CA 4C78A 4CLHA 1MENA 4EO4A 4UEWA 4DG8A 4EPWA 5IJ0B 3CZ9A 3GPBA 2GDZA 4RX1A 3U7FB 3DZFA 1U7UA 4Z3OA 1GUDA 4B4DA 1YL7A 2IHTA 1M2HA 4DZZA 2F2TA 3OCYA 1BEZA 3E7WA 3H2KA 4DIUA 2WYWA 4AMUA 4IDDA 3UV3A 3G68A 1R50A 1IZ7A 4K9LA 4OHPA 4DSTA 2FV8A 2PRIA 3CRRA 4F9GA 1FNCA 4JC5A 4R9SA 2AEFA 2CSXA 2VJYA 1LI5A 5JXHA 3LBHA 4LW8A 4MUNA 2DB3A 4ESOA 5CT9A 5TS3A 1VKOA 4RTSA 3I2FA 1MXHA 1YBHA 2I6FA 1F3LA 2OY0A 1MX1A 2VS1A 1NR5A 1PWHA 2CXHA 4MKHA 3G2OA 3HGTA 2FQWA 2HWWA 2B8JA 2YC2C 4OP1A 2FF7A 1FYFA 4X6YA 1XJ5A 6AT1A 2CEAA 3KSMA 4EY7A 1FX0A 3AP1A 2QBYB 1UMCB 2R1TA 3AFHA 4NCJA 5ALHA 1SC3A 1TVKB 1UT5A 4DWJA 1XZPA 3M4ZA 2HSEA 4MQ4A 4MRAA 2GK4A 5IFKA 1QIDA 3G1TA 1RYHA 3MBOA 4LFBB 1ZJYA 3PNOA 5B7QA 3WL3A 1VSTA 1CUJA 4HEA1 2VK8A 3K0AA 3UWDA 2PGLA 4RWEA 5AVJA 3N2LA 1YZ3A 4WEQA 1MO2A 1XCMA 3IP6A 1K8RA 4EIWA 5KTPA 1GAEO 4RNDB 1EBUA 5H8WA 3KDAA 4IJWA 2HLDA 2CYBA 3LBYA 1Y4AE 2GEFA 3HUEA 4RSRA 4XW2A 1AGYA 4OLJA 5FWNA 1FX0B 2HK8A 1GLVA 4N9WA 4QA9A 1RI4A 2TYSB 4HGQA 1Z8DA 4OJMX 1W5AA 4XX0B 1LS1A 1V7QA 1KP2A 2FZGA 4TT3D 5AW7A 4IOLA 3PXGA 4X7MA 3CSUA 1KZ6A 2G9QA 4HNGA 5EXTA 1OVGA 3K9BA 2Z56A 2VOEA 3CVVA 2OGTA 1JBKA 4I14A 2CV1A 2GXSA 4KO1S 4V39A 3ILHA 1GGKA 1B0ZA 1ODLA 2GQ0A 3DQZA 3T8YA 1O97C 2IYFA 4F7WA 4KRGA 3GPCA 4GXNA 1PR4A 2QL7A 4PTZA 1ML4A 3FPEA 4FC6A 1QOPB 4D5GA 1V11A 1E7SA 4KACA 4TPKA 4YV1A 3QE9Y 4M49A 3CGGA 3G5MA 4LYGA 4XARA 5JJBA 3TYXA 1NMZA 4UBJA 1C30B 3GN1A 2AE1A 2XJ9A 2PKCA 4EO9A 3JYNA 5H81A 1P44A 3MVEA 1I4WA 1CERA 1E96A 1NN3A 2RH4A 4W63A 5CVDA 4EI2A 4ABTA 2ZSAA 4XGIA 3B9RA 4YHBA 2C99A 3TGWA 4MLDA 1GRVA 4KGZA 1PNTA 3NP9A 3D6VA 4ND1A 1THGA 2HF8A 3ANMA 3DDSA 4EMBA 4MV8A 4TWAA 2Y1GA 1B14A 1JZTA 3AUJB 1HOTA 3RODA 2EEPA 2OGSA 3LPNA 3P27A 3PV0A 4MV7A 3EUEA 2XXAA 1L5QA 4PX2A 2Q1WA 3OTWA 3PUIA 3MINA 4FVTA 2GH1A 4UUAA 3TW0A 4CG3A 1DIBA 4R8MA 1L8XA 1N1EA 2J7PD 3QXGA 4ND8B 2CLCX 1A9YA 2NO0A 4MPDA 2ATXA 4KWEA 1OFUX 1M2FA 2NNLD 1HURA 2PBZA 4WA7A 5ALTA 1CUSA 3IRUA 2WWRA 5FO0A 1IK6A 2P2SA 2PRKA 2XDWA 1ID1A 3M4NA 4D56A 4N5MA 2PCJA 2OZEA 1D2NA 3L79A 4CMAA 1UH5A 1R6TA 3PGLA 3K92A 5B57C 5BYKA 1NULA 1OZAA 1RYFA 3PXCX 3AR3A 1S9DA 3U37A 4CEHB 4KB5A 4F9FA 3E03A 2QW0X 3WK8A 1I4LD 2POCA 3NRCA 4YWJA 3EEYA 1G55A 7MHTA 1HPLA 1J97A 1L5HB 1BE8A 4YJ3B 4RY2A 3GYGA 4NJOA 4JBNA 5F7ZA 5IAKA 2P2YA 4R69A 4PC7A 1Z63A 1ZNXA 5DEIA 1CNFA 2X5OA 1GCGA 1NSFA 2ZUBA 4HXFB 3K0CC 4IXWA 4US0R 4J0FA 4CKWB 2GCOB 3MTEA 5A9RA 4OB8A 2G4VA 2QZ4A 3VPCA 4U9UA 3WS7A 4F3TA 2QJOA 2VL7A 1GFZA 4K9DA 3GHYA 4A2QA 2F4VB 2R6CA 3R5TA 4HWPA 3GF4A 2IXTA 1GIAA 3P32A 3PQ7A 1DIGA 1M7GA 4II2A 3DF7A 4Z53A 4YPOA 2CLDX 4XFKA 5BXQC 3EQZA 3WK9A 4TXMA 1HFEL 1U5BB 2FSHA 4HOYA 5G0TA 3UPUA 5KCMA 2JHFA 4WW0A 3FNHA 3ADBA 3H1FA 2IK8A 3BVPA 4F45A 1NR7A 4HEJA 3GRYA 3SKXA 2Q5IA 3H13A 2ZUTA 3OZTA 4NICA 4UNNA 4R16A 5DI3A 1W2GA 3L18A 1QQBA 4ERNA 2NADA 2QT0A 3M2TA 2HIHA 4IIEA 5LD2B 4G63A 4KR3A 4WADA 2YVLA 1WQ1R 2ZUCA 2WEKA 4FYWA 5EGNA 2Q45A 2FRDC 2R7KA 3ZJ5A 2H0QA 1U7XA 5CITA 2X40A 2AF4C 2O50A 1TAUA 2QR3A 5EE3A 2BONA 1ST3A 4BVLA 4BQRA 1E3IA 2R6ZA 5EI5A 1AGXA 1CEEA 3HB0A 1CP2A 2R2AA 3OLWA 1EFRA 1M1ZA 1X38A 1KDPA 3A3KA 1AS2A 4UOZA 3V8PA 2O8DA 1ODJA 3ZTYA 3NB0A 4DZRA 4AY3A 4WZZA 3UJDA 1JEYA 3HY3A 4A8JC 4XB1A 1MMFB 1M0WA 4OYLA 1R1DA 3COVA 1M6VA 1XAIA 4RVOA 2HMVA 4D74A 3ORYA 1YZKA 2ZRQA 2F1IA 4IFTA 3TUJC 5HIAA 1CY4A 1NBMA 2YJGA 3GJ6A 3OOEA 1V9CA 3ZV3A 3FIUA 2C04A 3AR4A 1P5JA 3P4XA 4B3HA 4I1PA 1YRWA 3FYUA 3L4SO 3G0HA 5FBZA 2QRPA 2NUAA 2YWEA 3DBHA 2CMDA 5B6JA 2AFIB 1E5DA 1B26A 1E9DA 1YBMA 3GLKA 1UANA 5H02A 3UYKA 4JU8A 5A6VA 1U0LA 5I9SA 4BS9A 