4F2MB

Crystal structure of a tgev coronavirus spike fragment in complex with the tgev neutralizing monoclonal antibody 1af10
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
DILLTQSPAILSVSPGERVSLSCRASQSIGTSIHWYQQRTNGSPRPLIKYASESISGIPSRFSGSGSGTDFTLNINSVESEDIADYFCQQTDSWPTTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal antibody 1AF10, heavy chain
publication title Structural bases of coronavirus attachment to host aminopeptidase N and its inhibition by neutralizing antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Viral protein/immune system
total genus 44
structure length 213
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f2mB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f2mB01
5DRXA 2W0PA 4NBZB 2A83A 2Y07L 3NFPB 3LKOB 1IT9L 4U3XA 3GUTA 4CL7A 4HXBL 4NQTA 2I25N 4PJ5D 4MDJB 4UT7L 2IBGA 4FXGB 3MNVA 3OSKA 2A6KB 3RIFK 3FOLA 4BYHA 3BYYA 1PLGH 1RJYB 1I1RA 4NO2A 1UH4A 2GKIA 5BVJA 3QCVH 4TRPH 1J1XH 1LO4H 2NY5C 4BQ6A 1P4LB 1JTTA 3DRTB 2XZCL 1UJ3A 1MQKH 4IRSA 4J7RA 1UM5L 4KRPB 4LVOC 2DI8A 3GGWB 5T5FL 5DURB 1NEZA 2XNAA 4OFYD 4X6CE 3U46A 2DLTA 1UQSB 2EYRB 5IQ9B 4WHTB 2HT2C 3BPNC 3VRIB 4KHTL 4OT1H 5F3HB 4YX2H 5D96B 4F9PC 3MOAL 2HT2D 4LRNH 5E00B 3QSKB 4RA0C 5FO9A 3KPPB 4XPGH 1MIEH 2OK0L 5FKPB 2CQVA 4PTUA 4IOSD 4GRMA 1EEYA 4NPYA 2Q76B 1GGBL 2D0HA 3X3GL 4U1LB 3QG7L 3HLAB 2YPLE 3QUKB 5E99L 3T1WA 4YFLF 4GQ9H 4NNYB 2L7UA 4PJ7F 5T33L 1BHGA 2AXFB 2C4FU 3MLRH 4CMMB 1A22B 2A77L 4QGTA 5I73B 4K55A 1AHWA 3V5KB 5DHYB 5T1KD 5I1IL 5FGCE 4LPWA 5FKAB 1OPGH 4HZAA 2WANA 3MUZ1 3BGMB 5HYSB 1TQCB 4W81A 5F72S 2AGJH 3ARGA 1I1YA 4Z8FH 2WLYA 3F8UB 5B21A 3VH8A 1MRDL 2VXVH 4D0CA 4CBPA 4M00A 5ENWA 4R4BB 2Z92A 1G7IA 1JTPA 1WFTA 4P9HH 2R4SH 3UYRH 1IAOA 4PRBA 1FG2A 1P53A 1G7PB 3MLTA 4H8WC 5IMKA 3JSSA 4A6YB 4R4FH 2HJKB 1ZGLP 3Q5TA 3PHSA 1MCSA 4LSDA 3GDBA 1FORH 3ES6A 2NY7H 5CJ8A 1JF1B 3U7WL 3KJ6L 1D5IL 4DTGH 3QH3B 4JFZH 4ODWB 3HZVA 3I75A 3CFCL 4Y19E 3U4BH 3ZTJH 2X9WA 1GAFL 1DZBA 4PP2B 3BP6B 5DJYB 1DQQA 4FS0A 4CN1A 3CPLA 3VD4A 1UWEH 3VWKA 3T2NL 1NGYA 3QIBC 4GXVH 1M6OA 4MVBC 3QIBD 1K2DB 1XT5A 4MVBD 1EVTC 5L7XL 4QYOB 2CIKB 3KR3H 1UZ8A 1L6XA 5DGQA 4P3WA 4EI6A 1JGLL 5M95B 1HCVA 3V7MA 1RUAL 3D39B 3M8OH 3HUJE 2VR4A 5C1MB 2P45B 2DI9A 2Z93B 4JRYB 5DK2B 5ICYA 4XMLH 4LLAA 2P5EA 1I7RA 4Z7QF 5JOFB 2Z8RA 3MJ9H 2ADJB 3Q5OA 1XF4B 5CEZL 4R90L 4OZGA 1AY1H 4WUUA 2CXKA 4WI7A 3RGHA 1IGIH 5ECJE 2IANB 5IM7A 3H9ZA 4PJEE 3F12B 4LFHD 3QDMD 5K9QG 2AW2A 5F7UA 2R0KH 3RWFB 4JJHA 4GKZB 4LIQE 5JPNB 2DQGL 5K9QI 1JUFB 3E0GA 3P0VH 2BRQA 1J0YA 3VD5A 3QI9C 3SJVB 4G6AC 4FQIL 2QHRL 4N9GB 4TVPH 5IG7A 2DDQL 4EZMA 1DUZA 1CFTB 3QI9D 4G6AD 4RAUA 4AQ1B 1XGQA 1TLKA 2UYLB 2ED7A 4S0TD 5EUOF 4ZPTA 1FZOB 4OD2B 3PDDA 3SKJH 4Y4HC 1T7ZA 5MHSE 5CEZD 4XVJL 4DZ8B 5I19L 4HPYH 4Y4HD 4JVPA 3WIIH 1Y0LB 3UTPE 5L2JA 4U7KA 2HFEA 1MCWW 2RHEA 2VXTH 3DIFA 1RY7B 3LH2L 1MHPL 2DTMH 4M62H 2QTEA 5FM5M 3KPSE 1ZHNA 1X6NA 1HSBA 3V0WL 4ZOCA 5D70L 3RVWC 3FB6B 3PE9A 1DBKL 5MEQB 5TPWL 3RVWD 3MV9D 1FIEA 5INCB 3K2MC 5IOPA 1A6WH 1FHGA 1CZ8L 2E5EA 3LQAH 5DDHA 3WNNA 1T3FB 1FZJB 1RU9H 4WHYH 5J9PA 1CLYH 1R24A 1FFPB 4JFFA 3MV7B 3UPAA 3AM8A 3FL7A 5BV7L 2UUDH 4KJYA 4U6TA 3RFZC 4YHLL 2VLRA 4C57C 4WFHE 3DO7B 4DOHB 4Y8DC 1A3LH 1HXMA 3ECBA 2LU7A 4NZUL 1LQSR 5E4IA 3HC0A 5E95B 5DQ9B 5I66A 2H26A 2OSLA 2P24A 4JZNA 5D1XA 3VG9C 5EO0A 2D3VA 3H3BC 4K94L 1A1OB 1CK0L 4F57L 2B4CH 5HYJB 5FYKU 2FX9H 4MCYA 5IBLC 3MUGB 4MQTB 4M9PA 2R8SL 5LQBL 4HWZA 3VXSE 4M7LH 3LKNB 5IBLD 4X8JB 3SKMB 1KPUA 5BV7C 4HIJA 4Q9RH 5BRZE 5ADPH 1R3KA 2OCFD 3QNYB 4DZBA 5IVXF 3V4UL 1N5AA 4NJ9L 1VDGA 2NR6C 4X6CA 4HS6B 3WXWL 5FB8A 1GC1C 5KBNC 2DJSA 1N0XL 2NR6D 5GISH 3I9GL 2OR7A 4IDJH 3BD4A 3DUSB 4I48B 2X42A 1R5VA 1G7JA 4XP6H 1RZIB 1J1PH 4YNYB 5J4MA 3KS0H 1XCQB 3QULA 2XWJA 1OAKH 3PWNA 4K3EL 1M4KA 2DIBA 3QR2A 1GGCH 4YBHA 4FXKA 5FV2A 5KZCD 1SBSL 5JW3L 4MD5A 1V7NH 3TF7C 4QRPD 5FF6B 1HYRC 4YO0A 2E9JA 2AI0H 4PJ5E 1VFAB 1XCTA 3IAQA 3RI5F 3P2TA 4XWGL 3VWJA 4BSVB 1QSFE 1U8IA 4JGUA 3MLUH 1EEUA 1H0DA 4F7CB 3V0VB 4L4TB 2QR0A 4X5WB 1I7UA 5DD0H 1EBPA 4JFQA 3PHQB 1N7ML 4ZUUB 3ZT5A 4B7IA 2MFNA 1M05A 