4F2MA

Crystal structure of a tgev coronavirus spike fragment in complex with the tgev neutralizing monoclonal antibody 1af10
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
214
Chain Sequence
b'QVQLQQSGPELVKPGASVKISCKASGYAFSSSWMNWVKQRPGQGLEWIGRIYPGDGETNYSEKFKGKATLTADKSSSTAYMHLSSLTSVDSAVYFCARGGYRYDPYYAMDYWGQGTSVTVSSAKTTAPSVYPLAPTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody 1AF10, heavy chain
molecule tags Viral protein/immune system
source organism Mus musculus
publication title Structural bases of coronavirus attachment to host aminopeptidase N and its inhibition by neutralizing antibodies.
pubmed doi rcsb
total genus 40
structure length 214
sequence length 219
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f2mA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f2mA02
3STZB 2PW1A 3S8WA 1QFUH 4GKSB 4G80A 3NTCL 3KPOA 1JNLL 1Q9LA 4ACPA 4LSUH 1NFDA 1O7VA 1VSCA 3S98A 3TM6A 4UTAL 1NEUA 3EIFA 3KPSA 2HT4D 1MRFL 3H6JA 4UDTA 4MDIA 4Y5XA 3P9LB 4K94C 3C5JA 3ULUE 3QEHB 1K8DB 4XMLL 2GUOA 5HDQH 4LL9A 4RWHA 4KTDH 5BRZD 2EDDA 1JNHA 4LSTH 2EO9A 5IV2A 3GBNL 1M7IB 3DVGB 3ULUD 2OYPA 1EFXD 5EZIL 2HJKA 3X3FL 4UIKL 3QIUA 2XTJC 4GG6A 3IDNB 4JDTL 1F4WL 1KCVL 1HKLL 3SGJA 4J3XA 2AEQL 4PFEA 2ZNXA 3BKYH 2Q86B 4Z77A 1RZGA 3ISWA 4KVCL 3DNKA 4NQDB 4J4PA 4WI8A 1NKRA 2IAMB 3AREA 3C8HA 4M61B 2OI9B 5F6IC 1LMKA 1SYSA 5TF1L 2BY3A 3D25B 1CFSA 4OBRA 5D2NC 1JV5B 5DLML 3STBA 1T4KA 3DLQR 1T0PB 4X6CE 5FUZH 4MJ5B 5L7XL 3QZWB 5D7LE 2XQBH 3TBTB 2ZZUT 2WUBL 4Y4FD 1A6VH 1NCNA 3QQNA 2WBJA 1TQBB 1EHLH 5DWUH 3ARFC 4X80H 3F6IA 1A6PA 1G1YA 2J6EA 3IJHB 4YXKH 1CK0L 5C0EA 1AIFA 1CU4H 1F97A 1S7WA 3PV6B 3D2UB 4G5ZL 4QNPE 5D7KD 4JEGB 3Q2CA 4QWWD 2DI7A 1T20B 1A7NH 5T1DH 3SY0A 3VJ6B 5KTEH 1AXSB 3WEXB 3EGSB 1O5DT 3IFLL 1SJVA 2AK1L 1UWXK 1YMMD 1RI8A 4TVPH 1A9EB 2IAMD 5JW3H 1WFUA 3WHE1 1OQOA 2A9ML 3WIHL 3HNTH 3GB7A 4B50A 3DMMC 4JO1H 2BMKB 4JFHD 4XI5D 4PJEF 2X7LA 1WBXB 4LF3A 3LQZB 3Q5TA 4U7MA 3C08L 2PUQT 3SDAA 5CEZL 4Q6YA 2JJWA 1BECA 4K8RD 2GJ6E 5D96B 4M6OL 5IB2A 1I3GL 2XZCH 1QR4A 3I50H 1UYWH 2X40A 4I0PA 5F8QC 3UPCA 43CAA 1UZ8B 2HFEA 1AC0A 4OM1H 3B5HA 1RV6X 5HYJA 5I19H 4OLWH 5JDSB 2NNAA 4K3GA 2Z91A 3U6RA 5K9OA 3LKNA 4WCYH 4Y1AD 3AM8C 5F72S 1KELH 5IFJA 4D9LL 1DR9A 3ARED 3MRKB 3SKNB 1BZ7B 1E4JA 3BRGC 2D03L 3F58H 5HVHC 4GRLB 1ZHKA 2VDQH 4FQ1H 3L3GA 3MA9H 4ETYA 1MFEH 2CR3A 4GG8B 4N8VG 5IW3A 1MLCB 5DC0A 4YHMH 1AJ7L 3PL6B 3PHOB 4X5WA 1OP3K 3BMWA 3ULUF 5GGRA 5AAWA 1W72H 3QQ3A 5GGSA 1T21B 3NPSC 3T08A 4IOSD 3QUZB 2IQ9H 4ZS6D 3QIBA 1IGJA 1NANH 1W8OA 2W07A 3CNKA 1JGLH 3RVUC 2NTSP 4C54A 5MENE 1QFHA 3FOMB 2Z0BA 1WT5A 4FQQB 4UAOB 5FB8B 3U1SL 5IK3A 4APQA 5DZNA 1OWRM 1KEGL 4U1KA 4XI5C 2DQTL 1LO3H 4FTVA 5IGXH 4LLVB 5DR5H 4R4ND 5DO2C 3S5LG 3V8CA 2W65B 3LKSB 4LSSH 3HZKB 1AQKH 2N7BA 4EOWH 3K1DA 2VXTH 4EI6A 2FR4B 1TZGL 2O61A 1N5AA 4Y1AA 5D2LF 1D6VL 4Y4FA 3C6SB 2CKBH 4NC1C 4BSVA 1T7WA 5C09B 3KPSD 3CVIH 4LU5L 1RURL 1YEHL 2N4IA 3MFGB 4YGAB 5AZEH 1MCIA 3P77A 5HXMA 1NGXB 3SDCD 4D94A 5DMIL 3VG9B 4GH7B 5DMIH 4YDVB 4YBQC 3WMSA 4AM0A 1D7FA 5IEHA 1LDSA 5EUOE 4I0PC 5EIVA 4OCMC 1CN4A 4LLAA 4NKDA 1FIEA 4IOFC 3B9AA 3A0OA 2PCPB 4HK3J 1TZGH 4BH7A 1U8PB 1WCBA 2JB5L 4NNXA 5JMOC 4KQ3H 3O3EB 1R24B 3WXVH 1H3XA 3STZA 5EH1A 3RWIA 3FONA 4YEFA 3CLEL 3G6JA 1NC4D 2P5ED 3DMMA 1FFPA 1PQZA 4FQ2H 5JW5A 4XC3H 2P43B 3VGFA 1CBVL 4OI8A 1HHGA 1DL7L 1QNZH 2W9EL 3E3QC 4RGOL 1NC2A 3BPCA 4RGNC 3EYFB 4NJAH 3QHFH 4GSDH 1MCFA 3D3VE 4UU9A 4XHQA 4DUVA 4HIXH 2DQJH 5DK2B 4MB5A 4M48L 1I9JH 5MHSD 4KUZL 2J2ZA 1V3LA 2HKFH 1JGUH 3ZMRA 3WFEH 4E42B 5KSUA 4CKVX 3RWHB 1JNJA 4JJ5B 1EMTH 5GS1C 4IM8A 4YHML 1CXIA 3RI5F 3H9SE 1T3FB 4PJIA 5I0ZA 5I16B 4G6AD 3QRFM 4K7PL 4KZDL 4UILH 4HPOL 2EYTB 4LK4A 5F7WC 1C7SA 1F4YL 4U1JB 1OB1A 4FRWA 2XZQL 5HYEA 2VDOH 2Q8AL 1RUML 4Z7WB 3WFBL 3FMGL 1D5BA 2XNAB 4N9GA 5J6GB 1AGEA 1TJIL 2Q1EA 1OGAE 1YPZE 5GS0L 3BO8B 1I3GH 2VH5L 1BVKB 3C60D 1BZ7A 4QRTB 1FG2A 4XH2A 1MI5B 4ALAH 2NY0B 4L4VA 3RVWC 1C16A 4YE4L 5DQJA 3T77A 2E7HA 1TFHA 4D0CA 5IB3B 5HYJB 5C08B 3GSQB 1FHGA 4OZGF 2NX5D 4LCCB 5EOCL 4JO1L 4AENA 4OUUA 3DECA 1RHHB 3BYTA 4JB9H 5T3ZD 2FBJL 4PJFB 3VWKB 5D5MF 3G04A 1BQSA 1L6ZA 2A9MH 3D9AH 5EU6B 5B22A 3DXAA 1P1ZA 3VXRB 3S9DB 1YEDA 4NHUA 3CXDL 1PJ9A 1D5MB 1VFAB 3P30L 2OJEB 5KTEL 1YQVL 1NC4B 2D7MA 1MLCA 4PJHA 1T7ZA 3C09C 2VWEE 4XVTH 2IH3A 5BZDB 4HS3A 5MHSE 3IDMA 4HWEH 4PJGA 4J8RB 4Y89A 1XF5B 3RDTD 3LKQB 4M7JL 5EZLA 4X80L 1J1OL 2LTQC 1N59B 3DX6A 3L3HA 3TFKC 1A6VL 1NUFA 3MROB 1B4RA 4XPTH 2D3VA 2XQBL 4UT9H 5L7XH 5GRJH 1T20A 3FFCE 2BDNL 3I3DA 4NNYB 3EGSA 1WC7B 2BHZA 3EOYG 4PJ7E 3VDCA 4XGZB 5CZVL 4LMQI 1I1FB 4Z76B 5GZOC 3WDHA 5IT2L 1MLBB 1BQLH 2AI0L 1XEDA 3MQIA 4TQEL 1E6OL 2IFFL 4P2QB 1F6AA 3I9GL 5E6IA 2X4OA 4LEXL 4UIMB 1MCEA 3BKYL 3C60C 3C6LD 3O8XB 3PQYD 4EZMA 1S9YA 3IVKB 4P0DA 1FRGL 1F3RB 1NBZA 1FZMB 4GJTB 4UIKH 3FTGA 2E7CA 5IQ9A 3UO1L 4HIEB 4W70A 3KPQA 4O2FA 5KW9H 1EUTA 4LSTL 4IJ3C 1H3PH 4CU7A 5CGYD 4L4VD 5JLZA 1QR1A 3GMQA 1BWMA 2B1HL 1W8NA 3MRQA 3CMOL 4ENEC 5B8CC 3Q1SL 1MRFH 4JQVC 32C2A 4ZOAA 3BQUC 1I1AA 3IDXH 3SKOA 1RIVL 4W6WB 2H32A 3QDJB 4A6YB 3MLXL 