1M0EA 2FPOA 2ZIAA 4KQ6A 2C2XA 2ETVA 3HVUA 1NVVR 5HQTA 3M81A 5CAEB 3WDKA 1DZIA 2HQOA 2CLEB 1K7FB 2P0YA 4DSAA 2LZ0A 2IS4A 1EQAA 4DLNA 2E37A 4XE5A 1TMGE 1Y7HA 2NZ2A 3KXLA 1XZHA 3W5DA 3TZEA 1HTWA 4JP8A 1AURA 4KVGA 5DYWA 4HXYA 4RXUA 4UZFA 4KYTA 1UQUA 2O1XA 1JQLB 2X8AA 2QXYA 1ZOPA 2AQKA 2Z5FA 5BV0A 3JQEA 4MV3A 4XASA 4EAAA 1CRWG 3OJFA 4M98A 5ITZA 4JJIA 3WGQA 2INGX 4L8GA 1MRZA 2QD1A 4BMPB 3DOCA 5BOSB 3DNMA 2HD4A 1KK0A 4POAA 4N5NA 3D4IA 1O8CA 2OHIA 1E4EA 1ZW6A 3DP9A 3HCRA 1JTEA 2FEXA 2P90A 3M1LA 3OJLA 4JEUA 4W1QA 4WLFA 5IAAA 3RE1A 5KKCA 3DM9B 3HBMA 4PAOA 2XHEA 4IIVA 3UOAB 3ZCPA 3TIVA 4IIJF 2WC1A 3R3WA 2O8NA 2PO5A 3SHOA 5JW6A 1V25A 1JHMA 1RRFA 1X1AA 2DBRA 3NXKA 2HK6A 4I19A 3PHHA 1D2CA 1Z5PA 1F06A 5ED4A 1XQ6A 1Y1LA 3K9QO 2WIFA 1TM3E 3LDFA 1Z17A 3OUUA 3P9PA 1SZPA 3RH0A 1EMDA 3R5HA 4FKZA 3OCVA 1KWGA 2Z1DA 3VJRA 3O90A 1GARA 1SOUA 2ZI3A 1SBZA 2E21A 2X2OA 3HPQA 3JVVA 3A4MA 4FHFA 3PS9A 4AZ3B 1ZD9A 4DDVA 4DIOA 4JV5B 1F9EA 2XY4A 5EJ7A 1XU7A 2L0XA 4L6CA 5T8KC 3EWIA 3OFSA 3C24A 4XA8A 3WRWA 2EKDA 5JXGA 1PR9A 1ICIA 2BGLA 2RHDA 3AOGA 2QE7A 1LBQA 4QDTA 4EDHA 1WY5A 3H0CA 4QTXA 3VNUA 3UBMA 1N2IA 2WF7A 5LXTF 1GQRA 3AP2A 2QDXA 4O02B 1WLYA 1LDNA 1P9RA 3HJAA 4OMCA 4WZAA 1BSVA 4NFHA 2W2PA 1UJMA 4OXKA 3HA5A 5DCYA 3G85A 1JTFA 2V0CA 4I9UA 5EXSA 3SEFA 1BFKA 2H7YA 3M6LA 4GPD1 1GNTA 3IVAA 3AUSA 2H17A 1B2RA 3GVXA 3LCRA 4F3RA 5FYDA 2NU7B 1P77A 1H69A 2GBCA 4ZAYA 2I54A 2YQ4A 1R12A 1WDKA 3EBOA 4RFLA 2HA0A 4OUDB 5JEEA 2WWYA 3U6BA 1VHLA 4PBRA 3B7PA 1V0JA 1AHIA 1U80A 1JWAB 4U0KA 1OF1A 2W2XA 3D3JA 5ERYA 3NHZA 1QWOA 1ZI9A 2G4LA 2R6GA 3Q3GE 1U7PA 4EF4A 3AYXB 5CJPA 4MHSA 2O2SA 3H5IA 4QDJA 2HA4A 4GO1A 4TKUB 5C8ZA 1UBEA 2QW1A 4GOMD 2M6KA 1CQXA 3RNLA 1LCIA 2QTLA 1A9OA 4C21A 1DKUA 3D5TA 4M1OA 3CW2A 1XAJA 1NR1A 2QN8A 4BP1A 2I62A 3K4HA 5I7EA 2C7QA 5JWHA 1Q84A 3LPLA 1JTVA 3L1UA 2CXSA 2Q1UA 1IN8A 2QKYA 1ZSYA 3ZE8A 1C7EA 3ICPA 2PSJA 3BK7A 5H80A 1GVHA 1Y8QB 1YHNA 1CRLA 3V48A 1LLCA 4MDHA 3RVSA 2V8BA 1KQGA 2X8WA 1E6UA 1PQYA 2RHBA 3GOQA 3LA8A 5BRAA 4QUJA 1C1XA 5BO5A 3VKUA 1JDUA 1W29A 1QRAA 3CM0A 3TMAA 3W2HA 5BVGB 2Y8EA 3UWMA 5EJIA 2E49A 4NFYA 3RVRA 2HYIC 2QD4A 1P7PA 2QG6A 1NGSA 2VDNB 3PSHA 4NE9A 5DX0A 1DVRA 3LP8A 3PX2A 5I9TA 2QLNA 4IWNA 3GLFA 1NPDA 2WYVA 3L04A 3JQGA 1X8KA 4RMJA 3D7SA 3AHHA 3D81A 1G8SA 3ZLVA 4EKYA 3OWXA 4CMIA 4XTCS 3IYLW 3EZXA 2A57A 1M1XB 2XUAA 3PENA 2NSDA 3BMQA 3GFVA 1YDEA 3FUXA 3RFCA 2I7DA 3ZWCA 5BT8A 1SB8A 3KTFA 2QQFA 3ZK9A 4BZQA 3LDHA 1VHDA 2RHGB 1W88A 3P2EA 2QQ0A 3LM8A 3M1AA 1CULC 2WWFA 3KVNA 4TMFA 5ALSA 3GLIB 3IHWA 2QL5A 3LS2A 3SM9A 2HMYB 4MA5A 2Q0QA 2XJ4A 4N0MA 3R0IA 1YD7A 3OT1A 3P9RA 2Q46A 4UUMA 1Y3FE 3P9NA 1C0EA 5AH0A 1C8LA 3BULA 1RTKA 4JQCA 4Q4AA 3MBIA 5K4GA 1HYHA 2WJ6A 2IEAA 5FUVA 3V4LA 5JT1A 3K9GA 1IOWA 4JNCA 3B6IA 3OLYA 1Z6PA 4W7SA 3IQGX 3O4JA 3S4YA 1PR3A 1A2QA 4CF7A 3KQUA 3T0FA 4FS8A 1KBZA 4QXQA 2GAOA 1WCXA 5DM1A 5K09A 1C9YA 2HEGA 5B4TA 2FPPA 4KIUA 1NYLA 3DWEX 3W5CA 1M8KA 3KBBA 5DHPA 3A1VA 1RI1A 3BSYA 4ROTA 3SBDA 1YK1A 2BKEA 3E61A 3G6KA 3DLIA 4KXWA 3BGWA 1IY1A 4QBIA 3VXKA 4H4DA 1RYZA 4GYWA 4RANA 1DCMA 3SI7A 4EUEA 5LQAA 2P4UA 1P6QA 4WFIA 4TXNA 4YP7A 4C0QC 1N3YA 1Z0AA 4FFPA 4YUVA 1ZNZA 2QWXA 4EPTA 5LMCA 2PKXA 3QTTA 4GU5A 2P6OA 5COAA 1CSEE 1YQTA 3RFTA 4V1CI 2OZKA 1M73E 4LI3X 4GFDA 5KEIA 3PNSA 3N2EA 2BM9A 2C2YA 2Q7DA 4P3OA 4BZXA 2QVCA 2QYHA 1Q77A 1P81A 2FOXA 2BPOA 3OZFA 2FKAA 4O4LA 3VPGA 5JQWA 2FY8A 2VDMB 1ZMBA 3FNQA 1XLTA 3NT5A 3P0FA 5K0TA 1K0UA 5CBKA 1HL7A 3RRZA 3FBWA 1HRDA 5M04A 4R2KA 1OC4A 1EVJA 2AW3A 1EX9A 1T1JA 3BGIA 5C8VA 4M36A 1P1CA 2R8EA 4X8HA 