1J11A 3QPXL 5DD1L 4TNWK 5FHBL 3HG1B 2Y7QB 3NIGF 3ARZA 3HRZA 3B8SA 2PO6C 1FE8L 4LLMA 2PO6D 4DKFL 4I0PA 1ACZA 1TTGA 1ERNA 3NTCL 1AO7D 2CKBL 2XG4A 3NIDF 5GS2H 3V2AR 2EDEA 2WWMC 1KYOJ 2DQCL 1CWVA 2XPGA 4Y16C 5EC1B 5H2BB 5I6XB 2WWMD 1S9VB 3WJJC 4HLJA 4Y16D 3T77A 3UBXI 3MO1B 3S98A 4IOFC 3MCLH 4LP4A 3V52L 3O6ML 4Y4FA 4IOFD 1MJ8H 3V8OA 1J0HA 4WY7H 2XA3A 3O41A 4Z18A 4MSWA 4M02A 1UXSA 5DJZA 1L0YA 5E8NA 1IAIH 4Y19A 5E6ZA 1MEXH 5A16A 2NY0B 3DX8A 3BPLB 3GHEH 4OD1H 1YMMD 2DQDH 1A4JB 3LEVL 5F88B 1M7DB 5FUCE 1I7ZB 3DVNA 1GRWA 4I2XB 1UG9A 5I1JL 1J10A 1TJHL 5DMYA 4J3WA 4R97B 1E4WH 4PJHA 4X9FA 3KAAA 5EUKB 5FO7B 1YEEL 2KPNA 5MEPB 1T83A 5FM8A 5HHVH 2HP4A 3IKCA 1CF8L 3BP4B 3HUJA 3MLPA 5DJDA 5E1AA 5AUMB 5DRNA 3D2UA 5CHNA 1B9ZA 1MOEA 2ZCHL 5CJXC 2G9HB 2BVQA 3UTSE 4PRAB 3WMSA 4WEUD 4G8EA 1P7QB 1U3ZA 4JZOA 3FN9A 4ZQKB 4XMPH 1QSEE 4PJEA 5E2JA 3AREB 5KTEL 1A1MA 2D9CA 1JRHH 3ULSA 2F9BT 3W9DB 4S1RL 1KCSH 4HBCL 1WZMA 4W4OC 5J56B 2NY6C 3MC0A 1R3JA 1H3VA 1QLFB 4G80B 3AGVA 4PJIB 2NY6D 3MV8D 1HIMH 2CLZB 4Q2ZA 3SDAB 2IALA 3V5DB 3SE4A 2I5YH 2DAVA 2NNAB 3RWJA 1AI1H 3FQTB 1VESA 4PTTA 1NC4D 4OZFH 5ESQA 4YPJA 2VZVA 1MJ7L 5IR1B 1MFAL 1QRKA 1XF2B 4D3CH 2FL5A 1AH1A 2YK1H 4NJAH 3DROB 5CCKL 1ED3B 1P2CB 1KJMA 1KCRH 1SYSA 4OI7A 3VU2A 2BDNH 2NY1C 2ADFH 5KVFL 1NLBH 1IJ9A 3HRPA 2NY1D 3PWPD 1A7PL 3SDDC 4LKCA 4QHNB 1MJUH 2EIEA 2WLZA 3A6BL 3KPSA 4WJ5A 3SDDD 4I77L 5CP3H 2VLMD 2XFXA 3C5SA 1ULVA 3ULUF 3EYSH 5EU6D 2EH8L 1D5ZB 4ODTH 3GBML 1A14L 4HIIA 5KAQG 1XGPA 2E9IA 3F62A 2C3WA 4TSAH 2OL3B 4L8BB 1MUJA 3MYJA 2I26N 2NLJA 4MA7L 2VSCA 5C8JA 1A6AB 4LHUA 5IW6A 1DDHB 1UB6B 3Q6GL 3IVKA 1AGCA 1LD9B 3MXWL 4EUPB 3PDOA 3QPQC 3ALXA 1J87A 2HYMA 3QPQD 1KV3A 1NEZG 1ZWIB 5MEND 1HE7A 4KVCL 4XMKL 4XBGB 5CBEA 3TIEA 1KFAH 2YMXH 1WEJH 1AIFA 4C56D 4GAJH 5BS0E 4PJ7E 1AGEB 1FNHA 1I1FB 4J6RH 3O3BA 1RZKL 5CSGA 3QB7C 2UV3A 3R06B 5JW5A 1A7OH 3HE7A 5K59F 2BNRB 3BH8B 4XCCH 2FJHB 3RHWK 4NRZB 3VXSA 2Q20A 5EWIL 1BD2E 2ITDA 1BIIB 4R26L 2CK2A 5DUBA 3IJYB 3LZFL 5BRZA 1D5MB 5TFSH 3TYFB 3V95A 3E6HB 4XVTH 2F54D 5EN2A 2VXUL 2ZNWA 3ROLA 1SEQH 1CICC 4UINH 4Y1AD 4EBQH 4PRHA 3OKKA 4F3FA 1HSAA 1RZKC 3T08A 4PGDA 5EDXA 4L8DA 3LHPH 2VDPL 2B2XL 5ADOL 1KC5L 1IGCL 1UXWB 1EMTL 5CLTA 3VH8G 43C9A 2NY4B 1KG0A 3QRGL 1O7VA 4WVRA 2L0DA 2I9TB 3NABH 4GRWF 5EOQH 4Z76B 1X9QA 4NC2B 1VEPA 1I3GL 1EVUA 2O5ZL 1FYHB 3SKNA 2BSSB 5SWSB 1QBLH 3JTTB 1KIPA 1KGCD 2VLLB 3PP3K 3EOAA 5E2UL 1FBIL 4Q0XL 4JFYB 1QSFA 4GBXC 3LKSB 3L9RA 3FFDA 1JHTB 5IK3B 3V4PL 3GSOA 1WGOA 4GBXD 4I0CC 5D7SL 1DN0A 3MRNA 1ZANH 3QO1B 1BWWA 2F8OA 4TUKH 5DVMA 4TOYL 5F7KC 1INDL 1RJLB 3DUHA 4PD4K 1WICA 1RJZA 2I07B 4OLXH 5IESL 5LJYH 4H88L 4Z7QE 1XR8A 4X6DF 3IJHA 5CINH 1NL0H 2BSED 3U1SL 3MJ7B 1ZHLA 4IJ3B 3ULUC 4ZDHB 5I71B 3CH1A 4HZLB 2MCPL 5KS9B 3ULUD 2H6PA 3QEHA 1MY7A 3MLWL 5H8DA 1RI8A 43CAB 4EQ3A 4QHUA 2K9UA 5TQ0L 3D25A 5GGVH 3F7VA 5KSVA 3JXAA 5HHOE 4NWUH 3HI6H 4D8PB 4I3RL 4WU7A 4RWYH 3ILPB 4L5FL 3M17A 5TDNB 1UWGL 1KB5B 2YBRB 3NACL 3RU8L 5DHVA 1U8OB 3G5XA 4LARH 2MKLC 1AGDA 1IGMH 1Q72L 2BK8A 5CKGA 2ZG1A 5I1GH 4AQOA 1A7NH 2AJ3B 4LLVB 2HFGH 5EUOE 4XHQA 5IEKA 1MCHA 5KVMC 4OCRH 2WUCL 2VLRD 4RISL 2IH1B 1FFOB 3ETBF 3SQOH 4JRXE 2HMIC 5GJTL 3NVQA 1TJGL 2NY2C 2HMID 2P8LB 1E4KA 2NY2D 1YDPA 1QBMH 3V6ZB 5C86A 3AS2A 4NN7B 4DGYH 2UY6A 4CU8A 1KPVB 4H1LB 1H15A 1DVFA 1JMXA 4P59H 3UTSA 3BEVB 1CDUA 2J1KA 4MA1B 1PZ5A 5AWNH 1U36A 2NY5H 3S34L 1QSEA 2FGWL 2GFBA 2ID5A 1MLBA 3OAYK 2ATKB 3N1QC 1PKQB 1T2XA 5D8JL 1R3LA 1WAAF 3QDJE 1KTDA 3OKOB 1VKXA 4OD3H 1MFDL 1YYMH 1VENA 3IDYC 2ORBL 4G42B 2Y07H 2YSSB 1IT9H 4KUCD 1YN7B 4Y5VA 5D2NA 3LAFA 3VDAA 3BWAB 1CFQA 1F6LL 4KAQH 4UT7H 2A38A 3DJ9A 4TSCH 1U8HB 4EI5C 5D1ZB 1H8SA 2WWKT 3O11B 3WIFB 5E4EC 5IW1B 4EI5D 3VFMB 1AC0A 1OAQH 1PYWA 2DWDA 3O3EA 5IIEA 5LWYL 3L5WA 2A73B 2XZCH 5DSCA 1U8QB 1UM5H 1MLCA 3ZYIA 1DEEA 1HN1A 4POZC 3REWB 4ZTPL 3VXPA 2XI9A 4MMZC 2D4DA 4YR6A 1PG7W 3J7HA 4POZD 4KHTH 5EZJB 2APWA 1MELA 3MOAH 4QTHB 3B5TA 4JZJA 5IVXE 1QFPA 1RFDL 2Z9TA 1I7TA 2SEBA 3HE6B 4TUJA 1WT5C 1JFQL 4U6XA 3BP5B 4EEEA 3MCKA 4KROC 5LVEA 2Q7YA 1YN6B 1M7IA 3X3GH 1J1OL 4C83A 4ELMB 2ESVE 4KROD 4OF6A 1V8HA 