3SGDH 1WZKA 1JNLH 2JJSC 1SMAA 2VZSA 3ARUA 2BSTB 3RX8A 4KK5C 3FT3B 2ADJA 1KEMH 3SOBL 4WI6A 3D0VB 2D0FA 1RPQA 3JTTB 1BFVL 1FVEB 1CXKA 1X6NA 4NOBA 5CJOL 3BZEA 2H2PD 1Q1JL 4LLUB 4NOFA 4PJAA 4ZYKB 5CWSA 4ZD3H 4HF5H 3TT3L 4JY4A 4ZD3L 1OAZH 1JK8B 5JOPD 4PPTA 1I8IB 1MRCH 2OJZH 4MZ3A 2NY3B 1VADA 1HNFA 4G9FE 3TBSB 4GRWE 1AGDB 1IGTB 2Q7NA 4X4YB 3NPSB 5F71A 4GMSL 3QUZC 1XGPB 1OD9A 4OCSL 3BH9B 2YS4A 1L9NA 5AAMA 1S3KH 2P24B 5IB5A 3TV3H 4M02A 1CXEA 4WI9A 1FE8H 1RIVH 3QT2A 3IDXL 3RDTA 1F5WA 2PO6A 3TCLA 4WHTB 3QQ9C 2P8MB 2VN4A 2Z8SA 1LO4L 1X5IA 1ZVSA 3BZFB 3IT8D 2GSIA 5IW6A 1MHPL 4NN6B 1CICC 5DJAB 4QT5A 1ONQB 4TUJB 1ZGLB 1AXTL 1B90A 2DQIL 4U0RB 1KN2H 2NY3D 4OQTL 5MERA 3DX7B 3GMMA 4R0LB 5HHOD 4UOJA 2D4FA 3OF6A 3SDXB 5EU6D 1FFOA 3UPRA 3SE4A 4DVRL 4K3DL 1DANT 2ENSA 5I71B 3WHXB 4RNRA 3L3IA 3ARZA 1KENL 4QHLA 1NKOA 4ONFH 5IVZB 4XTRC 2ZCKH 5E6IB 1XGTA 1C5CH 3RQ3A 3MLVL 1BQLL 5ITBH 3ZTNL 2ERJC 4CW1A 1SJHB 2AK4D 1G9EA 4XNUL 3EYQC 4CGTA 5DD0H 1WQVT 3RX7A 1U42A 3GO1L 1WC7A 2NY4B 5DSCA 3QULB 2I5YL 2BDNH 3RWCA 2J7LA 2AEPH 2DN7A 3ESVF 4GAYA 1S7VA 3RUGE 3HMXA 1OGAB 1N59A 5E8DL 3QFJB 4HGWA 3BW9B 4QRSA 4WI4A 5DD5H 1AGBA 5I1EL 3GHBL 4JR9L 5CP3H 1EFXB 2V6HA 1VERA 2OX5A 3VDAA 3GJFK 3SDXA 4JREB 5JTWA 5TE7L 3P30H 4HX1A 4ODUA 5FOJA 1A22B 4JFYA 3NAAH 2OZ4H 3V0VB 4I0PD 2YD4A 3O9WC 2Y6SC 4PJFA 3VWKA 2X9WA 5CIPH 1ZT4B 1HYSC 4PRBB 4HCRH 2CDGB 2XTJE 4U33A 3MXVL 3V5HA 2CDGA 2J8UF 2P5EE 3JV6B 2HN7A 1J1PH 4H0HB 4C4KT 1LEIA 3FCTB 5MI0C 2XA3A 2NLJA 1EERB 2LU4A 4UT7H 4OI9A 2EZ0D 2Z31B 2VH5H 1JWUB 4UOW1 4JRYB 1A7QH 4LSPH 4GRWF 5MENA 5DK2A 3SBWA 1L7TL 2DL9A 1JYXA 2G60L 3CC5A 3T09A 3Q3GA 5HYSG 2ZUQB 3WFBH 1RUMH 1HN1A 5ACLA 2ZUWA 5GGVY 1VA9A 4L8DA 4O58H 1G7IA 1WZLA 4IHOB 1B3JA 3S6CA 3RY6A 1J05A 1QSEE 3HI1B 3EOAA 4QRUA 5F9AC 1FZJB 1IGFH 3TH2T 2A83A 5J1SC 3WDJA 4EBQL 4XWOC 4WWKD 3MRHA 3C9NA 2IALB 4Z8FH 1CZ8H 2NX5B 1E4KA 1X5JA 1KPVB 1A6ZB 1CXFA 2QBWA 1BP3B 1ZHLB 2XQYK 4GSDL 3QUYA 4NJAL 1GCFA 2DMBA 4Z7VE 3TPKA 4HS6A 4I3SH 3ZYIA 1RHFA 1OTSD 4RFNB 4XGZA 1BM3H 2G2RB 4X4YA 1BD2E 3BWAA 3LRSA 4P2RD 1MNUL 3CFBA 4LP4A 1FVCB 3QIWB 4PV8B 1ZAGA 4GW1A 5HDLA 5ID1B 4WENB 3CFJB 3MJ7A 2P47B 2EO1A 2BVOA 4Z5RB 1BLNA 5GISL 1MJJA 3DVNB 1LK3L 4AY0A 2A6JB 5DMYA 1MCLA 3VFNB 4PJEA 3RVWD 3B9KA 2CIIA 2R1XA 2R2BB 2WAHA 4XXCC 4JY6B 4XXDA 2H9GA 3LKPB 1N5YL 1Q72H 1UH4A 3FQRA 3MRHB 5DEFA 5KAQF 3MRIA 1YEGL 3EJJX 1RK1B 3RWEB 2BRRL 2Z8WC 3D0LA 1IMHC 4PG2A 4KROC 2AEIT 2E7LA 1F13A 1HHKB 3IDJA 1SBSH 2VAAA 4UI2A 5L2JB 4N0UB 1IL1A 3QI9C 2FX9L 1P4IL 4LCWA 2CKBL 4Z78B 4RMUA 1RUQL 1CE1H 3IDIB 3MRJB 3SKMB 2VYRE 2DDQH 5C0BB 4PJBF 2NY6B 4MLIA 3FB6B 2A77H 1HI6A 4NSKB 2AV1A 4YQXL 4GG8A 3S96B 3O4OB 1KUMA 3EZ8A 1I8KA 2VE6A 3V79C 1HZHH 3LKOA 4ERSH 4V1DA 4P2CG 4Z7QF 3S36H 5D70L 1UQSB 1S7UB 2FGWH 5D7LB 4Y5VB 4TOYH 4IOIB 3OKEB 3HI5H 1T0NA 3KPRB 1W0YT 4X6FA 4GBXB 1JGLL 1CTOA 1OGAA 1Z3GH 1WWAX 4U1LA 2IQ9L 3CH8A 4XP1H 4CMHB 1MIEL 1D5ZA 1UXWB 4NCC2 1W72L 5T3ZL 3WV0A 2Z31C 4M1GL 2K7PA 4J6RH 1T2QL 3SDCB 4JJ5A 1L0QA 4RSVA 1A9BA 3T3PE 2Q6WA 3X11B 4HGMA 2ARJA 4LPUA 3DO7A 4TSCL 2KZ1B 1FFNA 1VEMA 1YJDH 5EFIB 2DKMA 2NPLX 4XWOD 5IFJB 4HC1A 1R0AH 1U3HD 4RX4D 1QSED 2CRMA 1QUNA 4N0RA 4EUPG 3HLAA 3SQBA 3ARDA 1NLDH 4GO6B 4H26A 4F15C 4NZDA 2OTWA 5HYQB 3IDMB 4AYFA 3K2UL 4TNWK 4YK4C 4RQQA 1VGKA 3DMMB 1ORSB 1UYWL 5E4EB 4RMSA 2Q8BL 1XR9A 3SDDB 5A1AA 4HW6A 1IJ9A 3S3SA 3SE9L 4KKBD 3G08A 2MHAA 3QCUL 2R0ZL 4U6VL 2FEDC 5CEZH 3ZKND 3PWPB 1NCCL 3FFCA 1GYAA 3P4OB 4OCYH 4QHUB 3U4EA 4P49A 1Z9MA 2YXMA 4NFDA 3VXTB 3IB4A 3WLBA 2QJDA 4C56D 4OF8A 1QYGL 5H94B 3MLRL 4JHAL 4TVPL 5TFSL 3RIFF 3WCYA 1A02N 5DUBB 4G8GE 4WUUE 2XWTA 5B3JF 1MCSA 5AD0A 1LO5B 3RKPA 4O00A 1HHHB 4FQXC 3EJYD 1DBJL 2XNAA 3DPBA 2ADFH 4LHUG 4ZFFB 1WZ1H 1DVFD 3DWTA 4YXKL 2HMIC 4XCNB 1A7OL 3KLDA 4X9HA 1F4XL 4I18C 5BCAA 4KDVA 3RHWF 5BVPL 3HAEA 4HUWA 4IRJA 1AC6A 4N8CL 3CXHK 4NRXA 5KVDH 3HNSH 1RULL 1TPXC 4MJ5A 4J4PD 1NGWA 2WQ8A 3NABH 2OTUB 3IJYB 4NC2B 4APQB 1JYVA 5DLMH 4WV1C 1FNSL 3AC0A 3EDFA 3T4YA 3ZE2F 4MNHB 4LLMA 3MCKB 3MLWH 4JFEB 2CRZA 3SCMD 4AH2B 4RX4A 2CMRL 3F6LA 4U1IB 2KKQA 3MRLB 4MGXA 4PY7A 4KAQL 4XPFH 5KOVC 5C1MB 2CKBB 3QO1A 3ULVF 3OXRB 3MGOB 1WIUA 3RVVC 1KCVH 1CLCA 4XNZB 3O4LA 1HHHA 3OX8B 4D9RE 5AD0B 4LQFH 1V7MH 3PJSA 5AG8A 4CADB 1AP2B 4P5TD 4NWTH 2JTDA 3DETD 1A4JB 4KTDL 3L5WA 3MNVA 1FL3A 2EDNA 1B0GA 4L3EA 3BPLC 5IIEB 1M05B 2JB6A 4CUCA 5I73B 1U3YA 2Z35A 3QH3B 2BK8A 3HHRB 2C4FT 1NGWB 2DB8A 4HFWB 3GKZA 4M7LT 4J3SA 3SO3B 2VZVA 3T3PF 5C0JA 1ZKAA 4LKXA 3ARWA 2B4CC 1XF2B 1BAFL 3X12A 4PRHA 4NM8L 3I75B 5BXFB 5L9DH 4QTHA 3BE1L 4HHAA 1VCAA 1WAAE 2A6DB 1CWVA 4NQCA 1U3ZA 1FFPB 2UZYB 1NCWL 3WFCH 4ZAKC 4MA1C 4OB5H 4DTGH 1RD6A 1U8NB 3HMXL 3MYJA 1NDGA 5JHLH 4ZTOH 2I25N 4PTTA 3VRIB 3WUWA 2X6MA 3UC0H 4J8RA 3VXSB 2W0FA 4FTVB 4GOSA 3QUYC 2Z92B 3FN3A 1U92A 4JRXE 1GGCL 4OLEA 4RFEB 4LLWA 4BELD 2FYYA 2ZUSA 1II4E 3SDDA 1UM4L 3V5DA 4NNYA 3NVQA 2EDHA 4M8VA 1J0KA 1VGEL 2EDWA 4JM2F 3QNZB 4JRWA 4KRPC 3BYYA 3ARDB 4S0TD 1I1YA 4JQIL 3GB7B 3MUGA 2ZUTA 5LXGH 4AMKH 1PKQB 2DLFH 2GY7B 4ZDHA 3EDKA 4L9LA 1NLBL 2X1QA 5T33L 2NY7L 3TGXA 3FB7B 1YYLH 3TIEB 5INDB 2ZP0T 3FB7A 1I8MA 