4F2IA

Crystal structure of glutaredoxin-like nrdh from mycobacterium tuberculosis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
84
structure length
83
Chain Sequence
b'TVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVAGNDHWSGFRPDRIKALAGAALTAHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mycobacterium tuberculosis NrdH at 0.87 A Suggests a Possible Mode of Its Activity.
pubmed doi rcsb
molecule keywords Glutaredoxin NrdH, putative
source organism Mycobacterium tuberculosis
molecule tags Electron transport
total genus 21
structure length 83
sequence length 84
ec nomenclature
pdb deposition date 2012-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4f2iA00
4LMVA 4WF5A 2PVQA 4G10A 1XXUA 3GKMA 3ZTLA 1NHYA 2A2SA 1UVZA 1AQVA 1QUWA 5GZZB 2GQLA 2BTOT 1J9BA 4E8EA 2PERA 4O32A 1XWBA 1XVQA 1AUCA 4RI6A 1EOHA 2GSTA 4FH8A 1JZRA 3UAPA 3VLNA 5ECOB 4ACSA 11GSA 5IMCA 5ABRA 3HDCA 2H8LA 3FW2A 4Z7XA 2CZ3A 1RK4A 3F3QA 5F05A 1CQHA 2DMMA 3US3A 3TKQA 4EKZA 3TKRA 1OE8A 3O76A 4EE0A 3MSZA 4HQSA 4XS6A 2FHEA 3EC3A 3F8UA 2JACA 1SD8A 3HA9A 2H6XA 2FNOA 1VF1A 2H70A 3LYKA 3EURA 2B7JA 3VURA 2ON5A 1GULA 4MF5A 1U3AA 17GSA 4JR6A 2QC7A 2C3TA 2G0FA 4BWSA 1O7UA 4LL1B 1BG5A 5A4VA 3QFBC 2MBSA 1PMTA 3KTBA 4MH2A 1OVNA 1U88A 3FR9A 1SK2A 1BYEA 2LRTA 5IMVA 2PN8A 1Z7PA 4K2DA 4ECJA 3DIEA 3GV1A 2H66A 1T4ZA 4POLA 4KB3A 2PVOC 2DJJA 4ZL8A 6GSWA 3GTUB 1YKAA 1R26A 3HZ4A 2A4VA 2NDOA 4IS0A 5F0GA 1NM3A 2RIIA 1EV4A 4ISDA 1PKZA 3LWAA 1YQ1A 2K18A 1AC1A 2EIOA 2VO4A 4K7NA 1F3BA 3CRUA 4Q5RA 2YZHA 1SK0A 3G7JA 1SD9A 3KIJA 4FYCA 3HCZA 3WYWA 1DE2A 4POMA 1WP0A 3I9V2 2N5BA 4POBA 5JCGA 5KN2A 4TKYA 1TRUA 1T8EB 1WIKA 1F6MC 3UOMA 1GSEA 2LUSA 4WKWA 3IRAA 1M2DA 2X99A 2IMDA 5GAND 1AW9A 3RHCA 2JADA 3TKSE 1PD21 3PINA 1SYXA 2GT5A 1A24A 3C1RA 4TR4A 2DIZA 3GFKA 3TRQA 2HI7A 2JSYA 2IMFA 2FA8A 5IO2A 3RHBA 3DD3A 3IHQA 4OCEA 2M72A 3CTGA 4L5LA 3IA1A 4PXOA 3HJMA 1K3LA 3I6AA 5JWQB 3J7Yb 5LNKe 4YQMA 2E7PA 4HU7A 3Q19A 2R5GA 5GAPD 4HEA2 4ILFA 1C72A 3FKFA 5AISA 4IBPA 3MDKA 4WEYA 4V2NA 1XIYA 5J3RA 4KUNA 1SKRB 5IMFA 1JZWA 1PGTA 4N0ZA 1VF2A 3GRXA 2LJAA 2O8VB 4V1Ag 2WB9A 3WD6A 5B8BA 2R4VA 5CREA 4AJ7A 2GS3A 1HYUA 3HJOA 5A5KA 3KXOA 2MYGA 3EMPA 6GSTA 4FYBA 3SWLA 2OE3A 4WBJA 2EIRA 1FAAA 4TOPA 4XRAA 3L0HA 4MZWA 3HVSA 1OE7A 1QMVA 4NWYA 2DLXA 1USBA 3GA4A 4NMUA 1YEXA 3ZYWA 1SL1B 5HR3A 3DWVA 5J5NA 3KEBA 4XIHA 4KDXA 4YQUA 4TVEA 2VCTA 3C71A 1MDIA 2FLSA 1TU7A 3PGTA 4N10A 4ECIA 3I69A 1MDKA 4MJBA 3NOFA 3M1GA 3GTUA 3TCOA 1RQMA 3S9FA 1KNGA 4NAXA 5IO0A 1V57A 2E2MA 3M3MA 4GWRA 1FB6A 4TXVA 3ZVJD 2OJLA 3H4KA 4HJMA 1YY7A 1K0CA 5KEJA 2HE3A 2WDUA 4KX4A 5GSSA 3WGXA 3LG6A 3WGEA 4TN8A 2WRTA 4WR5A 2H74A 5ECRB 4HJ2A 2H19A 1GSQA 4RQXA 1XWCA 2WFCA 2FD3A 5G5EA 4AJ6A 2BJXA 2F3MA 2FWEA 2KP2A 1HD2A 3UVTA 2B7KA 1ERWA 2WULA 1A2LA 4LA1A 1FOVA 4ZB9A 1XPVA 2ZNMA 3F6DA 1MD4A 1M9AA 3VI5A 3CXGA 3HY2A 3RDWA 5H5SA 2VL2A 3QPMA 2V32A 5G1KA 1T7PB 2RLIA 5F06A 1GSYA 2FWHA 1NSWA 1N8JA 3F4RA 3QD9A 1YJ6A 2G2QA 2GSSA 2H71A 2DMLA 1Z9HA 2H76A 5E4WA 4IJ3A 4XRDA 3R2QA 2L57A 2C1YA 1AXDA 5CRWA 5JCWA 2R6KA 5IOWA 2F51A 1Y6EA 2I3YA 1X5EA 5JCUA 4N11A 1SU9A 3HD5A 4MPFA 1ML6A 2VLTA 1LU4A 4ECBA 3APSA 4K7OA 1XOAA 2CV4A 2FGXA 3G7IA 1MDJA 3KP8A 4IQAA 2CVDA 4IELA 4ZL7A 3H79A 1ON4A 3FZ4A 1TJDA 18GSA 4JEDA 4WXTA 2DIYA 3V1WA 1TP9A 4JRRA 3FK8A 2CT6A 3QAWA 1XWAA 1TK0B 1GTAA 5FHIA 3TJKA 2K9FA 3A2XA 4HU9A 4KNDA 5A4WA 2LSTA 5GSTA 4E8HA 4YQVA 3HVXA 1XWKA 3U6VA 2X8GA 3ERGA 2OE1A 4PX1A 3O6TA 3GSSA 3A2VA 3DEXA 3DGQA 3RPNA 4EXJA 1V58A 4GQCA 3FZ9A 1QXHA 4AF2A 5DJMA 1WOUA 3F0IA 1OKDA 2GQKA 5G1LA 1GUHA 4LMWA 1S3AA 2E2GA 3CSJA 4QL9A 1BAYA 2GQMA 3W8SA 3LXTA 4OCFA 3MWHA 1HNAA 4XCSA 3IBHA 1YZXA 3I43A 2I1UA 4PQIA 2VOCA 1AQWA 2IMIA 5EY6A 3VPQA 2H01A 4BWQA 3D5JA 1YEPA 4PQHA 1Q98A 3K8NA 4MZCA 3MNGA 4HDEA 3UEMA 2VCQA 2YWNA 5HR2A 5LCZA 2H30A 6GSXA 5J9CA 1G7OA 3EYTA 1EV9A 3VWUA 1SJIA 5DCHA 3GUSA 3FR3A 3LORA 4LLRA 2C80A 5LD0A 3C1SA 3GYKA 1HQOA 2YPMA 2NPBA 2E0QA 4HI7A 2PWJA 2DJ0A 2IIYA 1GSFA 1VGLA 3BD2A 2KLXA 2LRNA 1KEBA 5B7CA 4FYUA 1DSBA 2DJ3A 2PPTA 1CQGA 5DALB 5DQSA 3DRNA 2J9HA 3RPPA 4MF6A 3ZMLA 3ME8A 5DDLA 1H75A 3HHVA 4I2TA 4ZBDA 1GUMA 4KAEA 3GKNA 3KCMA 1XVWA 19GSA 2MMOA 1BX9A 3QCPA 3F4TA 4O92A 4KCEA 4TR0A 2JZSA 1SL0B 3PH9A 1BEDA 4QL7A 1PL2A 2YWIA 4GF0A 3VWXA 3TRXA 1SKSB 3GNJA 1EEMA 2H0GA 1GSUA 1EGRA 5INYA 1R5AA 3QR6A 2GSQA 2VLVA 3IV4A 4RI7A 1K0AA 2MMAA 3LJRA 3TJFA 2CQ9A 1JHBA 2OACA 2X64A 3ED3A 4ULXA 10GSA 3LYPA 4IW9A 4OWYA 4TRXA 1TXXA 1W4VA 1ZCPA 4MP4A 5HQPA 2GZYA 5IPHA 1PSQA 3APOA 2GSRA 2HSHA 1UC7A 1EP7A 2YV7A 4QQ7A 2PBJA 3GL5A 3UL3A 4I5QA 5A4UA 5AIVA 2X8HA 1SJ6A 2C0FA 5DCGA 2NVLA 4J57E 3GL3A 2FUG2 5ECHB 2IFQB 1B4QA 3L9SA 3ME7A 5HR0A 3IC4A 3D4MA 4PNFA 3ZL5A 4JE1A 2Z9SA 4MK3A 1TRWA 4F9ZA 1GWCA 2L6CA 3IK9A 1J08A 14GSA 2R37A 4K7IA 2VL3A 2IPAA 2JZTA 5D73A 3M0FA 1UN2A 3ZLPA 13GSA 1PRXA 3P2AA 3TGZA 3G9BA 2EIQA 2C4JA 1V98A 4F0BA 1ZYEA 3DMLA 2IMEA 1FG4A 1WE0A 4EDYA 1JFUA 3L4NA 3ZREA 1YF0A 3TJJA 2DSAA 3TJBA 1Z3EA 5IPGA 3VK9A 1U6TA 2V1MA 3A5WA 1GL8A 2YNXA 3M8NA 3TDGA 1A8YA 5ID2B 4PURA 2WGRA 3GH6A 1Z5YE 4IJIA 3JCML 1TKDB 5F07A 2QGVA 3KTLA 3FHKA 5HFGA 3KH7A 3BCKA 1VF3A 1X9MB 4HOJA 4PQ1A 4POKA 3GX8A 4PNGA 5KN0A 1B48A 1G6WA 1YKCA 1XW9A 2OA7A 3L9UA 5HFKA 3C8EA 2AUVA 3E9JB 2IMKA 5H5QA 1GSSA 4I2UA 4V2LA 1OC3A 5CYYA 4ZBAA 4IKHA 5DJLA 1B9YC 1EGOA 3UIWA 2V6KA 1EWXA 4CW9A 1DUGA 1K3YA 2CAQA 1ZMAA 4N0VA 2VD0A 3ISOA 2PGTA 3TKSA 1LBKA 5ECLB 4GXZA 2FWFA 1WWJA 3ZVJA 5D9TA 1G0TA 2V41A 2C0GA 3KGKA 2QSIA 2C0DA 4IP6A 3J7Yk 2M46A 3EMXA 1Q4JA 5D93A 1G6YA 2IFQA 1I5GA 5JWRB 3FRCA 4IVFA 4XS4B 1GH2A 5IOXA 2VL9A 1VRSD 5E59A 2P5RA 2YCDA 2B3SA 3VPTA 3ZIVA 1F3AA 2KP1A 6GSYA 1R5PA 2K6VA 3F9UA 16GSA 1U3IA 2HZEB 4KA0A 2L5LA 1TI1A 3BJ5A 5IMDA 2AV4A 2H6YA 1SYRA 3TJGA 4J2FA 2LQQA 4MF7A 2LJRA 5ECQB 1V9WA 3TB2A 2CAIA 3O3TA 4G19A 2O87A 4JZQA 1SENA 4BVXA 2H1BA 3M9JA 4ZILA 1PA3A 4EO3A 3N5OA 4K9ZA 7GSSA 1B9XC 1TW9A 4BPYA 1A8LA 2AHEA 1QQ2A 3GH9A 1V2AA 5DBQA 2H73A 1A2JA 1X0RA 2MZCA 1K0OA 5B8AA 2I81A 2FWGA 3FY7A 20GSA 1Z6NA 2FA4A 4IP1A 1TK8B 5D9XA 4NV2A 5IIZA 2JZRA 1URMA 1A2MA 4OFMA 1PX6A 3CSHA 2C0EA 2JU5A 2H6ZA 3ERFA 3HVVA 2F8FA 4MABA 4EDZA 3NZNA 1TK5B 2CX4A 2FY6A 5J4UA 2LV3A 3CTFA 1HNBA 4PUAA 2CA8A 2HXKA 3GMFA 2XPDA 3EINA 2K8VA 3EU4A 3P8WA 3FEUA 3UVHA 2A2RA 2I4AA 3QAGA 4MJAA 3D0ZA 5JWOB 2XPEA 3HKRA 2BMXA 4MJCA 5AIXA 5ELGA 5G30A 1QGVA 4H86A 5AN1A 2ON7A 2GZZA 4BVYA 3ERWA 4HZ2A 2HLSA 3GURA 3GX0A 2XBQA 1AQXA 2DC5A 2VCVA 3GIXA 4GSSA 1DBYA 3DYRA 2H72A 3W6GA 4CDOA 3QFAC 2OKAA 3DVXA 2PUKC 1TOFA 4HUAA 5AGYA 1NW2A 3RAZA 5IMZA 3UMAA 3ZFLA 4Q5NA 2K8SA 1K0DA 3KP9A 1OYJA 6GSVA 2LEGA 1M99A 4TR1B 4WR4A 3KM6A 2GVPA 1M2BA 3UJ1A 1EEJA 1JLWA 4XS4A 1SKWB 1X9WB 1XW6A 3TRPA 1SL2B 3HYPA 5COHA 2X8CA 4MDCA 2LNTA 4KW6A 2HZEA 4Q5FA 1XZOA 2TIRA 2B5EA 2VAFA 4MJEA 4OD7A 2MMNA 1VF4A 2CVKA 3RBTA 3UBKA 3PR8A 4Q5QA 4ZIJA 1ZGNA 3KJYA 3D4TA 1M0UA 1T00A 1GLPA 2AYTA 1A0RP 1XW5A 3QDNA 3CMIA 5CRDA 5EL8A 4V1Ap 2YANA 2XC2A 1ERTA 4MLYA 5CP1A 2WJUA 4GRFA 2H0IA 1XBSA 3KZQA 2H75A 2WCIA 5L71A 1H4OA 3A3TA 3H93A 4MA9A 4TXOB 4KDYA 4ZB6A 1GTUA 2VM2A 3CYNA 4KSMA 4OFNA 3W8JA 2LRCA 2YZUA 4F82A 1DE1A 4NV5A 4GLTA 1THXA 2XBIA 2LQOA 4DSQA 1OC8A 4K0GA 1NHOA 3L9VA 1B4PA 3TKPA 1EOGA 4XS1A 1F37A 5EPFA 4N30A 1GTBA 1XFLA 4EVMA 2VL2C 3QOUA 3LQ7A 4KGIA 4EF0A 4BA7A 2GLRA 5CNWA 2C8UA 1OKTA 6GSSA 3TOTA 4IHUA 3UARA 3EU3A 3SBCA 4OFTA 3KH9A 1OC9B 2N5AA 3FZAA 2PMTA 2B5XA 3C73A 2VCWA 3GHAA 1ACVA 3F4SA 1LJRA 3N9JA 4JBBA 3VI7A 9GSSA 4L8EA 1IYIA 4IQ1A 4KH7A 5ECNB 1TRVA 2H1AA 1A0FA 1GNWA 5D8IA 4YH2A 5CAXA 4L5OA 1SJZA 1M7TA 4TR1A 2CZ2A 2HFDA 2R3XA 4ML6A 3QAVA 5ELAA 3DVWA 2N5FA 1GLQA 5KN3A 3A2WA 3EWLA 2KHPA 3IAS2 1X5DA 4GSNA 1PX7A 2FCHA 5ECIB 1IYHA 2VIMA 3VWWA 1R4WA 3KMOA 3LSZA 3C7MA 1MEKA 4WETA 4HQZA 2JL4A 2QKEA 4GTUA 3U5RE 1I9DA 3CBUA 2RM5A 4DEJA 2AAWA 2B5YA 5DAKB 3ZITA 4G9HA 4ZXGA 3F3RA 2YN1A 2YJHA 5ECMB 1J0FA 1T4YA 3F63A 4MH3A 5ECSA 2VM1A 3EVIA 2O89A 2CVBA 1W89A 4EC0A 4D73B 5H5RA 4L0WA 4WBRD 1S3CA 2OADA 5DVBA 4TXOA 3TUEA 2RUEA 1ZOFA 2F9SA 1THOA 1PKWA 4OO5A 3L78A 4XHMA 1JZDA 2EC4A 3WT1A 5G5FA 5ECKB 4O7HA 4MPGA 2ZUPA 2GT6A 2HRNA 2WS2A 2LNSA 1K0MA 1O85A 5FWGA 4AJ8A 3FR6A 5DALA 2AJQB 4MZBA 4KE3A 4OO4A 3G7YA 1KBNA 5CO3A 2H1GA 2LTKA 4EUYA 2GGTA 4FO5A 4KCAA 4KSOA 1TU8A 2H1DA 2YOIA 3IK7A 3LGCA 1N2AA 2LKUA 5C00A 3H1NA 1GRXA 3E0UA 1OC9A 4ZB8A 5FT3A 3P90A 4K6XA 4I8BA 5B6MA 1K0BA 4WF4A 5IM9A 3AY8A 1A23A 1B8XA 4IN0A 1FHEA 3P7XA 1WMJA 2P31A 1EP8A 1Y25A 6GSUA 1K0NA 1O8WA 1U87A 2L4QA 3WT2A 1BQ7A 2IWTA 2IJYA 4EL1A 1M9BA 3ZMKA 3GKKA 3WGDA 3CSIA 1PN9A 4CHSA 4JU5A 1X5CA 4X43A 2ZCTA 1FO5A 3HZ8A 4LL4B 3BOAA 1GSDA 2D2ZA 3LXZA 2R2JA 3IOSA 3HXSA 4X0XA 5DAKA 2F8AA 2RUFA 2PU9C 3KMNA 3ZRDA 1WPIA 4HS1A 2J23A 2WZ9A 4YAPA 1X9SB 1WRYA 3LEFA 1E2YA 1XWGA 4BL7A 8GSSA 1TI3A 4D73A 4HZ4A 2YWOA 2YWMA 3UBLA 1M2AA 3ZIJA 3CRTA 4X1UA 2LS5A 1KTEA 1ZZYA 2YV9A 4DSSB 4F0CA 2M80A 1O73A 5D9VA 2GDRA 4OMVA 4J56E 5KN1A 3LFLA 1HNCA 2VCZA 1T1VA 2HT9A 1F9MA 2ES7A 5IMAA 1QK8A 3APQA 2VD1A 2IN3A 4JR4A 1Z7RA 3M9KA 3IE3A 4P3YB 2GZPA 4RUVA 5EVOA 2REMA 2LJKA 2VUPA 2C3NA 2I9HA 3BCIA 4K0NA 4GQFA 1UA5A 3D21A 1ST9A 1OAZA 4G2EA 2OBKA 3GN3A 5J9BA 1V40A 1FB0A 2TRXA 2DBCA 5D96A 4PUFC 1O8XA 2L4CA 4ID0A 2O7KA 3IDVA 3HJPA 1FVKA 5ID2A 1EZKA 3OR5A 1E6BA 2HYXA 1RW1A 1FW1A 2AB6A 2OE0A 1O81A 3IXRA 2L59A 1SK1A 2B1KA 2C3QA 1ZYQB 4I97A 1ZL9A 2YP6A 3EE2A 12GSA 1JLVA 2VLUA 4L0UA 3DKSA 4ZL9A 3Q6OA 4DVCA 1S3DA 4FIWA 22GSA 5G2ZA 3Q18A 2NBSA 1MTCA 1JZOA 2V2GA 4ZBBA 5ENUA 2HSYA 2RM6A 2B6MA 1YDKA 2L6DA 1GUKA 2DJ1A 4RQRA 4PGTA 1T3BA 3NIVA 2V6OA 1XCCA 4K8MA 1AIUA 1GTIA 1TDIA 2KUCA 4IGJA 4NPBA 1BJXA 3TOUA 4ECCA 4KDUA 3MAKA 2GTUA 4TW5A 3IR4A 4NXIA 2JSZA 5J41A 2P0GA 1ERVA 5D9WA 3ZFBA 3BBYA 5CRGA 4F2IA 3IPZA 5DQYA 2OBIA 2H0HA 1PL1A 3DXBA 3TKSC 3FZ5A 1XOBA 4DSSA 1ILOA 1AAZA 3VFIA 1F2EA 5B6NA 2HNLA 1ERUA 1TRSA 1WJKA 3D6IA 1Z6MA 5IQYA 4GCIA 2NTOA 2XHFA 1O6JA 4YAVA 4MMMA 3D22A 4V2MA 4XTSA 1GP1A 1R7HA 1PQNA 2VCXA 2DJKA 5C04A 4GSTA 4DSRA 3F6FA 1YF1A 5HR1A 4AGSA 3E3EA 2ALBA 2TRCP 4ML1A 1K3OA 2HRFA 3KD0A 3GKXA 2YJ7A 4MCUA 3QMXA 3GSTA 4F03A 5HFIA 1GNEA 2CX3A 4NHWA 2HZFA 1TTZA 4I6XA 5ECPB 4O5RA 3Q74A 2DJ2A 2MMZA 1MD3A 3FYGA 2P5QA 2IL3A 3H8QA 3ZZXA 5G31A 1ABAA 5CRHA 4K1FA 2O85A 2KOKA 3IAM2 1QFNA 2B1LA 2L5OA 1FVJA 3VWVA 4TR3A 4NHZA 5F8BA 1G7EA 2MBTA