1E27B 4ZFOA 3UYPA 5I1AA 4NQDE 4QRSA 5E99H 5F1NA 2XTJE 4F7TA 4H8WH 5T33H 3ZHDA 5C70A 3STZB 2HJFB 1U3HA 3TGXA 3DGGB 3VFRB 2A77H 5A2FA 3BN9C 4PPTA 1Q8MA 3O3DA 5DJXA 4UDUB 3BN9D 4OCWL 1G9ML 3PWUB 3V6FA 4N5EC 4G9DA 5I1IH 4OM0H 3VGDA 1D3CA 4HX1A 1VFUA 3KS0J 4BZ1H 2P5WD 3IDMB 5BS0A 4N5ED 4PJ7A 1LK2B 3KLAB 2C26A 5BJTA 4JJ5B 1J8HD 2XKSA 5J1AB 5A2IH 1BQHA 3DV4B 3PWPE 5C6PB 4Q9CA 1KIQB 1WTGT 4APQC 5B39A 3H42L 2PCPB 1IM9A 5IF0B 1OTUC 2F5AL 4APQD 4HS3A 4P4RA 1BD2A 1FNEB 5EU6E 2AJUL 5SX5K 1OCWH 1OTUD 3FFCD 4HSQA 5HY9A 1U91B 1QRND 3B2UC 4AH2B 1GOGA 3L3OA 5EBMA 3NIDE 3I6LE 3B2UD 4HT1L 3U36A 4F15B 4HDIB 3TLRA 3FAWA 4UZGA 2R1YB 2W9EL 4I3SL 3U7WH 3KJ6H 1EAJA 2WINA 3BZDA 1G9MC 5FO8B 1CXKA 1X5FA 4GFTB 3QWRD 1GAFH 3VXQA 3HMWL 4PBXA 1X5AA 3NPSC 4XXDB 1JZ8A 3T2NH 1I1AA 4O2EB 5FDWB 4BK5A 1RUQL 4UAOB 2MPAL 2VDQH 1RQ5A 5L2KD 3LKQB 1IAKB 4N0RA 5L7XH 4QLRA 4JFPB 5EOTA 5B38A 2IMMA 2RFXB 2WP3T 4ESKA 4OZIE 4NT6A 1F4YL 3T65A 3F6IA 3MX0A 4QWWC 2VDRL 4HLZH 4QWWD 4NO0A 2PYEB 1QSZA 5E6IA 4DN4L 1EO5A 3BW9A 3SCMC 5C0EB 1UYWL 1XIWA 4JQVC 1UVQA 3SCMD 2H8PB 4MNQB 5CEZH 1C12A 4R90H 5DJ8B 1HHHB 4OKVB 1TETL 4TQEL 3U0TA 1WUNT 1YY8A 3O9WC 5J3HC 1GOFA 5D7JA 5I8CB 4FMKA 4RGOL 2DL9A 5J3HD 1IQDA 1U92B 4NQCB 3FN0L 4ODBD 2V5MA 4F7MA 4XI5C 4HWEL 3VI4F 4KDVA 3D18A 2BERA 3VXRD 1PG7H 1FO0H 4AIOA 1T1WA 4XI5D 3FT2B 3MRKB 3UZQA 2DQGH 4CNIA 2R15A 4HEPG 4AIZA 1UB5B 2UWEB 4O58H 3SGJA 4NYLA 4FQIH 2QHRH 2DDQH 1KIRA 1MCCA 4L3EA 3EOBB 2AK4B 2GQHA 3KYMB 4HV8B 2HTKC 5HHOA 4OLUL 5ELIA 4WCYL 2HTKD 1NBZB 3HPJB 3VE0B 3FTGA 4D0BB 4DJMA 2VE6B 3BN3B 1A9EB 4XVJH 5I19H 4ODSH 1SYVB 3F5WA 1T2QL 3Q48A 3QZWA 3O3UN 4ZFGL 4U1KB 4ZYKA 1NFKA 5EUOA 3LH2H 1MHPH 1DSFH 1UACL 2BCKA 3EYUL 4LBEA 4JRXA 3V0WH 3JUZA 3T4AB 5D70H 3C6LA 4ZTOL 2E7BA 1DBKH 1W72L 4ZUSB 5TPWH 2D31A 3QWOA 1J7VR 3MFFB 4G6KL 3D85D 2CDEA 3MMEA 3DMMB 5E94A 3KDMB 4YZFF 5ID0A 1CZ8H 4HIHB 1BZ9B 5T1LA 3X11A 5GJSL 3JWOL 1TMCB 1HHKB 4UIKL 4X6BA 3ULUE 4HBQA 1QLRB 4XVSH 2VITA 5BV7H 1YNTA 4YHOH 3LY6A 4YHLH 1JV5B 3GSVB 4LSRH 3VXUD 3BD5A 1S7QA 3VW3H 4QXUH 5I8EB 4XPBL 5IHZB 3QDJA 5DZLA 1TVHB 3QXAA 3OR7B 4NZUH 1I9IL 2VMFA 4IIQC 1JF5A 5DJAB 5DVOA 1GC1H 1HEZB 3CJJA 5T3ZL 1MPAL 1NFIB 5C2BL 1JIBA 1TPXB 2XZZA 4QY8A 3VFTA 2W9LA 4J3UA 3QFJD 4RRPA 5ID1B 4CVZA 4F57H 1CK0H 1T66C 1TZGL 2ZUSA 1HZHL 3MODL 4E41E 2AV1B 3FO1B 3RDTC 1T66D 1E28A 2AJSL 2JB5L 1W2KT 3X12A 3RDTD 4CJ1A 4JAMA 4ZUWB 3JWOC 1MI5A 1EJOL 1QLEL 5LQBH 4XXCC 3ARQA 1U8PA 3HZKA 3E6FB 1Q9KB 1IL1A 3TIDB 5IWLC 3GSNL 4HH9B 3DXAB 1H9VA 3N85L 2ZCKL 1A1NA 3OAYH 4LHUG 4FTVD 3V4UH 4DUVA 4NJ9H 3BFOA 4IDLA 1YECL 3GMOA 5K59E 3WXWH 4BSWA 4F2MB 3OQ3B 1G9EA 1AE6L 1PQZB 3MRRA 4YHNA 5ETUA 3TZVB 5C9JA 3I9GH 4R96A 2W0FB 5T3ZD 4ETQA 4KRPC 4X8XA 1BM3L 4KRPD 4J4PA 1LGVA 3O6LL 3KWWB 4K7PY 4FABL 5D1QC 2P43B 5D96C 3W0WE 5D1QD 3QYCA 3IDNA 5I0DA 1SBSH 1EHXA 4Y4KC 4YC2C 4LEOA 3O45A 1IC1A 4NQDA 4Y4KD 1X4ZA 4XX1E 1I8KA 1ZTXL 4XWGH 3BOVA 4JANA 5TE6L 2F15A 4NM8L 5FEBA 5TH2B 4GRWE 1MAKA 4U2YA 4HKBA 2LAGB 3GBLA 3QPXH 4YK4C 4A6YL 5FHBH 1XFPA 3BJ91 2VLKD 1FE8H 2MHAA 2FCBA 3FQWA 4NN5C 5FA3B 3NTCH 3O4OB 2CKBH 3QJFB 4N0FB 3S36H 5CP7B 3P77B 1R5WB 1FLTX 4I8DA 1NCWL 5C08B 5C0FA 2PXYB 3GRWH 2BOCA 4ZAKC 2XOTA 3QEQE 4FZEL 5T1MB 4ZAKD 1B0RB 5A3IC 3VDCA 3V52H 4PRIA 3MLYH 4IBLT 3RPIA 2CSPA 1P5VA 4Y7MA 2NXZC 1FCCA 4PLNC 4GS7B 2AVGA 2NXZD 1ZT1A 3WXVL 1PX3A 3G04A 3IETB 4LPCA 5I8OL 4NHCL 5E5MA 4DVRL 2CPCA 1JVKA 2DTSA 2UZIL 5GGSB 3LEVH 3W82A 2QSTA 4JO2L 4R0LB 5CWSA 1MCQA 4ISVB 1S5IH 2ZG3A 1ADQH 3FO2B 4EN3A 4MD4A 3CUPA 5EU5B 1FL5A 3T0EB 3IU3B 3NCFB 4F7EA 2DM4A 5KSAA 3H3PH 2RCSL 2P5WE 4JPWL 4GG6B 4D0DA 3QAZB 4OZIA 5DFWH 1YEEH 1FAIL 1J8HE 5E2TL 4P5KA 3CZJA 1CF8H 1L0XA 2DLGA 3EJJX 3K80A 3KPMB 2YUWA 2A2QT 3LSOB 2E8YA 4YDJB 1MHEA 1G9NC 2ZUUA 5D2LE 2ZCHH 5FHAL 4OZ4B 3GSQA 4YPGB 4K3JH 3WLWC 4DUWA 1FQ9C 1ITCA 1S7UB 1JBJA 4I18B 3WLWD 3D39D 1Y6MR 3VD7A 5C0RH 1CLCA 3ARSA 3P4OA 4KK8C 5IMLA 1I4FA 4N0UB 4S1RH 4OLEA 2AEQH 4KK8D 5JLZB 1RZJL 3V5HB 3GNML 3T1FB 2PF6A 2BVPA 1NEUA 4WFEE 5C2UB 3WHXB 2IAND 5L8KB 2GAZB 2VDNL 3MACH 5FYKL 4WHCA 4CU7A 1WAAE 1JGUL 3ALPA 1BOGA 1HI6A 2VAAA 5DVLA 1AKJD 