2HT4C 1UB5A 4UOW0 3SBWC 1C12A 2J4WH 4OGXH 1YEIH 5C0IA 4JPVH 3SDXE 1ZHBA 3TT1H 1XF4B 3DI2B 3P4NB 3PDDA 1IM9B 4HT1L 1FORH 4LDLB 4KMQA 4N8VB 4FMKA 4BZ2L 5D6DA 5DS8B 3PWNB 4RIRA 5D7IB 1I1RA 1UWEL 2FYYB 5ICYA 2ICES 4M6AA 2EYRA 3I6LE 1ZVYA 4NUJB 2C1PB 4LFHG 3U0WL 5CAYB 5IR1B 3OQ3B 1ZHKB 2DBJA 2DAVA 3CDGA 1FC1A 2NXZB 4EI5C 1HIML 2AQ2A 1T1WB 4NQVB 1YEJL 2GSGA 2NY6D 3F62A 3MREB 2AJSL 3S5LB 5J8OA 3KYNA 4X7SL 2XT1B 4RZCA 3QUMH 5IB4A 3PWPE 5DJ2A 2GQHA 2V5MA 5C0DA 3AS1A 4HLZG 4KDTA 1FLRL 4HWZA 4MD5A 3G5VA 4HLJA 3ZTJG 4OLVL 3MYZA 3GJFB 4P2OB 5E24E 3NCJH 4DN4L 1EXUA 2BVEA 1FJ1B 4KMTL 4JFFD 1QSEA 2VKWA 3V4UL 2FECL 5LGJA 1F45A 1IGIL 2XTLA 2ZCHL 1JPGA 4NO2B 2R0KL 4KK5D 1JHKL 2QHLA 2DQHH 5IBLC 1QSFD 5GZND 2R1WB 4V1DD 4XBEL 2J5LB 3VWJA 4HZLA 3AAZA 1YY8B 3AMLA 3GSRA 4E0RB 2VXSH 1AD9B 3PHQB 5I74C 4DGVH 1Y18A 3Q0HA 3SE3C 5IWLA 4BFIA 1OD7A 2MQ3A 1RVFL 4Z7VA 1GGIL 1NGZB 3MLTB 3QEQD 4K8RC 4GG6F 2X70A 1JPTL 5JO5A 5F1KC 2A1WH 1G7QB 4XVSH 3C2AH 1MI5D 1WBZA 1S7QA 3TO4B 3QJFB 3FQXA 5E2UL 3ILPA 5GSRB 3VRLF 4Y16C 4R7NA 1QBMH 2JIXA 3C8KB 4G43B 5DVMA 1XIWC 3JTSA 3EYUH 3P11H 1FZJA 3S34L 4IS6B 1QSFA 3G5ZA 3MODH 1DJSA 2WBWB 1EJOH 4NQDD 1R5IA 4WTXA 1OAKH 5DUMH 3O3AA 2R39A 4G6AC 4RBPK 4OKVA 4QF1B 3HB3C 4K2UL 1T0NB 2ZKHH 5E4IA 5LAXA 2WBJD 5ID0A 5TE6L 4FQXB 2CK0L 1UM5L 3BP4A 4QXGL 1ITCA 3T2NL 2APFA 3CDYA 3GSUA 3LQAC 4GMTH 4JO2H 5JIIA 3BJ91 2P7TA 4LVOB 1A14L 1JRHL 4IIQC 3O41B 1EFXA 3V6OC 3CFDA 3BP5A 4WVRA 4DW2H 2B1AL 3LN4A 5I1LB 1T0MB 4PJFF 3VXTA 1JN6A 4I9WE 2RIKA 3I6KB 5C0RH 2GJ6D 4R2GD 2VLKA 5SWZE 3HKFA 4ODWB 3FRPG 1P6AB 3G5ZB 5IM7A 3INUL 4WEMB 5DRNA 4XPBH 1NL0L 15C8L 4QYOA 3RWDA 4OZHE 3NA4A 1I8MB 1E28B 4PBXA 2JIXD 1GGTA 2VLLA 3RU8H 5JORA 2D2OA 1MCWW 2CGRH 5F9OL 2VSDA 5H37G 3SE3A 2EIDA 4FQXA 2PKDA 1E27B 3G5YA 4L8BB 1S5HB 2EDLA 1SBBA 4MQXD 3T4AB 3QDAA 1N8ZA 1A6WH 2XOTA 4HGKC 2BNQE 3QHTC 4EDXA 5DJXB 4LHJB 4ZTPH 4X4XA 2F8OA 4NZUL 1I7RB 1JGEA 3U9PH 5JHDB 3DOSA 1P5VA 1FGVH 4HKXA 2VLRA 3BEVB 3GM8A 3QWRA 1FBIH 1O0VA 4OD3L 3PP3K 1FLTX 3UJJH 5BS0A 1RFDH 3NCBB 1GIGH 2FB4H 4BH8A 1CDJA 1U3HB 5M7QA 3NFPB 2UVFA 4C55A 1BEYL 2A74A 1ETZB 4X5XB 1XZ0A 2CRYA 5I1CL 2X5PA 5JW4M 4PRDB 2X89D 4L4VE 4ORGB 4JVPA 5DJDB 3EKCA 4HXBH 5IBLD 4ODSH 4BFIB 4WUKL 1OTUC 3FJTA 4PR5B 3REVA 5DQ9A 2VXVL 1FFOB 1H15B 1QFWH 4FS0A 3H7LA 1DUYB 2PTUA 1N0LA 3MOBL 3Q6GL 4EKXA 3LSOB 1U8JA 5D72L 5GRUH 1I9IH 3QDMA 3QEUA 4P2QE 1MAMH 4OSUH 3SKJL 1J10A 4F7CA 5F93C 3TO2A 2NZ9C 3DXAE 4M5ZL 4U0QB 5E9DD 3V6FB 3FN0H 1QEWB 1AR1C 1N26A 2DLTA 1IC5H 4ELKB 3OR7B 1HWHB 4PRIE 2OQJB 3GSVB 1RSFA 5FO8A 2A6IB 4B41A 3QDGA 3VFSA 2K9UA 3BKML 3WJJC 2DQDH 2VTFA 4JKWA 4QXTA 3TN0B 4LVHC 1YEEH 3FCTA 4QXTB 3DVFA 4NQCD 4YDIL 1S8DA 3ULVE 4XP6L 2R8SH 1WIOA 3EO1B 1AP2A 1BX2A 1UH2A 1G1CA 1F6FB 2QQLH 4PJ9D 2D9CA 2R4RL 4I3RH 3S97C 3VA2C 1IARB 5INCA 4AIZA 5D7SH 4QRRE 4PRPB 4PJ7A 1QO3B 2FIKA 4OTXH 2W9DL 3P0VL 3DARA 4PV8A 5DTFB 1T7YA 3D69B 3MA7B 4BQCA 3GSWB 1N4XL 1KYOJ 5JOPE 1DQTA 3VXSE 1JUFA 1D5IH 3N1MC 2PF6A 4O9HL 1RZKC 3QA3B 5IQ9B 4OGAD 4R7NB 4XWGH 3VXUD 4M7LH 3PGDB 5ICXA 3QPQC 5ETUA 1O7SA 2E27H 3IFNH 2A6IA 5EZJA 1A6ZA 4G7YL 1P4BH 4V2BA 4XVUD 4QWWC 5FHBL 3QIWD 5CZXD 4Q6IC 1FH5H 3ZDYE 4KGJA 4KVNH 2LU7A 4OIIH 3CDFA 4ODTH 5ELIA 2LAGB 3SDDD 1DEEA 4P4KC 3MV8D 1ITBB 4BZ1L 4N0CD 5E2VH 4HKZB 1KJ2H 5EU7C 1NMAL 5CILH 1T83A 4LASH 2X42A 1T2XA 1MPAH 4YWGH 1A7PH 4LAQH 2FGZA 4KJYA 5EWIL 3PWVB 3IVKA 4XVJH 1FN4B 3PABA 4YHNB 5HGHB 4DGYL 1KJ3L 1MWAH 4Y19B 2D0HA 4HC1L 3FAXA 5E94A 3NIDE 4GFTB 1N64L 1SYVA 2EEDA 3H0TB 1EFQA 2NY1D 4XC1H 2OMBA 2ADIB 5JXED 4QYOB 2YKLH 3U7AA 4X6DB 3MLSH 1D9KA 1JZ3A 5FCUH 3NA9L 4MJIB 4HUVA 2YPKB 5F1SA 4TUOA 5FOBB 2QSCL 1A4KB 1Q9OB 4JG1L 1T0MA 3BGFC 2OL3A 5C0CB 1X5FA 4U31A 3E1F1 12E8L 2FX8H 1MREL 2R2EB 3BQUD 3VXMD 4DOHB 2YZ1A 5E2WL 3QUKB 1FP5A 3CU1A 3D6GA 4WWID 5TDPA 1ZTXH 4Y19D 4K94L 3VXRA 5E99L 5JPNB 2FEDD 3WN5B 3EO9H 3VFGL 3H2WA 4G8IA 3OB0H 2X4PA 3HI6L 1I75A 4CDHA 4MAUH 1WWCA 1FIGL 4JM2A 4XB8A 3MV8E 1ZA3A 5IHUH 4LNRB 1MH5A 1MCWM 3QDJE 2YMXH 5D9SB 3MV11 4WJ5A 1HSAA 5L2KB 3T77B 3WUWG 4UDUA 4KHTL 2ICWA 1FGNH 1DSFL 4IRJC 3TLRA 4M5YL 4ETQA 4AEFA 3TJEH 1F8TL 2Z92A 4O2EB 5FIEA 3V6ZA 4OZ4A 4IRZL 1CG9A 4KKBC 5C08E 2QV2A 5J11B 2XN9E 3AB0B 4JCMA 1BBDH 3GIZH 4PJ5A 3GSXB 2R0WH 3NIDF 4NSKA 3OX8A 1IEAB 1CDGA 2NQCA 1XFPA 3QUZD 2R9HD 1JNNH 4ZUTB 1FNLA 4P46A 1I1YB 2VXQL 4TUKL 4WFED 5HDOA 3T0VA 3E8UH 4U3CA 2B20A 5EOTB 5DHXB 1G7PA 5KVGH 2Q20A 5L6YH 5IW6B 4KKLC 5D1QA 5EBLB 5IJKA 1R5VA 3BZFA 4S1QL 3L5XL 5HJ3A 4P3CH 3UTQA 3V5KB 1A1NB 3WD5L 4PRHB 4OF0A 4YUEL 2R1XB 4WI2A 1FO0A 4TYUA 5KSUB 1FO0B 2DRUA 3CCHA 5HY9A 5A2JH 2FH8A 4NNPL 3GJFA 2GJZB 1OWWA 5DJZB 4ZS7L 4U0RC 5KANG 2B7DT 2AKRA 2ENYA 2G5BB 2WINB 3EFDH 4KXZH 1FVCA 5ISZE 1KGCE 4RAUB 4K9EH 4KTEL 1J1XH 1LDPH 3BPOB 6FABH 1NDMB 5K9KB 4KV5E 4D8PA 2EDJA 2IANB 4JDZB 2O61B 4NKOA 5T5FL 5E5RB 1R3KA 1ORQA 1NCDL 4GQ9H 1X4YA 2GJ6A 4DJMA 3OXRA 1AE6L 3RZCD 1MJUL 2BVQB 3I3BA 3JXAA 3QAZC 5HI5D 4I18B 3PXJA 3KYOB 3K3QA 4MA8L 5E2TL 4AEHH 3PDOB 5F6HJ 4UTBL 3FO0H 5DYOB 2IGFH 4U6XB 4Q74A 5LBSH 5E0QA 1A2YB 4YHIA 2APXA 3BKCH 1VENA 3DHJA 3V4VH 1IGCH 3VWKD 2ESVB 2UZIL 