chains in the Genus database with same CATH superfamily
4LMVA 4O5QA 4WF5A 2PVQA 4G10A 1XXUA 3GKMA 3ZTLA 1NHYA 2A2SA 1UVZA 1AQVA 1QUWA 5GZZB 2GQLA 4X4JA 2DKHA 2BTOT 1J9BA 4E8EA 2PERA 4O32A 1XWBA 1XVQA 1AUCA 4RI6A 1EOHA 2GSTA 4FH8A 1JZRA 3UAPA 3VLNA 5ECOB 4ACSA 11GSA 5IMCA 5ABRA 3HDCA 2H8LA 3FW2A 4Z7XA 2CZ3A 1RK4A 3F3QA 1M3JA 5F05A 1CQHA 2DMMA 3US3A 3TKQA 4EKZA 4K2XA 3TKRA 1OE8A 3O76A 4EE0A 3MSZA 4HQSA 4XS6A 2FHEA 3EC3A 3F8UA 2JACA 1SD8A 3HA9A 2H6XA 2FNOA 1VF1A 2H70A 3LYKA 3EURA 2B7JA 3VURA 2ON5A 1GULA 4MF5A 1U3AA 17GSA 4JR6A 1XG8A 2QC7A 2C3TA 2G0FA 4BWSA 1O7UA 4LL1B 1BG5A 5A4VA 3QFBC 2MBSA 1PMTA 3KTBA 4MH2A 4HSCX 1OVNA 1U88A 3FR9A 1SK2A 1BYEA 2LRTA 5IMVA 2PN8A 1Z7PA 4K2DA 4ECJA 3DIEA 3GV1A 2H66A 1T4ZA 4POLA 4KB3A 2PVOC 2DJJA 4ZL8A 6GSWA 3GTUB 1YKAA 1R26A 3HZ4A 2A4VA 2NDOA 4IS0A 5F0GA 1NM3A 2RIIA 1EV4A 4ISDA 1PKZA 3LWAA 1YQ1A 2K18A 4Z2RA 1AC1A 2EIOA 2VO4A 4K7NA 1F3BA 3CRUA 4Q5RA 2YZHA 1SK0A 3G7JA 1SD9A 3KIJA 4FYCA 3HCZA 3WYWA 1DE2A 4POMA 1WP0A 3I9V2 2N5BA 4POBA 5JCGA 5KN2A 4TKYA 1TRUA 1T8EB 1WIKA 1F6MC 3UOMA 1GSEA 2LUSA 4WKWA 3IRAA 1M2DA 2X99A 2IMDA 5GAND 1AW9A 3RHCA 2JADA 3TKSE 1PD21 3PINA 1SYXA 2GT5A 1A24A 3C1RA 4TR4A 2DIZA 3GFKA 3TRQA 2HI7A 2JSYA 2IMFA 2FA8A 5IO2A 2A2PA 3RHBA 3DD3A 3IHQA 4OCEA 1ZYPA 2M72A 3CTGA 4L5LA 3IA1A 4PXOA 3HJMA 1K3LA 3I6AA 5JWQB 3J7Yb 5LNKe 4YQMA 2E7PA 4HU7A 3Q19A 2R5GA 5GAPD 4HEA2 4ILFA 1C72A 3FKFA 5AISA 4IBPA 3MDKA 4WEYA 4V2NA 1XIYA 5J3RA 4KUNA 1SKRB 5IMFA 1JZWA 1PGTA 4N0ZA 1VF2A 3GRXA 2LJAA 2O8VB 4V1Ag 2WB9A 3WD6A 5B8BA 2R4VA 5CREA 4AJ7A 2GS3A 1HYUA 3HJOA 5A5KA 3KXOA 2MYGA 3EMPA 6GSTA 4FYBA 3SWLA 2OE3A 4WBJA 2EIRA 1FAAA 4TOPA 4XRAA 3L0HA 4MZWA 3HVSA 1OE7A 5BRTA 1QMVA 4NWYA 2DLXA 1USBA 3GA4A 4NMUA 1YEXA 3ZYWA 1SL1B 5HR3A 3DWVA 5J5NA 3KEBA 4XIHA 4K5SA 4KDXA 4YQUA 4TVEA 2VCTA 3C71A 1MDIA 2FLSA 1TU7A 3PGTA 4N10A 4ECIA 3I69A 1MDKA 4MJBA 3NOFA 3M1GA 3GTUA 3TCOA 1RQMA 3S9FA 1KNGA 4NAXA 5IO0A 1V57A 2E2MA 3M3MA 4GWRA 1FB6A 4TXVA 3ZVJD 2OJLA 3H4KA 4HJMA 1YY7A 1K0CA 4G0LA 5KEJA 2HE3A 2WDUA 4KX4A 5GSSA 3WGXA 3LG6A 3WGEA 4TN8A 2WRTA 4WR5A 2H74A 5ECRB 4HJ2A 2UZ8A 2H19A 1GSQA 4RQXA 1XWCA 2WFCA 2FD3A 5G5EA 4AJ6A 2BJXA 2F3MA 2FWEA 2KP2A 1HD2A 3UVTA 2B7KA 1ERWA 2WULA 1A2LA 4LA1A 1FOVA 4ZB9A 1XPVA 2ZNMA 3F6DA 1MD4A 1M9AA 3VI5A 3CXGA 3HY2A 3RDWA 5H5SA 4USSA 2VL2A 3QPMA 2V32A 5G1KA 1T7PB 2RLIA 5F06A 1GSYA 2FWHA 1NSWA 1N8JA 3F4RA 3QD9A 1YJ6A 2G2QA 2GSSA 2H71A 2DMLA 1Z9HA 2H76A 5E4WA 4IJ3A 4G0KA 4XRDA 3R2QA 2L57A 2C1YA 1AXDA 5CRWA 5JCWA 3CQFA 2R6KA 5IOWA 2F51A 1Y6EA 2I3YA 1X5EA 5JCUA 4N11A 1SU9A 3HD5A 4MPFA 1ML6A 2VLTA 1LU4A 3FMWA 4ECBA 3APSA 4K7OA 1XOAA 2CV4A 2FGXA 3G7IA 1MDJA 3KP8A 4IQAA 2CVDA 4IELA 4FQUA 4ZL7A 3H79A 1ON4A 3FZ4A 1TJDA 18GSA 4JEDA 4WXTA 2DIYA 3V1WA 1TP9A 4JRRA 3FK8A 2CT6A 3QAWA 1XWAA 1TK0B 1GTAA 5FHIA 3TJKA 2K9FA 3A2XA 4HU9A 4KNDA 5A4WA 2LSTA 5GSTA 4E8HA 4YQVA 3HVXA 1XWKA 3U6VA 2X8GA 3ERGA 2OE1A 4PX1A 3O6TA 3GSSA 3A2VA 3DEXA 3DGQA 3RPNA 4EXJA 1V58A 4GQCA 3FZ9A 1QXHA 4AF2A 5DJMA 1WOUA 3F0IA 1OKDA 2GQKA 5G1LA 1GUHA 4LMWA 1S3AA 2E2GA 3CSJA 4QL9A 1BAYA 2GQMA 3W8SA 3LXTA 4OCFA 3MWHA 1HNAA 4XCSA 3IBHA 1YZXA 3I43A 2QA1A 2I1UA 4PQIA 2VOCA 1AQWA 2IMIA 5EY6A 3VPQA 2H01A 4BWQA 3D5JA 1YEPA 4PQHA 1Q98A 3K8NA 4MZCA 3MNGA 4HDEA 3UEMA 2VCQA 2YWNA 5HR2A 5LCZA 1PN0A 2H30A 6GSXA 5J9CA 1G7OA 3EYTA 1EV9A 3VWUA 1SJIA 5DCHA 3GUSA 3FR3A 1S3RA 3LORA 4O5UA 4LLRA 2C80A 5LD0A 5KOXA 3C1SA 3GYKA 1HQOA 4MNNA 2YPMA 2NPBA 2E0QA 4HI7A 2PWJA 2DJ0A 2IIYA 1GSFA 1VGLA 3BD2A 2KLXA 2LRNA 1KEBA 5B7CA 4FYUA 1DSBA 2DJ3A 2PPTA 1CQGA 5DALB 4YKGA 5DQSA 3DRNA 2J9HA 3RPPA 4MF6A 3ZMLA 3ME8A 5DDLA 1H75A 3HHVA 4I2TA 4ZBDA 1GUMA 4KAEA 3GKNA 3KCMA 1XVWA 19GSA 2MMOA 1BX9A 3QCPA 3F4TA 4O92A 4KCEA 4TR0A 4BIKA 2JZSA 1SL0B 3PH9A 1BEDA 4QL7A 1PL2A 2YWIA 4GF0A 3VWXA 3TRXA 1SKSB 3GNJA 1EEMA 2H0GA 1FOHA 3A5IA 1GSUA 1EGRA 5INYA 1R5AA 3QR6A 2GSQA 2VLVA 3IV4A 4RI7A 1K0AA 2MMAA 3LJRA 3TJFA 2CQ9A 1JHBA 2OACA 2X64A 2R0GA 3ED3A 4G0IA 4ULXA 3LYPA 4IW9A 10GSA 4OWYA 4TRXA 1TXXA 1W4VA 1ZCPA 4MP4A 5HQPA 2GZYA 5IPHA 1PSQA 3APOA 2GSRA 2HSHA 1UC7A 1EP7A 2YV7A 4QQ7A 2PBJA 3GL5A 3UL3A 4I5QA 5A4UA 5AIVA 2X8HA 1SJ6A 2C0FA 5DCGA 2NVLA 4J57E 3GL3A 2X49A 2FUG2 5ECHB 2IFQB 1B4QA 3L9SA 3ME7A 5HR0A 3IC4A 3D4MA 4BL7B 4PNFA 3ZL5A 4JE1A 2Z9SA 4MK3A 1TRWA 4F9ZA 1GWCA 2L6CA 3IK9A 1J08A 14GSA 2R37A 4K7IA 2VL3A 2IPAA 2JZTA 5D73A 3M0FA 1UN2A 3ZLPA 13GSA 1PRXA 3P2AA 3TGZA 4BVXB 3G9BA 2EIQA 2C4JA 1V98A 4F0BA 1ZYEA 3DMLA 2IMEA 1FG4A 1WE0A 4EDYA 1JFUA 3L4NA 3ZREA 1YF0A 3TJJA 2DSAA 3TJBA 1Z3EA 5IPGA 3VK9A 3MYDA 1U6TA 2V1MA 3A5WA 1GL8A 2YNXA 3M8NA 3TDGA 1A8YA 5ID2B 4PURA 2WGRA 3GH6A 1Z5YE 4IJIA 3JCML 1TKDB 5F07A 2QGVA 3KTLA 3FHKA 5HFGA 3KH7A 3BCKA 1VF3A 1X9MB 4HOJA 2HRKA 4PQ1A 4POKA 3GX8A 4PNGA 5KN0A 1B48A 1G6WA 1YKCA 1XW9A 2OA7A 3L9UA 5HFKA 3C8EA 2AUVA 3E9JB 2IMKA 5H5QA 1GSSA 4I2UA 4V2LA 4CY6A 1OC3A 5CYYA 4ZBAA 4IKHA 5DJLA 1B9YC 1EGOA 3UIWA 4BVYB 2V6KA 1EWXA 4CW9A 1DUGA 1K3YA 2CAQA 1ZMAA 4N0VA 2VD0A 3ISOA 2PGTA 3TKSA 1LBKA 4YKFA 5ECLB 4GXZA 2FWFA 1WWJA 3ZVJA 5D9TA 1G0TA 2V41A 2C0GA 3KGKA 2QSIA 2C0DA 4IP6A 3J7Yk 2M46A 1M3IA 3EMXA 1Q4JA 5D93A 1G6YA 2IFQA 1I5GA 5JWRB 3FRCA 4IVFA 4XS4B 1GH2A 5IOXA 2VL9A 1VRSD 5E59A 2P5RA 2YCDA 2B3SA 3VPTA 3ZIVA 1F3AA 2KP1A 6GSYA 1R5PA 2K6VA 3F9UA 16GSA 1U3IA 2HZEB 4KA0A 2L5LA 1TI1A 3BJ5A 5IMDA 2AV4A 2H6YA 1SYRA 3TJGA 4J2FA 2LQQA 4MF7A 2LJRA 5ECQB 1V9WA 3TB2A 2CAIA 3O3TA 4G19A 2O87A 4JZQA 1SENA 4BVXA 2H1BA 3M9JA 4ZILA 1PA3A 4EO3A 3N5OA 4K9ZA 7GSSA 1B9XC 1TW9A 4BPYA 1A8LA 2AHEA 1QQ2A 3GH9A 1V2AA 5DBQA 2H73A 1A2JA 3EPTA 1X0RA 2MZCA 1K0OA 5B8AA 2I81A 2FWGA 3FY7A 20GSA 1Z6NA 2FA4A 4IP1A 1TK8B 5D9XA 4NV2A 5IIZA 2JZRA 1URMA 1A2MA 4OFMA 1PX6A 3CSHA 2C0EA 2JU5A 2H6ZA 3ERFA 3HVVA 2F8FA 4MABA 4EDZA 3NZNA 1TK5B 2CX4A 2FY6A 5J4UA 2LV3A 3CTFA 1HNBA 4PUAA 2CA8A 2HXKA 3GMFA 2XPDA 3EINA 2K8VA 3EU4A 3HVNA 3P8WA 3FEUA 3UVHA 2A2RA 2I4AA 3QAGA 4MJAA 4Z2UA 3D0ZA 5JWOB 2XPEA 3HKRA 2BMXA 4MJCA 5AIXA 5ELGA 5G30A 1QGVA 4H86A 2ON7A 5AN1A 2GZZA 4BVYA 3ERWA 4HZ2A 2HLSA 3GURA 3GX0A 1PFOA 2A4HA 2XBQA 1AQXA 2DC5A 2VCVA 3GIXA 4GSSA 1DBYA 3DYRA 2H72A 3W6GA 4CDOA 5BMUA 3QFAC 2OKAA 3DVXA 2PUKC 1TOFA 4HUAA 5AGYA 1NW2A 3RAZA 5IMZA 3UMAA 3ZFLA 4Q5NA 2K8SA 1K0DA 3KP9A 1OYJA 6GSVA 2LEGA 1M99A 4TR1B 4WR4A 3KM6A 2GVPA 1M2BA 3UJ1A 1EEJA 1JLWA 3IHGA 4XS4A 1SKWB 1ZYNA 1X9WB 1XW6A 3TRPA 1SL2B 3HYPA 5COHA 2X8CA 4MDCA 2LNTA 4KW6A 2HZEA 4Q5FA 1XZOA 2TIRA 2B5EA 2VAFA 4MJEA 4OD7A 2MMNA 1VF4A 2CVKA 3RBTA 3UBKA 3PR8A 4Q5QA 4ZIJA 1ZGNA 3KJYA 3D4TA 1M0UA 1T00A 1GLPA 2AYTA 1A0RP 1XW5A 3QDNA 3CMIA 5CRDA 4EIPA 5EL8A 4V1Ap 2YANA 2XC2A 1ERTA 4MLYA 5CP1A 2WJUA 4GRFA 2H0IA 1XBSA 3KZQA 2H75A 2WCIA 5L71A 1H4OA 3A3TA 3H93A 4MA9A 4TXOB 4KDYA 4ZB6A 1GTUA 2VM2A 3CYNA 4KSMA 4OFNA 3W8JA 2LRCA 2YZUA 4F82A 1DE1A 4NV5A 4GLTA 1THXA 2XBIA 2LQOA 4DSQA 1OC8A 4K0GA 1NHOA 3L9VA 2DKIA 1B4PA 3TKPA 1EOGA 3IC8A 4XS1A 1F37A 5EPFA 4N30A 1GTBA 1XFLA 4EVMA 2VL2C 3QOUA 3LQ7A 4KGIA 4EF0A 4BA7A 2GLRA 5CNWA 2C8UA 1OKTA 6GSSA 3TOTA 4IHUA 3UARA 3EU3A 3SBCA 4OFTA 3KH9A 2QA2A 1OC9B 2N5AA 3FZAA 2PMTA 2B5XA 3C73A 2VCWA 3GHAA 1ACVA 3F4SA 1LJRA 3N9JA 4JBBA 3VI7A 9GSSA 4L8EA 1IYIA 4IQ1A 4KH7A 5ECNB 1TRVA 2H1AA 1A0FA 1GNWA 5D8IA 4YH2A 5CAXA 4L5OA 1SJZA 1M7TA 4TR1A 2CZ2A 2HFDA 2R3XA 4ML6A 3QAVA 5ELAA 3DVWA 2N5FA 1GLQA 5KN3A 3A2WA 3EWLA 2KHPA 3IAS2 1X5DA 4GSNA 1PX7A 2FCHA 5ECIB 1IYHA 2VIMA 3VWWA 1R4WA 3KMOA 3LSZA 3C7MA 1MEKA 4WETA 4HQZA 2JL4A 2QKEA 4GTUA 3U5RE 1I9DA 3CBUA 2RM5A 4DEJA 2AAWA 2B5YA 5DAKB 3ZITA 4G9HA 4ZXGA 3F3RA 2X4AA 2YJHA 2YN1A 5ECMB 1J0FA 4K5RA 1T4YA 3F63A 4MH3A 5ECSA 2VM1A 3EVIA 2O89A 2CVBA 1W89A 4EC0A 4D73B 5H5RA 4L0WA 4WBRD 1S3CA 2OADA 5DVBA 4TXOA 3TUEA 2RUEA 1ZOFA 2F9SA 1THOA 1PKWA 4OO5A 3L78A 4XHMA 1JZDA 2EC4A 3WT1A 5G5FA 5ECKB 4O7HA 4MPGA 2ZUPA 2GT6A 2HRNA 2WS2A 2LNSA 1K0MA 1O85A 5FWGA 4AJ8A 3FR6A 5DALA 2AJQB 4MZBA 4KE3A 4OO4A 3G7YA 1KBNA 5CO3A 2H1GA 2LTKA 4EUYA 2GGTA 4FO5A 4KCAA 4KSOA 4A5PA 1TU8A 2H1DA 2YOIA 5KOWA 3IK7A 3LGCA 1N2AA 2LKUA 5C00A 3H1NA 1GRXA 3E0UA 1OC9A 4ZB8A 5FT3A 3P90A 4K6XA 4I8BA 5B6MA 1K0BA 4WF4A 5IM9A 3AY8A 1A23A 1B8XA 4IN0A 1FHEA 4KF9A 3P7XA 1WMJA 2P31A 1EP8A 4PTSA 1Y25A 6GSUA 1K0NA 1O8WA 1U87A 2L4QA 3WT2A 1BQ7A 2IWTA 2IJYA 4EL1A 1M9BA 3ZMKA 3GKKA 3WGDA 3CSIA 1PN9A 4EIQA 4CHSA 3LW9A 4JU5A 1X5CA 4X43A 2ZCTA 1FO5A 3HZ8A 4LL4B 3BOAA 1GSDA 2D2ZA 3LXZA 2R2JA 3IOSA 3HXSA 4X0XA 5DAKA 2F8AA 2RUFA 3PPUA 2PU9C 3KMNA 3ZRDA 1WPIA 4HS1A 