5FYQA 3ROTA 5EIHA 3VV2A 4L5JA 1SUBA 1ECCA 5FPYA 2XHZA 5CB8A 2W6QA 4D6XA 4YJ2A 1VG1A 1A8SA 2VNKA 3ND5A 4IDCA 5ADVA 1LC0A 3HCEA 3N86A 2AN4A 2I99A 2IL1A 3Q7SA 2BSQA 3CIOA 5H82A 1MB0A 3WMEA 2OBXA 2ZBUA 2ZULA 2UDPA 3KTAA 4G1VA 2C8VA 4PRKA 4PXAA 4BMDA 5K8LA 2ENWA 3W3AA 4BYGA 4D80A 2GYWA 5GPBA 2DJ5A 4LC0A 2WPNA 4EJ6A 3CEAA 3FUWA 1BGVA 5FTNA 4P3KA 2WRZA 5K6TA 2VJPA 3HTXA 3NXSA 4IEFB 4F4FA 2GHRA 1TMKA 4RIIA 4B7UA 2XGMA 4YRBA 4KPUB 3AVYA 3DC7A 3J80A 2OGZA 2AMVA 4DG5A 4JYZA 2AOVA 5C1IA 1GKKA 1E2BA 2CDRA 2UKDA 3I9NA 1QS0B 1TJ5A 3E5MA 1U7OA 2OM2A 4G9EA 2IZ0A 1YRYE 4I66A 3IIMA 4Y6RA 4C3ZA 4Z7JA 4WESB 4FT2A 1L9XA 3T9DA 1ULSA 5EIAA 1E6EA 3SX2A 5FA6A 1U5BA 1ADGA 2A33A 1LSSA 4R2HA 2NZXA 4QHTA 5DGDA 4AS3A 4D4KA 3OLZA 5AJYA 4Q18A 2NZWA 4U7PB 4BCBA 4X0EA 3QLUC 4EI7A 1OBVA 1NXVA 1XU9A 3BBLA 3DAHA 4PZDA 2JDID 3E3AA 4EZIA 1QSGA 4RYLA 1U1EA 1VCMA 3PHLA 2AA3A 2C5SA 2Y0BA 3CLTC 3CSDA 3X0DA 4DSZA 2B1RA 2E2WA 2J85A 3MLBA 3T9BA 4B3JA 1SHKA 2BHNA 3OY2A 4KNWA 3FSGA 3GFTA 4MPRA 5LVAA 2UZ0A 4DIBA 1EP3B 2QD5A 3EARA 2G5GX 1NF8A 4M0MA 4FW8A 1GQQA 4L5AA 5BUZA 5LU8A 4IO1A 1R0KA 1WVMA 4KLCA 5JBQA 4DV2B 5A7HA 3CIFA 2C5AA 1IBCA 3J7AC 1QWSA 1NI5A 3MS4A 3F6CA 1CV2A 1X1BA 4YYEA 1E94E 5LN1A 1MX9A 3BGOS 2GT1A 2ID7A 2ZSEA 4BMOB 2YY5A 3OFKA 5C1BA 3UN1A 5TF0A 1X0XA 2X7JA 4OQZA 2H57A 2IHYA 1AB5A 3CZAA 4HXEB 3DMPA 4JL6A 1NQ5A 2YMLA 2NZ8A 1ZBDA 3C1UA 4IH9A 1GFWA 2QZJA 3WBKA 3SZLA 2H1SA 2FQ1A 1XEXA 4O2RA 4OMUA 1NYQA 4ZO6A 5EAIA 2MSDB 4LRUA 5DHAA 3U7QB 4KDFA 1CEQA 4QXRA 1G8PA 4ZZ3A 3IEMA 1J49A 4J4BA 3C48A 3NJ8A 4KOAA 2ZI7A 2Y9MB 1VFPA 1DT3A 1OV4A 2DVMA 2P75A 3BQNB 3IOEA 3AKZA 5JDIC 1WVIA 2RGRA 1SXJC 1K6IA 1CR1A 2B3TA 3DB1A 3PFHA 3TM5A 1V71A 4ZYYA 3AHEA 2VRCA 1V5WA 1E5QA 3IAS1 3RS3A 3LZ6A 3UFBA 4BAUA 2EKLA 1K66A 3HVKA 4ZDIA 3I9V6 1CVRA 2IT1A 4GPZA 1PEYA 1XK7A 4G1CA 1XEAA 3CH4B 4BUCA 4DYHA 4IL5A 2MTBA 2PN1A 1YJAA 1XQXA 1HDIA 2O2EA 2VC2B 1U2RA 3LUHA 2FXVA 3ELBA 4TTQA 1ZGGA 2YIMA 3Q41A 2ZITA 3BFVA 4TLEA 1U9CA 5K0NA 5ES3A 4E09A 5CLJA 5PGMA 3QPUA 3WYNA 5EGSA 2R6DA 2O0KA 1E0SA 2HPZA 3RJMA 1KMNA 5LMZA 4PYIA 4DPMA 5KPJA 2AL7A 2IWHA 1XKTA 3CU5A 3MPOA 3LXXA 3OTIA 4K8OA 3V32A 5BUSA 1MB3A 1IXZA 4RK6A 4XYLA 1IUKA 2BISA 3TDKA 5BNTA 4IMPA 4DLSA 3WRXC 4Q15A 3L4BC 4AZSA 1AUPA 3BL8A 4PANA 3WLEA 1WHTB 1W0JA 1BJRE 2WNIA 1UXOA 1XZCA 2ECQA 3NX4A 4HRXA 1IUNA 4L78A 1IM8A 3DBVO 1HFWA 3HZRA 4PAWA 4QBGB 4ZGBA 4BEJA 1U5CA 2R0QC 2QN3A 5HYVA 1EK0A 3DNFA 2C95A 3UIEA 2Y4OA 4BP9A 1F38A 1SPXA 2Z5GA 1GPWB 1BD3A 2BHTA 3VZBA 4CL0A 1U0BB 3QVGA 1P7ZA 4BFSA 2VBGA 2IZ5A 4LJ4A 1DDIA 4BLUA 2H31A 2QRNA 4KLAA 2CF6A 4GECA 4EL5A 9LDBA 3USCS 3QFFA 2XDAA 1AXRA 2B69A 3AXTA 4QOIA 5I4IA 3CZPA 2YWCA 2JFBA 3IELA 4ISCA 4F92B 1TVEA 2HU7A 3E48A 4DV4B 4NWIA 1TOAA 4O2BB 3ANXA 3AUTA 2IXAA 1PT5A 3SK0A 1KYIA 1MEEA 1PIWA 3TB4A 1AV6A 4CHTA 3C39A 2J5BA 1GAWA 2C42A 3LOPA 2BEUB 4QPDA 4MR9B 4HNTA 4LGYA 3EQ8A 2LTAA 3PITA 2ZSIA 1YRHA 2AXEA 2ZJBA 2DM6A 3N28A 4M2LA 1W94A 5FWXA 4WFKA 3NYWA 4Z99A 1SR8A 1TQ4A 2CF5A 1ZVVA 4NV0A 1CDDA 4L0QA 4URHA 3K70C 3K8OE 3RWMB 3RFVA 4WBSA 1E5XA 4YONB 1CUBA 1GG8A 1QDEA 1QIEA 1QR6A 2XE6A 4AJOA 4EGQA 4YROA 4NNPA 1JSLA 1VJ5A 1FSFA 5T5QA 3W7AA 3B3QA 1KYXA 4MJ3A 1OLUB 4AFNA 2R5FA 2CLSA 3U62A 4D99A 1ZGCA 3C6MA 4O8CA 2O0JA 2JBAA 1SCJA 1N9KA 1NLZA 3AL3A 4GKVA 1MTOA 4GLLA 2D2VA 2JAPA 2VG8A 2O3RA 1J4AA 4MYRA 2C57A 4MRMA 2OOKA 1KJYA 2XWQA 2P4SA 1Z0JA 3HVIA 1LRLA 4YJHB 4XCQA 4XJSA 3FRIA 3PC8A 2RH8A 5A71A 3PEFA 2EWMA 3H2YA 2FJPA 2DPYA 3KAQA 1GSAA 4FT4A 4LY0A 3CLSC 4IUBS 4BU1A 1CUDA 1TCUA 3ZHVA 2WLSA 1XRNA 4BWFB 4JQYA 2Q4TA 