2LAAA 1KBGL 1YMMA 3C5ZB 3L7EB 1R3HA 3EO0A 3DROA 4GW4A 4YPGB 5D93C 4F7EB 1KJMB 1Y6NR 5JXEC 4NQXB 1QRNA 4GS7B 1QBLL 2Y4SA 5JNYB 1CDIA 3X3GH 1P53A 2VLJB 4NQSB 4OF5A 1BVLA 3MRMA 3BH8A 4KWUA 3QIUC 2F53B 1KFAL 4X7CC 2DTSA 3T1FA 1CCZA 2AABH 3RJDA 5FB8A 4G6FD 3JWDH 3TVMA 2NYYD 3VXMB 4TUOB 1D5ZB 1OT2A 4QRPA 3O8XA 3CSYB 2Y7QB 4LVHB 5J56B 2VAAB 4ZPVA 4ORZC 3WIIL 1RUPL 2VXUH 2GK2A 3FB5B 4Z6AT 3O4LD 4KJQD 4G6JH 4OCRL 3S7GA 4YHLH 3PDOA 1IT9L 5JXAL 4H0IA 2FL5B 1DBMH 1I1FA 4F33B 4Z76A 2ADGB 4LQ1A 3I85A 1C8PA 4Y8AA 3PV7A 5KVFH 3CH1B 4FQPA 1CF8L 4FQIH 4M93B 1QFWI 2NY3C 1HOCB 3KAAA 1Q9KB 3S3PA 3DX9B 5K9OB 3DV6A 3QNYA 4OGAC 1OAYH 4IRSC 1KN4H 4O2CB 3MNWA 3RAJL 2IMNA 2YPKA 1VACB 3QEGH 5BZDA 4PRIB 3VG0L 5T3XE 5CLWA 3ZHKA 4G42A 1XH3B 4F2MB 1I7UA 2JE8A 4YDLB 1QQDA 1F00I 4GKOA 4XNXL 4CU6A 4BZYA 1C1EL 5MEOB 5F1IB 5ACZB 1UCBL 3KR3L 5F1NA 4YNYA 1XGRA 2Q87A 4Y16B 4JVUA 3ELAT 1ZA6A 1WEJL 4HQQH 4JKPH 3GKWL 1NMBH 4YHPB 3VFNA 2FJFA 1WJ3A 2R4SH 3H42H 4XNMB 3OJDB 5ANME 4UUJA 5BQ7A 3KPRA 1MJJB 3DVNA 4N0FA 3BPOC 2PO6D 5FYLE 4YDVA 4Z7NE 1RU9L 4ZS6C 3BKJH 3RPIB 5I66A 3J8F7 5C0ND 1FV1A 5T1KB 2VIRB 3MBEC 4G6KH 1AR1D 1JHTB 4F9LA 5EIIB 1V5JA 4R90H 4K7FA 5GIRA 1VEOA 3W82A 4JHWL 3NFNB 2EDBA 2JELH 4AEIH 2HH0H 3CAFA 3OHXA 3IDIA 2A38A 2F9BT 4PJIE 5FHAL 4K23L 3SE8L 1CIUA 3VFRB 3RFZC 1QLEL 1T1XA 5KS9E 2R69L 5EBWB 3NN8A 4XP5H 4H88L 2Z35B 1FG9C 5T1KD 2H1PH 1TTGA 2YSSB 5DEZA 4FFYL 2EKJA 3FKUS 2V7HA 1UQSA 3LCYA 3UYRH 3VWKC 3ARBB 4UV7L 2N56A 3O6FC 1OAUH 4RMTA 1S78C 3VGGA 3O9WA 4XAWH 1QA9B 3TVMC 4LRNH 2FO1A 4N1CA 1CLZH 1A8JH 2VDPL 1QZ1A 3TPUA 3MV9D 2NMSA 4GG6B 4PREB 4JAMB 3W0WE 1JZ7A 5FA3B 2VDKH 3QPXH 5I75C 3U9UB 5E95B 1E0OB 3ZKMC 4WFGE 3B5GA 3TWCL 5DURD 4CMMA 3JTTA 2XG5A 4ONGH 2VIRA 3O6KH 4R7DB 1KC5L 2XY2A 4PR5A 1T5XB 1MFCH 2DF3A 1GVIA 3UTTD 5DD6A 3STLB 4HMEA 1IBGH 3IAGC 3HC4H 1YA5A 4LFHD 2LV4A 4NRZB 5BQ7B 1MJ8L 4LLQB 4WHCA 5C0BD 1CFQB 3H9SA 1EGJH 4M9OA 3RBSA 3V6FA 4M03A 1U36A 4I0PB 1NGQL 4JZJB 4I0KA 4PJHE 4MNGE 3L95B 1TVDA 4PLOB 5FYJH 4KPHL 2VL5B 4GUPB 4P5MB 1T80A 1MF2H 4OD2A 5I8KH 5E94B 3ARXA 5BRZA 3RP1A 2FZ3B 5HGAA 4IRSB 4NC0B 1IKFL 2PYFB 1NH6A 1OSZB 2BXYA 5JIKA 2VR4A 1ZLUH 3T65B 2CPCA 4JFXB 5IFHH 4YK4B 4KI5E 3BW9A 1MFNA 2ZG2A 5HHXH 4URTB 1CFNB 1HDMB 1E4XI 2BERA 2E9BA 4LIQE 3O0RH 2Z4QA 3K1KC 1MRDH 3L9RA 3LN5B 2PO6C 5DVNA 3SY0B 1QKZL 3GJEA 3VJ6A 2Q6WB 5TDOA 3GMRA 1AFVH 5F89B 4L4TA 1PLGL 1TJHL 2L0DA 4NBZB 3NOIA 1IAIH 2VLKB 3PG2A 5C0AA 1IZJA 1Z9LA 2O5ZL 2QKIA 4NUGH 5EZJB 2AJXL 2WLYA 1L0XA 3QUZA 2VLJE 1IFHH 2ARJQ 1WUNT 1XR8A 2HFTA 5HGBB 4Q2ZB 1K5NB 1KLGA 4WDIB 4HDIA 5HHMB 2X05A 3CLFH 4PY8J 4YO0B 5F7FA 4PGDB 3WL9A 3UBXG 4DGIL 1UM6L 3DX7A 3BDYH 3GMMB 4LPVA 3MRDB 1TCRB 1NEZG 4GXUN 2IQAB 4ZFOA 5DJ8A 3BZDA 4QGYA 5ILTH 1OHQA 3MRCA 4XNYL 4Q9QH 1OOAA 2AV1B 2HT3C 2V7NA 4P23C 4F7EA 4F57H 2F8VA 4C56B 3MFFA 1MY7A 4Z78A 1FAKT 4APQC 2GK0B 3MFFB 1FNGA 5AUMA 2CIKB 1DQQB 1EX0A 1RZFL 3W2DH 3S4SA 2DI9A 2DKUA 3C8KA 2X4PB 5ETUB 3F7PC 2ICWI 2ZOKB 3KYAA 4X6FB 4FQHB 2QHRH 3WKNA 3SGEI 4KRPD 1IKNC 3LY6A 4MWFA 2HFGH 3G6DH 5CJ8A 1J5OH 1AGEB 3TBSA 1YEKL 3RWGB 3QDJA 4A6YA 1INEH 4XNZC 5I1KH 7FABH 5HYFA 1FO0L 2AJVL 4HXAL 3WYRA 3PWUA 4Y4HD 4YZFF 3NCFB 3FB6A 2R29H 5DD1L 2X4TB 4KQ4L 3NACH 2HLAA 2YWYA 3EFFA 3QIWA 3FAWA 2OTPA 4LEOB 4Q58C 3GMLA 4MSWB 3C60A 1J8HE 1ZANH 1SJHA 2F74B 3RWHA 4EI5D 3LDBC 4WW1A 1D9KC 3CUPA 1WBZB 2HT3D 3ZL4L 1N6QH 1I7ZB 5HGHA 2GITB 3MJ9L 4PJCA 4ELMA 1FZKB 1HINH 5ERWB 4X6CF 4OZFA 3UTQB 1NSNH 3QCTL 1OSZA 4H1LH 4QXUL 4PJAE 1CLYH 1IGYA 3VXUA 5TPWH 1YECH 4B0MM 2XA8L 2JLLA 2VN7A 4UV4L 1ZGLA 3PGFL 4TVSa 3CZFB 2H2SD 5DJ0B 3ZLQC 3TEUA 2OZ4A 5DVOA 1XF1A 2OM5A 4L8CB 4M1CC 5FDYA 4JY4B 3A6CL 2P8MA 4HS6B 4NKIL 4ZUTA 5LGHH 1G7JB 3KPPB 5DFTA 1UKSA 1G6VK 4OCWL 2HJLA 2ZJSL 4FQJL 4R4BA 4Z95L 1Q0YL 4UIMA 2DM7A 2FHFA 4R96A 4Q6IA 2XXMB 1JNHB 3BQUB 3GMOA 4HWBA 3L7FA 4OQ1A 4OD1H 3HCVA 4OFKA 2F74A 4G7VL 3R1GH 1RK0A 5FYLL 1MEXL 3THMH 2DM3A 1E4XL 2CJUL 1ADQH 1KB5A 3JWOL 4XP9L 1FAIH 4L5FH 5D9SA 4TVPD 4ZPTB 5MI0B 4HUMB 5CCKH 2VO5A 5HVHB 1C12B 2WNGA 5EB9A 5D71L 3WIFA 3AREC 2I60H 1DN0A 1XF5A 3HS0B 4J4PC 3F5WB 3LSOA 1BJMA 5TDPB 2HG5B 5CSBA 3TIEA 1PKQE 5EA0L 3Q5YA 5GGQL 4GG6E 1HCVA 4MD4A 2OJEA 3ZSSA 2V5YA 2CQVA 4XPGH 1EK3A 2VZ3A 3GK8L 4QRQB 4DEPC 3SQOL 1UFUA 3MUJA 3BXNA 1CT8A 5BW7A 2CDFB 2XWJA 1PG7L 2NY5L 4WO4D 5JUEL 2PTTB 1TETL 4XX1E 2UWEF 1NBVH 2DJUA 3VXMA 4PJDE 1SEQH 1GC1H 1X5KA 4CRPA 1EVUA 2DQEH 4Z7WE 5D2NE 3ARRA 1U8JB 3L6FB 3K74B 3GSUB 2H32H 1F02I 1ACYH 1N7ML 1KJMA 2OI9C 5CS7A 4NO3A 5F6IB 1AGBB 3PE9A 5BMFH 1R3HB 3EO0B 4NQTA 5ESAA 5EC1A 2BY2A 5GGTL 5KVEL 5K59F 5JW5B 2BOBB 1ZE3C 1E6JL 3V9FA 4JPWL 4GXVH 2HRPL 5FKAA 3RWCB 5DRWA 4ZSOB 1FNEA 4GRWH 4FXLA 4Q0XL 3WFDL 4I4WA 1XGUB 5FDWA 3ES6B 1I7UB 4KDWA 4NQEE 4G42B 4F2MA 2LFGA 5IJKC 4OZIA 5E1AA 2J8UA 3RVUD 5JO5B 4FTVE 4NT6A 1ULVA 4MD5B 1T5WA 2OK0H 2VQ1B 4YX2L 3N1PC 5C0DB 2VMFA 3MRGB 5F7HA 3FHQA 4P46C 2EIZB 4YC2B 1CFTA 1OM3L 4NQCB 2LQRA 2E8ZA 1EO8H 3ULUH 4DKAA 1U8MB 1G0DA 4QHKI 1DQDL 2BVPB 4R97B 2EIBA 4HUNB 3NCYS 5IVXE 5MP6H 1UJ3A 5D1XC 4EI6B 2FR4A 5CWSB 4BYHA 5F7EH 3O9WB 5D8JL 2FD6H 1BFSA 5HVFB 1HHIB 1CVSC 4K07A 