2J23A 2WZ9A 4YAPA 1X9SB 1WRYA 3LEFA 1E2YA 1XWGA 4BL7A 8GSSA 1TI3A 4D73A 4HZ4A 2YWOA 2YWMA 3UBLA 1M2AA 3ZIJA 3R3EA 3CRTA 4X1UA 2LS5A 1KTEA 1ZZYA 2YV9A 4DSSB 4F0CA 2M80A 1O73A 5D9VA 2GDRA 4OMVA 4J56E 5KN1A 3LFLA 1HNCA 2VCZA 1T1VA 2HT9A 1F9MA 2ES7A 5IMAA 1QK8A 3APQA 2VD1A 2IN3A 4JR4A 1Z7RA 3M9KA 3IE3A 4P3YB 2GZPA 4RUVA 5EVOA 2REMA 2LJKA 2VUPA 2C3NA 2I9HA 3BCIA 4K0NA 4GQFA 1UA5A 3D21A 1ST9A 1OAZA 4G2EA 2HRAA 2OBKA 3GN3A 5J9BA 1V40A 1FB0A 2TRXA 2DBCA 5D96A 4PUFC 1O8XA 2L4CA 2R0CA 4ID0A 2O7KA 3IDVA 3HJPA 1FVKA 5ID2A 1EZKA 3OR5A 1E6BA 2HYXA 1RW1A 1FW1A 2AB6A 2OE0A 1O81A 3IXRA 2L59A 1SK1A 2B1KA 2C3QA 1ZYQB 4I97A 1ZL9A 2YP6A 3EE2A 12GSA 1JLVA 2HSMA 2VLUA 4L0UA 3DKSA 4ZL9A 3Q6OA 4DVCA 1S3DA 4FIWA 22GSA 5G2ZA 3Q18A 2NBSA 1MTCA 1JZOA 2V2GA 4ZBBA 5ENUA 2HSYA 2RM6A 2B6MA 1YDKA 2L6DA 1GUKA 2DJ1A 4RQRA 4PGTA 1T3BA 3NIVA 2V6OA 1XCCA 4K8MA 1AIUA 1GTIA 1TDIA 2KUCA 4IGJA 4NPBA 1BJXA 3TOUA 4ECCA 4KDUA 3MAKA 2GTUA 4TW5A 3IR4A 4NXIA 2JSZA 5J41A 2P0GA 1ERVA 5D9WA 3ZFBA 3BBYA 4ICYA 5CRGA 4F2IA 3IPZA 5DQYA 2OBIA 3MIXA 2H0HA 1PL1A 3DXBA 3TKSC 3FZ5A 1XOBA 4DSSA 1ILOA 1AAZA 3VFIA 1F2EA 4CY8A 5B6NA 2HNLA 1ERUA 1TRSA 1WJKA 3D6IA 1Z6MA 5IQYA 4Z2TA 4GCIA 2NTOA 2XHFA 1O6JA 4YAVA 4MMMA 3D22A 4V2MA 4XTSA 1GP1A 1R7HA 1PQNA 2VCXA 2DJKA 5C04A 4GSTA 4DSRA 3F6FA 1YF1A 5HR1A 4AGSA 3E3EA 2ALBA 2TRCP 4ML1A 1K3OA 2HRFA 3KD0A 3GKXA 2YJ7A 4MCUA 3QMXA 3GSTA 4F03A 5HFIA 1GNEA 2CX3A 4NHWA 2HZFA 1TTZA 4I6XA 5ECPB 4O5RA 3Q74A 2DJ2A 2MMZA 1MD3A 3FYGA 2P5QA 2IL3A 2R0PA 3H8QA 3ZZXA 5G31A 1ABAA 5CRHA 4K1FA 2O85A 2KOKA 3IAM2 1QFNA 2B1LA 2L5OA 1FVJA 3VWVA 4TR3A 4NHZA 5F8BA 1G7EA 2MBTA
chains in the Genus database with same CATH topology
4LMVA 4O5QA 4WF5A 2PVQA 4G10A 1XXUA 3GKMA 3ZTLA 1NHYA 2A2SA 1UVZA 1AQVA 1QUWA 5GZZB 2GQLA 4X4JA 2DKHA 2BTOT 1J9BA 4E8EA 2PERA 4O32A 1XWBA 1XVQA 1AUCA 4RI6A 1EOHA 2GSTA 4FH8A 1JZRA 3UAPA 3VLNA 5ECOB 4ACSA 11GSA 5IMCA 5ABRA 3HDCA 2H8LA 3FW2A 4Z7XA 2CZ3A 1RK4A 3F3QA 5F05A 1CQHA 2DMMA 3US3A 3TKQA 4EKZA 4K2XA 3TKRA 1OE8A 3O76A 4EE0A 3MSZA 4HQSA 4XS6A 2FHEA 3EC3A 3F8UA 2JACA 1SD8A 3HA9A 2H6XA 2FNOA 1VF1A 2H70A 3LYKA 3EURA 2B7JA 3VURA 2ON5A 1GULA 4MF5A 1U3AA 17GSA 4JR6A 2QC7A 2C3TA 2G0FA 4BWSA 1O7UA 4LL1B 1BG5A 5A4VA 3QFBC 2MBSA 1PMTA 3KTBA 4MH2A 1OVNA 1U88A 3FR9A 1SK2A 1BYEA 2LRTA 5IMVA 2PN8A 1Z7PA 4K2DA 4ECJA 3DIEA 3GV1A 2H66A 1T4ZA 4POLA 4KB3A 2PVOC 2DJJA 4ZL8A 6GSWA 3GTUB 1YKAA 1R26A 3HZ4A 2A4VA 2NDOA 4IS0A 5F0GA 1NM3A 2RIIA 1EV4A 4ISDA 1PKZA 3LWAA 1YQ1A 2K18A 4Z2RA 1AC1A 2EIOA 2VO4A 4K7NA 1F3BA 3CRUA 4Q5RA 2YZHA 1SK0A 3G7JA 1SD9A 3KIJA 4FYCA 3HCZA 3WYWA 1DE2A 4POMA 1WP0A 3I9V2 2N5BA 4POBA 5JCGA 5KN2A 4TKYA 1TRUA 1T8EB 1WIKA 1F6MC 3UOMA 1GSEA 2LUSA 4WKWA 3IRAA 1M2DA 2X99A 2IMDA 5GAND 1AW9A 3RHCA 2JADA 3TKSE 1PD21 3PINA 1SYXA 2GT5A 1A24A 3C1RA 4TR4A 2DIZA 3GFKA 3TRQA 2HI7A 2JSYA 2IMFA 2FA8A 5IO2A 2A2PA 3RHBA 3DD3A 3IHQA 4OCEA 1ZYPA 2M72A 3CTGA 4L5LA 3IA1A 4PXOA 3HJMA 1K3LA 3I6AA 5JWQB 3J7Yb 5LNKe 4YQMA 2E7PA 4HU7A 3Q19A 2R5GA 5GAPD 4HEA2 4ILFA 1C72A 3FKFA 5AISA 4IBPA 3MDKA 4WEYA 4V2NA 1XIYA 5J3RA 4KUNA 1SKRB 5IMFA 1JZWA 1PGTA 4N0ZA 1VF2A 3GRXA 2LJAA 2O8VB 4V1Ag 2WB9A 3WD6A 5B8BA 2R4VA 5CREA 4AJ7A 2GS3A 1HYUA 3HJOA 5A5KA 3KXOA 2MYGA 3EMPA 6GSTA 4FYBA 3SWLA 2OE3A 4WBJA 2EIRA 1FAAA 4TOPA 4XRAA 3L0HA 4MZWA 3HVSA 1OE7A 5BRTA 1QMVA 4NWYA 2DLXA 1USBA 3GA4A 4NMUA 1YEXA 3ZYWA 1SL1B 5HR3A 3DWVA 5J5NA 3KEBA 4XIHA 4K5SA 4KDXA 4YQUA 4TVEA 2VCTA 3C71A 1MDIA 2FLSA 1TU7A 3PGTA 4N10A 4ECIA 3I69A 1MDKA 4MJBA 3NOFA 3M1GA 3GTUA 3TCOA 1RQMA 3S9FA 1KNGA 4NAXA 5IO0A 1V57A 2E2MA 3M3MA 4GWRA 1FB6A 4TXVA 3ZVJD 2OJLA 3H4KA 4HJMA 1YY7A 1K0CA 4G0LA 5KEJA 2HE3A 2WDUA 4KX4A 5GSSA 3WGXA 3LG6A 3WGEA 4TN8A 2WRTA 4WR5A 2H74A 5ECRB 4HJ2A 2UZ8A 2H19A 1GSQA 4RQXA 1XWCA 2WFCA 2FD3A 5G5EA 4AJ6A 2BJXA 2F3MA 2FWEA 2KP2A 1HD2A 3UVTA 2B7KA 1ERWA 2WULA 1A2LA 4LA1A 1FOVA 4ZB9A 1XPVA 2ZNMA 3F6DA 1MD4A 1M9AA 3VI5A 3CXGA 3HY2A 3RDWA 5H5SA 4USSA 2VL2A 3QPMA 2V32A 5G1KA 1T7PB 2RLIA 5F06A 1GSYA 2FWHA 1NSWA 1N8JA 3F4RA 3QD9A 1YJ6A 2G2QA 2GSSA 2H71A 2DMLA 1Z9HA 2H76A 5E4WA 4IJ3A 4G0KA 4XRDA 3R2QA 2L57A 2C1YA 1AXDA 5CRWA 5JCWA 2R6KA 5IOWA 2F51A 1Y6EA 2I3YA 1X5EA 5JCUA 4N11A 1SU9A 3HD5A 4MPFA 1ML6A 2VLTA 1LU4A 3FMWA 4ECBA 3APSA 4K7OA 1XOAA 2CV4A 2FGXA 3G7IA 1MDJA 3KP8A 4IQAA 2CVDA 4IELA 4FQUA 4ZL7A 3H79A 1ON4A 3FZ4A 1TJDA 18GSA 4JEDA 4WXTA 2DIYA 3V1WA 1TP9A 4JRRA 3FK8A 2CT6A 3QAWA 1XWAA 1TK0B 1GTAA 5FHIA 3TJKA 2K9FA 3A2XA 4HU9A 4KNDA 5A4WA 2LSTA 5GSTA 4E8HA 4YQVA 3HVXA 1XWKA 3U6VA 2X8GA 3ERGA 2OE1A 4PX1A 3O6TA 3GSSA 3A2VA 3DEXA 3DGQA 3RPNA 4EXJA 1V58A 4GQCA 3FZ9A 1QXHA 4AF2A 5DJMA 1WOUA 3F0IA 1OKDA 2GQKA 5G1LA 1GUHA 4LMWA 1S3AA 2E2GA 3CSJA 4QL9A 1BAYA 2GQMA 3W8SA 3LXTA 4OCFA 3MWHA 1HNAA 4XCSA 3IBHA 1YZXA 3I43A 2QA1A 2I1UA 4PQIA 2VOCA 1AQWA 2IMIA 5EY6A 3VPQA 2H01A 4BWQA 3D5JA 1YEPA 4PQHA 1Q98A 3K8NA 4MZCA 3MNGA 4HDEA 3UEMA 2VCQA 2YWNA 5HR2A 5LCZA 1PN0A 2H30A 6GSXA 5J9CA 1G7OA 3EYTA 1EV9A 3VWUA 1SJIA 5DCHA 3GUSA 3FR3A 3LORA 4O5UA 4LLRA 2C80A 5LD0A 5KOXA 3C1SA 3GYKA 1HQOA 4MNNA 2YPMA 2NPBA 2E0QA 4HI7A 2PWJA 2DJ0A 2IIYA 1GSFA 1VGLA 3BD2A 2KLXA 2LRNA 1KEBA 5B7CA 4FYUA 1DSBA 2DJ3A 2PPTA 1CQGA 5DALB 4YKGA 5DQSA 3DRNA 2J9HA 3RPPA 4MF6A 3ZMLA 3ME8A 5DDLA 1H75A 3HHVA 4I2TA 4ZBDA 1GUMA 4KAEA 3GKNA 3KCMA 1XVWA 19GSA 2MMOA 1BX9A 3QCPA 3F4TA 4O92A 4KCEA 4TR0A 2JZSA 1SL0B 3PH9A 1BEDA 4QL7A 1PL2A 2YWIA 4GF0A 3VWXA 3TRXA 1SKSB 3GNJA 1EEMA 2H0GA 1FOHA 3A5IA 1GSUA 1EGRA 5INYA 1R5AA 3QR6A 2GSQA 2VLVA 3IV4A 4RI7A 1K0AA 2MMAA 3LJRA 3TJFA 2CQ9A 1JHBA 2OACA 2X64A 2R0GA 3ED3A 4G0IA 4ULXA 3LYPA 4IW9A 10GSA 4OWYA 4TRXA 1TXXA 1W4VA 1ZCPA 4MP4A 5HQPA 2GZYA 5IPHA 1PSQA 3APOA 2GSRA 2HSHA 1UC7A 1EP7A 2YV7A 4QQ7A 2PBJA 3GL5A 3UL3A 4I5QA 5A4UA 5AIVA 2X8HA 1SJ6A 2C0FA 5DCGA 2NVLA 4J57E 3GL3A 2X49A 2FUG2 5ECHB 2IFQB 1B4QA 3L9SA 3ME7A 5HR0A 3IC4A 3D4MA 4BL7B 4PNFA 3ZL5A 4JE1A 2Z9SA 4MK3A 1TRWA 4F9ZA 1GWCA 2L6CA 3IK9A 1J08A 14GSA 2R37A 4K7IA 2VL3A 2IPAA 2JZTA 5D73A 3M0FA 1UN2A 3ZLPA 13GSA 1PRXA 3P2AA 3TGZA 4BVXB 3G9BA 2EIQA 2C4JA 1V98A 4F0BA 1ZYEA 3DMLA 2IMEA 1FG4A 1WE0A 4EDYA 1JFUA 3L4NA 3ZREA 1YF0A 3TJJA 2DSAA 3TJBA 1Z3EA 5IPGA 3VK9A 3MYDA 1U6TA 2V1MA 3A5WA 1GL8A 2YNXA 3M8NA 3TDGA 1A8YA 5ID2B 4PURA 2WGRA 3GH6A 1Z5YE 4IJIA 3JCML 1TKDB 5F07A 2QGVA 3KTLA 3FHKA 5HFGA 3KH7A 3BCKA 1VF3A 1X9MB 4HOJA 2HRKA 4PQ1A 4POKA 3GX8A 4PNGA 5KN0A 1B48A 1G6WA 1YKCA 1XW9A 2OA7A 3L9UA 5HFKA 3C8EA 2AUVA 3E9JB 2IMKA 5H5QA 1GSSA 4I2UA 4V2LA 4CY6A 1OC3A 5CYYA 4ZBAA 4IKHA 5DJLA 1B9YC 1EGOA 3UIWA 4BVYB 2V6KA 1EWXA 4CW9A 1DUGA 1K3YA 2CAQA 1ZMAA 4N0VA 2VD0A 3ISOA 2PGTA 3TKSA 1LBKA 4YKFA 5ECLB 4GXZA 2FWFA 1WWJA 3ZVJA 5D9TA 1G0TA 2V41A 2C0GA 3KGKA 2QSIA 2C0DA 4IP6A 3J7Yk 2M46A 3EMXA 1Q4JA 5D93A 1G6YA 2IFQA 1I5GA 5JWRB 3FRCA 4IVFA 4XS4B 1GH2A 5IOXA 2VL9A 1VRSD 5E59A 2P5RA 2YCDA 2B3SA 3VPTA 3ZIVA 1F3AA 2KP1A 6GSYA 1R5PA 2K6VA 3F9UA 16GSA 1U3IA 2HZEB 4KA0A 2L5LA 1TI1A 3BJ5A 5IMDA 2AV4A 2H6YA 1SYRA 3TJGA 4J2FA 2LQQA 4MF7A 2LJRA 5ECQB 1V9WA 3TB2A 2CAIA 3O3TA 4G19A 2O87A 4JZQA 1SENA 4BVXA 2H1BA 3M9JA 4ZILA 1PA3A 4EO3A 3N5OA 4K9ZA 7GSSA 1B9XC 1TW9A 4BPYA 1A8LA 2AHEA 1QQ2A 3GH9A 1V2AA 5DBQA 2H73A 1A2JA 3EPTA 1X0RA 2MZCA 1K0OA 5B8AA 2I81A 2FWGA 3FY7A 20GSA 1Z6NA 2FA4A 4IP1A 1TK8B 5D9XA 4NV2A 5IIZA 2JZRA 1URMA 1A2MA 4OFMA 1PX6A 3CSHA 2C0EA 2JU5A 2H6ZA 3ERFA 3HVVA 2F8FA 4MABA 4EDZA 3NZNA 1TK5B 2CX4A 2FY6A 5J4UA 2LV3A 3CTFA 1HNBA 4PUAA 2CA8A 2HXKA 3GMFA 2XPDA 3EINA 2K8VA 3EU4A 3P8WA 3FEUA 3UVHA 2A2RA 2I4AA 3QAGA 4MJAA 4Z2UA 3D0ZA 5JWOB 2XPEA 3HKRA 2BMXA 4MJCA 5AIXA 5ELGA 5G30A 1QGVA 4H86A 2ON7A 5AN1A 2GZZA 4BVYA 3ERWA 4HZ2A 2HLSA 3GURA 3GX0A 2A4HA 2XBQA 1AQXA 2DC5A 2VCVA 3GIXA 4GSSA 1DBYA 3DYRA 2H72A 3W6GA 4CDOA 5BMUA 3QFAC 2OKAA 3DVXA 2PUKC 1TOFA 4HUAA 5AGYA 1NW2A 3RAZA 5IMZA 3UMAA 3ZFLA 4Q5NA 2K8SA 1K0DA 3KP9A 1OYJA 6GSVA 2LEGA 1M99A 4TR1B 4WR4A 3KM6A 2GVPA 1M2BA 3UJ1A 1EEJA 1JLWA 3IHGA 4XS4A 1SKWB 1ZYNA 1X9WB 1XW6A 3TRPA 1SL2B 3HYPA 5COHA 2X8CA 4MDCA 2LNTA 4KW6A 2HZEA 4Q5FA 1XZOA 2TIRA 2B5EA 2VAFA 4MJEA 4OD7A 2MMNA 1VF4A 2CVKA 3RBTA 3UBKA 3PR8A 4Q5QA 4ZIJA 1ZGNA 3KJYA 3D4TA 1M0UA 1T00A 1GLPA 2AYTA 1A0RP 1XW5A 3QDNA 3CMIA 5CRDA 4EIPA 5EL8A 4V1Ap 2YANA 2XC2A 1ERTA 4MLYA 5CP1A 2WJUA 4GRFA 2H0IA 1XBSA 3KZQA 2H75A 2WCIA 5L71A 1H4OA 3A3TA 3H93A 4MA9A 4TXOB 4KDYA 4ZB6A 1GTUA 2VM2A 3CYNA 4KSMA 4OFNA 3W8JA 2LRCA 2YZUA 4F82A 1DE1A 4NV5A 4GLTA 1THXA 2XBIA 2LQOA 4DSQA 1OC8A 4K0GA 1NHOA 3L9VA 2DKIA 1B4PA 3TKPA 1EOGA 3IC8A 4XS1A 1F37A 5EPFA 4N30A 1GTBA 1XFLA 4EVMA 2VL2C 3QOUA 3LQ7A 4KGIA 4EF0A 4BA7A 2GLRA 5CNWA 2C8UA 1OKTA 6GSSA 3TOTA 4IHUA 3UARA 3EU3A 3SBCA 4OFTA 3KH9A 2QA2A 1OC9B 2N5AA 3FZAA 2PMTA 2B5XA 3C73A 2VCWA 3GHAA 1ACVA 3F4SA 1LJRA 3N9JA 4JBBA 3VI7A 9GSSA 4L8EA 1IYIA 4IQ1A 4KH7A 5ECNB 1TRVA 2H1AA 1A0FA 1GNWA 5D8IA 4YH2A 5CAXA 4L5OA 1SJZA 1M7TA 4TR1A 2CZ2A 2HFDA 2R3XA 4ML6A 3QAVA 5ELAA 3DVWA 2N5FA 1GLQA 5KN3A 3A2WA 3EWLA 2KHPA 3IAS2 1X5DA 4GSNA 1PX7A 2FCHA 5ECIB 1IYHA 2VIMA 3VWWA 1R4WA 3KMOA 3LSZA 3C7MA 1MEKA 4WETA 4HQZA 2JL4A 2QKEA 4GTUA 3U5RE 1I9DA 3CBUA 2RM5A 4DEJA 2AAWA 2B5YA 5DAKB 3ZITA 4G9HA 4ZXGA 3F3RA 2X4AA 2YJHA 2YN1A 5ECMB 1J0FA 4K5RA 1T4YA 3F63A 4MH3A 5ECSA 2VM1A 3EVIA 2O89A 2CVBA 1W89A 4EC0A 4D73B 5H5RA 4L0WA 4WBRD 1S3CA 2OADA 5DVBA 4TXOA 3TUEA 2RUEA 1ZOFA 2F9SA 1THOA 1PKWA 4OO5A 3L78A 4XHMA 1JZDA 2EC4A 3WT1A 5G5FA 5ECKB 4O7HA 4MPGA 2ZUPA 