4X84A 2WG0A 3KU1A 3T99A 2G83A 1BN6A 3SIWA 2Q29A 2IV3A 3QEAZ 3EIEA 4KN5A 2F9FA 4YBRA 4MNTA 3S1AB 5IRCD 4A8JB 3M6AA 5JMPA 1YACA 4LUCA 2GM4A 3PBKA 4RAQA 2X7XA 1I2BA 3ZX4A 5JHHB 3SOPA 4CKWA 2H51A 4F4IA 2QX9A 5DI3B 5AVSA 3I37X 2VBFA 3IULA 4KUGA 1TEZA 3ZZ0A 1GL3A 2GM9A 4BUJA 3IQXA 1RPZA 1F0NA 2HSDA 2IHBA 3H87A 4FLMA 1F1JA 4QODA 3ZWAA 3EVFA 4UHEA 5D3KA 1EWKA 2WKSA 4B9EA 2G71A 1JDTA 2ZI4A 2NO6A 4G6ZA 2C77A 4K46A 1SUEA 1OU0A 5M7EA 2CBXA 3CT4A 1GG9A 2XR1A 4UQPA 1FRZA 2OORC 3AL2A 1YO6A 3RBXA 5LMNB 2ID8A 4Y0NA 4GR4A 4HAVA 4KO2S 4J0QA 1XWIA 2UZ3A 2VP2A 4TYQA 3ZGOA 4BLVA 4R0VA 5FLEX 4C14A 4D96A 3RSZA 1EESA 5F1YA 1HLDA 1PUXA 2HJWA 5DBIA 2J32A 2VTBA 1X7DA 1ZC4A 1NP7A 1ZL0A 3K30A 4PIMA 5BN3A 3BIFA 2V7QD 2Z3WA 2Q28A 1XA4A 3R3SA 4XGRA 3RK4A 1HNNA 3DEKA 3QPCA 3G1UA 4ARIA 4LQDA 3PQ8A 1C7IA 1HL3A 3IJPA 2CCGA 3A11A 3NBKA 5ILQA 5K7SA 2PHZA 5D5HA 3Q4GA 3T4UA 3H2GA 2ONKA 4TTTS 3LV8A 4A23A 5K6RA 1XA0A 2GEBA 2NXJA 4G07A 4NABA 5WRFA 5KWJA 3BJEA 4ZGGA 2IUYA 4CM9D 4LOAA 2I9KA 3SVZA 3B6EA 1TLFA 4DLYA 2QX7A 1JAYA 1KJIA 1FFSA 3QVWA 5E9AA 2Q27A 4D82A 3DOJA 1XRMA 1AKVA 2BZ0A 1BWPA 1PD0A 2VWHA 2QQ5A 4DMFA 1N2GA 2QTZA 4U7GA 1KFEB 4EECA 1QZ3A 2BKVA 3FRJA 4YAJA 3LLSA 1YIOA 2D2XA 3MB8A 1P7CA 1UMKA 4OFBA 1Y7LA 1BDMA 2FR8C 3FRHA 1PVVA 3H4IA 3KD3A 4OQLA 5AFSA 1EWVA 4WRRA 4QZVA 4HEQA 1B8NA 3IXLA 4F60A 4JNKA 1XZAA 4ZMBA 5I9LA 4ZYVA 4JVLA 1W85B 4M8NE 2Q4EA 2JIBA 3ROPA 1IWBB 3CMMA 4O3FA 2JIQA 3BN3A 1RAIA 5HMMA 3WGZA 4K26A 1C30A 4CMBA 2QBYA 3R9KA 5ICGA 2WKPA 1EVKA 1MJHA 1W25A 2CNOA 3TAXA 4WKNA 4QUDA 1I5OA 3N53A 4BNNA 4QNMA 1X3LA 2WSSA 1GP2A 2I8AA 2PLRA 3UHJA 3ZE7A 1KDTA 3ITEA 4JP2A 3HB4X 2PZMA 3ESAA 2EG5A 2WJHA 1UIMA 3GDFA 4LJ5A 2BHRA 3L4BA 4WPGA 2IP4A 5KNCH 1TW2A 1Y5RA 5CH5A 3IQZA 1CF4A 3X2FA 1ULUA 1TVCA 3DMHA 2XUPA 1EFVA 3PRJA 2OFPA 4RK0A 1QNFA 3WAKA 1HYBA 2GZAA 3FOBA 2QRQA 3TOSA 2R60A 1X7WB 4CM8A 5JIBA 2CHQA 2GARA 1RWNA 4I4IA 2B61A 2Z95A 3LUFA 3A3PA 3TRFA 4F5DA 4L5BA 4ZOLF 1UKEA 1I3OA 3LYLA 2BBTA 4UMFA 1VMKA 3PUYA 4BFLA 1ZP6A 3Q3HA 4OIMA 1UC8A 3U39A 1V11B 4R3NA 4ZHQF 1O95D 3OICA 1ISGA 1EXMA 3RROA 5C1PA 1SCKA 1KYZA 3IPAA 1AU9A 5JAUA 3WGLA 1YR2A 5L8VA 2R8PA 3LRTA 5SZKB 1YA6A 4WV3A 3I62A 4AZWA 1VMEA 5F3RA 1P0QA 2VP0A 2XBLA 1XNHA 5FUQA 2JA2A 3QPWA 3FBTA 5LCXA 4BJ3A 4C3UA 2H2DA 5JDCC 3BS4A 3QXJA 3R7FA 1Y7PA 1A4XA 3I6BA 3EXFB 1VFNA 2REXB 1E7MA 1R37A 4TQUS 3GROA 3T3NA 4Y2RA 5KVCA 1IRXA 1VZ3A 3FGOA 3U9TA 3O2NA 5IVIA 5G0VA 2X0EA 1G41A 3GGSA 2WZCA 4NBNA 1M1YE 3A4TA 2GHTA 4O1HA 5C7YA 2GBGA 5JD3A 3EIHA 2BI7A 3MLEA 3RRBA 2ZJ2A 2ISCA 1OLSA 3EGDA 4EHJA 1DGQA 1FQWA 2QM8A 3PIIA 3KQQA 4N7JA 2H92A 1CQPA 2VSFA 1E1CA 4HQFA 2WD7A 1UIRA 4TMYA 3GFFA 4KK4A 4Y2VA 3QIVA 3NU1A 4YRRA 3DV0B 4F2GA 4HK4A 3D8HA 4A2WA 1KOJA 4EELA 2IVZA 2L17A 4L4ZA 4D6YA 5AW4A 1GGMA 1Y1SA 5HS4A 2I9PA 4RVNA 5TIIA 1J5EB 1D4ZA 2O52A 1R3UA 1UK6A 4MV6A 2DTDA 1GL6A 2VF5X 2JEYA 1NDQA 3K35A 1PQWA 3KQNA 1L7OA 2VHWA 3PZBA 2ZJAA 1ADFA 3C6KA 1ZD8A 3GNSA 2DYKA 5ADHA 4BNHA 2HSJA 2GKSA 1I2CA 3MWKA 2FUG1 1WBJB 3LY8A 3N2GA 1QIKA 2OV2A 2IW1A 2VCEA 5LUBA 4QFCA 4DCJA 2Q21A 2ZBPA 2YWBA 1UDAA 3IIIA 4WCFC 4OCZA 4RADA 1E7YA 4HUTA 1P4GA 1R6XA 3AB7A 3N6RA 4EBFA 4HUJA 4ECAA 1A7JA 2A9QA 5AHRA 2GRAA 4G5RA 1RNLA 8OHMA 1JAHA 2J1LA 4DTIA 3R8FA 3DE0X 1S0UA 3F90A 3FSEA 3HSYA 3A4IA 3R3JA 4REQA 4E2YA 4B48A 2NQ8A 1HNXB 2I3DA 3DXFA 2ZOSA 3KQOA 3DLTA 5IG2A 4LECA 1JYFA 3WI7A 2ZRIA 1GZSA 2ZAGA 1W44A 4GM1A 4QGGA 4TYMA 2FUCA 4RMGA 7ADHA 2YRWA 2GPSA 5IC6A 5J3JA 2QYSA 3PQ5A 1LLQA 3SLKA 4R1MA 2PNFA 5CNMA 4Q3LA 2REQA 5CGZA 1Z74A 5FI1B 3O95A 2QRHA 4INPA 5MGBA 