4XCYA 2Q3ZA 3WFHA 3KJ4C 2V2XB 4JM2C 5DQJB 3P73B 4M1CD 1MCPL 4Y2OA 5D6CB 5DJ6B 1T1XB 5F3HA 1DBBL 1QFPA 3JUYA 2GEEA 3QJFA 4FFZL 4IRJB 4ODVH 5IMKA 4JG0H 3C6SA 4X8XA 5EOQH 1TQCB 2F53E 2H32B 2F19L 3A67L 4KU1A 4K3EL 1AO7D 4OLYL 5LCVH 4DUXA 4HKBB 4EVNB 2P5WB 4S1RL 3BT2L 1CQKA 3D1MC 4KFZC 1WWBX 3P4MA 1A6TB 1FV1B 5AWNL 5T1KA 1QSFB 2GJJA 5GHWH 1RQ5A 4Y4KB 2H45A 4W81A 3UTSE 5HVGB 1EAPA 3FTGB 5HI4C 3HC3L 4BH7B 1FZMA 5I1GH 4D0BA 5C07B 3HRZA 3SJVB 3QEQA 3VFRA 1KIRB 5BZWA 5ACZA 1A6UH 5SWSA 1NCAL 2VOTA 1OVZA 2WIMA 1LEGA 4Y2DB 2DYPB 4BKLB 4MJ4A 5E08L 2XTJD 3ZT7A 4Y4KD 5ADOL 3T2QA 1RZ7L 2OR9H 1CTNA 3G6JB 3CX5J 4MNGA 4O2CA 4X7DC 5IWLC 4KKAD 4JFZL 3O8XD 4HUUA 1BZ9A 2W0KA 4R2GB 1CGVA 1U8PA 1WCBB 2RBLA 3VWJC 4KRMB 4WFHD 1T6VN 3E2HB 3QWOB 3HE6B 1V7NH 4X83A 1U8LB 2D7TL 5GXBB 2Z9TA 5DQDH 5DFWH 1N0XH 3D5OF 4NN5C 1CGTA 4LSQL 2DYPD 2ITCA 4TPRL 5C0FA 4JY5L 2DIAA 5FKAB 1CL7H 1JWMB 2NZIA 1HQRA 1UJTA 1GZPB 4LKXB 4N8VA 3HRZB 1YNKH 5FUOH 2VC2H 3RVTD 1IM9A 3D85B 3OJVC 4YXHH 4ZUUB 1RZJL 4YFLF 3ARBD 2YRPA 4LCYB 4X8JA 5SWSD 4AIOA 2Y07H 5FYJD 3IXAA 4HPYL 4I77H 1SQ2N 5FO7A 2FEEL 3VFUB 3KJ6L 3L3KA 3QCVL 4XMKL 1C16B 4NBYB 4MNGB 1JF5A 4N0YH 4PJ5B 5A2IH 3SGJC 4JO3L 5BV7H 2G75A 4OIBA 4NZTH 3OAUH 1CR9L 3UCRA 2G75B 4CADA 3JZ7A 3T0XA 2AJUH 3ZHLA 3DVIA 3BPNC 3B8YA 1LO2L 3LIZL 4PGZA 3FT4A 1L4IA 3CGTA 3WS3B 5C3LD 2X4QA 1MFDH 2F58L 2VDMH 2AXFA 4L1HA 5DUPH 1KSRA 5D2NB 3FN9A 1QPXA 1INDL 2CLRA 4ZPVB 4R4FH 3K0WA 4M62L 3QIUD 4GBXC 5IOPB 1CDBA 4LCCA 5I17B 4MMXC 5D6DC 5F3BA 3GNMH 2X44D 1HSBA 3BHBA 4UQ3A 4HIHA 5A2FA 4NYLB 3W0WB 1JTTA 4BSJA 2V9TA 3GRWH 2OTUA 4JVWA 1REIA 5D2LE 1L6XA 3LHPH 4UNVA 1JPSL 1IC4H 5FO7B 2BMKA 1I8LA 2Y06H 4F7MB 3EYQD 1I9RH 4P4KD 4GW1B 3RI5K 2YN3A 2HAZA 1JMXA 2HJKB 2V17H 4D8PB 1H5BC 3PHQA 1NDMA 1SEBA 4XCEA 4MXWH 2G2RA 3LH2L 6CGTA 5LVEA 5LWYL 1X5LA 1C5BL 4JN2A 3RWIB 1KG0A 4Y4HB 4YFLI 1RZKH 4QY8B 2YN5A 1IZKA 3SDDC 1JWSA 1AY1L 5ICZA 3O3UN 5IMMB 2AJ3A 2MCPH 2YR3A 4NQCE 3QZWA 2F5AH 3U7YH 4C4KO 1G6RH 1ND0A 3G5VB 5DMGD 2ITDA 1J0JA 4FNLH 4OCLC 1LO0H 4HBCL 4FXKA 1C5BH 3TZVC 2EDRA 1JPST 3QXTA 2LTQB 1A6TA 2ZCLL 3LH2H 4MXWL 2IG2H 1URLA 2SEBA 4LLDB 4Y2DA 4BKLA 2PYEE 3O2DH 5D1ZB 2Q86A 4Z77B 3E2HC 3N0PB 3KWWB 4IMLB 5GZOD 3UTZA 4K7PY 3IGAB 2Y06L 1KJ2B 5IB1A 1OCWH 2BOCA 1UWGH 5CLTA 3SJVA 1XGQB 3CCHB 3DUHA 1A0QH 5DHVB 5E6YA 5EORH 2D0GA 1DQMH 1KCRH 4LLMB 4GLRH 3LQAH 4K71C 3IF1B 3O8XC 5FGBA 4YXLH 1EO5A 2F54D 5SX4I 1ACZA 2CIKA 3PQYE 3IFOA 1TVBB 1LD9B 4OAWB 5K9JH 3JWOC 1IAMA 1J8HB 4Z0BH 3ZE1F 3BN9C 4LSRH 1G7LA 1AHWB 5KJRH 1NFDB 2VDML 4Y4FB 3ARDD 2FSEB 4JZOA 5DFVD 4MYWB 3OV6A 4FP8H 4X98B 5DJCB 4K55A 4X7EC 5JXEA 1S5IH 4WI3A 4U1SA 3WN5C 3OAUL 2YHGA 3ZKXB 4WEBL 3D3VD 4YO0A 3HS0A 1CG9B 5ACMA 1DLHA 4OJFH 3KJ6H 5KBNC 4J3OC 1DN0B 2XIDA 5C7XH 4ETQB 2Y07L 3IJYA 2N7AA 3P9MB 5GS0C 1A4KA 1Q9OA 3RTQC 3QPQD 3VD5A 3WSQH 4P48A 4UDTB 3C6LA 4LVNB 2VITB 1MH5B 5CGTA 3D85A 2HT2D 5FUOL 1EEZB 3OKNB 4ZG1A 2ORBL 2YWZA 5IBUG 1L0YA 4N1EA 3DRQA 4JY5H 1NFDE 4AIXA 3ZTJH 1XR9B 2BVPA 4FABL 3O2VH 3MJ8A 4M43H 3MLYL 2L4OA 1T1YA 1FYTD 1N0XL 2BJML 3RL1B 3JWNC 5DQDL 3MACL 4MAYD 1R3IH 3HAEH 5DUBA 5TE4H 3HE6A 3ZO0A 4UT6H 3BP6A 2QEJA 3V95A 3RPKA 3DSFH 4NHCH 2J5LC 1QFOA 4MA7L 4HS8H 4RGMB 3OKMA 3EHBD 2RAMA 2FCBA 1CQYA 1NAMH 3NZHL 2B39A 3MMEB 5AZ2H 1Z6JT 5I30L 1HHKA 5ADOH 4F58L 5E08H 2E9IA 3G5XB 3M07A 5IHBA 1B4JL 4PJXF 1HH6B 3H7BB 3VU2A 2APWA 2P46B 5D1QC 3L3IB 1JI2A 1MCQA 5IW1B 4GKZA 3LB6D 3WNOA 4YHOL 3DX8A 1FCGA 4YR6A 3HC3H 2WWKO 1L9MA 3OXSB 2BFVH 5D7LA 5E1HB 4CAGA 1I7TB 3VGDA 1A3RL 2VWEC 5B39G 1YNLH 3SDAD 2E7MA 5J06A 3S35H 1CFSB 1J05B 4AG4L 1TMCB 3GSWA 1FDLH 5DZOA 1Q0XH 2BNRD 3RGVB 3VWJB 2EXWD 4EI5A 3MO1A 4XVUC 1T03L 4HULB 1MJ7H 4LLYB 4GAGL 1EVTC 4BQ6A 5LCVL 4RCAA 5K59E 1LNUB 1LE9A 4P9HH 3MV9A 3RA7H 4P23B 4WY7H 4JG0L 4PBVC 4FFZH 2GAZA 4Z7UB 2Z31A 4IDJH 2YSSA 1MQKL 3WS6C 3DIFB 3UTPD 3LEVH 4FQHA 1FL5B 2YD3A 3WLWC 2ZOKA 1U3JA 3HR5B 1KB5H 5J13B 4UINH 4OF7A 5DRZB 1GAFL 3CD4A 2I9LB 4PS4H 3HUJB 4JN1L 1ES0B 5CJ5A 3WLWD 5D2LB 3LS5L 5CUSL 1LK2A 3MREA 4R8WH 1RZGB 1UADC 4KGLA 5MP6L 5I6XB 2DOCA 2FH6A 5C09E 4L9LC 3Q3GB 2Z93A 5EUKB 4EI5B 2J88H 1TCMA 3SCMB 1DQLH 1U91B 3VXQA 4LSVL 1CFTB 4PJ8C 4S0SD 3QDGD 4JFDB 4U6YA 1Z9OA 4OLXH 2EXWC 3PWNA 2H6PA 4RMRA 1WFTA 3DIFA 1S9YB 5B39B 5F7UA 4PG2C 2FECI 3B9KD 5TH2A 3EYSH 2OS7A 5CUSH 5I18L 1U3HA 5ITFB 2GCYA 4RWYH 3E3QE 4MXVE 1JI1A 2K3TA 4PS4L 3HMWH 1XGUA 4LIQL 5GJSH 4YDKH 1GAFH 3B9KC 4Q9CA 3O3BA 1XGTB 2XKUA 3NCYP 4JFDD 1A3LL 3QEQE 3RY5A 4LCWD 1T83C 3KPQB 1X3DA 2EXYC 1U41A 3MRFB 4WY7L 4PGDA 1TENA 3I2CH 4OT1H 4U7SA 1UVQB 1N7MH 3PGCB 4V1DE 1ACYL 1E27A 3RX5A 1VKXA 2ZSVA 4LCIH 1QHOA 4YDLC 4R9HA 4AJ0A 3WKML 3LS4H 5B8CB 3TBVA 5I1IL 2VLLB 1PBYA 5T5NG 5JORB 2JJVA 4C58B 3VFMA 8FABB 4GUPA 4AG4H 3S35L 3MBXL 2DQEL 1E4KC 1U92B 4RFEA 4WGWB 4PGCB 5SWZA 5KS9F 4HUXB 1CDHA 1SEQL 5C6PB 2IPKA 2XWBA 2UZXB 5JUEH 3FT2A 4PJ9B 4KJPC 4PJ8A 4R4NC 5DO2D 4L8DB 1MCOH 4JO4L 4U1GB 4ZUSB 5IEKB 3OKMB 4NQVA 3T65A 1DDHA 5IFAL 5ADPH 1YN6A 1B4JH 4OLZL 4FXGA 2YPVH 5F6HI 1TQCC 4EDWH 5E9DE 3LZFL 2DJ4A 2OMNA 4MD4B 1LP9F 5C86A 3MV7D 5FM5O 4QT5B 4TUJA 3VWJD 5I30H 1FPTH 4ZXBC 