2GT6A 2HRNA 2WS2A 2LNSA 1K0MA 1O85A 5FWGA 4AJ8A 3FR6A 5DALA 2AJQB 4MZBA 4KE3A 4OO4A 3G7YA 1KBNA 5CO3A 2H1GA 2LTKA 4EUYA 2GGTA 4FO5A 4KCAA 4KSOA 4A5PA 1TU8A 2H1DA 2YOIA 5KOWA 3IK7A 3LGCA 1N2AA 2LKUA 5C00A 3H1NA 1GRXA 3E0UA 1OC9A 4ZB8A 5FT3A 3P90A 4K6XA 4I8BA 5B6MA 1K0BA 4WF4A 5IM9A 3AY8A 1A23A 1B8XA 4IN0A 1FHEA 4KF9A 3P7XA 1WMJA 2P31A 1EP8A 4PTSA 1Y25A 6GSUA 1K0NA 1O8WA 1U87A 2L4QA 3WT2A 1BQ7A 2IWTA 2IJYA 4EL1A 1M9BA 3ZMKA 3GKKA 3WGDA 3CSIA 1PN9A 4EIQA 4CHSA 3LW9A 4JU5A 1X5CA 4X43A 2ZCTA 1FO5A 3HZ8A 4LL4B 3BOAA 1GSDA 2D2ZA 3LXZA 2R2JA 3IOSA 3HXSA 4X0XA 5DAKA 2F8AA 2RUFA 3PPUA 2PU9C 3KMNA 3ZRDA 1WPIA 4HS1A 2J23A 2WZ9A 4YAPA 1X9SB 1WRYA 3LEFA 1E2YA 1XWGA 4BL7A 8GSSA 1TI3A 4D73A 4HZ4A 2YWOA 2YWMA 3UBLA 1M2AA 3ZIJA 3R3EA 3CRTA 4X1UA 2LS5A 1KTEA 1ZZYA 2YV9A 4DSSB 4F0CA 2M80A 1O73A 5D9VA 2GDRA 4OMVA 4J56E 5KN1A 3LFLA 1HNCA 2VCZA 1T1VA 2HT9A 1F9MA 2ES7A 5IMAA 1QK8A 3APQA 2VD1A 2IN3A 4JR4A 1Z7RA 3M9KA 3IE3A 4P3YB 2GZPA 4RUVA 5EVOA 2REMA 2LJKA 2VUPA 2C3NA 2I9HA 3BCIA 4K0NA 4GQFA 1UA5A 3D21A 1ST9A 1OAZA 4G2EA 2HRAA 2OBKA 3GN3A 5J9BA 1V40A 1FB0A 2TRXA 2DBCA 5D96A 4PUFC 1O8XA 2L4CA 2R0CA 4ID0A 2O7KA 3IDVA 3HJPA 1FVKA 5ID2A 1EZKA 3OR5A 1E6BA 2HYXA 1RW1A 1FW1A 2AB6A 2OE0A 1O81A 3IXRA 2L59A 1SK1A 2B1KA 2C3QA 1ZYQB 4I97A 1ZL9A 2YP6A 3EE2A 12GSA 1JLVA 2HSMA 2VLUA 4L0UA 3DKSA 4ZL9A 3Q6OA 4DVCA 1S3DA 4FIWA 22GSA 5G2ZA 3Q18A 2NBSA 1MTCA 1JZOA 2V2GA 4ZBBA 5ENUA 2HSYA 2RM6A 2B6MA 1YDKA 2L6DA 1GUKA 2DJ1A 4RQRA 4PGTA 1T3BA 3NIVA 2V6OA 1XCCA 4K8MA 1AIUA 1GTIA 1TDIA 2KUCA 4IGJA 4NPBA 1BJXA 3TOUA 4ECCA 4KDUA 3MAKA 2GTUA 4TW5A 3IR4A 4NXIA 2JSZA 5J41A 2P0GA 1ERVA 5D9WA 3ZFBA 3BBYA 4ICYA 5CRGA 4F2IA 3IPZA 5DQYA 2OBIA 3MIXA 2H0HA 1PL1A 3DXBA 3TKSC 3FZ5A 1XOBA 4DSSA 1ILOA 1AAZA 3VFIA 1F2EA 4CY8A 5B6NA 2HNLA 1ERUA 1TRSA 1WJKA 3D6IA 1Z6MA 5IQYA 4Z2TA 4GCIA 2NTOA 2XHFA 1O6JA 4YAVA 4MMMA 3D22A 4V2MA 4XTSA 1GP1A 1R7HA 1PQNA 2VCXA 2DJKA 5C04A 4GSTA 4DSRA 3F6FA 1YF1A 5HR1A 4AGSA 3E3EA 2ALBA 2TRCP 4ML1A 1K3OA 2HRFA 3KD0A 3GKXA 2YJ7A 4MCUA 3QMXA 3GSTA 4F03A 5HFIA 1GNEA 2CX3A 4NHWA 2HZFA 1TTZA 4I6XA 5ECPB 4O5RA 3Q74A 2DJ2A 2MMZA 1MD3A 3FYGA 2P5QA 2IL3A 2R0PA 3H8QA 3ZZXA 5G31A 1ABAA 5CRHA 4K1FA 2O85A 2KOKA 3IAM2 1QFNA 2B1LA 2L5OA 1FVJA 3VWVA 4TR3A 4NHZA 5F8BA 1G7EA 2MBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMV A;  4WF5 A;  2PVQ A;  4G10 A;  1XXU A;  3GKM A;  3ZTL A;  1NHY A;  2A2S A;  1UVZ A;  1AQV A;  1QUW A;  5GZZ B;  2GQL A;  2BTO T;  1J9B A;  4E8E A;  2PER A;  4O32 A;  1XWB A;  1XVQ A;  1AUC A;  4RI6 A;  1EOH A;  2GST A;  4FH8 A;  1JZR A;  3UAP A;  3VLN A;  5ECO B;  4ACS A;  11GS A;  5IMC A;  5ABR A;  3HDC A;  2H8L A;  3FW2 A;  4Z7X A;  2CZ3 A;  1RK4 A;  3F3Q A;  5F05 A;  1CQH A;  2DMM A;  3US3 A;  3TKQ A;  4EKZ A;  3TKR A;  1OE8 A;  3O76 A;  4EE0 A;  3MSZ A;  4HQS A;  4XS6 A;  2FHE A;  3EC3 A;  3F8U A;  2JAC A;  1SD8 A;  3HA9 A;  2H6X A;  2FNO A;  1VF1 A;  2H70 A;  3LYK A;  3EUR A;  2B7J A;  3VUR A;  2ON5 A;  1GUL A;  4MF5 A;  1U3A A;  17GS A;  4JR6 A;  2QC7 A;  2C3T A;  2G0F A;  4BWS A;  1O7U A;  4LL1 B;  1BG5 A;  5A4V A;  3QFB C;  2MBS A;  1PMT A;  3KTB A;  4MH2 A;  1OVN A;  1U88 A;  3FR9 A;  1SK2 A;  1BYE A;  2LRT A;  5IMV A;  2PN8 A;  1Z7P A;  4K2D A;  4ECJ A;  3DIE A;  3GV1 A;  2H66 A;  1T4Z A;  4POL A;  4KB3 A;  2PVO C;  2DJJ A;  4ZL8 A;  6GSW A;  3GTU B;  1YKA A;  1R26 A;  3HZ4 A;  2A4V A;  2NDO A;  4IS0 A;  5F0G A;  1NM3 A;  2RII A;  1EV4 A;  4ISD A;  1PKZ A;  3LWA A;  1YQ1 A;  2K18 A;  1AC1 A;  2EIO A;  2VO4 A;  4K7N A;  1F3B A;  3CRU A;  4Q5R A;  2YZH A;  1SK0 A;  3G7J A;  1SD9 A;  3KIJ A;  4FYC A;  3HCZ A;  3WYW A;  1DE2 A;  4POM A;  1WP0 A;  3I9V 2;  2N5B A;  4POB A;  5JCG A;  5KN2 A;  4TKY A;  1TRU A;  1T8E B;  1WIK A;  1F6M C;  3UOM A;  1GSE A;  2LUS A;  4WKW A;  3IRA A;  1M2D A;  2X99 A;  2IMD A;  5GAN D;  1AW9 A;  3RHC A;  2JAD A;  3TKS E;  1PD2 1;  3PIN A;  1SYX A;  2GT5 A;  1A24 A;  3C1R A;  4TR4 A;  2DIZ A;  3GFK A;  3TRQ A;  2HI7 A;  2JSY A;  2IMF A;  2FA8 A;  5IO2 A;  3RHB A;  3DD3 A;  3IHQ A;  4OCE A;  2M72 A;  3CTG A;  4L5L A;  3IA1 A;  4PXO A;  3HJM A;  1K3L A;  3I6A A;  5JWQ B;  3J7Y b;  5LNK e;  4YQM A;  2E7P A;  4HU7 A;  3Q19 A;  2R5G A;  5GAP D;  4HEA 2;  4ILF A;  1C72 A;  3FKF A;  5AIS A;  4IBP A;  3MDK A;  4WEY A;  4V2N A;  1XIY A;  5J3R A;  4KUN A;  1SKR B;  5IMF A;  1JZW A;  1PGT A;  4N0Z A;  1VF2 A;  3GRX A;  2LJA A;  2O8V B;  4V1A g;  2WB9 A;  3WD6 A;  5B8B A;  2R4V A;  5CRE A;  4AJ7 A;  2GS3 A;  1HYU A;  3HJO A;  5A5K A;  3KXO A;  2MYG A;  3EMP A;  6GST A;  4FYB A;  3SWL A;  2OE3 A;  4WBJ A;  2EIR A;  1FAA A;  4TOP A;  4XRA A;  3L0H A;  4MZW A;  3HVS A;  1OE7 A;  1QMV A;  4NWY A;  2DLX A;  1USB A;  3GA4 A;  4NMU A;  1YEX A;  3ZYW A;  1SL1 B;  5HR3 A;  3DWV A;  5J5N A;  3KEB A;  4XIH A;  4KDX A;  4YQU A;  4TVE A;  2VCT A;  3C71 A;  1MDI A;  2FLS A;  1TU7 A;  3PGT A;  4N10 A;  4ECI A;  3I69 A;  1MDK A;  4MJB A;  3NOF A;  3M1G A;  3GTU A;  3TCO A;  1RQM A;  3S9F A;  1KNG A;  4NAX A;  5IO0 A;  1V57 A;  2E2M A;  3M3M A;  4GWR A;  1FB6 A;  4TXV A;  3ZVJ D;  2OJL A;  3H4K A;  4HJM A;  1YY7 A;  1K0C A;  5KEJ A;  2HE3 A;  2WDU A;  4KX4 A;  5GSS A;  3WGX A;  3LG6 A;  3WGE A;  4TN8 A;  2WRT A;  4WR5 A;  2H74 A;  5ECR B;  4HJ2 A;  2H19 A;  1GSQ A;  4RQX A;  1XWC A;  2WFC A;  2FD3 A;  5G5E A;  4AJ6 A;  2BJX A;  2F3M A;  2FWE A;  2KP2 A;  1HD2 A;  3UVT A;  2B7K A;  1ERW A;  2WUL A;  1A2L A;  4LA1 A;  1FOV A;  4ZB9 A;  1XPV A;  2ZNM A;  3F6D A;  1MD4 A;  1M9A A;  3VI5 A;  3CXG A;  3HY2 A;  3RDW A;  5H5S A;  2VL2 A;  3QPM A;  2V32 A;  5G1K A;  1T7P B;  2RLI A;  5F06 A;  1GSY A;  2FWH A;  1NSW A;  1N8J A;  3F4R A;  3QD9 A;  1YJ6 A;  2G2Q A;  2GSS A;  2H71 A;  2DML A;  1Z9H A;  2H76 A;  5E4W A;  4IJ3 A;  4XRD A;  3R2Q A;  2L57 A;  2C1Y A;  1AXD A;  5CRW A;  5JCW A;  2R6K A;  5IOW A;  2F51 A;  1Y6E A;  2I3Y A;  1X5E A;  5JCU A;  4N11 A;  1SU9 A;  3HD5 A;  4MPF A;  1ML6 A;  2VLT A;  1LU4 A;  4ECB A;  3APS A;  4K7O A;  1XOA A;  2CV4 A;  2FGX A;  3G7I A;  1MDJ A;  3KP8 A;  4IQA A;  2CVD A;  4IEL A;  4ZL7 A;  3H79 A;  1ON4 A;  3FZ4 A;  1TJD A;  18GS A;  4JED A;  4WXT A;  2DIY A;  3V1W A;  1TP9 A;  4JRR A;  3FK8 A;  2CT6 A;  3QAW A;  1XWA A;  1TK0 B;  1GTA A;  5FHI A;  3TJK A;  2K9F A;  3A2X A;  4HU9 A;  4KND A;  5A4W A;  2LST A;  5GST A;  4E8H A;  4YQV A;  3HVX A;  1XWK A;  3U6V A;  2X8G A;  3ERG A;  2OE1 A;  4PX1 A;  3O6T A;  3GSS A;  3A2V A;  3DEX A;  3DGQ A;  3RPN A;  4EXJ A;  1V58 A;  4GQC A;  3FZ9 A;  1QXH A;  4AF2 A;  5DJM A;  1WOU A;  3F0I A;  1OKD A;  2GQK A;  5G1L A;  1GUH A;  4LMW A;  1S3A A;  2E2G A;  3CSJ A;  4QL9 A;  1BAY A;  2GQM A;  3W8S A;  3LXT A;  4OCF A;  3MWH A;  1HNA A;  4XCS A;  3IBH A;  1YZX A;  3I43 A;  2I1U A;  4PQI A;  2VOC A;  1AQW A;  2IMI A;  5EY6 A;  3VPQ A;  2H01 A;  4BWQ A;  3D5J A;  1YEP A;  4PQH A;  1Q98 A;  3K8N A;  4MZC A;  3MNG A;  4HDE A;  3UEM A;  2VCQ A;  2YWN A;  5HR2 A;  5LCZ A;  2H30 A;  6GSX A;  5J9C A;  1G7O A;  3EYT A;  1EV9 A;  3VWU A;  1SJI A;  5DCH A;  3GUS A;  3FR3 A;  3LOR A;  4LLR A;  2C80 A;  5LD0 A;  3C1S A;  3GYK A;  1HQO A;  2YPM A;  2NPB A;  2E0Q A;  4HI7 A;  2PWJ A;  2DJ0 A;  2IIY A;  1GSF A;  1VGL A;  3BD2 A;  2KLX A;  2LRN A;  1KEB A;  5B7C A;  4FYU A;  1DSB A;  2DJ3 A;  2PPT A;  1CQG A;  5DAL B;  5DQS A;  3DRN A;  2J9H A;  3RPP A;  4MF6 A;  3ZML A;  3ME8 A;  5DDL A;  1H75 A;  3HHV A;  4I2T A;  4ZBD A;  1GUM A;  4KAE A;  3GKN A;  3KCM A;  1XVW A;  19GS A;  2MMO A;  1BX9 A;  3QCP A;  3F4T A;  4O92 A;  4KCE A;  4TR0 A;  2JZS A;  1SL0 B;  3PH9 A;  1BED A;  4QL7 A;  1PL2 A;  2YWI A;  4GF0 A;  3VWX A;  3TRX A;  1SKS B;  3GNJ A;  1EEM A;  2H0G A;  1GSU A;  1EGR A;  5INY A;  1R5A A;  3QR6 A;  2GSQ A;  2VLV A;  3IV4 A;  4RI7 A;  1K0A A;  2MMA A;  3LJR A;  3TJF A;  2CQ9 A;  1JHB A;  2OAC A;  2X64 A;  3ED3 A;  4ULX A;  10GS A;  3LYP A;  4IW9 A;  4OWY A;  4TRX A;  1TXX A;  1W4V A;  1ZCP A;  4MP4 A;  5HQP A;  2GZY A;  5IPH A;  1PSQ A;  3APO A;  2GSR A;  2HSH A;  1UC7 A;  1EP7 A;  2YV7 A;  4QQ7 A;  2PBJ A;  3GL5 A;  3UL3 A;  4I5Q A;  5A4U A;  5AIV A;  2X8H A;  1SJ6 A;  2C0F A;  5DCG A;  2NVL A;  4J57 E;  3GL3 A;  2FUG 2;  5ECH B;  2IFQ B;  1B4Q A;  3L9S A;  3ME7 A;  5HR0 A;  3IC4 A;  3D4M A;  4PNF A;  3ZL5 A;  4JE1 A;  2Z9S A;  4MK3 A;  1TRW A;  4F9Z A;  1GWC A;  2L6C A;  3IK9 A;  1J08 A;  14GS A;  2R37 A;  4K7I A;  2VL3 A;  2IPA A;  2JZT A;  5D73 A;  3M0F A;  1UN2 A;  3ZLP A;  13GS A;  1PRX A;  3P2A A;  3TGZ A;  3G9B A;  2EIQ A;  2C4J A;  1V98 A;  4F0B A;  1ZYE A;  3DML A;  2IME A;  1FG4 A;  1WE0 A;  4EDY A;  1JFU A;  3L4N A;  3ZRE A;  1YF0 A;  3TJJ A;  2DSA A;  3TJB A;  1Z3E A;  5IPG A;  3VK9 A;  1U6T A;  2V1M A;  3A5W A;  1GL8 A;  2YNX A;  3M8N A;  3TDG A;  1A8Y A;  5ID2 B;  4PUR A;  2WGR A;  3GH6 A;  1Z5Y E;  4IJI A;  3JCM L;  1TKD B;  5F07 A;  2QGV A;  3KTL A;  3FHK A;  5HFG A;  3KH7 A;  3BCK A;  1VF3 A;  1X9M B;  4HOJ A;  4PQ1 A;  4POK A;  3GX8 A;  4PNG A;  5KN0 A;  1B48 A;  1G6W A;  1YKC A;  1XW9 A;  2OA7 A;  3L9U A;  5HFK A;  3C8E A;  2AUV A;  3E9J B;  2IMK A;  5H5Q A;  1GSS A;  4I2U A;  4V2L A;  1OC3 A;  5CYY A;  4ZBA A;  4IKH A;  5DJL A;  1B9Y C;  1EGO A;  3UIW A;  2V6K A;  1EWX A;  4CW9 A;  1DUG A;  1K3Y A;  2CAQ A;  1ZMA A;  4N0V A;  2VD0 