3PTLA 1FVFA 4BNMA 1E2LA 3ROGA 1ZL2A 4OHYA 5FBHA 3ROXA 4ZCLA 2BJVA 1IVNA 3NNNA 3NT2A 4P38A 4BFVA 1VG9B 4CM7A 5JQGF 1JJIA 1FJ2A 3QGMA 4RLSA 3RSSA 4EYEA 4NNOA 2EGGA 5DBEX 5C5CA 3TF5A 3RC8A 3FPBA 1FC0A 3IRVA 4LFAB 4CUZA 3DGEC 1EE1A 2PLAA 3ZE6A 4DHEA 2ZFUA 1PSWA 3ZWMA 1FMLA 1Z4IA 1U0HC 1TU0A 3A25A 3K2QA 3QE4A 1ODKA 3EASA 4JSRA 2PGOA 1J20A 3CBQA 3HCDA 3SMQA 4LGMA 1OWPA 3IFSA 2JAOA 1XTRA 3RSFA 3JQ6A 3GVCA 3G7SA 5FUXA 3UHPA 3DJFA 3CCBA 1UBUS 1QAMA 3UJHA 5B12A 1JHZA 4DS3A 3F97A 4OO3A 1Z2NX 4JBLA 1W8IA 3ST7A 1JVBA 4I46A 3P2OA 4M0KA 2X0FA 4X66B 4LK2A 4U2CA 4RZHA 5ESRA 1Q11A 4PHCA 4KLZA 4ANFA 1NU6A 1ZMTA 1NLMA 4C0XA 2YHSA 2MT9A 4OHXA 2CT8A 1BMTA 3DEZA 2BJHA 4C5CA 3MUFA 3TZ6A 5JSFA 3MGKA 1HG1A 1FLVA 1QC5B 1VYUA 2JFQA 4FR0A 3CVJA 3K5IA 1NMXA 1YGYA 1SURA 1YZFA 1ZUNB 2WUEA 2ZRNA 5JROA 1YDWA 3AHCA 4FEEA 2IXBA 2A30A 5EZYF 3VPXA 3O3CA 4DKJA 3Q8LA 1YFLA 5DB4A 5EWMB 3UJBA 3ZWPA 2PBRA 3HA2A 2Q3EA 1QZTA 2BD0A 2QSZA 3AIKA 4JUIA 3AY6A 1ZM2A 2EKPA 2FWPA 2Y93A 4JZYA 1FA9A 2F4NA 4KI7A 2NU8B 4CUJA 2Q5CA 4IIJA 1A5TA 2MCFA 1D6SA 4H16A 3ZI7A 4ALIA 1K9SA 2PZJA 4QPNA 1HEIA 5D3MA 5JSKA 4B3TB 2J0EA 3ZWOA 2ZREA 1ULAA 1GWNA 5DJ5A 1T9DA 2IYXA 3G2IA 3GVHA 1K92A 4KPUA 3WIOA 2AD5A 4YCSA 4G85A 4AY2A 3KZNA 2IOHA 5CH3A 3SVLA 1XVLA 1J0EA 1HDXA 1BOOA 1KP9A 3NPAA 2W6PA 1C9MA 1DAIA 2JI9A 5B2FA 4F0JA 2Q9AA 3TL2A 2GYUA 3ZX5A 1JHRA 1B23P 3DT6A 1SA0A 4G1MB 2C07A 1S3GA 1ADYA 1GCOA 1LTHR 3U3MA 1O5TA 3AHDA 3VTFA 4MRVA 3GEIA 3G9TA 1FE8A 1T6XA 5DGXA 3PDIA 4KX3A 1NNSA 4F1KA 4PYRA 3DW1X 4N01A 2J4DA 4NYJQ 4PCVA 5CFPA 5AM1A 4OXXA 2BMVA 4FCWA 3M6WA 2YX1A 3EODA 4UBMA 5T6MA 3S7ZA 3ZNPA 3L40A 1EYZA 1JU3A 4CIDA 2WW8A 3V4SA 3QKRB 3AEZA 5EIFA 1GL9B 2XEXA 3CRZA 3F3SA 2YNMA 5TEVA 1GADO 4KXMA 5D3MB 4AZVA 4RH1A 1JR3A 1M3SA 4MQUA 4DIEA 1AD2A 4XVRA 5BPFA 4UNPA 4QUEA 3R4CA 2DZDA 2OV1A 5C46F 1JSCA 2YOHA 1T2EA 3U3XA 1D1QA 5JYEA 4JMLA 5CA0F 1LS6A 5ITWA 1BCSA 5AIBA 2C4WA 4MYSA 1H2AS 1FTYA 1SK9A 4N5IX 4FXPA 2BGTA 3ZY3A 1M2WA 3KXKA 4TS9A 5FFFA 5GTDA 1C8BA 2ZYSA 4MVJG 2OBNA 4P3YA 4PNZA 5DI9A 5ECYA 3KQHA 5AI5A 1VKHA 4ZJYA 1ONOA 3F5MA 4XPIA 3UQYS 1EEHA 2GHQA 1N2BA 2R8YA 3DUWA 3PT9A 4W1SA 4GP7A 5HJEA 4S0ZA 4W8GA 4JBWA 1Y0BA 2QTBA 3JAWA 4IEIA 4D0NA 3EX7C 3ZDXB 1N2SA 9GPBA 5K3CA 2GBLC 4BNUA 5IT4A 1YOVA 5CB6A 3A6FA 4YV2A 1E1CB 3PXEA 2G36A 1SHTX 1BRTA 1CZLA 3ABIA 1H0HA 3OQ6A 3ENZA 1QOZA 2PMDA 2N1BA 5EG5A 2IX9A 4YPVA 3JXEA 1Z73A 2YDYA 2OWEA 3CUVA 3T4XA 3LQRA 4Q1DA 1X70A 3C3WA 4IXNA 4AVYA 4W6QA 2V1UA 4A36A 4XKJA 4P80A 4UTOA 3LXUX 2EYUA 3NHUA 5AD1A 3U7JA 2Z6QA 4YYZA 4QOJA 1IEXA 2X42A 3PRHA 2UUOA 4C4ZA 4OHFA 2VAVA 3LH5A 2H7XA 4E21A 3ZPXA 2REQB 1N2OA 2W11A 3JW8A 5DX8A 1K98A 3BMCB 5K3FB 2DUJA 2VA8A 4UATA 2ZR8A 4RGYA 1DAKA 5ALLA 2XWJI 1PJ4A 2ODBA 4PRYA 1GTZA 2WHYA 5HF5A 1PR2A 1KOGA 2C4VA 3KP1A 3ZDAA 3TR6A 5TRTA 2COEA 4RPGA 4C20A 5KC8A 3ETDA 1H23A 1MABA 1ZISA 3DEIA 4AK9A 4DLWA 3A1FA 3V7WA 5CPBA 5B37A 3JD4A 3KELA 3WL5A 2PLWA 2CNDA 3CNHA 4KN6A 4UHCA 4WT7A 3KQKA 2PUHA 1IPEA 4EPYA 4LOLA 2V5UA 3BREA 4ZGWA 2OD2A 5M5BA 2OXCA 2QRUA 3V1NA 1DBPA 2B1IA 1T5SA 5LWQA 2XZLA 2VAMA 1KAGA 1U9IA 4ZC8A 5IJXA 1PR6A 2SICE 3M5PA 5ILOA 4PZCA 1Z88A 2Y1OA 3COWA 1KVUA 3L92A 2NGRA 5K3BA 3RIXA 1N92A 3D7LA 2W98A 3ZHXA 4MKRA 5HRCA 1GU1A 1M8GA 4UU0A 4UNQA 5J63A 3HNPA 2VQEB 5A0FA 1RXUA 1KKLA 4R4JA 4AF6A 3LK6A 1JFFB 2YIJA 4HWRA 4M0EA 1T8YA 2VDQB 3OT4A 4P4GA 1JUDA 2RGUA 3BDIA 5AUQA 2X6TA 3RVNA 4R1OA 2COUA 4PZYA 4JROA 1MVOA 3OZRA 4G5QA 4MZDA 4BKOA 3TZQA 1N5KA 2QP9X 1AM4D 2L2QA 3GJ0A 4TTIA 3IIJA 2XF2A 3C8MA 3OJXA 2DTEA 4DEYA 2ECOA 3DAOA 2O2HA 3B5JA 