2L7UA 1W72A 2VDRL 1NAML 3KPLA 3I75A 2J1KA 2Y9RT 4CBPA 1IQWH 3VFVB 4MVBD 4MA7H 1FL6A 4MCZA 5GRVL 5BV7B 2Y23A 3BD5A 1TJGH 2DIJA 5TE4L 2OL3L 5TQ0L 4XP9H 2G9HA 2BJMH 4ONHB 1A6AB 3THML 1KB9K 1MEXH 2H2PC 3O6FB 4KKCC 1E4WH 2JB6B 5JZ7C 5CP7B 3C5ZC 4FABH 2L7JA 3OKKA 4NZRL 8CGTA 1BVKA 1KTLB 2NY6C 3RBGA 5C9JA 3ULUC 3L3OA 4Z95H 1IAKB 1KJ2A 1JGVL 2ZJSH 4L9LB 3QUYD 5HI4D 4Y8DC 5E6ID 4S1DC 1LNUA 1LE9B 3AS0A 4NDMA 1L7IL 1NGZA 2DWDA 4R26H 4ZQKB 2C1OA 3QFJA 1JJUA 1UACH 4E5XB 2RGSA 5CZXC 1YEFL 3OTTA 4O4YH 5C0AE 2QQNL 4G6MH 3PHSA 2BNRA 4RAUA 5ESQB 4FQCH 4L9DA 4HZLB 1LD9A 2Y36H 5TF0A 3ZDXF 2ZUYA 3QUXD 3QULA 4MNHA 3V4PL 1T22A 3U30B 2QQKL 4XCCH 3HFMH 1NSNL 3RZCB 3OR6A 2HVJA 3TCLB 3K46A 3GI8L 4LSRL 3BGMA 4KROD 4G3YL 4FN0A 1JMZA 5B39A 3QYCA 5T3XL 5GJTL 2B8OT 3NH7L 2XFXB 1UENA 5JOFB 3STLA 5DJ0A 1XH3A 5JLZB 3H9YA 1U91A 3VXQB 4RGMC 4M6MH 3E6HA 5J3HD 3KLSA 4M7ZC 3QB7C 3WE6B 4PRAB 3GI9H 4NO5B 3O4LE 4MQ7B 1I3RA 3DRTA 3SE4C 2KQMA 2AQ1A 4P5MA 2APTA 2VERN 2VKXA 5E8EA 3DX9A 3WXWH 5GGRY 3LEYL 3E6FA 2WANA 3L95A 3WNKA 4OM0L 4NCDA 1TZIA 1QA9A 3GM0A 2GITA 4NUJA 1IEBB 1BJ1J 3KHQA 2HFGL 3G6DL 4PRHD 4DKFL 2EIEA 3ZDZE 3RDTC 1KTRL 4MNQB 5I1HH 2DQUL 1LO0L 1TXKA 4HJJL 3MNVB 1JHLL 5IOPA 1EEYB 4PRHE 4J1UB 3RGHA 1RZFH 1G6RL 3VI4E 2AK4E 2C7UA 3CPLA 4DK6A 4FZ8H 3QQ3B 4U49A 1QLRA 2COQA 1T6WA 2CDEB 5JPNA 4TULH 3AS3A 4ODXB 4PJDB 5GRZA 3T1FB 3V8OA 1DLFL 4WU5B 3VXRE 3BDXA 2OR8A 1JHLH 3L3GB 2D9QB 3MUHL 1TCRA 2VJXA 1WITA 4LLVA 5LWYH 4WFHE 3QQ9D 3CFCL 4PJCE 3D0VA 4X98A 4ELME 1KV3A 4UDUB 1CGSH 3CLFL 1A1OA 4LHUA 2E7LC 3EOBB 2NCMA 3U36A 2UWEB 4OM0H 4PLJC 4KMLB 1I9RL 1XIWA 4Q2ZA 1CYGA 4M7KH 5I8OH 5FGBC 3QXDB 4Y16A 1WZMA 4HWNA 3QXDA 1KTDB 4MA3A 3BAEH 3N1QC 1RJLA 1EEYA 2AXGB 2XN9A 4PJCF 3ARBC 4ELMF 4JM4H 4DN3L 4JFPB 3GI9L 4XXCA 3TVMB 3MRRB 4MNQA 2EEBA 3B6SB 2B2XH 1J0IA 3IF1A 5L0QC 1NJ9B 4WNQB 1H3GA 4DKEH 3BUYA 2R2EA 5E8NA 1X5HA 4L4JA 2YD2A 4Y2DC 3O3DB 3EDDA 3CDCA 2WV3A 4CN1A 3I02B 3TZVB 4KY1L 4JKMA 5CSZA 5JOEA 4HUUB 1VHPA 4LGSB 5IQ7H 1CVRA 1DANU 4BFBD 1NGPH 3OKLA 2XZZA 1B0RB 1RZIB 3BPLB 4QHUA 4ZUUA 2Q7YB 3MPCA 2DD8L 4P59H 1P6FA 2WWKT 1F6AB 3LDBB 4S10A 1U0QA 3QUXB 1RUAL 4YDJB 3O3EA 1UA6L 4YDJA 5KZCB 2QQNH 2D4DA 4G6ML 5C0FB 4KPHH 3HZVA 1CFVH 1HQ4B 2YOCA 4NGHH 1G9NL 4M1DL 5C09D 1UACL 1T1ZB 2ZPKL 5FYJU 4WW2A 3LN5A 3MSPA 1V3JA 4KDTC 4JRXA 4YXHL 3TBTA 3UTTE 3EBAA 5F9WB 3LPGA 4UU9B 2VC2L 3RY6C 1YNKL 1KIQA 2BXZA 1F4HA 3BPCB 3QZWG 2PYED 5CD3A 2UUDK 3CFJA 1G6RB 4X7FC 2IPTH 3DBXB 4ZO6A 1B0GB 4L3EB 2QADD 5I8EA 3BD4A 1MFCL 2HFFB 3C5SA 1NCBL 1T04A 2QTEA 3K80A 4RGNB 4RFOL 5F44A 3QPXL 3RWJB 1ZEAL 1TJGL 5FA3A 1TNMA 2GJZA 4NJ9H 2GCYB 2FHBA 3OJ2C 3G04B 2FEEI 1OB1B 3BOVA 1M7XA 2O5YH 4JFZH 2XRAH 3WO4B 1P7QA 3VI4F 1IQDA 4ZFZB 5IG7A 1J0ZA 2HKHH 3VGBA 5B4MD 2OR9L 4TRPL 4GBXA 4L3ED 3V6ZB 4KI5D 2H1PL 1R5VB 4FHBD 4L4VB 3Q6FA 1DZBA 1FG2B 2R69H 4OLZH 5ESQA 5IFAH 2KH2B 3JSSA 1Z2KA 1QRNE 2PW2A 1CFBA 4WFEE 3BEWA 4OGYL 3G9AB 3S96A 4CNIB 3GSNL 2ICWJ 1YC7A 5E8EB 1F3DJ 4C83B 1H3WM 4GW4B 4MAYB 4YPGA 4X6CA 2UYLA 5FECA 1RIHL 5F88A 2M26A 2JCCF 3DO3A 3HUJA 3MLUH 3O6ML 5HD8C 5I15L 4NQEA 1OAXL 2D31B 3MOQA 3U2SB 2VQUA 4LMQE 3GHEH 1PKOA 3REWA 1ZMYA 3RHWK 5JMRA 4U3XA 3P4OA 3U4EB 5F96L 2EDTA 1NMBL 4HQQL 5JW4N 3MV9B 2BVQA 3CK0L 5L8KB 2O26U 5GPRA 4XMPL 2RJMA 2MHAB 4PY8I 1KPUA 1SJEB 1ZT1A 3QDMB 3QEUB 1MCKA 1A3LH 4LKCB 3L1OH 3H0TA 2IFGA 1I3RB 3RWJA 4BA8A 5K9KA 1QBBA 1CIDA 1MFAH 3LAFA 5EOTA 4H26B 3CFEB 1KLUA 1I7TA 2Q7YA 5L88H 3ALWA 2VDLH 4NM4L 5DHYA 1NPUA 5I18H 2HTKC 2XQYG 3BD3A 2GTZB 1CICA 1JVKA 3NBNA 5I1JL 3NCCB 1ZWIB 4HJGB 4OFIA 5KVMC 4LSVH 1NJ9A 1LHZA 5CD5C 4WJ5B 2AS5M 3ET9F 4QHMB 1UEYA 5C2BL 3O6LH 4P4RB 1J88A 3N9GL 3QIBB 4RISL 2VNCA 3PP4H 1S5HA 5EC1B 3IU4H 5J89A 1S9WA 4XHJC 2P42B 3OKLB 3FL7A 4IJ3B 3KPLB 2UWEA 3UTSA 5EO9A 3QQ4B 3KPTA 5IF0A 2EC9U 4Q0XH 3SDXF 3WFDH 5GSVB 4Y4FC 2IBZX 4LOUD 3JVGC 3HZKA 4R97C 1Z5LB 3BN3B 3RWDB 4F8QA 4H8WL 4KTYA 3WIFB 5GGTH 5CJQH 1D5BB 2BNQA 5KS9A 4XMPH 4IOFD 3RA7L 5BMFL 5EPMB 3GJFH 2CDEA 4PRPD 2WW8A 3U0TB 4P9HL 5CIPB 3M17A 5GQBA 5IV2B 4JM2B 1MJ7L 4HV8B 3N9GH 3OKDB 1INQB 3GSNA 3D0LB 5DRZA 1XAUA 2H6PB 2JJSA 3O6LL 5C2BH 3WNPA 1HHJA 1Q94B 5GGRB 3GHEL 1S9VA 4PJIB 1I1AC 2APBA 3VFSB 8FABA 3KLAA 5D1XA 2GAZB 4Z7UA 4ZAKD 2CLZB 2FJGB 2FO4B 2PR4L 4CN4A 2KUTA 1RIHH 3SPVA 4U1NA 4GW5B 4OFVA 2FIRT 2IPUG 2EDEA 5EUKA 4QCIB 2NY5H 4PJEB 4L8CA 1ZLWK 1NCDH 3IDNA 5T5FH 1FYTE 4U4BA 3JV0A 1RJZB 4YHKH 1G7MB 2WM0A 3MO1B 4HFUL 3SKMA 4G6FB 5L88L 4X9IA 5EU5A 1G9ML 4XB7A 4X99B 3QSKB 3C2SA 4XCFL 2P4AB 4W4NA 1LEGB 4KZEL 1SJXA 3W5NA 1FSKC 1CD8A 4J2XA 1QOKA 25C8L 3QO0A 4H1LA 3FQXB 1CDUA 3OG4B 2HKHL 2QR0A 3DURB 1GOHA 4NNPH 3ZHDA 3QUYB 1BF2A 3QEQB 1ZK9A 2YA2A 4R96B 5JPMA 1AO7B 1OT1A 2VLRE 3KYKL 4YUEH 3I6LD 3BGAA 1ZEAH 1R3IL 5F96H 5E6ZA 4MSWA 3MLYH 5BO1L 1KIPA 2SEBB 5FGSA 1EEUA 1SYSB 2DQGL 2XKSA 1NCBH 3ARDC 4PRNA 1AKJA 2OP4H 4E41A 3O9WD 4S2SB 5F8RC 4ESKA 5J0BA 3REVB 2AGJL 2HA1A 1ZHNB 2VZUA 2FJHB 3QWRD 3EYVB 2Z93B 2ORBH 4HWUA 3MLUL 4FQJH 4HIEA 4OZFB 3RGVC 4JFFA 4ZQKA 5DVLA 4NDMB 2W91A 5D2LA 3WSQL 4BK4A 2JJTC 2R0WL 3PWLB 5IMKB 1G9NH 1BBDL 1JWSB 5F7YC 1EDQA 2V5SA 2WIIB 5HD8D 3RL2B 