A;  3ISO A;  2PGT A;  3TKS A;  1LBK A;  5ECL B;  4GXZ A;  2FWF A;  1WWJ A;  3ZVJ A;  5D9T A;  1G0T A;  2V41 A;  2C0G A;  3KGK A;  2QSI A;  2C0D A;  4IP6 A;  3J7Y k;  2M46 A;  3EMX A;  1Q4J A;  5D93 A;  1G6Y A;  2IFQ A;  1I5G A;  5JWR B;  3FRC A;  4IVF A;  4XS4 B;  1GH2 A;  5IOX A;  2VL9 A;  1VRS D;  5E59 A;  2P5R A;  2YCD A;  2B3S A;  3VPT A;  3ZIV A;  1F3A A;  2KP1 A;  6GSY A;  1R5P A;  2K6V A;  3F9U A;  16GS A;  1U3I A;  2HZE B;  4KA0 A;  2L5L A;  1TI1 A;  3BJ5 A;  5IMD A;  2AV4 A;  2H6Y A;  1SYR A;  3TJG A;  4J2F A;  2LQQ A;  4MF7 A;  2LJR A;  5ECQ B;  1V9W A;  3TB2 A;  2CAI A;  3O3T A;  4G19 A;  2O87 A;  4JZQ A;  1SEN A;  4BVX A;  2H1B A;  3M9J A;  4ZIL A;  1PA3 A;  4EO3 A;  3N5O A;  4K9Z A;  7GSS A;  1B9X C;  1TW9 A;  4BPY A;  1A8L A;  2AHE A;  1QQ2 A;  3GH9 A;  1V2A A;  5DBQ A;  2H73 A;  1A2J A;  1X0R A;  2MZC A;  1K0O A;  5B8A A;  2I81 A;  2FWG A;  3FY7 A;  20GS A;  1Z6N A;  2FA4 A;  4IP1 A;  1TK8 B;  5D9X A;  4NV2 A;  5IIZ A;  2JZR A;  1URM A;  1A2M A;  4OFM A;  1PX6 A;  3CSH A;  2C0E A;  2JU5 A;  2H6Z A;  3ERF A;  3HVV A;  2F8F A;  4MAB A;  4EDZ A;  3NZN A;  1TK5 B;  2CX4 A;  2FY6 A;  5J4U A;  2LV3 A;  3CTF A;  1HNB A;  4PUA A;  2CA8 A;  2HXK A;  3GMF A;  2XPD A;  3EIN A;  2K8V A;  3EU4 A;  3P8W A;  3FEU A;  3UVH A;  2A2R A;  2I4A A;  3QAG A;  4MJA A;  3D0Z A;  5JWO B;  2XPE A;  3HKR A;  2BMX A;  4MJC A;  5AIX A;  5ELG A;  5G30 A;  1QGV A;  4H86 A;  5AN1 A;  2ON7 A;  2GZZ A;  4BVY A;  3ERW A;  4HZ2 A;  2HLS A;  3GUR A;  3GX0 A;  2XBQ A;  1AQX A;  2DC5 A;  2VCV A;  3GIX A;  4GSS A;  1DBY A;  3DYR A;  2H72 A;  3W6G A;  4CDO A;  3QFA C;  2OKA A;  3DVX A;  2PUK C;  1TOF A;  4HUA A;  5AGY A;  1NW2 A;  3RAZ A;  5IMZ A;  3UMA A;  3ZFL A;  4Q5N A;  2K8S A;  1K0D A;  3KP9 A;  1OYJ A;  6GSV A;  2LEG A;  1M99 A;  4TR1 B;  4WR4 A;  3KM6 A;  2GVP A;  1M2B A;  3UJ1 A;  1EEJ A;  1JLW A;  4XS4 A;  1SKW B;  1X9W B;  1XW6 A;  3TRP A;  1SL2 B;  3HYP A;  5COH A;  2X8C A;  4MDC A;  2LNT A;  4KW6 A;  2HZE A;  4Q5F A;  1XZO A;  2TIR A;  2B5E A;  2VAF A;  4MJE A;  4OD7 A;  2MMN A;  1VF4 A;  2CVK A;  3RBT A;  3UBK A;  3PR8 A;  4Q5Q A;  4ZIJ A;  1ZGN A;  3KJY A;  3D4T A;  1M0U A;  1T00 A;  1GLP A;  2AYT A;  1A0R P;  1XW5 A;  3QDN A;  3CMI A;  5CRD A;  5EL8 A;  4V1A p;  2YAN A;  2XC2 A;  1ERT A;  4MLY A;  5CP1 A;  2WJU A;  4GRF A;  2H0I A;  1XBS A;  3KZQ A;  2H75 A;  2WCI A;  5L71 A;  1H4O A;  3A3T A;  3H93 A;  4MA9 A;  4TXO B;  4KDY A;  4ZB6 A;  1GTU A;  2VM2 A;  3CYN A;  4KSM A;  4OFN A;  3W8J A;  2LRC A;  2YZU A;  4F82 A;  1DE1 A;  4NV5 A;  4GLT A;  1THX A;  2XBI A;  2LQO A;  4DSQ A;  1OC8 A;  4K0G A;  1NHO A;  3L9V A;  1B4P A;  3TKP A;  1EOG A;  4XS1 A;  1F37 A;  5EPF A;  4N30 A;  1GTB A;  1XFL A;  4EVM A;  2VL2 C;  3QOU A;  3LQ7 A;  4KGI A;  4EF0 A;  4BA7 A;  2GLR A;  5CNW A;  2C8U A;  1OKT A;  6GSS A;  3TOT A;  4IHU A;  3UAR A;  3EU3 A;  3SBC A;  4OFT A;  3KH9 A;  1OC9 B;  2N5A A;  3FZA A;  2PMT A;  2B5X A;  3C73 A;  2VCW A;  3GHA A;  1ACV A;  3F4S A;  1LJR A;  3N9J A;  4JBB A;  3VI7 A;  9GSS A;  4L8E A;  1IYI A;  4IQ1 A;  4KH7 A;  5ECN B;  1TRV A;  2H1A A;  1A0F A;  1GNW A;  5D8I A;  4YH2 A;  5CAX A;  4L5O A;  1SJZ A;  1M7T A;  4TR1 A;  2CZ2 A;  2HFD A;  2R3X A;  4ML6 A;  3QAV A;  5ELA A;  3DVW A;  2N5F A;  1GLQ A;  5KN3 A;  3A2W A;  3EWL A;  2KHP A;  3IAS 2;  1X5D A;  4GSN A;  1PX7 A;  2FCH A;  5ECI B;  1IYH A;  2VIM A;  3VWW A;  1R4W A;  3KMO A;  3LSZ A;  3C7M A;  1MEK A;  4WET A;  4HQZ A;  2JL4 A;  2QKE A;  4GTU A;  3U5R E;  1I9D A;  3CBU A;  2RM5 A;  4DEJ A;  2AAW A;  2B5Y A;  5DAK B;  3ZIT A;  4G9H A;  4ZXG A;  3F3R A;  2YN1 A;  2YJH A;  5ECM B;  1J0F A;  1T4Y A;  3F63 A;  4MH3 A;  5ECS A;  2VM1 A;  3EVI A;  2O89 A;  2CVB A;  1W89 A;  4EC0 A;  4D73 B;  5H5R A;  4L0W A;  4WBR D;  1S3C A;  2OAD A;  5DVB A;  4TXO A;  3TUE A;  2RUE A;  1ZOF A;  2F9S A;  1THO A;  1PKW A;  4OO5 A;  3L78 A;  4XHM A;  1JZD A;  2EC4 A;  3WT1 A;  5G5F A;  5ECK B;  4O7H A;  4MPG A;  2ZUP A;  2GT6 A;  2HRN A;  2WS2 A;  2LNS A;  1K0M A;  1O85 A;  5FWG A;  4AJ8 A;  3FR6 A;  5DAL A;  2AJQ B;  4MZB A;  4KE3 A;  4OO4 A;  3G7Y A;  1KBN A;  5CO3 A;  2H1G A;  2LTK A;  4EUY A;  2GGT A;  4FO5 A;  4KCA A;  4KSO A;  1TU8 A;  2H1D A;  2YOI A;  3IK7 A;  3LGC A;  1N2A A;  2LKU A;  5C00 A;  3H1N A;  1GRX A;  3E0U A;  1OC9 A;  4ZB8 A;  5FT3 A;  3P90 A;  4K6X A;  4I8B A;  5B6M A;  1K0B A;  4WF4 A;  5IM9 A;  3AY8 A;  1A23 A;  1B8X A;  4IN0 A;  1FHE A;  3P7X A;  1WMJ A;  2P31 A;  1EP8 A;  1Y25 A;  6GSU A;  1K0N A;  1O8W A;  1U87 A;  2L4Q A;  3WT2 A;  1BQ7 A;  2IWT A;  2IJY A;  4EL1 A;  1M9B A;  3ZMK A;  3GKK A;  3WGD A;  3CSI A;  1PN9 A;  4CHS A;  4JU5 A;  1X5C A;  4X43 A;  2ZCT A;  1FO5 A;  3HZ8 A;  4LL4 B;  3BOA A;  1GSD A;  2D2Z A;  3LXZ A;  2R2J A;  3IOS A;  3HXS A;  4X0X A;  5DAK A;  2F8A A;  2RUF A;  2PU9 C;  3KMN A;  3ZRD A;  1WPI A;  4HS1 A;  2J23 A;  2WZ9 A;  4YAP A;  1X9S B;  1WRY A;  3LEF A;  1E2Y A;  1XWG A;  4BL7 A;  8GSS A;  1TI3 A;  4D73 A;  4HZ4 A;  2YWO A;  2YWM A;  3UBL A;  1M2A A;  3ZIJ A;  3CRT A;  4X1U A;  2LS5 A;  1KTE A;  1ZZY A;  2YV9 A;  4DSS B;  4F0C A;  2M80 A;  1O73 A;  5D9V A;  2GDR A;  4OMV A;  4J56 E;  5KN1 A;  3LFL A;  1HNC A;  2VCZ A;  1T1V A;  2HT9 A;  1F9M A;  2ES7 A;  5IMA A;  1QK8 A;  3APQ A;  2VD1 A;  2IN3 A;  4JR4 A;  1Z7R A;  3M9K A;  3IE3 A;  4P3Y B;  2GZP A;  4RUV A;  5EVO A;  2REM A;  2LJK A;  2VUP A;  2C3N A;  2I9H A;  3BCI A;  4K0N A;  4GQF A;  1UA5 A;  3D21 A;  1ST9 A;  1OAZ A;  4G2E A;  2OBK A;  3GN3 A;  5J9B A;  1V40 A;  1FB0 A;  2TRX A;  2DBC A;  5D96 A;  4PUF C;  1O8X A;  2L4C A;  4ID0 A;  2O7K A;  3IDV A;  3HJP A;  1FVK A;  5ID2 A;  1EZK A;  3OR5 A;  1E6B A;  2HYX A;  1RW1 A;  1FW1 A;  2AB6 A;  2OE0 A;  1O81 A;  3IXR A;  2L59 A;  1SK1 A;  2B1K A;  2C3Q A;  1ZYQ B;  4I97 A;  1ZL9 A;  2YP6 A;  3EE2 A;  12GS A;  1JLV A;  2VLU A;  4L0U A;  3DKS A;  4ZL9 A;  3Q6O A;  4DVC A;  1S3D A;  4FIW A;  22GS A;  5G2Z A;  3Q18 A;  2NBS A;  1MTC A;  1JZO A;  2V2G A;  4ZBB A;  5ENU A;  2HSY A;  2RM6 A;  2B6M A;  1YDK A;  2L6D A;  1GUK A;  2DJ1 A;  4RQR A;  4PGT A;  1T3B A;  3NIV A;  2V6O A;  1XCC A;  4K8M A;  1AIU A;  1GTI A;  1TDI A;  2KUC A;  4IGJ A;  4NPB A;  1BJX A;  3TOU A;  4ECC A;  4KDU A;  3MAK A;  2GTU A;  4TW5 A;  3IR4 A;  4NXI A;  2JSZ A;  5J41 A;  2P0G A;  1ERV A;  5D9W A;  3ZFB A;  3BBY A;  5CRG A;  4F2I A;  3IPZ A;  5DQY A;  2OBI A;  2H0H A;  1PL1 A;  3DXB A;  3TKS C;  3FZ5 A;  1XOB A;  4DSS A;  1ILO A;  1AAZ A;  3VFI A;  1F2E A;  5B6N A;  2HNL A;  1ERU A;  1TRS A;  1WJK A;  3D6I A;  1Z6M A;  5IQY A;  4GCI A;  2NTO A;  2XHF A;  1O6J A;  4YAV A;  4MMM A;  3D22 A;  4V2M A;  4XTS A;  1GP1 A;  1R7H A;  1PQN A;  2VCX A;  2DJK A;  5C04 A;  4GST A;  4DSR A;  3F6F A;  1YF1 A;  5HR1 A;  4AGS A;  3E3E A;  2ALB A;  2TRC P;  4ML1 A;  1K3O A;  2HRF A;  3KD0 A;  3GKX A;  2YJ7 A;  4MCU A;  3QMX A;  3GST A;  4F03 A;  5HFI A;  1GNE A;  2CX3 A;  4NHW A;  2HZF A;  1TTZ A;  4I6X A;  5ECP B;  4O5R A;  3Q74 A;  2DJ2 A;  2MMZ A;  1MD3 A;  3FYG A;  2P5Q A;  2IL3 A;  3H8Q A;  3ZZX A;  5G31 A;  1ABA A;  5CRH A;  4K1F A;  2O85 A;  2KOK A;  3IAM 2;  1QFN A;  2B1L A;  2L5O A;  1FVJ A;  3VWV A;  4TR3 A;  4NHZ A;  5F8B A;  1G7E A;  2MBT A; 
#chains in the Genus database with same CATH topology
 4LMV A;  4O5Q A;  4WF5 A;  2PVQ A;  4G10 A;  1XXU A;  3GKM A;  3ZTL A;  1NHY A;  2A2S A;  1UVZ A;  1AQV A;  1QUW A;  5GZZ B;  2GQL A;  4X4J A;  2DKH A;  2BTO T;  1J9B A;  4E8E A;  2PER A;  4O32 A;  1XWB A;  1XVQ A;  1AUC A;  4RI6 A;  1EOH A;  2GST A;  4FH8 A;  1JZR A;  3UAP A;  3VLN A;  5ECO B;  4ACS A;  11GS A;  5IMC A;  5ABR A;  3HDC A;  2H8L A;  3FW2 A;  4Z7X A;  2CZ3 A;  1RK4 A;  3F3Q A;  1M3J A;  5F05 A;  1CQH A;  2DMM A;  3US3 A;  3TKQ A;  4EKZ A;  4K2X A;  3TKR A;  1OE8 A;  3O76 A;  4EE0 A;  3MSZ A;  4HQS A;  4XS6 A;  2FHE A;  3EC3 A;  3F8U A;  2JAC A;  1SD8 A;  3HA9 A;  2H6X A;  2FNO A;  1VF1 A;  2H70 A;  3LYK A;  3EUR A;  2B7J A;  3VUR A;  2ON5 A;  1GUL A;  4MF5 A;  1U3A A;  17GS A;  4JR6 A;  1XG8 A;  2QC7 A;  2C3T A;  2G0F A;  4BWS A;  1O7U A;  4LL1 B;  1BG5 A;  5A4V A;  3QFB C;  2MBS A;  1PMT A;  3KTB A;  4MH2 A;  4HSC X;  1OVN A;  1U88 A;  3FR9 A;  1SK2 A;  1BYE A;  2LRT A;  5IMV A;  2PN8 A;  1Z7P A;  4K2D A;  4ECJ A;  3DIE A;  3GV1 A;  2H66 A;  1T4Z A;  4POL A;  4KB3 A;  2PVO C;  2DJJ A;  4ZL8 A;  6GSW A;  3GTU B;  1YKA A;  1R26 A;  3HZ4 A;  2A4V A;  2NDO A;  4IS0 A;  5F0G A;  1NM3 A;  2RII A;  1EV4 A;  4ISD A;  1PKZ A;  3LWA A;  1YQ1 A;  2K18 A;  4Z2R A;  1AC1 A;  2EIO A;  2VO4 A;  4K7N A;  1F3B A;  3CRU A;  4Q5R A;  2YZH A;  1SK0 A;  3G7J A;  1SD9 A;  3KIJ A;  4FYC A;  3HCZ A;  3WYW A;  1DE2 A;  4POM A;  1WP0 A;  3I9V 2;  2N5B A;  4POB A;  5JCG A;  5KN2 A;  4TKY A;  1TRU A;  1T8E B;  1WIK A;  1F6M C;  3UOM A;  1GSE A;  2LUS A;  4WKW A;  3IRA A;  1M2D A;  2X99 A;  2IMD A;  5GAN D;  1AW9 A;  3RHC A;  2JAD A;  3TKS E;  1PD2 1;  3PIN A;  1SYX A;  2GT5 A;  1A24 A;  3C1R A;  4TR4 A;  2DIZ A;  3GFK A;  3TRQ A;  2HI7 A;  2JSY A;  2IMF A;  2FA8 A;  5IO2 A;  2A2P A;  3RHB A;  3DD3 A;  3IHQ A;  4OCE A;  1ZYP A;  2M72 A;  3CTG A;  4L5L A;  3IA1 A;  4PXO A;  3HJM A;  1K3L A;  3I6A A;  5JWQ B;  3J7Y b;  5LNK e;  4YQM A;  2E7P A;  4HU7 