1ZXLA 4TT3A 1DZ3A 2XB8A 5GZ6A 4ZJPA 2JLYA 3BSSA 1RMYA 3WRYA 1UPTA 5EQTA 5GV8A 1UAGA 5IZCC 4UMEA 3WADA 5DXAA 4JR2A 3I5XA 2QYOA 3BUSA 2C4HA 5CU7A 1YUBA 1XTUA 3AOEC 1XQ9A 3M82A 3GX1A 4BC1A 3HXMA 3L7DA 2DR2A 1XCOA 1YRQA 3GHHA 5L95A 2B9EA 3C1OA 1RPNA 4G3XA 3EGVA 1VE1A 1NI4A 2K6GA 3L0BA 3H1BA 3HJCA 2OV3A 2XDQA 1RFGE 1F9AA 3WLPA 5TT1A 4ND3A 1Y5NA 5A02A 3HR4A 3PUZA 3H3JA 4C7BA 1D8AA 1X1SA 2HOQA 2PZFA 5D00A 3S40A 5HF8A 1F2UA 4DLAA 4OFWA 2VUUA 1N2HA 4HQOA 3VNSA 2JVJA 4EATA 4HQ6A 4CRWB 4X1KB 2H1OA 2X3UA 5C8YB 1AKNA 3DMFA 5DM0A 1SBNE 4DDMA 2EKQA 3FVVA 3GJ7A 3SU8A 4RDCA 1IB6A 1EP2B 1DCFA 2B8NA 2P3OA 2FN9A 2W6JD 1GSIA 3WJAA 1UINA 1AQNA 4N76A 1IHDA 3CY6A 3WK6A 3P0JA 4NL4H 4L4XA 1YL6A 2LCFA 3BT7A 3EWNA 2OQRA 1GLGA 1P7YA 2UYQA 2MU1A 4K6KA 4DM7A 1L7AA 2FZWA 5EJ6A 1XLTC 1PJ2A 4KO3S 3TFWA 1LVHA 2AWOA 1QYIA 4HNVA 3ER6A 4B76A 4A2PA 5HS6A 1WR8A 1VQ1A 2VTVA 2O57A 1EUCB 5C80A 3QEJA 3K1AA 1JDSA 2GXUA 4AJJA 1NLYA 2O7VA 2WHQA 1TL7C 2P11A 2Z4RA 3B3JA 4OHVA 2HGSA 4EARA 4EH1A 1UEIA 3WYAA 4C2AA 4OQPA 5LZ9A 4IFEA 3KOUA 5KYUB 1KI2A 1APBA 2ONYA 1ZM9A 3B3GA 4BFWA 4EUHA 5AJUA 3QEBZ 3FD8A 2X0DA 2J7KA 2PQMA 3FNEA 3HKEB 4AWXA 1DEHA 1NPYA 1AB6A 4BBZA 3TQOA 3HI4A 4L85A 4UEOA 2B5OA 1YC2A 3VC3A 4RQTA 2HMAA 2YVUA 2VHXA 4ZQEA 3ICOA 3RIHA 3LWZA 4LDQA 1COWD 2VYQA 2BM8A 2Q6VA 2W00A 3RUHA 3HBAA 4G5XA 3L0DA 2YWFA 1ZAYA 1PGNA 5EJFA 3WO0A 4K86A 2E4UA 3I05A 2H5JA 2GEUA 2TECE 1BH6A 1L1FA 5LLTA 1TT5A 5AOVA 1W4RA 4D45A 1XTQA 3FMGA 3G7UA 2OV6A 3SCZA 1P5ZB 2WUVA 4EI9A 1GPH1 3GJ3A 2VF8A 3DC2A 3RWOA 4CETA 2HBYA 2OCLA 4ZEOA 2FQYA 4FYIA 4LKRA 4MMZB 4OL0A 2X8JB 5E6RB 1ZHFA 3ZHYA 4DDUA 1GKLA 1WVGA 4BRUA 3D43A 2Y05A 1G19A 2CMGA 3VTZA 4AP9A 1OVMA 4ENQA 4HYEA 1IL0A 2Q1SA 1ZG3A 4HGPA 1MORA 3VBCA 1XNJA 4IF6A 1KIFA 5KI6A 1PWEA 2IYWA 3BZWA 3H75A 4FK8A 1DPFA 4QJ3A 2FPGB 1EVEA 3F5DA 4M4SA 5AT1A 4DE5A 5EHZA 4NEHB 1IVYA 3K1ZA 4CIAA 3K9FC 1ISHA 5JNWA 3A4YA 3ICWA 3WC4A 3ESQA 3K2IA 1EWTA 4G9BA 2QMOA 5DWDA 2G88A 3JQ9C 4YP6A 3BDVA 2HI0A 4KQFA 1DTSA 4L0CA 2QAJA 4G5HA 4TWIA 3TQFA 3HMKA 3LT0A 4ZXFA 1DEAA 1Z2OX 1UFQA 4IS2A 3KS9A 4BVHA 1C2TA 4PC1A 3KXPA 1TFRA 1XROA 4NU5A 4D26A 3L1HA 4MEBA 2JZNA 1ODSA 3QLVA 4PNPA 3OIWA 5BSFA 4J9UE 7GPBA 3EZNA 3SHTA 1USGA 2V9CA 4RTOA 1ZGBA 3F3YA 1W59A 3CO0S 1SHZA 2HADA 4ML3A 4YCNA 2CUKA 1JE0A 2ERYA 2N75A 3RUIA 1UJNA 3C3MA 2WFLA 5JNUA 1REQA 2GWRA 2H7VA 4XFDA 5A3VA 5I7FA 1R0YA 1Z7WA 3CR8A 5CB4A 3OFVA 5CT6A 2KBEA 4X1YB 1LBHA 4UREA 1DIAA 1ZITA 3PGXA 3ZLBA 3HNRA 4RPKA 1F0KA 4A8HA 1ONSA 2D5AA 1NU8A 4MYDA 4OH1A 4WK2B 3FROA 3WDMA 5TY0A 1QGUB 2JJ2A 1EXVA 4WFQA 4KJZA 5B64A 1AO0A 3LQ2A 4KWCA 2O0HA 4BEVA 3HDQA 4BNFA 3QVMA 4H1UA 3ICCA 3AEUB 1YS2X 3DPSA 2Z2KA 4OAPA 4JXXA 3B3FA 1KMHA 3PQ4A 4QHYA 4CR7A 3SXPA 3VR5D 2NU6A 2FUKA 1B1AA 1FS5A 5EMKA 4HZUA 4KN8A 3I6MA 1Q0RA 1V37A 1WXHA 3MIIA 3OO1A 3RCBA 3GAMA 1V7ZA 1JAXA 1KGSA 4FGZA 3HXKA 1C9KA 3BOSA 4MV0A 4YTEA 3ZG6A 2H59A 2BGWA 3ASZA 4L0DA 4C01A 2I4OA 5KOHA 3FPCA 2OHXA 3K0SA 2J3IA 3ZDFA 2I0FA 1DOAA 4U6QA 1C8VB 2W0MA 4TQGA 2CBGA 1AS3A 2VF2A 5AI0A 2AV6A 2XUQA 2I4TA 3IBSA 1R00A 3PKIA 3LVBA 4HGZA 4EF6A 5IZ4A 5JJCA 3U61B 1AHHA 1LRJA 4XWOA 3FPSA 1JZSA 4BB6A 1IJBA 1UWCA 2Y1XA 3NAGA 2JBAB 1PWXA 3D4PA 3K20A 1UT6A 3QW4B 4ND8A 5KTNA 5EINA 5IVHA 3O3MB 3QV1A 3K53A 2ZYWX 4QDKA 3AEYA 3EZYA 2V5VA 3HEBA 4DJAA 1N5LA 2VUSA 4OK3A 5IJAA 4DCSA 3GGGA 4A8TA 1W46A 1J24A 2JEOA 2QGZA 4TSFA 1MEOA 2M9MA 2WSMA 2KQUA 2X9NA 4F6RB 2MSNA 1Q12A 2ECPA 4KE8A 4WKCA 3QBVA 5B53A 3IUQA 3HBLA 1V8FA 3ZZTA 3DCIA 5I4CA 3WKDA 2CCJA 2QUKA 1XXLA 1PJTA 1Y6QA 2GCPA 3E0QA 1MAUA 1NYRA 2NN3C 