3MJ8B 1S7RB 3ARFA 5J12C 5TPWL 3OZ9H 3K81A 1TDQA 4QXUH 5IVXB 4HH9A 5IM7B 3VD4A 4NCC1 2NW2A 4FP8L 3HE7C 4PYHA 4GAJH 4U3HA 1A7RL 3ESUF 5IMOB 3DUUB 2I24N 4P2RE 1CT8B 5GS2H 2XRAL 4X4ZA 5HPOA 1ZT4A 5I1LA 1N6QL 1KJVA 1PY9A 3GZKA 4F37F 4N5UA 4G80B 5FA4B 1BFOB 4K3HA 1I4FA 1UB5B 2AK4A 2HVKB 4HX1B 4ODUB 4RFOH 4QRRA 3UDWA 1LP9A 5GSVA 4HIHB 4JM4L 4WO4C 2IAMC 4DN3H 4PB9L 2IPTL 4XPAH 3ROOB 5HGBA 1K8DA 1OSPL 3VI3F 4H20L 1CICD 4CJ0A 1R5WA 3OKNA 1YY9C 4U05A 3VG9C 2VUYA 4OZIB 5GS1A 1VESA 3SKOB 4I2XB 2HTLD 3OJMB 1BJ1H 4PGEB 4ZFGL 4HK0A 2ZPKH 4M1DH 5D1ZD 3R0NA 1WFOA 5ESVB 5DT1H 1U2CA 4LARL 1U2HA 5KSVA 2R0LL 1N64H 4M6NL 1J11A 3VFMB 2MTPA 1FC2D 4HC1H 3OGOE 4WWKA 5C71A 2VDNL 1DLFH 3SJVE 4P59L 2F5AL 1BJ8A 1U95A 4PJDF 2MCPL 2BX5A 1MHCB 4HIJB 3IAPA 3LPWA 4LAQL 4O02L 4YGVB 2ZG1A 4YWGL 4X6DE 4XNYH 4YHYB 5MEPA 1YNTB 4P9HC 1KJ2L 4HJJH 4P5TB 4DK3A 4G9DB 4BZ1H 4HHAB 4HWBH 2YPLB 3BZ4A 3LKRB 1UM6H 1EAJA 2ITDB 3DRQB 2KZWA 5MEQB 1XF2A 4N8PA 4I2XA 4OUOA 2DM4A 4Q9RL 2JJUA 2PTTA 5GS1B 2H3NA 1P4LA 4P4KB 3HG1D 3PABB 1TNNA 4YHNA 1IC4L 1BZ9B 3H9HB 1LEKB 1QRND 1IRAY 1IEHA 2WMPA 3U7WH 1IAIL 1KNOB 4OFPA 4XWGL 4DCQA 2BVTA 4Z7VB 3EYVA 5CEXA 4JN2B 1CGSL 5HI5C 2GI7A 4PJGB 5SX5K 2YPLD 1D5IL 4CMMB 3K8KA 4YLQT 1IGTA 4OFDA 1N4XH 4HWBL 2MSPA 2B5IB 3D69A 3FFDB 1JK8A 5ALCH 5JIPA 1WVZA 4PJAB 4ZYKA 2PYEB 5A2LH 4G3YH 4HK0B 5E03A 4V2CB 5F70A 3BWUC 3U4BH 4TULL 1OP5K 2PCPA 4ODWA 3I6GB 1AO7A 1CFQA 1J8HA 3H9SB 5KSAA 1HKFA 1C5DA 3M8OH 1H8SA 5H8DA 1FYHB 2NW2B 1MCBA 3KLAB 1GL4B 2NR6C 2KPNA 2R8SL 1EAPB 3UZQA 3V4PH 3D39A 5ICYB 5F7DB 3QIBC 4KI1A 5J1AA 4ZNCD 4RIRB 3QI9B 4M6NH 5D7IA 2EDQA 2DQUH 2R0LH 5I1HL 3BKMH 1UZ6F 1VDGA 1XCTB 4LARH 1FYTB 1IQDB 4NQEB 5FYJL 4HPYH 1SEBB 1ZXQA 2F5BL 2P5WA 3OHXB 3BP4B 1ZT7A 3VFTA 5D7JD 1DUZA 5C0IB 1L7IH 1X9QA 5ISZA 2X4QB 5JZ7D 4JFFB 1DBKL 2BHYA 4ISVA 4M5ZH 3MRCB 1JGVH 3LEYH 3L5JA 4XT1C 1QR1B 4H20H 4AIZB 2OLDA 1CL7L 5DK3A 3GFUA 2HFFA 3MOBH 4JLRB 1AKJD 3FZUD 1SM3H 1E4WL 3O81A 3PL6D 3QNXB 3IDGA 3ABZA 3R0MA 2MKLC 2VAJA 3HR5A 4HDIB 3MV01 4XNMA 4PRID 1OARL 5IESH 3GMNB 3HUJE 3NN8B 3NH7H 2EYSA 4KHXH 3AMKA 2R23A 1FJ1A 3BFOA 3SDCC 5HHOB 3RIFK 1K2DA 4P3DA 3GI8H 3MR9B 3MZGB 1KCUL 3KWWA 4IMLA 1FPTL 2GFBA 5EIIA 3T0EE 5DHVH 3VA6A 1LGVA 1HHGB 5F9WC 2A73A 2F15A 1YY9D 2YPVL 2Y36L 3HC0A 2EIZA 4OCNC 4EDWL 1VPOH 3U48A 5ADPL 2C3HA 4X9FA 1UXSA 5CD3B 4O4YL 1N8ZB 1PKQA 5CINL 4Y16D 4Z0XB 4JO4H 4NFCA 4JFQB 4UUJB 1KIQB 3BRDA 4LCYA 2HH0L 1HOCA 3KLHD 1MCJA 3HE7D 2NNAB 5I1GL 5I9QB 3DX8B 1J8KA 1JFQH 5I2IB 4GRWB 2CGRL 3CSGA 5FCSH 5F1NB 3RUGA 1XGRB 4QGTA 3UJIH 2FL5A 4F33A 3DYOA 4LGPB 3T0WA 2GT9A 3V6OE 4QTHB 4TTGA 1MELA 2DQGH 2EXYD 2BC4A 3MV7E 2R4SL 2J3SA 5D2NA 4JKPL 1WEJH 2F19H 2X7LB 3U36B 3S5LA 3I2CL 4OT1L 4IOIA 1XGYH 43C9A 4OV5B 3SN6N 2VLKD 1FL3B 4MDJB 2VDRH 4XH2B 1C1EH 4KUCD 5JHDD 3L6FA 2VZOA 4M3JA 4FG6C 5DJYB 1XF3B 4JO2L 2P5EA 3T2NH 4QXGH 4P5KA 4YDKL 3BIAX 5GJSL 2KDGA 4JZNA 1HI6B 2UWEE 2X9XA 1G9MH 3BISA 2HMID 5CBAB 1HSBB 3BHBB 4MMZC 3MR9A 1K4DB 4J12A 1XR8B 4YHKL 3BJLA 3MGOA 1NC2D 1UZ6E 4YBQD 2ICEA 2ED9A 5SV4A 2ICEB 3QJHB 1RIUH 2B0SL 4PJXE 4X4ME 5EBMA 5C0AB 4QRPB 4F7PB 1DQDH 4OLXL 5EPMA 4IS6A 3EYUL 3P11L 4OZIE 1EPFA 1T4KB 1X5YA 3QR2A 2F53A 3ZZ1A 3KGRA 3WNNA 5KSBA 3L5WB 5I1DA 1IT9H 1TITA 5E2UH 3O41A 1NMCB 5INDA 2HG5A 3QXAB 2VXUL 2Z4QB 3WIIH 2PXYC 1GH7A 3FO1A 3NCEB 3WKMH 3MBEA 3WNLA 1JPTH 3UTZB 1QSFE 3QIUB 1DUZB 4YIQA 4CVZA 5KAQG 4PRAA 3JWDL 4C57C 5KANI 2JCCA 3CFBB 1J8HD 3E6HB 3HUJF 4FOMA 4LLDA 1XCQA 3DGGA 2FZ3A 1KB5L 1G9MC 1K3ZA 1G6RA 2MQ0A 1E6JH 5J1AB 5C0AD 2AXJA 1BQUA 2R0KH 4I3GA 5E6IC 2FJFB 3S3JA 4KKAC 3SDAB 4RWYL 1QRKA 4WW2B 4EN3B 2HJFB 3MRNB 2UZIH 1R3KB 4DVBB 3DURA 1EH9A 2QR0B 4EIGB 2PN5A 3BKCL 3H3PL 2BSRB 2P8PA 4Y4HA 1TZHB 1NGXA 2IGFL 3FFDA 1QD0A 1BOGB 1KLUB 1Q0XL 5C8JB 5IJVA 4I48A 2YA0A 5SWQA 1IM3B 3VXUB 4LPWA 3K4ZA 1T04B 5IB4B 3KPRE 3VXPB 5HHMD 3TH3T 2JCCB 2Y5TB 5EU3B 3NMEA 2LVCA 3QRGH 5JA8B 4YHOH 5I1JH 4AT6B 1FZKA 3MJ9A 3BEWB 3UXFA 5KG9A 1U6AH 4R8WL 4ONOA 2W65A 2LE9A 4JANA 4WNQA 3HZVB 3SDCA 4HMDA 5D1QB 1JL8A 5EBLA 4UINL 3GRWA 3BESR 5EBWA 3D25A 3NZHH 3LEVL 3L1OL 3QFJE 3T1WA 4ZS7H 3GSNB 3VH8B 1KTDA 5A40E 5D71H 3ETBF 3HG1B 3QUMB 4KI5C 2X4SB 3MCG1 3VD3A 3TT1L 3CK0H 3DV4A 1GXEA 4JRYD 1NQBA 2IAND 5B4MC 3WS3A 2N1KA 4WEUD 2F8XC 5BS0E 4I9WD 1VFMA 4GAGH 3L5XH 4FA8A 2IWGA 3MZTA 3MRLA 4MXQD 3KS0J 1M7IA 3GSOB 3X11A 4MQXC 1X5AA 2C1PA 4OD1L 4UNUA 1OAXH 1OAQH 3N06B 2YK1H 1U93B 3O11A 1JFQL 1RJLB 5DRXB 2DLEA 3FQNB 3FFCB 3A6CH 4PRBA 2XWJB 1VGEH 3GSNH 4YNYB 3QDME 2NW3B 5IB2B 4OJFL 4K9EC 1RK1A 4P46D 3RWEA 3RVVD 1FNHA 4RRPA 3FT4B 2KL6A 4PUBL 4M5YH 3PP3H 4ZUWB 2P5EB 3ILQD 5DJYA 2NYYC 3QP3A 4R4BB 3AXLA 1C08A 3N85H 4L29B 5SV3A 1FIGH 3H3KA 4CU8A 1NFDF 4Z5RA 4NT6B 3MJ6A 4KHXL 3CFKB 4DTGL 1P2CB 4NHCL 5K9JL 4GRMA 1TLKA 3BSZH 4NJ9L 4NFBA 5D1ZC 5DMKA 1JF1B 4M8QA 1U8HA 1PY4A 4HJ0C 2R2HB 4YXLL 5CP3A 5F7LB 3MNZA 1SM3L 2UY6A 3HA0A 5FYLD 1DQML 3O45B 5EN2A 4KQ4H 1UEMA 3TBVB 5HDBE 5A2KH 3MRPB 1UWGL 4RQQB 3VXSA 1OCWL 3IRPX 3ARGA 1CFNA 4WUUA 1ZOXA 3CUPB 4HXAH 1FO0H 2P24A 5J1TC 4NPYB 3O2DL 1BLNB 5CSZB 1DVFB 4HCRA 4I2XE 5EU7E 4QOKE 1GZQB 1FFNB 3T2OA 4FNLL 