A;  3Q19 A;  2R5G A;  5GAP D;  4HEA 2;  4ILF A;  1C72 A;  3FKF A;  5AIS A;  4IBP A;  3MDK A;  4WEY A;  4V2N A;  1XIY A;  5J3R A;  4KUN A;  1SKR B;  5IMF A;  1JZW A;  1PGT A;  4N0Z A;  1VF2 A;  3GRX A;  2LJA A;  2O8V B;  4V1A g;  2WB9 A;  3WD6 A;  5B8B A;  2R4V A;  5CRE A;  4AJ7 A;  2GS3 A;  1HYU A;  3HJO A;  5A5K A;  3KXO A;  2MYG A;  3EMP A;  6GST A;  4FYB A;  3SWL A;  2OE3 A;  4WBJ A;  2EIR A;  1FAA A;  4TOP A;  4XRA A;  3L0H A;  4MZW A;  3HVS A;  1OE7 A;  5BRT A;  1QMV A;  4NWY A;  2DLX A;  1USB A;  3GA4 A;  4NMU A;  1YEX A;  3ZYW A;  1SL1 B;  5HR3 A;  3DWV A;  5J5N A;  3KEB A;  4XIH A;  4K5S A;  4KDX A;  4YQU A;  4TVE A;  2VCT A;  3C71 A;  1MDI A;  2FLS A;  1TU7 A;  3PGT A;  4N10 A;  4ECI A;  3I69 A;  1MDK A;  4MJB A;  3NOF A;  3M1G A;  3GTU A;  3TCO A;  1RQM A;  3S9F A;  1KNG A;  4NAX A;  5IO0 A;  1V57 A;  2E2M A;  3M3M A;  4GWR A;  1FB6 A;  4TXV A;  3ZVJ D;  2OJL A;  3H4K A;  4HJM A;  1YY7 A;  1K0C A;  4G0L A;  5KEJ A;  2HE3 A;  2WDU A;  4KX4 A;  5GSS A;  3WGX A;  3LG6 A;  3WGE A;  4TN8 A;  2WRT A;  4WR5 A;  2H74 A;  5ECR B;  4HJ2 A;  2UZ8 A;  2H19 A;  1GSQ A;  4RQX A;  1XWC A;  2WFC A;  2FD3 A;  5G5E A;  4AJ6 A;  2BJX A;  2F3M A;  2FWE A;  2KP2 A;  1HD2 A;  3UVT A;  2B7K A;  1ERW A;  2WUL A;  1A2L A;  4LA1 A;  1FOV A;  4ZB9 A;  1XPV A;  2ZNM A;  3F6D A;  1MD4 A;  1M9A A;  3VI5 A;  3CXG A;  3HY2 A;  3RDW A;  5H5S A;  4USS A;  2VL2 A;  3QPM A;  2V32 A;  5G1K A;  1T7P B;  2RLI A;  5F06 A;  1GSY A;  2FWH A;  1NSW A;  1N8J A;  3F4R A;  3QD9 A;  1YJ6 A;  2G2Q A;  2GSS A;  2H71 A;  2DML A;  1Z9H A;  2H76 A;  5E4W A;  4IJ3 A;  4G0K A;  4XRD A;  3R2Q A;  2L57 A;  2C1Y A;  1AXD A;  5CRW A;  5JCW A;  3CQF A;  2R6K A;  5IOW A;  2F51 A;  1Y6E A;  2I3Y A;  1X5E A;  5JCU A;  4N11 A;  1SU9 A;  3HD5 A;  4MPF A;  1ML6 A;  2VLT A;  1LU4 A;  3FMW A;  4ECB A;  3APS A;  4K7O A;  1XOA A;  2CV4 A;  2FGX A;  3G7I A;  1MDJ A;  3KP8 A;  4IQA A;  2CVD A;  4IEL A;  4FQU A;  4ZL7 A;  3H79 A;  1ON4 A;  3FZ4 A;  1TJD A;  18GS A;  4JED A;  4WXT A;  2DIY A;  3V1W A;  1TP9 A;  4JRR A;  3FK8 A;  2CT6 A;  3QAW A;  1XWA A;  1TK0 B;  1GTA A;  5FHI A;  3TJK A;  2K9F A;  3A2X A;  4HU9 A;  4KND A;  5A4W A;  2LST A;  5GST A;  4E8H A;  4YQV A;  3HVX A;  1XWK A;  3U6V A;  2X8G A;  3ERG A;  2OE1 A;  4PX1 A;  3O6T A;  3GSS A;  3A2V A;  3DEX A;  3DGQ A;  3RPN A;  4EXJ A;  1V58 A;  4GQC A;  3FZ9 A;  1QXH A;  4AF2 A;  5DJM A;  1WOU A;  3F0I A;  1OKD A;  2GQK A;  5G1L A;  1GUH A;  4LMW A;  1S3A A;  2E2G A;  3CSJ A;  4QL9 A;  1BAY A;  2GQM A;  3W8S A;  3LXT A;  4OCF A;  3MWH A;  1HNA A;  4XCS A;  3IBH A;  1YZX A;  3I43 A;  2QA1 A;  2I1U A;  4PQI A;  2VOC A;  1AQW A;  2IMI A;  5EY6 A;  3VPQ A;  2H01 A;  4BWQ A;  3D5J A;  1YEP A;  4PQH A;  1Q98 A;  3K8N A;  4MZC A;  3MNG A;  4HDE A;  3UEM A;  2VCQ A;  2YWN A;  5HR2 A;  5LCZ A;  1PN0 A;  2H30 A;  6GSX A;  5J9C A;  1G7O A;  3EYT A;  1EV9 A;  3VWU A;  1SJI A;  5DCH A;  3GUS A;  3FR3 A;  1S3R A;  3LOR A;  4O5U A;  4LLR A;  2C80 A;  5LD0 A;  5KOX A;  3C1S A;  3GYK A;  1HQO A;  4MNN A;  2YPM A;  2NPB A;  2E0Q A;  4HI7 A;  2PWJ A;  2DJ0 A;  2IIY A;  1GSF A;  1VGL A;  3BD2 A;  2KLX A;  2LRN A;  1KEB A;  5B7C A;  4FYU A;  1DSB A;  2DJ3 A;  2PPT A;  1CQG A;  5DAL B;  4YKG A;  5DQS A;  3DRN A;  2J9H A;  3RPP A;  4MF6 A;  3ZML A;  3ME8 A;  5DDL A;  1H75 A;  3HHV A;  4I2T A;  4ZBD A;  1GUM A;  4KAE A;  3GKN A;  3KCM A;  1XVW A;  19GS A;  2MMO A;  1BX9 A;  3QCP A;  3F4T A;  4O92 A;  4KCE A;  4TR0 A;  4BIK A;  2JZS A;  1SL0 B;  3PH9 A;  1BED A;  4QL7 A;  1PL2 A;  2YWI A;  4GF0 A;  3VWX A;  3TRX A;  1SKS B;  3GNJ A;  1EEM A;  2H0G A;  1FOH A;  3A5I A;  1GSU A;  1EGR A;  5INY A;  1R5A A;  3QR6 A;  2GSQ A;  2VLV A;  3IV4 A;  4RI7 A;  1K0A A;  2MMA A;  3LJR A;  3TJF A;  2CQ9 A;  1JHB A;  2OAC A;  2X64 A;  2R0G A;  3ED3 A;  4G0I A;  4ULX A;  3LYP A;  4IW9 A;  10GS A;  4OWY A;  4TRX A;  1TXX A;  1W4V A;  1ZCP A;  4MP4 A;  5HQP A;  2GZY A;  5IPH A;  1PSQ A;  3APO A;  2GSR A;  2HSH A;  1UC7 A;  1EP7 A;  2YV7 A;  4QQ7 A;  2PBJ A;  3GL5 A;  3UL3 A;  4I5Q A;  5A4U A;  5AIV A;  2X8H A;  1SJ6 A;  2C0F A;  5DCG A;  2NVL A;  4J57 E;  3GL3 A;  2X49 A;  2FUG 2;  5ECH B;  2IFQ B;  1B4Q A;  3L9S A;  3ME7 A;  5HR0 A;  3IC4 A;  3D4M A;  4BL7 B;  4PNF A;  3ZL5 A;  4JE1 A;  2Z9S A;  4MK3 A;  1TRW A;  4F9Z A;  1GWC A;  2L6C A;  3IK9 A;  1J08 A;  14GS A;  2R37 A;  4K7I A;  2VL3 A;  2IPA A;  2JZT A;  5D73 A;  3M0F A;  1UN2 A;  3ZLP A;  13GS A;  1PRX A;  3P2A A;  3TGZ A;  4BVX B;  3G9B A;  2EIQ A;  2C4J A;  1V98 A;  4F0B A;  1ZYE A;  3DML A;  2IME A;  1FG4 A;  1WE0 A;  4EDY A;  1JFU A;  3L4N A;  3ZRE A;  1YF0 A;  3TJJ A;  2DSA A;  3TJB A;  1Z3E A;  5IPG A;  3VK9 A;  3MYD A;  1U6T A;  2V1M A;  3A5W A;  1GL8 A;  2YNX A;  3M8N A;  3TDG A;  1A8Y A;  5ID2 B;  4PUR A;  2WGR A;  3GH6 A;  1Z5Y E;  4IJI A;  3JCM L;  1TKD B;  5F07 A;  2QGV A;  3KTL A;  3FHK A;  5HFG A;  3KH7 A;  3BCK A;  1VF3 A;  1X9M B;  4HOJ A;  2HRK A;  4PQ1 A;  4POK A;  3GX8 A;  4PNG A;  5KN0 A;  1B48 A;  1G6W A;  1YKC A;  1XW9 A;  2OA7 A;  3L9U A;  5HFK A;  3C8E A;  2AUV A;  3E9J B;  2IMK A;  5H5Q A;  1GSS A;  4I2U A;  4V2L A;  4CY6 A;  1OC3 A;  5CYY A;  4ZBA A;  4IKH A;  5DJL A;  1B9Y C;  1EGO A;  3UIW A;  4BVY B;  2V6K A;  1EWX A;  4CW9 A;  1DUG A;  1K3Y A;  2CAQ A;  1ZMA A;  4N0V A;  2VD0 A;  3ISO A;  2PGT A;  3TKS A;  1LBK A;  4YKF A;  5ECL B;  4GXZ A;  2FWF A;  1WWJ A;  3ZVJ A;  5D9T A;  1G0T A;  2V41 A;  2C0G A;  3KGK A;  2QSI A;  2C0D A;  4IP6 A;  3J7Y k;  2M46 A;  1M3I A;  3EMX A;  1Q4J A;  5D93 A;  1G6Y A;  2IFQ A;  1I5G A;  5JWR B;  3FRC A;  4IVF A;  4XS4 B;  1GH2 A;  5IOX A;  2VL9 A;  1VRS D;  5E59 A;  2P5R A;  2YCD A;  2B3S A;  3VPT A;  3ZIV A;  1F3A A;  2KP1 A;  6GSY A;  1R5P A;  2K6V A;  3F9U A;  16GS A;  1U3I A;  2HZE B;  4KA0 A;  2L5L A;  1TI1 A;  3BJ5 A;  5IMD A;  2AV4 A;  2H6Y A;  1SYR A;  3TJG A;  4J2F A;  2LQQ A;  4MF7 A;  2LJR A;  5ECQ B;  1V9W A;  3TB2 A;  2CAI A;  3O3T A;  4G19 A;  2O87 A;  4JZQ A;  1SEN A;  4BVX A;  2H1B A;  3M9J A;  4ZIL A;  1PA3 A;  4EO3 A;  3N5O A;  4K9Z A;  7GSS A;  1B9X C;  1TW9 A;  4BPY A;  1A8L A;  2AHE A;  1QQ2 A;  3GH9 A;  1V2A A;  5DBQ A;  2H73 A;  1A2J A;  3EPT A;  1X0R A;  2MZC A;  1K0O A;  5B8A A;  2I81 A;  2FWG A;  3FY7 A;  20GS A;  1Z6N A;  2FA4 A;  4IP1 A;  1TK8 B;  5D9X A;  4NV2 A;  5IIZ A;  2JZR A;  1URM A;  1A2M A;  4OFM A;  1PX6 A;  3CSH A;  2C0E A;  2JU5 A;  2H6Z A;  3ERF A;  3HVV A;  2F8F A;  4MAB A;  4EDZ A;  3NZN A;  1TK5 B;  2CX4 A;  2FY6 A;  5J4U A;  2LV3 A;  3CTF A;  1HNB A;  4PUA A;  2CA8 A;  2HXK A;  3GMF A;  2XPD A;  3EIN A;  2K8V A;  3EU4 A;  3HVN A;  3P8W A;  3FEU A;  3UVH A;  2A2R A;  2I4A A;  3QAG A;  4MJA A;  4Z2U A;  3D0Z A;  5JWO B;  2XPE A;  3HKR A;  2BMX A;  4MJC A;  5AIX A;  5ELG A;  5G30 A;  1QGV A;  4H86 A;  2ON7 A;  5AN1 A;  2GZZ A;  4BVY A;  3ERW A;  4HZ2 A;  2HLS A;  3GUR A;  3GX0 A;  1PFO A;  2A4H A;  2XBQ A;  1AQX A;  2DC5 A;  2VCV A;  3GIX A;  4GSS A;  1DBY A;  3DYR A;  2H72 A;  3W6G A;  4CDO A;  5BMU A;  3QFA C;  2OKA A;  3DVX A;  2PUK C;  1TOF A;  4HUA A;  5AGY A;  1NW2 A;  3RAZ A;  5IMZ A;  3UMA A;  3ZFL A;  4Q5N A;  2K8S A;  1K0D A;  3KP9 A;  1OYJ A;  6GSV A;  2LEG A;  1M99 A;  4TR1 B;  4WR4 A;  3KM6 A;  2GVP A;  1M2B A;  3UJ1 A;  1EEJ A;  1JLW A;  3IHG A;  4XS4 A;  1SKW B;  1ZYN A;  1X9W B;  1XW6 A;  3TRP A;  1SL2 B;  3HYP A;  5COH A;  2X8C A;  4MDC A;  2LNT A;  4KW6 A;  2HZE A;  4Q5F A;  1XZO A;  2TIR A;  2B5E A;  2VAF A;  4MJE A;  4OD7 A;  2MMN A;  1VF4 A;  2CVK A;  3RBT A;  3UBK A;  3PR8 A;  4Q5Q A;  4ZIJ A;  1ZGN A;  3KJY A;  3D4T A;  1M0U A;  1T00 A;  1GLP A;  2AYT A;  1A0R P;  1XW5 A;  3QDN A;  3CMI A;  5CRD A;  4EIP A;  5EL8 A;  4V1A p;  2YAN A;  2XC2 A;  1ERT A;  4MLY A;  5CP1 A;  2WJU A;  4GRF A;  2H0I A;  1XBS A;  3KZQ A;  2H75 A;  2WCI A;  5L71 A;  1H4O A;  3A3T A;  3H93 A;  4MA9 A;  4TXO B;  4KDY A;  4ZB6 A;  1GTU A;  2VM2 A;  3CYN A;  4KSM A;  4OFN A;  3W8J A;  2LRC A;  2YZU A;  4F82 A;  1DE1 A;  4NV5 A;  4GLT A;  1THX A;  2XBI A;  2LQO A;  4DSQ A;  1OC8 A;  4K0G A;  1NHO A;  3L9V A;  2DKI A;  1B4P A;  3TKP A;  1EOG A;  3IC8 A;  4XS1 A;  1F37 A;  5EPF A;  4N30 A;  1GTB A;  1XFL A;  4EVM A;  2VL2 C;  3QOU A;  3LQ7 A;  4KGI A;  4EF0 A;  4BA7 A;  2GLR A;  5CNW A;  2C8U A;  1OKT A;  6GSS A;  3TOT A;  4IHU A;  3UAR A;  3EU3 A;  3SBC A;  4OFT A;  3KH9 A;  2QA2 A;  1OC9 B;  2N5A A;  3FZA A;  2PMT A;  2B5X A;  3C73 A;  2VCW A;  3GHA A;  1ACV A;  3F4S A;  1LJR A;  3N9J A;  4JBB A;  3VI7 A;  9GSS A;  4L8E A;  1IYI A;  4IQ1 A;  4KH7 A;  5ECN B;  1TRV A;  2H1A A;  1A0F A;  1GNW A;  5D8I A;  4YH2 A;  5CAX A;  4L5O A;  1SJZ A;  1M7T A;  4TR1 A;  2CZ2 A;  2HFD A;  2R3X A;  4ML6 A;  3QAV A;  5ELA A;  3DVW A;  2N5F A;  1GLQ A;  5KN3 A;  3A2W A;  3EWL A;  2KHP A;  3IAS 2;  1X5D A;  4GSN A;  1PX7 A;  2FCH A;  5ECI B;  1IYH A;  2VIM A;  3VWW A;  1R4W A;  3KMO A;  3LSZ A;  3C7M A;  1MEK A;  4WET A;  4HQZ A;  2JL4 A;  2QKE A;  4GTU A;  3U5R E;  1I9D A;  3CBU A;  2RM5 A;  4DEJ A;  2AAW A;  2B5Y A;  5DAK B;  3ZIT A;  4G9H A;  4ZXG A;  3F3R A;  2X4A A;  2YJH A;  2YN1 A;  5ECM B;  1J0F A;  4K5R A;  1T4Y A;  3F63 A;  4MH3 A;  5ECS A;  2VM1 A;  3EVI A;  2O89 A;  2CVB A;  1W89 A;  