2O2DA 5E6UA 3IVCA 5JE8A 1U31A 2X1VA 1HTBA 3HG7A 4LSMA 5E3JA 4WEOA 1OAOA 3ODGA 4P92A 3UMFA 2Z1NA 4OFXA 4U2GA 1N6HA 2B7BA 2J33A 3VNQA 4H0CA 2HMTA 2PKRA 3SD7A 3KZMA 4PBSA 1XA3A 2MSKA 4JXKA 1V16A 2R7NA 5A1TA 1GPJA 5GQSA 4X94A 5I9BA 4EB0A 1BXZA 2CFOA 1QHNA 3E9EA 2JGDA 2XUFA 3I9FA 3LMKA 8ATCA 4HSGA 5AVRA 3R44A 5FNVB 4G5YA 2A58A 2XZTA 5IAEA 1R4NB 2I3BA 3IIEA 3NETA 3FUCA 4ZYLA 1ZK4A 1JRLA 1RS0A 4O4JA 4LRYA 1OFIA 1B6SA 4IGEA 5DISB 1QM5A 1O4VA 3R5XA 4KDRA 4K81B 1JQ3A 3M9XA 1JHQA 4XM1A 3SE7A 3N8NA 1CE8B 1TC1A 4W9NC 3DFKA 3GUVA 3LQKA 3MYRA 4NCKA 4Z4CA 3N0VA 4BXOA 2G8LA 1AN9A 2VPIA 3O8RA 3EW9A 2DMRA 4DXDA 3IUEA 1KDZA 3DO8A 4R0MA 2WV7A 1Y4ZA 3FHOA 1AV7A 2XVYA 1G64A 2R8BA 4A8PA 5A3JA 1RLMA 3P0HA 4CF4A 4JLVA 4E7OA 4N65A 2R84A 5JTTA 3HU1A 2OHGA 4KXNA 1NPTO 3KWMA 1L7RA 1NBWB 2IYOA 4YUAA 2XSZA 3RI3A 3G23A 3K9LA 1KEVA 5CVTA 1KEEA 13PKA 1N5IA 4N18A 1ZD4A 2IDMA 2IIVA 3FPLA 4NAUA 1QG6A 5J2UB 3U2QA 2C96A 3G8CA 4A10A 8GPBA 4J94A 2GS9A 5TEWA 3PL5A 1X1EA 2GZHA 5JDIA 4P2BA 3KZ1E 3WLRA 1TQDA 3N8IA 2HDNB 2QMHA 3L0ZA 3FF1A 4PHFA 2GRJA 5EZYA 4EB3A 1DC5A 1Y3IA 1WUJS 2BMJA 2OV4A 4HPXB 1R0WA 1Y5MA 4TL9A 1EFRD 2XUKA 4E88A 1Z8FA 3AFGA 3QKUA 3AVTA 4BRZA 2QRVB 2ZDQA 3B2EA 2Z6VA 4QAQA 4ARAA 1XTKA 1GNRA 5LL6P 1GGJA 3FJYA 1V6AA 3A9TA 1N6IA 3GL9A 3IEUA 2CL6X 4JN6B 1LPOA 5ELMA 3DE5X 5AOBA 2AG0A 1CFZA 2XWSA 2XZDA 2XE8A 3O03A 4R8SA 1IN5A 2I1QA 5ECDA 3HSSA 4DCVA 3O8BA 4LF9B 4QHSA 3A10A 5HIIA 1YVRA 1FYDA 3VOSA 1KAQA 4I50A 4I1SA 4KE6A 4GS5A 2LNDA 1MX5A 1OFVA 1WOYA 3EHEA 4R51A 5KYYB 3KC2A 5LXTA 4GZ3A 4ZODA 1PEDA 3S5UA 4PZ0A 3WIEA 4H1WA 1SD1A 4LTMA 2P0EA 1MOPA 5AKIA 3CXRA 2X19A 1HXHA 1UL1X 1GZVA 3CRW1 2B83A 2BH2A 4NBUA 2ID9A 4AICA 1Z4PX 1Y1TA 3C45A 2Q7OE 3SP1A 2BFPA 3OLQA 2VSNA 2FFRA 1D5CA 3G2PA 3GWGA 4EYOA 2I3GA 1QRSA 3B38A 1ESEA 2QN2A 1PFKA 4R8LA 3VJKA 4HVAA 5EEHA 1FSZA 4HMQA 5KYVA 2VAWA 3U7HB 3IQDB 1ECJA 1UOEA 2AS0A 1SZJG 3GGDA 1NVTA 1T35A 3KSUA 3EHDA 3E81A 2ST1A 3L7MA 4ZPJA 4RYDA 2J5QA 2RGYA 3H17A 3X1MA 1C1HA 3MERA 1QH8A 2IQ5A 4DADA 1NT2A 3OQIB 3MWYW 2J6IA 1KJWA 2Y1DA 1T8UA 1X74A 3A27A 4I36A 4BQFA 5HWSA 1YVPA 3PEUA 1ZCBA 2GEJA 4I4NA 5BSTA 5T41A 1ZLYA 1N2XA 4C03A 1KK1A 2F8LA 2Z83A 4P7BA 1PK9A 1QFMA 1UKZA 2P3SA 1R74A 2XNDD 1IY0A 3RT7A 1SQ5A 3EGIA 3GNQA 4X41A 4ARZA 1Y1RA 2Q99A 4P7GA 1OBHA 3H7AA 1MRNA 1SVWA 2XAUA 2ZI5A 2HTFA 4WLOA 3O4HA 3UPTA 2O07A 4M9XA 5IKOA 3WIVA 1N5MA 2V6GA 3FTEA 3VHLB 2HT6A 4WY8A 5CEEA 1TA0A 1QCZA 1U4OA 4HN9A 1OAOC 2VH5R 3LDGA 1FTSA 2OV8A 3K6RA 3LDUA 3TI9A 4TUYA 1XELA 3HNOA 5HFNA 1FFAA 4WCVA 2PUAA 4QTYA 1J7JA 4Q1EA 3WGUA 4MV1A 1FU7A 1T4CA 3L6OO 4RF2A 3ZIAA 1CY6A 3LX8A 1GJRA 5CW2A 2FR8A 3JWGA 3LNTA 5H3LA 2O5EA 1JFFA 4ZCTA 1UC4B 1QFYA 1US8B 5AI8A 4ZVKA 4B45A 3AY7A 3I4LA 7MDHA 3GUHA 4NZNA 3DAFA 3E9QA 4J03A 4E3WA 1G2QA 2DWQA 3H2HA 3QJGA 4UM7A 4C08A 5I7AA 3DA8A 4M22A 2IYTA 3GUUA 4RJ2A 4WCFB 3EIWA 1N9GB 1E3WA 1YWGO 2FE1A 1O0CA 1MZVA 1YRBA 1GZHB 2WMNB 3CRVA 4FIDA 3JVEA 3CBGA 2IE0A 4NCIA 3ZJUA 4HBGA 5DTJA 3SYKA 3KSBC 4REMA 5L7YA 4KSCA 5K05A 2QRZA 4MUYA 4UCQA 4DUYB 4AZ0B 4PM4A 4CQNA 4WN3A 2PL9A 4DCCA 3ZNQA 2OXEA 3BWVA 1XP5A 5B2ZA 3SQWA 3KLBA 3KUCA 4NMXB 1UKBA 2HKIA 3HA7A 4L9AA 3GJ8A 4TVBA 4YJ2B 5SZJA 4BLTA 1CJUC 5K0BA 1H3EA 1EQUA 3GRKA 4PRLA 1SCAA 2GPAA 1JNYA 1AMOA 2VFAA 3HVJA 1ABEA 3RVBA 3CKYA 3KR1A 3VVBA 1LJ8A 5DT9A 4DREA 2PSSA 3UAXA 1YIAA 1A5AB 2YHUA 3FCCA 4S1PA 3NRJA 3QNUA 4EF5A 621PA 4BGDA 3UENA 3B78A 1OXXK 1Z3IX 1YKSA 1FYEA 3EFOA 1GPYA 3GZJA 5FULA 4B6OA 2AIRA 5D5QA 5BOSA 4ALLA 3NTQA 4DLZA 3TIIA 2I4LA 4AURA 1YDFA 1A9XA 3EPLA 1B43A 3LECA 5E7IA 1QKJA 2O8VA 