1JPST 4XH2A 1MJ7H 3FQXA 1DR9A 5E6YA 3KPRB 2G5BA 4GG8B 5CCKH 5TE7L 3BZFB 2XY2A 5F8RC 2MNUA 5C0CA 2Q8BL 4BH8A 1I85A 3MRPB 3UTZB 1WISA 1RZJC 4XP9L 3U9PL 1A7PH 3B2VL 5GRYA 5L6YL 4CVXB 3DX7A 4MNGE 4LGSB 3A6BH 1T03L 4I77H 1U3HD 1IKNA 4DK6A 1F13A 3OF6D 4RDQF 1R5IB 3GBMH 2R2HB 4YBQC 5FYKD 1A14H 3CVIL 3ZHKA 1JZ2A 1A9BA 4YBQD 5E9DA 2FJGA 1DBJL 4KHXH 3L3KB 3EYFA 2J8OA 4JREB 4F37K 4N8CH 4PJFB 4NOFA 2Q8AL 4TNVK 4XZUB 5F7DA 3Q6GH 5CFHA 2QHLA 3MXWH 1HNFA 4M7JL 1MSPA 5B4MC 1HOCA 2IC2A 1NCCL 1G1YA 1FVCB 3QCUL 1Q9WA 5SWZD 3D0LA 4XMKH 4QXTA 1A5FL 4NQXA 3HAEA 5HPOA 4Y5YC 4KRMB 1TCRA 3BPOC 1DJSA 5C0IB 5C6WH 3BGAA 1V3MA 3WUZA 2Q6WB 5IV2B 5J89A 2ICCA 5DR5H 1RZKH 4E41A 1JWMA 1KF9B 3LEXB 4R2GB 4LVNC 3IFOB 4JDVA 3UROR 3RZCA 3TBYB 5DJ0B 4U1IB 4RCAA 3FRUB 1WZ1L 1C16B 3CDGB 1T1YA 1T4KB 5EWIH 5I17A 2XV6B 4R26H 2VKWA 3LZFH 4LLQA 4Z77B 2C3GA 3BUTA 3PWLA 1JTOA 4P2QE 2IH3B 1QFWM 1EGJA 3EW3B 1UGNA 5D6DC 2VXUH 4Y5XC 1K8IB 2NW3B 4XAKD 4S2SA 4F7PB 3G08B 2EICA 2GJZB 5DHXB 1VGKA 4HC1A 1FFRA 1MCLA 4MJID 3LN5B 1KJ2A 1ZT4B 1VGEL 3I6KA 1XIWC 5CZVL 2HLAB 1XIWD 2B2XH 5ADOH 5DS8B 1KC5H 5IFJA 3MR9B 1IGCH 1DQJB 1EMTH 3W0WA 1K4CB 1BQHG 3OBAA 1J05A 3CFJA 3QRGH 2UY7A 4PJIF 1JNHB 4UT6L 3OKLB 1LNUA 1I3GH 2O5ZH 1K8DB 2R0ZL 4L3CB 5B39G 3ULUH 3V6OA 1U8LB 5C3TA 3RWDA 5E2UH 5EIIA 4XRCA 1FBIH 3E8UL 4Q0XH 2H32H 3V4PH 2VISB 1U3JA 5IB2B 5F7LB 5D7SH 5CBAB 2XWTA 4LU5L 4PGEB 5D5MB 1OP3K 1S9XB 3L3HB 3SGJC 2F5BL 1Q0YL 3CDCA 1JGDB 5DA0B 2V7NB 2GTZA 4L3ED 3T3MF 5C07E 5DYOB 1JYVA 5FCUL 4XVUC 4F33A 1TZIB 5IESH 4P57B 5LGHL 4UU9B 1BVZA 4E0RB 3VFUA 2VSDA 4XVUD 4AZ8A 1QFUL 2H3NB 4MX7A 3HG1D 3QEQA 1U8NB 1N8ZA 1RHFA 2AV7B 2MCPH 3CMGA 5B38G 1T7XA 3PV7A 4XAWL 3CGTA 3MJ6A 2R4RL 2UVFA 1B90A 3MLWH 2RBLA 3ZE2F 1D6EB 4AEIL 1XGUA 5TQ0H 5I6XC 3MZTA 2BC4A 4S10A 3ZTNL 4HJGB 1OB1B 3VA2C 3VGBA 5B8CA 2V9TA 3VI4E 1VACB 3G9AB 4I3RH 2VIRB 4L5FH 5K9OA 4PGBA 2XKNA 1UWGH 2GJ6D 3RU8H 2AJVH 3EO1B 1ZS8B 2UZXB 1Q72H 1RIHH 3PWVA 2X89A 2V7HB 3R0NA 5BZWA 2NY0C 1ES0B 1FN4B 2JIXB 1IARB 2NY0D 4LDLB 2VLJD 5LCVL 2WUCH 3T4YB 1CFSB 3GM0A 5D7KD 1KBGH 5EORL 4FFVC 5BW7C 3ARBB 5IJKA 1FRGH 4R97C 4FFVD 1CE6B 3OKNA 4GRWH 3EJZC 4RQQA 5D2LA 2X4PA 8CGTA 1OSZB 3EJZD 3MRIA 1SJHA 4PJAB 1I3RA 1IFHL 4ZXBB 2C3VA 1LMKA 3S34H 1XF3A 1K4DA 2FGWH 5JPMA 2VWEE 3GSUA 4YZFE 4Q9BA 4C54A 3FQNA 4PV9A 5DQJA 1AGBA 1INEL 3QZWG 5D8JH 4P5MB 3ME0A 1XGYL 4FFZL 2QV2A 3VJ6B 1NC2D 2EKSA 3RAJL 1HXYA 4L8CB 4KQ3L 2ORBH 4P4KA 2A74A 4GMTL 1EFXA 3L1OH 3BDYL 1AD0A 4KKNA 5E2VL 4JM4L 1IM3B 3RY5A 1WAAA 1QVOB 3TVMC 1G7MA 2X9XA 5TF1L 4HK0A 4OFIA 3IFPA 2OJEB 3TVMD 3G5YA 4Z5RA 2JB6A 1T5WB 4MWFA 4LCCB 4NZTL 1CFBA 2RJMA 3IXTB 4BKLA 4MJ5A 1HCFX 1ITBB 4M7LT 5LWYH 3LPGA 5J11C 3HZMB 4TUOA 4OIIL 3QDGB 2AP2A 2VL5B 3P4LA 3BIBX 2VQ1A 3IDIA 4LCUA 3IDJA 3J8F7 5BCAA 5CIPB 1WTLA 4QHMA 5DI8A 4WO4B 4ZTPH 2JK5A 4NHUB 1XH3B 5HGHB 1BZQK 3D39E 4M1DL 1BJMA 3DURB 4XCEA 3GHBH 2EDWA 5AAWA 4JRYE 3KPQA 4RRPG 4XP5L 3BGFC 1A6VH 4R7NB 5IJVB 2IFGA 3CMOL 2IAMC 3GB7B 1HH9A 1GXEA 4IM8A 5HGBB 2IAMD 3NCJL 2NZIA 2XN9A 1YMHA 2IQAA 1NGZA 2AJXL 1JWUB 5FGSA 3MUY1 2IANE 4BA8A 4QCIA 4ZSOB 3GMMA 2FRGP 5KS9F 4PJ9B 4UOJA 3L3JA 2C1OB 5EBLA 5ITFB 1AQDA 4NN6B 5HBBA 4C59B 1E4XI 4M5YL 1T89A 2P49B 3QNXA 3CSBA 1HHIB 1II4E 1EEZA 2X4NA 4LSVH 2PTTB 3IDXL 4OCWH 5JORA 1G9MH 4PRID 4YDVA 4EDXA 3JTSB 5KSBB 3IXAB 1MWAA 3O2WL 1OGAB 2GT9A 2VYRE 2OQJA 3SJVE 1MCPH 2FZ3A 3P9LB 3WN5A 2OZ4L 2VDOL 1AP2B 3QUXA 1JYNA 1AXTH 3F7YA 4MLSA 1YUHA 5F9JB 2XACC 2Z8WC 1G0DA 4OFVA 4YHIA 1DQDL 2VDKH 2F5AH 4MQ7B 3SO3C 3U9UB 2AJUH 1GCFA 4LPTA 2KDGA 1DEDA 4U6VL 4P2QA 5DLMH 5CEXB 4UV7L 4HT1H 1G6VK 4PB0L 3TN0B 3O4LB 2CIIB 4PV8A 2BNRD 2W9EH 2XQBL 4I3SH 4JO4L 5L88L 4H0GA 1A6TA 3CH8A 3OZ9L 4WDIB 5EBWA 5TE4L 4G7VL 2NX5D 3MBEB 3HMWH 3DBXA 2VRAA 1CL7L 4M93C 2Q86A 1U95A 2OP4L 3H9HA 5JQ6L 4U1MB 3CVHA 5EO9A 5ICZA 1GGIL 3QIUA 1ZEAL 4GKOA 2DYPA 1BBJA 2OTWB 1R3HB 4LMQE 1YJDL 3MRJA 3U0PA 3K4ZA 4HULB 1RUQH 1TZHA 2MPAH 3RTQB 3TC9A 1KJ3L 1MF2L 3MV7E 1P9MA 1JGEA 3EFFA 3NN8B 3HS0B 5ANMB 3IF1B 4DOHE 1F4YH 2DL2A 4GW1A 3GKWH 3DX9A 2VDRH 2D7OA 1S78C 1XF5B 1ZSDB 5A2JH 5JHLL 5DC9B 5DUPH 1S78D 3OB8A 4UV4L 1LEKB 