4EC0 A;  4D73 B;  5H5R A;  4L0W A;  4WBR D;  1S3C A;  2OAD A;  5DVB A;  4TXO A;  3TUE A;  2RUE A;  1ZOF A;  2F9S A;  1THO A;  1PKW A;  4OO5 A;  3L78 A;  4XHM A;  1JZD A;  2EC4 A;  3WT1 A;  5G5F A;  5ECK B;  4O7H A;  4MPG A;  2ZUP A;  2GT6 A;  2HRN A;  2WS2 A;  2LNS A;  1K0M A;  1O85 A;  5FWG A;  4AJ8 A;  3FR6 A;  5DAL A;  2AJQ B;  4MZB A;  4KE3 A;  4OO4 A;  3G7Y A;  1KBN A;  5CO3 A;  2H1G A;  2LTK A;  4EUY A;  2GGT A;  4FO5 A;  4KCA A;  4KSO A;  4A5P A;  1TU8 A;  2H1D A;  2YOI A;  5KOW A;  3IK7 A;  3LGC A;  1N2A A;  2LKU A;  5C00 A;  3H1N A;  1GRX A;  3E0U A;  1OC9 A;  4ZB8 A;  5FT3 A;  3P90 A;  4K6X A;  4I8B A;  5B6M A;  1K0B A;  4WF4 A;  5IM9 A;  3AY8 A;  1A23 A;  1B8X A;  4IN0 A;  1FHE A;  4KF9 A;  3P7X A;  1WMJ A;  2P31 A;  1EP8 A;  4PTS A;  1Y25 A;  6GSU A;  1K0N A;  1O8W A;  1U87 A;  2L4Q A;  3WT2 A;  1BQ7 A;  2IWT A;  2IJY A;  4EL1 A;  1M9B A;  3ZMK A;  3GKK A;  3WGD A;  3CSI A;  1PN9 A;  4EIQ A;  4CHS A;  3LW9 A;  4JU5 A;  1X5C A;  4X43 A;  2ZCT A;  1FO5 A;  3HZ8 A;  4LL4 B;  3BOA A;  1GSD A;  2D2Z A;  3LXZ A;  2R2J A;  3IOS A;  3HXS A;  4X0X A;  5DAK A;  2F8A A;  2RUF A;  3PPU A;  2PU9 C;  3KMN A;  3ZRD A;  1WPI A;  4HS1 A;  2J23 A;  2WZ9 A;  4YAP A;  1X9S B;  1WRY A;  3LEF A;  1E2Y A;  1XWG A;  4BL7 A;  8GSS A;  1TI3 A;  4D73 A;  4HZ4 A;  2YWO A;  2YWM A;  3UBL A;  1M2A A;  3ZIJ A;  3R3E A;  3CRT A;  4X1U A;  2LS5 A;  1KTE A;  1ZZY A;  2YV9 A;  4DSS B;  4F0C A;  2M80 A;  1O73 A;  5D9V A;  2GDR A;  4OMV A;  4J56 E;  5KN1 A;  3LFL A;  1HNC A;  2VCZ A;  1T1V A;  2HT9 A;  1F9M A;  2ES7 A;  5IMA A;  1QK8 A;  3APQ A;  2VD1 A;  2IN3 A;  4JR4 A;  1Z7R A;  3M9K A;  3IE3 A;  4P3Y B;  2GZP A;  4RUV A;  5EVO A;  2REM A;  2LJK A;  2VUP A;  2C3N A;  2I9H A;  3BCI A;  4K0N A;  4GQF A;  1UA5 A;  3D21 A;  1ST9 A;  1OAZ A;  4G2E A;  2HRA A;  2OBK A;  3GN3 A;  5J9B A;  1V40 A;  1FB0 A;  2TRX A;  2DBC A;  5D96 A;  4PUF C;  1O8X A;  2L4C A;  2R0C A;  4ID0 A;  2O7K A;  3IDV A;  3HJP A;  1FVK A;  5ID2 A;  1EZK A;  3OR5 A;  1E6B A;  2HYX A;  1RW1 A;  1FW1 A;  2AB6 A;  2OE0 A;  1O81 A;  3IXR A;  2L59 A;  1SK1 A;  2B1K A;  2C3Q A;  1ZYQ B;  4I97 A;  1ZL9 A;  2YP6 A;  3EE2 A;  12GS A;  1JLV A;  2HSM A;  2VLU A;  4L0U A;  3DKS A;  4ZL9 A;  3Q6O A;  4DVC A;  1S3D A;  4FIW A;  22GS A;  5G2Z A;  3Q18 A;  2NBS A;  1MTC A;  1JZO A;  2V2G A;  4ZBB A;  5ENU A;  2HSY A;  2RM6 A;  2B6M A;  1YDK A;  2L6D A;  1GUK A;  2DJ1 A;  4RQR A;  4PGT A;  1T3B A;  3NIV A;  2V6O A;  1XCC A;  4K8M A;  1AIU A;  1GTI A;  1TDI A;  2KUC A;  4IGJ A;  4NPB A;  1BJX A;  3TOU A;  4ECC A;  4KDU A;  3MAK A;  2GTU A;  4TW5 A;  3IR4 A;  4NXI A;  2JSZ A;  5J41 A;  2P0G A;  1ERV A;  5D9W A;  3ZFB A;  3BBY A;  4ICY A;  5CRG A;  4F2I A;  3IPZ A;  5DQY A;  2OBI A;  3MIX A;  2H0H A;  1PL1 A;  3DXB A;  3TKS C;  3FZ5 A;  1XOB A;  4DSS A;  1ILO A;  1AAZ A;  3VFI A;  1F2E A;  4CY8 A;  5B6N A;  2HNL A;  1ERU A;  1TRS A;  1WJK A;  3D6I A;  1Z6M A;  5IQY A;  4Z2T A;  4GCI A;  2NTO A;  2XHF A;  1O6J A;  4YAV A;  4MMM A;  3D22 A;  4V2M A;  4XTS A;  1GP1 A;  1R7H A;  1PQN A;  2VCX A;  2DJK A;  5C04 A;  4GST A;  4DSR A;  3F6F A;  1YF1 A;  5HR1 A;  4AGS A;  3E3E A;  2ALB A;  2TRC P;  4ML1 A;  1K3O A;  2HRF A;  3KD0 A;  3GKX A;  2YJ7 A;  4MCU A;  3QMX A;  3GST A;  4F03 A;  5HFI A;  1GNE A;  2CX3 A;  4NHW A;  2HZF A;  1TTZ A;  4I6X A;  5ECP B;  4O5R A;  3Q74 A;  2DJ2 A;  2MMZ A;  1MD3 A;  3FYG A;  2P5Q A;  2IL3 A;  2R0P A;  3H8Q A;  3ZZX A;  5G31 A;  1ABA A;  5CRH A;  4K1F A;  2O85 A;  2KOK A;  3IAM 2;  1QFN A;  2B1L A;  2L5O A;  1FVJ A;  3VWV A;  4TR3 A;  4NHZ A;  5F8B A;  1G7E A;  2MBT A; 
#chains in the Genus database with same CATH homology
 4LMV A;  4O5Q A;  4WF5 A;  2PVQ A;  4G10 A;  1XXU A;  3GKM A;  3ZTL A;  1NHY A;  2A2S A;  1UVZ A;  1AQV A;  1QUW A;  5GZZ B;  2GQL A;  4X4J A;  2DKH A;  2BTO T;  1J9B A;  4E8E A;  2PER A;  4O32 A;  1XWB A;  1XVQ A;  1AUC A;  4RI6 A;  1EOH A;  2GST A;  4FH8 A;  1JZR A;  3UAP A;  3VLN A;  5ECO B;  4ACS A;  11GS A;  5IMC A;  5ABR A;  3HDC A;  2H8L A;  3FW2 A;  4Z7X A;  2CZ3 A;  1RK4 A;  3F3Q A;  5F05 A;  1CQH A;  2DMM A;  3US3 A;  3TKQ A;  4EKZ A;  4K2X A;  3TKR A;  1OE8 A;  3O76 A;  4EE0 A;  3MSZ A;  4HQS A;  4XS6 A;  2FHE A;  3EC3 A;  3F8U A;  2JAC A;  1SD8 A;  3HA9 A;  2H6X A;  2FNO A;  1VF1 A;  2H70 A;  3LYK A;  3EUR A;  2B7J A;  3VUR A;  2ON5 A;  1GUL A;  4MF5 A;  1U3A A;  17GS A;  4JR6 A;  2QC7 A;  2C3T A;  2G0F A;  4BWS A;  1O7U A;  4LL1 B;  1BG5 A;  5A4V A;  3QFB C;  2MBS A;  1PMT A;  3KTB A;  4MH2 A;  1OVN A;  1U88 A;  3FR9 A;  1SK2 A;  1BYE A;  2LRT A;  5IMV A;  2PN8 A;  1Z7P A;  4K2D A;  4ECJ A;  3DIE A;  3GV1 A;  2H66 A;  1T4Z A;  4POL A;  4KB3 A;  2PVO C;  2DJJ A;  4ZL8 A;  6GSW A;  3GTU B;  1YKA A;  1R26 A;  3HZ4 A;  2A4V A;  2NDO A;  4IS0 A;  5F0G A;  1NM3 A;  2RII A;  1EV4 A;  4ISD A;  1PKZ A;  3LWA A;  1YQ1 A;  2K18 A;  4Z2R A;  1AC1 A;  2EIO A;  2VO4 A;  4K7N A;  1F3B A;  3CRU A;  4Q5R A;  2YZH A;  1SK0 A;  3G7J A;  1SD9 A;  3KIJ A;  4FYC A;  3HCZ A;  3WYW A;  1DE2 A;  4POM A;  1WP0 A;  3I9V 2;  2N5B A;  4POB A;  5JCG A;  5KN2 A;  4TKY A;  1TRU A;  1T8E B;  1WIK A;  1F6M C;  3UOM A;  1GSE A;  2LUS A;  4WKW A;  3IRA A;  1M2D A;  2X99 A;  2IMD A;  5GAN D;  1AW9 A;  3RHC A;  2JAD A;  3TKS E;  1PD2 1;  3PIN A;  1SYX A;  2GT5 A;  1A24 A;  3C1R A;  4TR4 A;  2DIZ A;  3GFK A;  3TRQ A;  2HI7 A;  2JSY A;  2IMF A;  2FA8 A;  5IO2 A;  2A2P A;  3RHB A;  3DD3 A;  3IHQ A;  4OCE A;  1ZYP A;  2M72 A;  3CTG A;  4L5L A;  3IA1 A;  4PXO A;  3HJM A;  1K3L A;  3I6A A;  5JWQ B;  3J7Y b;  5LNK e;  4YQM A;  2E7P A;  4HU7 A;  3Q19 A;  2R5G A;  5GAP D;  4HEA 2;  4ILF A;  1C72 A;  3FKF A;  5AIS A;  4IBP A;  3MDK A;  4WEY A;  4V2N A;  1XIY A;  5J3R A;  4KUN A;  1SKR B;  5IMF A;  1JZW A;  1PGT A;  4N0Z A;  1VF2 A;  3GRX A;  2LJA A;  2O8V B;  4V1A g;  2WB9 A;  3WD6 A;  5B8B A;  2R4V A;  5CRE A;  4AJ7 A;  2GS3 A;  1HYU A;  3HJO A;  5A5K A;  3KXO A;  2MYG A;  3EMP A;  6GST A;  4FYB A;  3SWL A;  2OE3 A;  4WBJ A;  2EIR A;  1FAA A;  4TOP A;  4XRA A;  3L0H A;  4MZW A;  3HVS A;  1OE7 A;  5BRT A;  1QMV A;  4NWY A;  2DLX A;  1USB A;  3GA4 A;  4NMU A;  1YEX A;  3ZYW A;  1SL1 B;  5HR3 A;  3DWV A;  5J5N A;  3KEB A;  4XIH A;  4K5S A;  4KDX A;  4YQU A;  4TVE A;  2VCT A;  3C71 A;  1MDI A;  2FLS A;  1TU7 A;  3PGT A;  4N10 A;  4ECI A;  3I69 A;  1MDK A;  4MJB A;  3NOF A;  3M1G A;  3GTU A;  3TCO A;  1RQM A;  3S9F A;  1KNG A;  4NAX A;  5IO0 A;  1V57 A;  2E2M A;  3M3M A;  4GWR A;  1FB6 A;  4TXV A;  3ZVJ D;  2OJL A;  3H4K A;  4HJM A;  1YY7 A;  1K0C A;  4G0L A;  5KEJ A;  2HE3 A;  2WDU A;  4KX4 A;  5GSS A;  3WGX A;  3LG6 A;  3WGE A;  4TN8 A;  2WRT A;  4WR5 A;  2H74 A;  5ECR B;  4HJ2 A;  2UZ8 A;  2H19 A;  1GSQ A;  4RQX A;  1XWC A;  2WFC A;  2FD3 A;  5G5E A;  4AJ6 A;  2BJX A;  2F3M A;  2FWE A;  2KP2 A;  1HD2 A;  3UVT A;  2B7K A;  1ERW A;  2WUL A;  1A2L A;  4LA1 A;  1FOV A;  4ZB9 A;  1XPV A;  2ZNM A;  3F6D A;  1MD4 A;  1M9A A;  3VI5 A;  3CXG A;  3HY2 A;  3RDW A;  5H5S A;  4USS A;  2VL2 A;  3QPM A;  2V32 A;  5G1K A;  1T7P B;  2RLI A;  5F06 A;  1GSY A;  2FWH A;  1NSW A;  1N8J A;  3F4R A;  3QD9 A;  1YJ6 A;  2G2Q A;  2GSS A;  2H71 A;  2DML A;  1Z9H A;  2H76 A;  5E4W A;  4IJ3 A;  4G0K A;  4XRD A;  3R2Q A;  2L57 A;  2C1Y A;  1AXD A;  5CRW A;  5JCW A;  2R6K A;  5IOW A;  2F51 A;  1Y6E A;  2I3Y A;  1X5E A;  5JCU A;  4N11 A;  1SU9 A;  3HD5 A;  4MPF A;  1ML6 A;  2VLT A;  1LU4 A;  3FMW A;  4ECB A;  3APS A;  4K7O A;  1XOA A;  2CV4 A;  2FGX A;  3G7I A;  1MDJ A;  3KP8 A;  4IQA A;  2CVD A;  4IEL A;  4FQU A;  4ZL7 A;  3H79 A;  1ON4 A;  3FZ4 A;  1TJD A;  18GS A;  4JED A;  4WXT A;  2DIY A;  3V1W A;  1TP9 A;  4JRR A;  3FK8 A;  2CT6 A;  3QAW A;  1XWA A;  1TK0 B;  1GTA A;  5FHI A;  3TJK A;  2K9F A;  3A2X A;  4HU9 A;  4KND A;  5A4W A;  2LST A;  5GST A;  4E8H A;  4YQV A;  3HVX A;  1XWK A;  3U6V A;  2X8G A;  3ERG A;  2OE1 A;  4PX1 A;  3O6T A;  3GSS A;  3A2V A;  3DEX A;  3DGQ A;  3RPN A;  4EXJ A;  1V58 A;  4GQC A;  3FZ9 A;  1QXH A;  4AF2 A;  5DJM A;  1WOU A;  3F0I A;  1OKD A;  2GQK A;  5G1L A;  1GUH A;  4LMW A;  1S3A A;  2E2G A;  3CSJ A;  4QL9 A;  1BAY A;  2GQM A;  3W8S A;  3LXT A;  4OCF A;  3MWH A;  1HNA A;  4XCS A;  3IBH A;  1YZX A;  3I43 A;  2QA1 A;  2I1U A;  4PQI A;  2VOC A;  1AQW A;  2IMI A;  5EY6 A;  3VPQ A;  2H01 A;  4BWQ A;  3D5J A;  1YEP A;  4PQH A;  1Q98 A;  3K8N A;  4MZC A;  3MNG A;  4HDE A;  3UEM A;  2VCQ A;  2YWN A;  5HR2 A;  5LCZ A;  1PN0 A;  2H30 A;  6GSX A;  5J9C A;  1G7O A;  3EYT A;  1EV9 A;  3VWU A;  1SJI A;  5DCH A;  3GUS A;  3FR3 A;  3LOR A;  4O5U A;  4LLR A;  2C80 A;  5LD0 A;  5KOX A;  3C1S A;  3GYK A;  1HQO A;  4MNN A;  2YPM A;  2NPB A;  2E0Q A;  4HI7 A;  2PWJ A;  2DJ0 A;  2IIY A;  1GSF A;  1VGL A;  3BD2 A;  2KLX A;  2LRN A;  1KEB A;  5B7C A;  4FYU A;  1DSB A;  2DJ3 A;  2PPT A;  1CQG A;  5DAL B;  4YKG A;  5DQS A;  3DRN A;  2J9H A;  3RPP A;  4MF6 A;  3ZML A;  3ME8 A;  5DDL A;  1H75 A;  3HHV A;  4I2T A;  4ZBD A;  1GUM A;  4KAE A;  3GKN A;  3KCM A;  1XVW A;  19GS A;  2MMO A;  1BX9 A;  3QCP A;  3F4T A;  4O92 A;  4KCE A;  4TR0 A;  2JZS A;  1SL0 B;  3PH9 A;  1BED A;  4QL7 A;  1PL2 A;  2YWI A;  4GF0 A;  3VWX A;  3TRX A;  1SKS B;  3GNJ A;  1EEM A;  2H0G A;  1FOH A;  3A5I A;  