1B42A 4M60A 3TS1A 5E2BA 4BGVA 3IEVA 4NZ9A 3UG7A 2AZDA 3ZIAD 5G40A 3AG5A 4UBIA 3SYNA 3EQ6A 1J2JA 3ZV7A 4ACAA 4BMSA 1M5RA 2HUNA 1T6BY 4JOSA 3KM0A 1LEHA 3IV7A 4Y18A 4C6TB 1EBFA 3U6KA 1J8YF 1KO8A 1NHGA 3PCRB 4LAFA 3AHGA 3VQTA 4OHWA 1DAGA 2ZM5A 3KOXA 1DUVG 4X95A 3ZH9B 2I03A 1CUEA 4JYBA 1HFKA 1MOSA 4KOEC 2B4TO 4NR0A 2WT4A 2RK4A 2Q0XA 3DT9A 4GKKB 5AVUA 3PHJA 3C7CB 3ON5A 4X5OA 3NHYA 4BO6A 3I5MA 2A9PA 1WP9A 3DE7X 5JLAA 3RC2A 3TZLA 3V7YA 1I3KA 3E7XA 1A88A 1PW5A 1BHSA 1NW4A 2J59A 1HX7A 2QLJA 3AKCA 3KYCB 5ED0A 3LCVB 4I3GA 1M34E 1P5RA 2Q5QA 8ABPA 3DYVA 2CNLA 3O3NB 2NPFA 1TYEB 1V1MA 3HJUA 1YAHA 3UMBA 2VHUA 5GONF 1G7CA 4GLFA 5IFLA 4QPCA 4Y98A 4PLVA 5T6BA 4YV0A 1WQ3A 2DHCA 5FUMA 1M33A 3V9PA 4LF7B 2YH2A 2PS3A 2ZRLA 3D3NA 3GI1A 3U60B 2I2WA 5HP4A 2A59A 1J33A 2NACA 1QTQA 1QXSA 5J23A 1RXIA 3RUEA 4YQZA 2O2IA 2G25A 1KSHA 1JIJA 1P0MA 2CJWB 1ZN2A 1Z56C 2QVYX 3ELWA 4PZ9A 4XVUA 3OE7A 4OAOA 1HEUA 2GWHA 3KJXA 4FUTA 1Z4QA 4JU9A 4M0CA 5EKSA 4BVBA 1Q2UA 3W06A 1E2MA 3P0RA 3FPFA 4XB2A 2DFVA 3FAZA 5K3OA 4BQPA 2NVWA 1KY2A 3CCFA 3FDJA 3ZK8A 3KOOA 3C41J 2TMYA 3FB1A 2NXWA 3DCYA 5AXCA 3I6YA 2EVWX 4WUVA 1XTPA 3KAJA 1NY5A 4R2WA 3W04A 5JQGA 1FDRA 3ZU4A 1SK8A 1S2OA 4V0MA 4HB4A 1H2YA 1MGPA 3CTPA 3N6XA 1Y8RB 3R1IA 2EL9A 4MRRA 4JEHA 4ZMSA 1QKIA 2BZSA 1DADA 2ZW9A 3WB0A 4BFYA 1JHDA 3G2MA 5BYBA 4BQIA 4NYIR 4NJEB 4DDWA 4JX8A 3D4OA 3GIWA 4OBXA 4E5KA 3VO1A 3F1KA 3WLLA 1L4UA 4A6EA 2AMFA 5JJLA 4J3JA 4PE5B 4RD1A 3G79A 1F4PA 4UEKA 1JIIA 1U28C 2BHLA 4PFJA 5M3BA 3UG6A 3UHOA 1Y6FA 4ENVA 1IY8A 1RWBA 1E2HA 4MICA 3OQVA 3G5LA 2NUPB 1MR3F 1UPUA 2YCBA 3KVOA 1QE0A 2M6LA 5AW8A 5IPFA 2I7VA 2YDXA 2Q1TA 4JWTA 4P7KA 4XLLA 5DV9A 2WUWE 5HCIA 3R76A 2WHXA 4FX5A 2XVAA 2JFWA 3DTVA 4JT2A 3UMRA 4I1RA 4E5SA 4FHGA 2GNAA 1MH9A 1DG1G 1PZXA 3E0XA 3PGMA 3WGIA 3BD8A 2UV8A 2G77B 3GCDA 4H9GA 5CCXA 1J0XO 2C8LA 3THXB 4EG8A 4ZTUB 4Q0MA 1NLFA 4J43A 5HFJA 3FM9A 4GXTA 1E1MA 4HDSB 4NMLA 3SFTA 4LRTB 3VSAA 4WBNA 2RAPA 2FCAA 4B7CA 4MB6A 2JI8A 1T8PA 3VR5H 3ZCXA 2RHOA 4AIRA 1UDWA 5HK9A 2H1WA 3I04M 5F4BA 2GEDA 3AL0C 4IY1A 1KMIY 1GV0A 1OH8A 2GCGA 2VIIA 4F7DA 4K6MA 2GD2A 3K2BA 4GPBA 2XV1A 3B6ZA 1O9BA 3OD5A 4YXWD 1I30A 3ANYB 1P75A 3Q6MA 1ARZA 4A0GA 4ID9A 3AVOA 3PDIB 3IE2A 4MWDA 2XTNA 4S1TA 4XOIA 2QLFA 5FNVF 1E8MA 4PFKA 1FBNA 3HN7A 1PYGA 3NKFA 4LV6A 5CVJA 2WABA 4D3XA 2C7PA 4EKGA 4CCSA 3IHTA 1NVEA 4YDRA 3KJFA 4MUBA 5EKXA 2A9OA 4LV8B 2IBSA 4RPLA 1CRPA 4ZWNA 4CR8A 4UMDA 1ZO8A 1KJZA 2BEWA 3KV3O 4LQ4A 5LBUA 3TSYA 3TZHA 4TZKA 1KS2A 1CBUA 1QYWA 1O94D 3ABSB 2ATVA 3WXBA 5IXYA 2G9RA 2XGOA 3PC4A 1Z8NA 2OHFA 4O5OA 2IYEA 1OMOA 3MJCA 1SNYA 3NYQA 4ZXPA 3M70A 3G9XA 4Q1BA 3U3DA 4NCBA 4TMZA 1WBDA 3ZQ6A 3TJMA 1KYQA 1XQYA 3BL5A 3L6DA 2QLLA 1YULA 4ZQIA 1QFJA 1Y3DE 1S2IA 3D6HA 4KQCA 1MEJA 2PJZA 1CLEA 1EI9A 1O6BA 3AVQA 3IHLA 1ILEA 3T1YB 2CNWA 2F48A 2AOUB 4V02A 3VZPA 2NVUA 2PPVA 3G89A 3KPVA 4ZZ0A 3E53A 3VUFA 1MD9A 3LK7A 3E3LA 4GLBA 4U6SA 1R4AA 5KMGA 4EHBA 4MKZA 4QU8A 3FAKA 4RGQA 3SBXA 2H00A 1UUFA 1P29A 1SUWA 4PCUA 4BO1A 1TMYA 2ECFA 2GJ9A 3BWEA 1QGOA 3INTA 3X1JA 3DPUA 4HQRA 1DBRA 4MS1B 3WP1B 2FI1A 2G8NA 5AJWA 4E5PA 4ZPXA 5LQKA 1H9CA 1R18A 3NZEA 4IHAA 2DFKB 4NU8X 5TVKA 4GOND 2FRVA 3DOEA 4BYMA 3N39C 3DTTA 1OZHA 1Z45A 2XOEA 5GWXA 2YC4C 3VYRB 4L2IA 3RTCA 5JG7A 4WCDA 1ESNA 4R40A 3KTOA 2GZSA 1Q74A 3DOOA 1SKQA 1ADCA 2FK8A 5DTRA 3TH5A 1N5OX 2TRSB 4Q3NA 4F5YA 2CXOA 2ZSJA 2CXPA 3SJAA 4PPNA 1AZLA 2PO7A 4TV9A 3FNIA 4IWXA 4HRVA 3KOWA 2Q3FA 4A8JA 4U2BA 1GTVA 4ARVA 1EX1A 1JL3A 1U0OC 3RNOA 4YALA 4RZ2A 3WVNA 3KL4A 1FX1A 1H2BA 4EQZA 3PXUA 2ZCUA 2H8GA 3D2AA 3RFFA