3JVGA 3CFEB 5JHDD 3EZJB 3FB7A 3OJMB 2J5LC 5ACZB 4MDJA 4PS4L 4WI4A 1IMHC 1Q0XL 4FXGA 4TQEH 5HYJE 5C07A 2NPLX 3LEYL 4GSDL 1VADB 4O5LL 1YJDC 4LVOB 4OFPA 4YDIH 4RGOH 5JZ7C 2EC8A 2FB4H 4DVBA 5JZ7D 1ZT7B 2VZOA 3FN0H 3L7EA 3L3IB 4LP5A 5C0GB 1D9KB 1P4LA 3BPNB 4HWEH 3DRTA 2DIJA 8FABB 5DEGB 1EUUA 3ARVA 4C55A 3GGWA 4O2FA 5EO1A 3VGAC 2NTFA 1UQSA 2X4UA 4IJ3C 4Z78B 5I71C 4M48L 3L5IA 4OLUH 3IAPA 3EO9L 5FGRA 5FKPA 5B3NA 2X09A 1BMGA 1WBYB 3FB5B 1FC1A 1V3KA 3L3DB 4X80H 1T2QH 4K71C 2YZ8A 2Q76A 4ZFGH 4L9LB 1IEBB 1T7VA 5J06A 4U1LA 4HWBA 3GI8L 1T0MB 3GBNL 1NMAH 4NNYA 1CXFA 3SDXB 2AXFA 4JPKL 4ZTOH 1WFOA 3NFSL 3QUYC 2YD9A 1W72H 1CDIA 1FAKT 3STLB 2CK0L 4L4TE 2VKXA 3P4NA 3QUYD 1ORQA 3V5KA 1KB9J 1EXUA 2FLBT 3A67H 4ONFH 4U1HB 5DHYA 3WE6B 1KJ2L 4UNUA 1CGYA 3HG1E 1F4AA 3JWOH 4XPHL 4UIKH 2LVCA 1JWSA 4OLYL 1H3GA 2Z8VC 4HHAB 3ROOB 3W11D 1RMFL 4NN7C 5FCSH 5ICXB 3OB0H 4QOKB 5IKCB 3CLEL 5I75C 3VXMD 2FJFA 1I9IH 3AMLA 1RZ8B 5T3ZH 1MPAH 3H0TB 2GEEA 5C2BH 4PJ8C 1WFNA 2HJKA 4PJ8D 1JF1A 3PWJB 1HZHH 3MODH 1U8JB 4PJDB 1IC5H 2ZPKL 3QH3A 1BWMA 3QIBB 1F2QA 2JB5H 4DGIL 4PP2A 1JZ7A 1EJOH 5DJYA 2WIIB 5GXBB 3C8KB 4X0KB 3GSNH 5D1ZC 3RWEB 3N85H 4WNQB 2ZCKH 3C6SA 1T7YA 4I2XE 5D1ZD 4YFEA 3CK0L 1K2DA 3SBWA 4UOW0 1YECH 5F6IB 1EHLL 4QYOA 1ZHKB 2EE2A 3CD4A 3DVGB 12E8L 1SY6L 3SDCA 1AE6H 2Y36L 5GS1A 4BK4A 3HAEG 2R2EA 5FYLL 3UTQA 3QNZA 3VMPA 6CGTA 3BKJH 1BM3H 3TCLB 5IHUL 4UTAL 2Z93A 4JRYA 5DK2A 3UDWC 3O6LH 1BQLL 4OF0A 1NUDA 2ITCB 5JOFA 1RUML 2J8HA 3ARDB 3QDMB 2ADJA 1YEGH 3BMWA 4EVNB 1S9YB 3WDHA 3CSPA 3HE6C 2Y5TA 3IYLW 2IQ9L 3HE6D 3FONB 1NCDL 1S8DB 2UWEF 1XEDA 1ZTXH 4JQXA 4QRRB 3C5ZA 5TE6H 3QFDB 5EZIH 3N1GC 4NM8H 7CGTA 3RL1B 2PW1B 4PJIE 2G75B 1E6OL 4NCDA 2Z31B 1HILB 4RMWA 3F7PC 3ZYZA 1JUFA 4A6YH 3C8DA 4Z7WA 3MLXL 3SJVA 2M26A 2X44D 3P9MA 4N9GA 1F11B 5FYLD 3MLZL 1P7KB 1SVZA 4WW2A 3KVQA 1PZUB 3BEWB 5EZLB 1FZOA 4M3KB 2K1MA 2CMRL 1NCWH 3MRLB 2AEPL 2G60L 4Q74A 4RZCB 2NY3C 4DZ8A 4FZEH 3T3ME 2NY3D 5E03A 5HDBF 4XX1G 2A1WL 3MV9B 4YE4L 2OXHA 2BXZA 2CDFA 2RQ8A 1G9NH 3F65A 2GSIB 3EGSB 2R0WH 4I13B 3EYOB 4MXWH 4G8IB 5I8OH 5MEQA 1PG7X 4NHCH 1ACYH 4JFED 1FV1B 4OLVH 2FYYB 3BP7A 3ZE2E 5INCA 4OZHB 1PJ9A 4JO2H 5LAXB 4XNQB 2BVYA 3DX6B 3LQZA 1F4HA 2E7LA 2QEJA 3WS6A 3IDGA 4XWOC 1FFPA 4JO3L 4LCWD 4LF3B 3MV7A 1JHLL 4JPWH 4XWOD 3WIHA 4HFWB 2YD1A 3DO7A 1FAIH 2M2DA 2ZUTA 5E2TH 3VG9B 5SV4A 2YWZA 4JFDB 3RI5K 4LNRB 4EKXA 1R3IL 4X99A 2X4QA 1H3UA 1RZGB 3VGHA 3UBXB 4W6XB 3P4MB 3L7FB 2VDML 4QRUB 3HR5A 5HYJA 2K7QA 2PYED 5F7FA 1CFNB 4LHQB 1GGYA 1DBML 4LGPB 3VRJA 4LLUB 3D3VD 1W0WB 1ZLVH 3LKNA 1RZJH 4X8JA 3SKMA 3TH2T 3GNMH 3BT2H 1KELL 4KXZH 4NO5B 4IMKA 5BMFL 2VDNH 4IOIB 2VOTA 5FYKH 1PEWA 5F6HJ 4HS6A 5FOJA 3DSFL 3ZE0F 4Q6IB 2EO9A 4OCYL 2YD6A 4JEGB 4OB5L 1NDGB 3PGCB 5KZCB 3Q6FB 3DUSA 1I9EA 4I48A 5KOVC 4ZMAT 4QRPB 3UTTB 2A9NL 3RJQB 4X9BA 4YNYA 5TE7H 1KJVB 1T22B 1K5NA 1G7QB 1HHJB 2LU3A 2XN9D 4WEBL 2Q8BH 3Q3GB 3PL6A 2AK4D 5LGJB 2FBOJ 3TM6A 4L8SC 4XP9H 3U9PH 2GSGA 3B2VH 3ZKQD 5FF6A 5SWSE 4XCNB 5E2WL 5L6YH 1JNLL 5T5NF 5EFIB 1PX4A 3VMNA 1T03H 2X4RB 3OHXB 4OCXH 3WD5L 4R4NC 2XRAL 2EDYA 1P69B 4HKZA 3BYTA 4HUXA 1I8IA 4R4ND 2MSPA 4F7CA 3V0VA 2PO6B 4L4TA 2DKUA 3AROA 3ARUA 3K2UL 1AO7B 1HINL 5CSZB 4PREA 1JZ4A 1DBJH 2NMSA 2VZ1A 2Y7QA 3CVHL 1FNGB 2Y4SA 4ZFZB 1RZ7L 3G5VA 1NAKH 3BQUC 2Q8AH 5CZKA 5FYJE 4PGCB 5FUZL 3BQUD 4HH8A 4UUJA 3CZFB 1WBZB 4M7JH 3MV11 1MCBA 4MB3A 5H2BA 4S1QH 3O2VL 1AR2A 3QCUH 3TBTB 1S7VB 3MO1A 4G8FA 3RUGB 1OWRM 1INQB 1SMAA 4N8VB 5KS9E 1A5FH 4OIBA 2EDBA 1WWBX 1YMMB 1Z5LB 1IGTA 5HDQL 3QXTA 3TBSB 4FQHA 3VGEA 4CUCA 4FQCL 1DCLA 5HHMD 5FECB 3LKRB 2P46B 1WVZA 4GG6F 4OGAC 1WZ1H 1ZGLB 1A4JA 4ZUTB 4D9LH 4OGAD 5IW3A 4UDTB 2QQLL 4NZJA 4G3YL 5JW4N 4ZG1A 2DLFL 2CKNA 5DRXB 5IROA 3VGGA 1JHKL 3S36X 3GUTB 3FQUA 5MEPA 5D6CA 5SWQB 2OS7A 3MNVB 1VGEH 1H3XA 5CZVH 5AUMA 4NO2B 1OAZL 2HKFL 3BISA 1N6VA 1IE5A 4S1SL 3MV8B 1UJ3B 4JDTL 1P7QA 4PB9L 4UT6H 5F71A 4ZQKA 2R0ZH 1OWWA 1T7WA 3AREA 1F58L 4MGXA 1PKQE 4I9WE 3U46B 1H5BC 3E8UH 3W9DA 2H9GB 1QLFA 4FP8L 5DRZA 4G80A 4LU5H 3HA0A 4F58L 3SDAA 5FO9B 3QEGL 3S4SA 4B5EA 3HMXL 5MI0C 4GAGH 3V5DA 2F5BH 1RHHA 2WQRA 1Q0YH 1BQSA 