4ZNEA 1IVLA 1QO3A 3RTQD 1QRNB 4LQFL 4NBXB 1J18A 3U7YL 4PLKD 4PV9A 3O4LB 4X6CB 4X5LA 2H8PA 3M8OL 4XVJL 3NPZB 3B9VA 5CEYA 5IHLB 1MCNA 1ZT7B 3VFTB 2JF1A 5KJRL 3CPLB 2M8XA 1CI5A 3U4BL 4NWUH 4LASL 1WT5C 5C9KA 1RZKL 2FNBA 3IDYC 3ALXA 5ILTL 5ALCL 1YN7A 5DC4B 1EHXA 1JP5A 2NY1B 4ZO7A 4PJ9C 1FNSH 1M05A 4DGIH 2DQCL 4ODTL 4Y4KA 3NABL 4Y7MA 4R7DA 1P5UA 2XPGB 2V17L 1KCRL 4N8CH 2ICCA 4DKDC 3IJSA 2IAMA 3AREB 4UBDC 3E0GA 3X14A 3U0PA 3BI9X 3TA3C 2X4TA 3D18A 3BAEL 3KPOB 4PJ7F 3L3JA 3TO2B 4ODXA 5I8OL 4NUGL 1J9CT 1N6UA 1JPSH 3GIVA 3L3OB 2W38A 4IRJD 3AM8A 2YXFA 4PY7B 3HPLB 2DQCH 2CRIA 4NKMB 4BSWA 1QKZH 5CP7A 5FK9A 1T5WB 4RAVA 1JZ8A 3FHAA 4NWUL 3FQUB 4O02H 3H7BA 4WW2F 1BMGA 1F2QA 1TVHB 1AY1H 3RZCA 5SWZB 2R0ZH 2PXYB 1FNEB 2BHUA 2VDNH 5DJ8B 1UCTA 4NZTL 4EDXB 4N0YL 5CFHA 1MF2L 4L3CA 4PRNB 5JIHA 5DT1L 2ARWA 1LWRA 3CFKA 4DKFH 1JYNA 3PWVA 3QQ4A 5IF0B 3G5YB 1NLDL 4L8BA 4ZFGH 3TIDA 3VXUE 2VQ1A 4ZUSA 1JTOA 1ETZA 1XZ0B 1R0AL 1EIBA 3WXWL 3SGEH 2MOVA 1LILA 2A74B 1I9IL 1RJYA 3B43A 5EO0B 2IEPA 2E6JA 5FGRA 4PP2B 3ULVC 2VXVH 3HZYA 5EULV 1T22B 5T3XD 4J6RL 1X7QB 2X4NB 5A16B 5J12B 1V7NL 4PGEA 2I07B 4X4XB 3SKUD 3BSZL 4R4FL 3GDBA 3UBXA 3WHXA 1R5WB 2W92A 3BP5B 3PGDA 1JPFA 4BFEA 4JQXA 3F7YA 3BP6B 2CLVB 4DZ8B 2Z31D 3U79A 3HI5L 2X4RA 1OAUL 5I1AA 3N85L 1A7RH 1T5XA 3BO8A 3LIZH 1U95B 2CK2A 4FFYH 5D93B 3HN3A 3S36L 2AK4B 5HYJE 1LP9B 3RUGF 5BRZB 4XP5L 5C9JB 4N9GB 1S9XB 1JWUA 4PUBH 2BCKB 1YQ2A 2W9LA 3OZ9L 2X09A 5BV7L 4FQCL 5I75B 3FO2B 1I8IA 2DM2A 2MQCA 1A6UL 3VFPA 1A6AA 3HG1A 1NCUA 4K23H 5INCB 4OUUB 2JELL 3CSYA 4WO4B 5IROC 4R26L 4Z7QE 2NY2D 4WTZG 2DQFB 4Y5YB 3WJJA 4N0UA 4Y5XC 1P9MA 1JGDB 5A16A 3BXNB 5IP4A 1N3NB 5C0CE 2YK1L 1JN6B 1FFRA 1OAQL 5IB5B 4PGCA 3T0DA 1WLHA 3LN4B 3UAJD 4L4TB 1YEGH 5GGSY 4CMHC 1JE6A 2OP4L 1YN7B 4JFYB 3BKJL 2P8LA 1RU9H 4Q9BA 1NL0H 2A6KA 5T1MB 5IMLB 4Y19A 4S1RH 5BO1H 3ZKNC 2MWCA 4LVEA 4JY6A 4XXDB 2D7TH 1HK6A 3W39B 5C0RL 3OBAA 2ZOLA 2H8PB 4OKVB 2AV7B 4WDIA 1EJ6A 3GGWB 4LLUA 1YMMB 4QF1A 4ZSOE 1U58A 4OZHB 4S2SA 2PYFA 4P4RA 4OAWA 4DEPB 1IL1B 2BNUA 4L4TD 3BWAB 5CHNB 2P8PB 1BM3L 1B88A 3HE6D 4NNXB 2JIXB 2WP3T 4XCFH 3P40A 4I3SL 4ZOEA 5BJTA 2R2CA 3QEGL 5D7JA 5TE6H 3HCVB 2FD6L 3WUZA 1KN4L 1OAYL 1U6AL 4QOKB 1J12A 4JFDE 1JZ5A 4NRZA 4WW1B 4FQIL 3QRGL 1KPRB 3ULUL 5KVFL 3MNZB 4Q7DA 4QRPE 2FJHA 5CEZE 5GHWL 3B9EA 1JIBA 5C09A 3SCMA 4FFVC 4X99A 4HMCA 5DJAA 1XMWA 1U8IA 4KH2A 3LV3B 1TZHA 1I9EA 5DA0B 3MNWB 3BT2H 1U58B 1BIIA 3H3PH 4NO2A 3C2AL 3GGWA 4GT7A 4HUKB 1KPUB 3A67H 4JRXB 3X14B 1L7TH 5F7KC 4JKLA 1KXVC 5L8LB 3F12A 3RJQB 3R4DA 4HWZB 3CSPA 4W68A 1MLBA 4H8WH 4U6TA 5DS8A 2HRPH 2KQNA 5BJTB 3DXAB 4MHHI 1MCPH 2DQHL 4IRSD 1XGPA 3RZWA 4CL7A 1BPVA 3QJHA 1PD6A 5FO8B 1IGIH 2ZCHH 3HPLA 4MJ6A 4Z7UF 3U4AA 1P84J 2HN7B 2IANE 3JV6A 2DWEB 3V4UH 5J13C 5J6HB 1P2CA 4F80A 4IIQA 1NAMA 3QG6A 1DE4A 4QLRA 5D8JH 3IU4L 2BNQB 3KS0H 1QTYT 3PP4L 4JAMA 4HEPG 3ALPA 5KOMC 2XN9D 1XF3A 3BPNB 1BVLB 3MRMB 4NO0A 5F7NC 4UTBH 1MUJA 4OZ4B 1EO8L 5DQ9B 5C07E 1FNFA 5ANMA 5H37H 1IILE 2XACC 2ICWB 1X4XA 4Z7VF 4FQQA 2PNDA 1P1ZB 4JR9H 4JFPA 5IHZB 3FOMA 5DD5L 5I17A 1TETH 5CEZD 2J88L 3QDMD 5EBMB 1G7LB 1AE6H 1RIUL 2B0SH 4LP5A 4YHPA 5E8DH 4XBPB 4U1JA 1HIMH 5HHPA 4HV8A 3OKDA 1XF4A 4WIQA 1DTUA 3PXHA 2JK5B 4I5BB 1HH6A 3RY4A 2VDLL 1OW0A 4NM4H 5CBAA 3JTSB 4JN1H 3BEVA 3PHOA 4WFFE 6FABL 5DSCB 1QSVA 1X5GA 5C0BE 4XNUH 4K9EL 4KTEH 4JZJC 4J3TA 5ITBL 3W9DA 1ZWIA 3B8SA 3KXFE 4MVBC 4D9QD 5AG9A 4N5ED 3F65A 4QHNB 5BS0D 5HHQB 3P9WB 5IUSA 1WK0A 1XGYL 3RNKB 1FVDA 5DF0A 3QBTB 4K3DH 3MLTA 1U8KA 4L29A 4WUUB 4MJIA 4HUVB 3AXLB 1FSKB 3CFEA 3WEXA 1E4XH 4R0LA 4S1QH 4PJGE 1F11A 1HQRB 4FTVD 1A2YA 4YHIB 4NN7B 2BVYA 5I9QC 5L6YL 4EQ2A 5E5MA 4EXPX 1M7DB 1YYLL 1ZGLP 1T66C 5HDBF 2AW2A 3UJIL 3CVHA 1YNLL 5E8OB 5HHOA 3MRNA 1A3RH 5D7KE 1GC1L 5H2BA 4OCWH 1BHGA 3TZVD 2PXYD 5A3IC 1NBVL 3RDTB 3R8QA 2C4FU 5DRXA 3S37X 1LP9E 3DX6B 5IIEA 4HAFA 4R0LC 1NDGB 3UYPA 5CINH 5EZLB 1UM4H 4WHYH 3SQOH 1S3KL 1DLHB 5GZNC 3TF7C 3GK8H 1VPOL 5HHNB 1TTFA 1QLFB 2DMCA 2AAVA 5J9PB 5C2UB 3QCTH 2Y72A 1AGDA 1MVUA 1RY7B 1U8QA 1VFBA 5EA0H 5GGQH 4CVZB 4LGRB 3B5TA 1I85C 2OJZL 4PTUB 4C83A 5L2KD 5HVWA 1KCUH 3LQMA 3DHMA 3MJ9H 1OAZL 3L3DB 1K2DB 4MAUL 3QO1B 2X1WL 3PL6C 1RHHA 2O5YL 5SX5H 1AGFB 4L8SC 1KT2B 3D18B 4KK6C 3VFGH 1ED3A 4OB5L 2EYTA 4UT6L 5E99H 3PDGA 3IFOB 1D6EA 1OARH 5IESL 3O11B 2EYRB 2V7HB 3MACH 1S7XA 5BV7C 2NXZD 2CJUH 3R1GL 1FL5A 4MDIB 5DC9B 5FYLH 1WGOA 4NKMA 4LNRA 2LVEA 1KTKE 1IGJB 2R29L 3MLXH 1P7QB 5J6GA 4DUWA 1T7XA 1DBKH 4XAKE 3Q1SH 2PW1B 2WWMC 2YD8A 4UZGA 1AHWA 1VB9A 5B21A 1J5OL 2F5BH 2ESVA 1CL7I 1QLFA 4NGHL 1CFVL 2CO7B 2PW2B 5C7XL 3LKSA 5I76A 3PGFH 3WBDA 2MNUA 4UV4H 3HR6A 1UA6H 1P7KB 2AP2A 4FXKB 1RUAH 3MRKA 3SKNA 1H3TA 2V5RA 2EKSB 1CLYL 5F7DA 2AVGA 3W2DL 1S5IL 4Y5XB 1Y6MR 4DFIA 2J8UB 2LABA 1D6EB 1RAMA 4PGBA 1AD0A 1TZIB 2ILLA 5IQ7L 3ZYJA 3ZT6A 1IC1A 5IB1B 5GGSB 5J11C 5FM5M 3ZL4H 4DOHE 4LRIC 4KK8D 3NFNA 4HH8A 5E2VL 4X5WB 3GUTA 4PTUA 4DKEL 2W0FB 4NO5A 4PLJD 2VLRD 3SGKA 4OIIL 2VL4A 4KVNL 5SWQB 1AO7E 1RULH 5KVDL 2B2XL 3NGBB 1X5XA 4ZAKA 3V7MA 5EORL 4RMWA 3FOLA 3U7WL 2AKRB 2WINA 4YIQB 2X1XR 1A47A 4UQ2A 5FFLA 5E70A 1R3JA 1F4XH 5HHQA