1GSU A;  1EGR A;  5INY A;  1R5A A;  3QR6 A;  2GSQ A;  2VLV A;  3IV4 A;  4RI7 A;  1K0A A;  2MMA A;  3LJR A;  3TJF A;  2CQ9 A;  1JHB A;  2OAC A;  2X64 A;  2R0G A;  3ED3 A;  4G0I A;  4ULX A;  3LYP A;  4IW9 A;  10GS A;  4OWY A;  4TRX A;  1TXX A;  1W4V A;  1ZCP A;  4MP4 A;  5HQP A;  2GZY A;  5IPH A;  1PSQ A;  3APO A;  2GSR A;  2HSH A;  1UC7 A;  1EP7 A;  2YV7 A;  4QQ7 A;  2PBJ A;  3GL5 A;  3UL3 A;  4I5Q A;  5A4U A;  5AIV A;  2X8H A;  1SJ6 A;  2C0F A;  5DCG A;  2NVL A;  4J57 E;  3GL3 A;  2X49 A;  2FUG 2;  5ECH B;  2IFQ B;  1B4Q A;  3L9S A;  3ME7 A;  5HR0 A;  3IC4 A;  3D4M A;  4BL7 B;  4PNF A;  3ZL5 A;  4JE1 A;  2Z9S A;  4MK3 A;  1TRW A;  4F9Z A;  1GWC A;  2L6C A;  3IK9 A;  1J08 A;  14GS A;  2R37 A;  4K7I A;  2VL3 A;  2IPA A;  2JZT A;  5D73 A;  3M0F A;  1UN2 A;  3ZLP A;  13GS A;  1PRX A;  3P2A A;  3TGZ A;  4BVX B;  3G9B A;  2EIQ A;  2C4J A;  1V98 A;  4F0B A;  1ZYE A;  3DML A;  2IME A;  1FG4 A;  1WE0 A;  4EDY A;  1JFU A;  3L4N A;  3ZRE A;  1YF0 A;  3TJJ A;  2DSA A;  3TJB A;  1Z3E A;  5IPG A;  3VK9 A;  3MYD A;  1U6T A;  2V1M A;  3A5W A;  1GL8 A;  2YNX A;  3M8N A;  3TDG A;  1A8Y A;  5ID2 B;  4PUR A;  2WGR A;  3GH6 A;  1Z5Y E;  4IJI A;  3JCM L;  1TKD B;  5F07 A;  2QGV A;  3KTL A;  3FHK A;  5HFG A;  3KH7 A;  3BCK A;  1VF3 A;  1X9M B;  4HOJ A;  2HRK A;  4PQ1 A;  4POK A;  3GX8 A;  4PNG A;  5KN0 A;  1B48 A;  1G6W A;  1YKC A;  1XW9 A;  2OA7 A;  3L9U A;  5HFK A;  3C8E A;  2AUV A;  3E9J B;  2IMK A;  5H5Q A;  1GSS A;  4I2U A;  4V2L A;  4CY6 A;  1OC3 A;  5CYY A;  4ZBA A;  4IKH A;  5DJL A;  1B9Y C;  1EGO A;  3UIW A;  4BVY B;  2V6K A;  1EWX A;  4CW9 A;  1DUG A;  1K3Y A;  2CAQ A;  1ZMA A;  4N0V A;  2VD0 A;  3ISO A;  2PGT A;  3TKS A;  1LBK A;  4YKF A;  5ECL B;  4GXZ A;  2FWF A;  1WWJ A;  3ZVJ A;  5D9T A;  1G0T A;  2V41 A;  2C0G A;  3KGK A;  2QSI A;  2C0D A;  4IP6 A;  3J7Y k;  2M46 A;  3EMX A;  1Q4J A;  5D93 A;  1G6Y A;  2IFQ A;  1I5G A;  5JWR B;  3FRC A;  4IVF A;  4XS4 B;  1GH2 A;  5IOX A;  2VL9 A;  1VRS D;  5E59 A;  2P5R A;  2YCD A;  2B3S A;  3VPT A;  3ZIV A;  1F3A A;  2KP1 A;  6GSY A;  1R5P A;  2K6V A;  3F9U A;  16GS A;  1U3I A;  2HZE B;  4KA0 A;  2L5L A;  1TI1 A;  3BJ5 A;  5IMD A;  2AV4 A;  2H6Y A;  1SYR A;  3TJG A;  4J2F A;  2LQQ A;  4MF7 A;  2LJR A;  5ECQ B;  1V9W A;  3TB2 A;  2CAI A;  3O3T A;  4G19 A;  2O87 A;  4JZQ A;  1SEN A;  4BVX A;  2H1B A;  3M9J A;  4ZIL A;  1PA3 A;  4EO3 A;  3N5O A;  4K9Z A;  7GSS A;  1B9X C;  1TW9 A;  4BPY A;  1A8L A;  2AHE A;  1QQ2 A;  3GH9 A;  1V2A A;  5DBQ A;  2H73 A;  1A2J A;  3EPT A;  1X0R A;  2MZC A;  1K0O A;  5B8A A;  2I81 A;  2FWG A;  3FY7 A;  20GS A;  1Z6N A;  2FA4 A;  4IP1 A;  1TK8 B;  5D9X A;  4NV2 A;  5IIZ A;  2JZR A;  1URM A;  1A2M A;  4OFM A;  1PX6 A;  3CSH A;  2C0E A;  2JU5 A;  2H6Z A;  3ERF A;  3HVV A;  2F8F A;  4MAB A;  4EDZ A;  3NZN A;  1TK5 B;  2CX4 A;  2FY6 A;  5J4U A;  2LV3 A;  3CTF A;  1HNB A;  4PUA A;  2CA8 A;  2HXK A;  3GMF A;  2XPD A;  3EIN A;  2K8V A;  3EU4 A;  3P8W A;  3FEU A;  3UVH A;  2A2R A;  2I4A A;  3QAG A;  4MJA A;  4Z2U A;  3D0Z A;  5JWO B;  2XPE A;  3HKR A;  2BMX A;  4MJC A;  5AIX A;  5ELG A;  5G30 A;  1QGV A;  4H86 A;  2ON7 A;  5AN1 A;  2GZZ A;  4BVY A;  3ERW A;  4HZ2 A;  2HLS A;  3GUR A;  3GX0 A;  2A4H A;  2XBQ A;  1AQX A;  2DC5 A;  2VCV A;  3GIX A;  4GSS A;  1DBY A;  3DYR A;  2H72 A;  3W6G A;  4CDO A;  5BMU A;  3QFA C;  2OKA A;  3DVX A;  2PUK C;  1TOF A;  4HUA A;  5AGY A;  1NW2 A;  3RAZ A;  5IMZ A;  3UMA A;  3ZFL A;  4Q5N A;  2K8S A;  1K0D A;  3KP9 A;  1OYJ A;  6GSV A;  2LEG A;  1M99 A;  4TR1 B;  4WR4 A;  3KM6 A;  2GVP A;  1M2B A;  3UJ1 A;  1EEJ A;  1JLW A;  3IHG A;  4XS4 A;  1SKW B;  1ZYN A;  1X9W B;  1XW6 A;  3TRP A;  1SL2 B;  3HYP A;  5COH A;  2X8C A;  4MDC A;  2LNT A;  4KW6 A;  2HZE A;  4Q5F A;  1XZO A;  2TIR A;  2B5E A;  2VAF A;  4MJE A;  4OD7 A;  2MMN A;  1VF4 A;  2CVK A;  3RBT A;  3UBK A;  3PR8 A;  4Q5Q A;  4ZIJ A;  1ZGN A;  3KJY A;  3D4T A;  1M0U A;  1T00 A;  1GLP A;  2AYT A;  1A0R P;  1XW5 A;  3QDN A;  3CMI A;  5CRD A;  4EIP A;  5EL8 A;  4V1A p;  2YAN A;  2XC2 A;  1ERT A;  4MLY A;  5CP1 A;  2WJU A;  4GRF A;  2H0I A;  1XBS A;  3KZQ A;  2H75 A;  2WCI A;  5L71 A;  1H4O A;  3A3T A;  3H93 A;  4MA9 A;  4TXO B;  4KDY A;  4ZB6 A;  1GTU A;  2VM2 A;  3CYN A;  4KSM A;  4OFN A;  3W8J A;  2LRC A;  2YZU A;  4F82 A;  1DE1 A;  4NV5 A;  4GLT A;  1THX A;  2XBI A;  2LQO A;  4DSQ A;  1OC8 A;  4K0G A;  1NHO A;  3L9V A;  2DKI A;  1B4P A;  3TKP A;  1EOG A;  3IC8 A;  4XS1 A;  1F37 A;  5EPF A;  4N30 A;  1GTB A;  1XFL A;  4EVM A;  2VL2 C;  3QOU A;  3LQ7 A;  4KGI A;  4EF0 A;  4BA7 A;  2GLR A;  5CNW A;  2C8U A;  1OKT A;  6GSS A;  3TOT A;  4IHU A;  3UAR A;  3EU3 A;  3SBC A;  4OFT A;  3KH9 A;  2QA2 A;  1OC9 B;  2N5A A;  3FZA A;  2PMT A;  2B5X A;  3C73 A;  2VCW A;  3GHA A;  1ACV A;  3F4S A;  1LJR A;  3N9J A;  4JBB A;  3VI7 A;  9GSS A;  4L8E A;  1IYI A;  4IQ1 A;  4KH7 A;  5ECN B;  1TRV A;  2H1A A;  1A0F A;  1GNW A;  5D8I A;  4YH2 A;  5CAX A;  4L5O A;  1SJZ A;  1M7T A;  4TR1 A;  2CZ2 A;  2HFD A;  2R3X A;  4ML6 A;  3QAV A;  5ELA A;  3DVW A;  2N5F A;  1GLQ A;  5KN3 A;  3A2W A;  3EWL A;  2KHP A;  3IAS 2;  1X5D A;  4GSN A;  1PX7 A;  2FCH A;  5ECI B;  1IYH A;  2VIM A;  3VWW A;  1R4W A;  3KMO A;  3LSZ A;  3C7M A;  1MEK A;  4WET A;  4HQZ A;  2JL4 A;  2QKE A;  4GTU A;  3U5R E;  1I9D A;  3CBU A;  2RM5 A;  4DEJ A;  2AAW A;  2B5Y A;  5DAK B;  3ZIT A;  4G9H A;  4ZXG A;  3F3R A;  2X4A A;  2YJH A;  2YN1 A;  5ECM B;  1J0F A;  4K5R A;  1T4Y A;  3F63 A;  4MH3 A;  5ECS A;  2VM1 A;  3EVI A;  2O89 A;  2CVB A;  1W89 A;  4EC0 A;  4D73 B;  5H5R A;  4L0W A;  4WBR D;  1S3C A;  2OAD A;  5DVB A;  4TXO A;  3TUE A;  2RUE A;  1ZOF A;  2F9S A;  1THO A;  1PKW A;  4OO5 A;  3L78 A;  4XHM A;  1JZD A;  2EC4 A;  3WT1 A;  5G5F A;  5ECK B;  4O7H A;  4MPG A;  2ZUP A;  2GT6 A;  2HRN A;  2WS2 A;  2LNS A;  1K0M A;  1O85 A;  5FWG A;  4AJ8 A;  3FR6 A;  5DAL A;  2AJQ B;  4MZB A;  4KE3 A;  4OO4 A;  3G7Y A;  1KBN A;  5CO3 A;  2H1G A;  2LTK A;  4EUY A;  2GGT A;  4FO5 A;  4KCA A;  4KSO A;  4A5P A;  1TU8 A;  2H1D A;  2YOI A;  5KOW A;  3IK7 A;  3LGC A;  1N2A A;  2LKU A;  5C00 A;  3H1N A;  1GRX A;  3E0U A;  1OC9 A;  4ZB8 A;  5FT3 A;  3P90 A;  4K6X A;  4I8B A;  5B6M A;  1K0B A;  4WF4 A;  5IM9 A;  3AY8 A;  1A23 A;  1B8X A;  4IN0 A;  1FHE A;  4KF9 A;  3P7X A;  1WMJ A;  2P31 A;  1EP8 A;  4PTS A;  1Y25 A;  6GSU A;  1K0N A;  1O8W A;  1U87 A;  2L4Q A;  3WT2 A;  1BQ7 A;  2IWT A;  2IJY A;  4EL1 A;  1M9B A;  3ZMK A;  3GKK A;  3WGD A;  3CSI A;  1PN9 A;  4EIQ A;  4CHS A;  3LW9 A;  4JU5 A;  1X5C A;  4X43 A;  2ZCT A;  1FO5 A;  3HZ8 A;  4LL4 B;  3BOA A;  1GSD A;  2D2Z A;  3LXZ A;  2R2J A;  3IOS A;  3HXS A;  4X0X A;  5DAK A;  2F8A A;  2RUF A;  3PPU A;  2PU9 C;  3KMN A;  3ZRD A;  1WPI A;  4HS1 A;  2J23 A;  2WZ9 A;  4YAP A;  1X9S B;  1WRY A;  3LEF A;  1E2Y A;  1XWG A;  4BL7 A;  8GSS A;  1TI3 A;  4D73 A;  4HZ4 A;  2YWO A;  2YWM A;  3UBL A;  1M2A A;  3ZIJ A;  3R3E A;  3CRT A;  4X1U A;  2LS5 A;  1KTE A;  1ZZY A;  2YV9 A;  4DSS B;  4F0C A;  2M80 A;  1O73 A;  5D9V A;  2GDR A;  4OMV A;  4J56 E;  5KN1 A;  3LFL A;  1HNC A;  2VCZ A;  1T1V A;  2HT9 A;  1F9M A;  2ES7 A;  5IMA A;  1QK8 A;  3APQ A;  2VD1 A;  2IN3 A;  4JR4 A;  1Z7R A;  3M9K A;  3IE3 A;  4P3Y B;  2GZP A;  4RUV A;  5EVO A;  2REM A;  2LJK A;  2VUP A;  2C3N A;  2I9H A;  3BCI A;  4K0N A;  4GQF A;  1UA5 A;  3D21 A;  1ST9 A;  1OAZ A;  4G2E A;  2HRA A;  2OBK A;  3GN3 A;  5J9B A;  1V40 A;  1FB0 A;  2TRX A;  2DBC A;  5D96 A;  4PUF C;  1O8X A;  2L4C A;  2R0C A;  4ID0 A;  2O7K A;  3IDV A;  3HJP A;  1FVK A;  5ID2 A;  1EZK A;  3OR5 A;  1E6B A;  2HYX A;  1RW1 A;  1FW1 A;  2AB6 A;  2OE0 A;  1O81 A;  3IXR A;  2L59 A;  1SK1 A;  2B1K A;  2C3Q A;  1ZYQ B;  4I97 A;  1ZL9 A;  2YP6 A;  3EE2 A;  12GS A;  1JLV A;  2HSM A;  2VLU A;  4L0U A;  3DKS A;  4ZL9 A;  3Q6O A;  4DVC A;  1S3D A;  4FIW A;  22GS A;  5G2Z A;  3Q18 A;  2NBS A;  1MTC A;  1JZO A;  2V2G A;  4ZBB A;  5ENU A;  2HSY A;  2RM6 A;  2B6M A;  1YDK A;  2L6D A;  1GUK A;  2DJ1 A;  4RQR A;  4PGT A;  1T3B A;  3NIV A;  2V6O A;  1XCC A;  4K8M A;  1AIU A;  1GTI A;  1TDI A;  2KUC A;  4IGJ A;  4NPB A;  1BJX A;  3TOU A;  4ECC A;  4KDU A;  3MAK A;  2GTU A;  4TW5 A;  3IR4 A;  4NXI A;  2JSZ A;  5J41 A;  2P0G A;  1ERV A;  5D9W A;  3ZFB A;  3BBY A;  4ICY A;  5CRG A;  4F2I A;  3IPZ A;  5DQY A;  2OBI A;  3MIX A;  2H0H A;  1PL1 A;  3DXB A;  3TKS C;  3FZ5 A;  1XOB A;  4DSS A;  1ILO A;  1AAZ A;  3VFI A;  1F2E A;  4CY8 A;  5B6N A;  2HNL A;  1ERU A;  1TRS A;  1WJK A;  3D6I A;  1Z6M A;  5IQY A;  4Z2T A;  4GCI A;  2NTO A;  2XHF A;  1O6J A;  4YAV A;  4MMM A;  3D22 A;  4V2M A;  4XTS A;  1GP1 A;  1R7H A;  1PQN A;  2VCX A;  2DJK A;  5C04 A;  4GST A;  4DSR A;  3F6F A;  1YF1 A;  5HR1 A;  4AGS A;  3E3E A;  2ALB A;  2TRC P;  4ML1 A;  1K3O A;  2HRF A;  3KD0 A;  3GKX A;  2YJ7 A;  4MCU A;  3QMX A;  3GST A;  4F03 A;  5HFI A;  1GNE A;  2CX3 A;  4NHW A;  2HZF A;  1TTZ A;  4I6X A;  5ECP B;  4O5R A;  3Q74 A;  2DJ2 A;  2MMZ A;  1MD3 A;  3FYG A;  2P5Q A;  2IL3 A;  2R0P A;  3H8Q A;  3ZZX A;  5G31 A;  1ABA A;  5CRH A;  4K1F A;  2O85 A;  2KOK A;  3IAM 2;  1QFN A;  2B1L A;  2L5O A;  1FVJ A;  3VWV A;  4TR3 A;  4NHZ A;  5F8B A;  1G7E A;  2MBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...