1VB9A 5H37G 2X2YA 2NNAA 4GRMB 4NPYB 4P23A 5EA0L 1CDHA 3NZ8A 5FCUH 3CIQA 1CTNA 2VXSL 5IR1A 1BJ8A 2YA0A 5LGHH 1MVUA 4GQPH 1XF2A 5K93A 1QFUH 3UJJH 3WFDL 4NGHL 1F6AA 4GKSA 5T3XE 3NZHL 4XAWH 4GUPB 3WLBA 5CS7A 2CLVA 1PY4A 2H41A 5FGBC 1AHWB 1LDPL 4HIXH 1JGVL 4X7FC 3IS0X 4QHNA 4JFOB 3GJFA 3RIFF 2PXYC 4HXAL 4YXLL 3LVEA 5DJ6B 3ZTNH 5I15H 5HVHB 5EC2B 1QYGL 4XBEH 1I1YB 4PJFF 4KDTA 3PNWB 3VH8B 2BP3A 5ENWB 4JCMA 4P46C 4DAGL 4Z7VB 4CRPA 1HKLL 4P46D 1T0NB 3U7YH 4PRBB 1FG2B 4X98A 5M94B 5F7EL 1P1ZA 1CIUA 4L4JA 3ES6B 1LD9A 5EORH 1R6VA 4LPYA 2G2RB 4GJTB 1RIVH 3I75B 4ZD3L 4LSPL 1JZ6A 4TSBL 4Q6YA 2YRLA 3QAZC 2A6JA 4D9QD 1AGEA 3PDGA 3LRSA 1I1FA 1QSVA 4M6ML 1IFHH 1M6OB 4NSKA 4RMSA 1NGQL 3R06A 4DWHA 1NMBL 2F54B 3L6FB 5MP6L 1INEH 1UH3A 1UZ8B 3BH8A 2ED9A 4FFZH 4EI6B 4NRZA 4G9FA 1QFWL 2DQHL 4Y1AB 3RY6A 1BIIA 3RAJH 3Q5YA 4ZPVA 1MJJB 1D5MA 1YEIL 4GXUN 3R4DA 4ZS6C 5FXCH 5GSRB 3W39B 3A6CL 1MFEL 3BAEL 2QQNL 3I50H 4GMTH 4ZS6D 2P5EB 5E2VH 4JM4H 5GGRB 4ONGL 4WGVB 5TF1H 4LCIL 1I9JH 3GM8A 5C0AE 1LE5B 1AC6A 2Q1EA 5CAYB 3B9KA 2EC9T 1FIGL 5E7BA 3EAKA 5IM7B 4LPUA 5DK0B 1OTSC 3EOYG 3GO1L 1T1ZB 4X4YA 2HJLA 1MRFH 1OTSD 4UI2A 1IKFH 3UEZA 4OIIH 1OAYL 4BUHA 1UXWA 2OL3H 1HQRA 3T2PA 2BNQA 4JGMA 3I2CL 4GBXB 3MJ8A 2I9TA 5D5MF 4O4YL 4Z76A 5HYFA 2ZSWB 5SWSA 4BQ8A 3JTTA 3TBVB 3TO4C 3RWGB 5DD6B 3NAAL 3TO4D 2AXGA 5DEFB 2CDGA 4EUPH 1JHTA 5IK3A 2PYEE 2DM3A 4XP5H 4UB0H 2Y25A 1Z0NA 3B43A 3AU1A 3CMOH 4V1DE 1FG9C 3QO1A 5DTFB 1RVFH 4MNQE 1UZ6F 2AJXH 1RJLA 5FV1L 4J3OC 5I1CL 1CBVL 4ZS7H 3C5JA 4OF3A 4M5ZL 3RWCB 3TA3C 4YBLC 4WW1A 1S7WB 3TA3D 4NQCE 3TH3T 3RGVC 4K23H 2H32B 4M5YH 3WIHL 3MJ7A 4O2CA 3RGVD 3O8XA 1ZLUH 4ZDHA 1UCBL 3FO9A 3FB8A 3VFWA 4HZLA 3TBWB 2APBA 1J86A 2C4XA 1A6ZB 2UWEE 3O2WH 5JXEC 2OZ4H 2AK4E 2VDOH 5JXED 3DYPA 1JZ5A 3OKMB 4D8PA 2BRRH 3ILPA 1R24B 3TNNA 5MEOA 5TDNA 5I1DA 2YBRA 3TESA 5C09E 1TIUA 2VLRB 3KXFD 5IVZA 3NCBB 3HNSH 1U8OA 4YLQT 5HHXH 1HXMB 2CR3A 3ORJA 4JFHE 3ECBB 1CD0A 2ARJQ 2AJ3A 4U6VH 4U7MA 1X5KA 4NWTH 4UV7H 4J8RB 2H26B 3KLSA 4PB0H 4JZNB 3ULVL 4KDWA 5D1XB 4WTZA 2XQBH 1JPGA 1NCBL 1FFOA 2ENSA 2IH1A 4JO4H 3QXVA 2V17L 4X6FA 5L88H 5EO0B 3OZ9H 1QFWI 1GJIA 3RWIB 4XP1L 4PJAF 5TE4H 2Q3AA 1KT2B 5HDBE 1NUGA 2P8LA 3REVA 4FQJL 1CL7H 3O2DA 1I9RL 3V6ZA 2OP4H 2BMKA 3N1PC 1OP9A 1ZA3B 4U1JB 1WZLA 1GGIH 3DV6B 4HWZB 3PHOA 2O61B 1YJDH 4H1LA 1WSST 4NNPL 1KPUB 3EOTL 3BEVA 4K2UH 1KJ3H 4YJZL 1MF2H 1R3KB 4DZBB 4Y2DC 1N5AB 3IGAB 5TDPB 5I1KL 1CG9B 3IDYB 3QQ9C 4IRJA 4Y2DD 2ATKA 1PKQA 4FNLH 4EOWL 3QQ9D 2YPKB 3OKOA 4W6WB 3ULVC 5JHLH 4UV4H 4EI5B 3MRQB 3ULVD 5E4EB 1VA9A 4G42A 4Y8AA 1G7JB 3HN3A 5EU4A 1RURL 5KVDH 4X9GA 4PS4H 2XWJB 1FH5L 1Q0XH 1U8HA 1CDGA 4FQXC 3O11A 3WIFA 3D6GA 3LEYH 5IW1A 3VFMA 4UNVA 4KUZH 4FQXD 2CLRB 3T09A 1WWCA 2DOCA 4XC3L 4YO0B 3JWNC 4YFDB 3T04D 4CU6A 2X41A 4PJGE 1KB5H 2XZAL 1XCTB 4PRPE 3PQYA 1JN6B 4JQIL 3DXAE 2A73A 1H0DB 3IU4H 3K46A 1U8QA 4LMQI 3MGAA 2QR0B 4OFDA 1TJIH 1DN2A 2EDXA 4PIRF 5DUML 4JHZA 4JFQB 3BZEB 1ZHBB 1I3UA 1M05B 3REWA 2V9QA 5F9WB 1D5XB 4QHKI 1QUNA 1IQWL 4M48H 3LMJH 4LK4A 1IGFL 3BMVA 3CFBB 2J6EA 3K1KC 1UT9A 4LLMB 5EB9A 4I0PB 4U6YA 3ZE0E 5HGAB 1YN6A 3V8CA 2E27L 4PG2C 1OAXL 5ALBL 1U58B 2FX8L 1EZVX 3GBNH 4Y4FB 5DQDL 4RMUA 5KSBF 2P48B 3BRDA 1S7RA 4JPKH 5JO5B 4MSWB 1UXSB 3NFSH 3DGGA 1B6UA 1FYTA 4KKCC 2CK0H 3UPCA 1X5JA 5DJZB 5E8NB 4Y19B 4KKCD 3OX8A 4UDUA 2JIXD 3OPZL 2IG2L 4WUKL 5C0JB 3IDMA 2BHZA 2E7CA 3U0WL 7FABL 4PLJC 4XPHH 2X1OA 3EFDL 4YDKL 1QOKA 4NBYB 1A64A 4PLJD 4OLYH 4NKOA 1QRNB 3BKML 5J1AA 1F4WL 3DV4A 2W9DL 4PY7A 4PJHB 5L9DL 5C08E 5HYEA 3WFCL 5IF0A 4P3DB 4ZXBC 1FNEA 2E7HA 1RK0A 4TNWF 1GHFH 4ZXBD 4YHYC 3HUJB 1TQBC 2Y1VA 4YHML 5E1AB 1P84K 4JPIA 4HJ0C 1NJ9A 4TVPE 2FD6H 2R1YA 4J3VA 1SVCP 3NPSB 4HJ0D 1E6JH 5C0AA 2BVQB 3SE9L 1JPTH 3VFOB 1NBVL 5L2KB 4DGIH 2W60A 4JZOB 1V3LA 3L95A 1YPZF 4NZDA 4TN9A 3AY4A 2EIZB 3UMTA 4ZFFA 2OYPA 4I5BA 1A1MB 4XXDA 4RBPK 2HT4C 1NAML 3BH9B 4O2EA 4RDQG 2HT4D 1R3JB 5FDWA 4FQQA 3T0EE 4BUGA 3HZYA 3CK0H 1CDBA 1IAKA 5C0NC 4G8GD 1VCAA 4B53A 1EHLH 4GG6E 4JFPA 1RIUL 4D9QE 1SY6H 5C0ND 3SCMB 5I0ZA 2ICEB 3RWJB 5CD5C 1WC7B 3O3AB 4PTTB 1A6PA 5FYLH 5IHUH 2CJUH 5CD5D 4UTAH 3NCMA 4RA3A 3OKEB 4WO4C 2AQ2A 4OGYL 3MRCB 5C0EA 4V1DA 1RUMH 4WO4D 1WF5A 5KN5A 2BXYA 2QSCH 4MNQA 1NPUA 5F1SA 5DJ8A 5JNYB 3SGKA 5DC4B 2FECI 3VXRB 2LE9A 1N0LA 1C5DA 3BDXA 4XPAL 4RGNC 5ALCH 2OTUB 2IQ9H 4HUUA 1NCDH 4RGND 5I8CA 2X4OA 4LKCB 1PD6A 1NSNL 4N0UE 1U92A 3RNQA 4NQCA 4WJ5B 3C5SB 2R0LH 4KY1H 3T0BA 1E6OH 4PJ9C 3FT2A 1T6WA 4PJ9D 4NN6C 1GPOL 2ZCLL 3UJIH 1XGPB 4P2OC 1BBDH 4I0KA 2DJ4A 1X44A 3MLZH 2DQUL 1L7IL 2NW2B 4HS8H 4P2OD 3SN6N 1MUJB 1U93A 3UPRB 4HV8A 3E3QE 3MYJB 1Q9OA 3QHFL 5FOBA 3P0YL 1FL3B 3O6FA 2NLJB 1NBZA 3KPRE 3TPUA 3HPJA 2CMRH 5GGTL 4LHUB 4D0BA 5C09A 4LKXB 1NH6A 2G60H 1AGCB 3SDXF 4U1SB 4WFFE 1SYVA 3EDKA 3R1GL 5GGVY 3S37L 3EDEA 4U1KA 2YWYA 1P4BL 2FDBP 3D85B 5GZNC 2FBJL 4LQFH 2BHYA 5GZND 4AENA 2OMBA 4MAYC 3S4SG 3VFPA 3RIAF 4MAYD 4XP4L 4ZUSA 1FZKA 4KVNL 3MFFA 4JPVL 5I16A 2ZUXA 3DMMA 4XNZC 3VXUB 1CXLA 3V9FA 4HIHA 3VFVB 4LAQL 3B8YA 2AK1L 4EXKA 3OAZH 3MBEC 5DUBB 3EO0A 4PJFE 3RKDC 5BRZB 4IIQB 1QLRA 4JO3H 3MBED 3BZ4A 3W2DL 1JHLH 5F9DC 3RKDD 2VZ3A 1JV5A 3GSVA 4KI5F 1DLFL 3QFJB 5D7LA 1HH6A 1MQ8A 5I8KL 4KV5F 4XNUL 1W72B 1TVHA 1XGTB 4PJDF 3OR7A 1VSCA 4YHPA 4GOSA 3MXVL 4PRHB 3CFKA 4JN1L 3RDTB 4F3FB 2F53D 5ESVA 1R3IH 4OF5A 1I3VA 5ID1A 1RUPL 4KMTL 43C9B 2AV1A 3NCCB 3FO1A 1OGTA 3RVTC 4OI8A 1HYSC 4FTVB 1YYLL 4GMSH 3LRGA 3RVTD 4OBRA 1WCBA 1HYSD 4AYFA 1A7BA 1DBMH 1N59A 5F89B 3SKNB 1KIPB 4PJGA 3ELAT 3E6FA 3TIDA 4PRPA 1FNLA 5DXWA 1LO2L 1QSFB 4HH9A 3DXAA 2ED8A 3L9RB 3FFDB 3H7LA 1KELH 5H35B 2BNQD 5CGMA 3N1FC 5C6TL 1DN0B 4FOMA 4XPTH 3C08H 5CJOL 5D4QA 4NQEA 3ZDYE 3DSFH 1PQZA 3U7AA 1D9KC 1KLFA 4OCYH 3TZVA 5D1QB 4OB5H 2W0FA 1D9KD 4O9HH 3RHWF 4L4VD 3KPTA 3CXHK 1FFNA 2A9NH 3KPLB 4NDMA 4Y4KB 3VFGL 4DUXA 3WUWA 4YC2B 3DVFA 3KWWA 1SJEB 3GSNB 5E8DL 3IJHB 3HC4L 3QEUB 5HTSA 4W6YB 4G43B 3HFMH 4CVWA 1P4IH 1JK8A 1Z3GL 4WWID 4K9EL 5E2WH 2V2WA 4K3DL 3KG5A 3SO5A 3KHQA 5FM4A 1V7ML 2XRAH 4YK4B 5GIRB 4L9LC 2VLKB 2R1WB 5KSVB 4XB8A 4LSTL 5TH2A 1EIBA 5D5ME 4NN5B 3K2UH 1HINH 1PEZA 3ARWA 2Y06L 4NUJA 4K7PX 3KLHC 2VZSA 1LEIA 3MJ9A 1G6RL 3KLHD 4DGVH 3LV3B 3G5XB 5F96H 1AGDB 1DLHA 2DQEL 1NMCB 1RZ7H 2JJVA 2F58H 4ZAKB 4PRDA 3VFNA 1F3JB 3BKYH 3QJFA 3KHOA 5CP7A 1NANI 1WIUA 1R5WA 2APXA 1KEMH 2DS4A 1UZ6E 5C08A 2NXZB 3CDFA 4LVHC 2B1AH 2XWBB 3EIFA 4K9EC 4IS6B 1OD7A 4PRNB 3VD3A 1YDPB 4I4WA 3PABA 3V7AE 4QOKD 2CRIA 5HDQH 4RMVA 3V6BR 32C2A 1H15B 1DVFB 1H3PH 4HGKC 4RX4A 3STBA 1A0QH 1FSKB 2FO4B 4JLRB 4FQCH 4D9RE 4KI5C 3KYKL 5E8OB 1MAMH 4KI5D 1MLBB 5F7WC 4R0LA 4ISVA 1KTDB 2GHWB 2QQLH 1VKXB 3T0EA 4XC1L 1AGFB 2AKRB 1QZ1A 1JHKH 1ZVYA 1MNUL 1IC7L 3I3BA 4IRJD 4Y5VB 5D2NB 1OW0C 1W0VA 4H0HB 4BELD 5EIVA 2KKQA 5F6IC 1SJVA 3VCLA 1PYWB 1OAZH 3BDBA 2YD3A 2HKFH 4MB4A 4UILL 4U6HA 4AIXA 5KG9B 4OZ4A 3L5WB 5IBUG 1JF6A 4YPGA 5F7NC 1U8KB 4PJAE 4S1SH 3NA4A 1G1CA 4XPFH 4JDTH 1S7UA 5DSCB 4PB9H 3GKZA 1F8TL 4I18A 4RBPH 3BHBA 1MLCB 1W8OA 4MJ6A 1F58H 1NLDH 1N4XL 3ARDC 3VXPB 3MZGB 4N0UA 3ARDD 3NA9L 5JLZA 5FM5O 1OHQA 3B6SA 4FP8H 3T1FA 3SGDI 1AKJB 1FVEB 4JZJB 4F58H 3WHXA 5BO1H 3HMXH 2GAZA 4WTZG 1E0OB 3X13B 3LIZH 3ARFC 3LKPB 3KYAA 5F9AC 5IMOA 3P11L 3HCVA 3ARFD 5EZOH 4U6XB 4HFUL 1V3JA 4ELKA 4QRRD 5EA0H 3IRPX 2Q7YB 1QQDA 2B5IC 2Z31C 3Q0HA 4C83B 2VXSH 4UBDC 1MCOL 4WFGE 2Z31D 2VZTA 5I1AB 4UBDD 3KPRA 1A8JH 4H1LG 5CD3A 5F1NB 4PUBL 4GG8A 3TT1L 3ARRA 3SE3A 3WFDH 4U1GC 2O5XL 4NM4H 3MNWA 4EQ2A 1U3HB 3QDGE 4A2MA 3NZHH 3RRQA 4P2RD 3MRPA 1LDPH 4NC1E 1JGVH 1GGUA 1KCUL 1SHMA 3V6FB 5KVEL 2Y6SC 2ZUWA 4YXLH 4LRIA 4J3SA 3T0DA 2Y6SD 3OKDA 4WI9A 3QHZL 1QYGH 2ICWA 1AXSA 2C7UB 3P0GB 1X4XA 2BVUA 3H9SD 4UIMA 3DTXA 5CEYB 3UYOD 1U8MA 1OQOA 4MZ3A 2FHCA 4DAGH 5DT1L 35C8L 3L3KA 1HKLH 4HS3B 1BD2B 1L7TH 2LV4A 4ZSOE 5SWZB 4QT5A 3DRQB 3RUGF 5C0BD 4XZUA 5EBMB 4LAJH 5F7EH 1J18A 2QLVB 1IILE 4Y5YB 3WJLC 3BPOB 5EBGA 1S9WA 1SQ2N 4LDEB 4JM2A 1MHHA 1NCNA 4YWGL 4ZD3H 3S96A 1FFQA 3PXJA 4LVNB 1I8LA 3SDYL 1KEGL 1UWXH 5C0IA 5DWUL 1OGAE 4Z7OF 4WV1C 5C7XL 2Q6WA 4AEHL 3T0XA 4ALAL 4XNXL 4QTIL 1I1AB 2V5YA 4M6MH 4OCSH 4ZOBA 4L1HA 3LEXA 4CDHA 3KYOB 3DOSA 1NGQH 1B3JA 2Y9RT 4JFDD 1NMBH 5DJ0A 5EOCL 4J3XA 2EE9A 3UC0L 5MP6H 4FQPA 1C16A 3QUML 4NT6B 1MCDA 3T65B 5HYQB 2VUYA 1QFWH 1T4KA 1X5GA 4Y5XB 2W38A 1YEIH 4MJIB 3A6CH 1FL6B 4NO0B 2AERT 5HPMA 3BAEH 3GJFK 1BREA 1B0WA 2QQNH 2IH3A 2D7QA 2X70B 3BW9B 3O4LE 1KLGA 4KRLB 4YXKL 1XIWB 2YZ1A 3BE1H 1K8IA 3DI2B 4LCIH 1NDMA 1UVQB 5IT2L 1KN4L 1FIGH 2GJZA 4OM1L 1QPPA 1MHCB 3LN5A 1G84A 1JPSL 2L4OA 3GO1H 1MIML 1YY8B 4V2CB 1PLGL 2WBJC 4K94C 4JVUA 5D7JB 4YHZH 2WBJD 3MR9A 4Q6IC 1IGJB 1OAYH 1LO4L 5F1OB 4QRTB 3T2QA 1PVHA 4F7MB 5TF0A 3I2CH 1YPZE 2CRMA 3BIKB 1JNHA 4CNIB 1K8DA 1S7SB 4ODXA 3UTTD 5ANME 2YPLA 4AIZB 3NAAH 1LP9F 1KIRB 4L3EB 3THML 4OT1L 4YX2L 4JG0L 4QRQB 5CBAA 3CXDL 4LRNL 3FT3A 1S9XA 1OP5K 3FTGB 2A6IA 2B0SH 4DQOL 1JGDA 2E6PA 1OLZA 4M61B 3QZWB 4FMFA 5ISZD 4YEFA 4X4XA 5DYOA 4LASH 2FIKA 1PSKL 1TZIA 4XT1C 5GRXG 4P57A 4E0RA 5E08L 2BCKB 1QNZH 4OLZL 4JFXB 4LBEB 4JRXB 3C6LB 1U8NA 1UCBH 2AJZB 3GK8L 5AG8A 4OUUB 2AV7A 3T8XB 1XR9B 2D31B 3QWOB 2GJ6B 5FUOH 3ALWA 3L3GA 5E94B 1DQML 1QBAA 2PTVA 1RULH 1ZA6B 2EDRA 1DBAH 2JELL 3K81A 4HKJB 4BFIB 4EXPX 3QP3A 1OPGL 2ZJSH 3X11B 2CH8A 4Z7VF 4YGAB 1OB1A 2GK2A 4OZFA 4BZYA 1VACA 4N90D 2VIRA 4PG9A 4Z8FL 2VLJB 2X4TA 1A2YA 4JDZA 3ZT7A 2VXVL 2YXMA 1ETZB 1S7QB 1BX2A 5FA4A 1OTTC 1Z9OA 1S7TB 2EC9U 1OTTD 2PUQT 3AS3A 4LSQH 4Y2OA 2V7HA 1M7XA 1ES0A 5J12C 1FN4A 3QUZA 1NGPL 3UYRL 3UZVB 2IGFL 3ABZA 4X7SH 3ULVH 1OARH 4R4FL 3T4YA 4AK1A 1CFSA 1NCBH 2V17H 5CP3A 5D7LD 5IB3B 3ARBA 1A7RL 4PGJA 2WBKA 2XKUA 3TJEL 3X12B 1NGXA 4JAMB 1CE6A 3GMLA 5ESAA 1MI5B 3FZUC 4ZUVB 3WNOA 1IL1B 4NNPH 3FZUD 1OSZA 2BZDA 3EOTH 1NC2B 4PJAA 1LO5A 1A1NB 4ZODA 4OV6F 1RAMA 5TGBB 5HVFB 5JUEH 3GMOB 2YOCA 5JXAH 4EOWH 3C60A 3MRRB 5ETUB 3L5HA 4NUGL 4X4ME 3TVMB 5C9JB 1UJ3C 4R96B 4IRSC 5DMKB 2A6DA 4IRSD 4WTWA 1RURH 3MLSL 2J3SA 4XMLL 4GKNA 5F8QC 4KV5E 1QVOA 1FH5H 3P30L 4NQED 3WKMH 4PJDE 1T04B 4FZ8L 2OJEA 1H3WM 3O6KL 5J11B 1YY9C 3BUYA 1AY1L 1AQKL 1LO0L 2OJZH 1YY9D 1OT2A 4XC3H 4LEOB 4LCCA 4X7TA 4JQIH 1RZFL 4LSUL 2CR6A 2YPVH 3QDGA 5J6GB 4LLYB 3S5LA 1S5HB 5DUMH 3JV6B 3DUUB 2D9QB 4OLWL 3U4EB 3BGFB 2Q7NA 3NMEA 2BHUA 4N9OB 5JR1L 2IAMB 3AS0A 4PP1C 1UKSA 4POUB 5HGHA 5IB4B 1G0XA 2MHAB 4OTXL 1IGFH 1MCKA 4PP1D 1AHWC 3DURA 1FNSH 3BKCL 2V5SA 5EU3B 3SKJL 4JKLA 1Q1JL 5HHQA 3QDME 5I30L 4QEGA 5DK3A 5HVHC 5HGBA 2CO6B 3CNKA 1IGYB 3ARGC 2DN7A 1T0PB 2EYSB 1AFVL 3BO8B 3BRFA 1OAXH 5ALBH 5CLWA 3ARGD 4PRIB 5DQDH 4F9LA 2WNGA 2FSEA 5ITFA 5LGKA 3ARPA 4YUEL 3B4NA 1ZT1B 4OQTH 1WJ3A 3G04B 2DLEA 2PTTA 5EU7C 1VEOA 3QXWA 2JJSA 2PN5A 3OPZH 2IG2H 4WUKH 3JTSA 5E0QA 4O02H 5D9SB 5CEZE 3U0WH 3IXAA 3QJHA 1OGAA 3ZTJG 5CWSB 2OR9L 2DMKA 3LQAL 3EFDH 5D71L 4EN3B 4MD4B 3BKMH 3LDBB 3SO3B 3WUWG 1F4WH 2W9DH 1CLYL 1HQ4A 1QEWB 1JI2A 4DKEH 5BXFB 2VUOA 4P5TA 5F9JA 5E8PA 4D0DB 3WFCH 3VWKC 4OZIB 2W92A 4MQ7A 1A3LL 3VWKD 5SX4H 2BX5A 1IEAA 2NX5B 2ADIA 2Z35A 5DZNA 5AD0B 3UP1A 3MV9E 4YHMH 5CEXA 1C08B 4CAGA 1QFOA 5HXMA 4N1CA 1KOAA 3JV0A 5CIPH 1WZKA 5SV3A 3O4LA 4AT6A 3U30C 4M93B 1CU4L 4HCRH 3S37X 1SBBA 4TYUA 5T5NG 3W9EA 2B4CL 4UOW1 3SGEH 4KUCF 3P4OB 3WS3B 2FX9L 2ZUQC 4U1MA 2P5ED 4M4RA 1NAMH 5IMLB 3CU1A 1L6ZA 4M7LL 1R3HA 4GRLA 2BVPB 3RTQA 4WUUD 2QSVA 1KYOK 1YPZA 2F8VA 2HH0L 1LILA 2KBGA 5JHDB 1RIUH 2EDTA 3NN8A 3HS0A 3IF1A 3FT4A 4FQ2L 4PJ5A 2EYTB 4IHOA 2RR3A 5FAAA 2CGRL 2J5LB 1XF5A 1ZSDA 4B7LA 4XH2B 3GIVA 2D0GA 1LEKA 2EE6A 2F19H 1BVLB 6FABL 3RBGA 3WSQH 4HKXB 4XP6L 3DETC 3FHAA 1MCEA 3U6RB 5ILTL 3DETD 5E7FA 5GSVA 1K6QL 4AM0B 5C0CB 1OVZA 4BH8B 1CYGA 1JZ3A 2VABA 1KCLA 4RAVB 4KTEL 1VADA 3MA9L 4OFYA 2WM0A 1NSNH 4OFKA 5JMRA 1CXHA 3LB6C 1HDMB 4U0RC 3VGAB 1ZT7A 3MRBB 3L3IA 4M6AA 3LB6D 2CUMA 1P84J 5C0GA 3OMZA 3GMRB 3B9DA 4F9PA 8FABA 1GIGH 5DEGA 2FEEL 1GPOH 2ZCLH 1A9BB 5E9DB 3WFHA 3WNLA 2DQUH 1L7IH 4Z78A 1EAPB 5DO2C 4K71B 3BSZH 3P0YH 3MRHB 5DO2D 4QRPE 3UTTE 1BGXL 3X3FL 5GGTH 5F7DB 1ZLSH 2XQYG 4WHYG 5J13B 2OBGA 4NNXA 1HOCB 4POYA 4OBSA 2R69L 3MRDA 1P4BH 1Q9WB 4MDIB 3QUYB 3D0LB 2FBJH 3AM8C 3MCLL 4JFFD 5T1KA 1TCRB 5FFLA 2VL4A 4HPOL 1HK6A 5FIEA 2GY5A 2BY3A 4C4KT 4HF5H 4XP4H 3RY4A 3STLA 4JM2D 4DN3H 4KVNH 3WO3B 3ZL4L 2CUHA 4JPVH 4JDVB 1AO7E 3RZCB 4RMQA 5D1XC 3ZT6A 4JKMA 3IKKA 4PJHF 4OD1L 4WEMB 5D1XD 3LN4B 1VFBB 4LAQH 4M9OA 1ORSB 3VXMB 1T1YB 2VQUA 4LLQB 2D03L 5I75B 3HNVL 2X1XR 3ROOA 4HHAA 5J7CC 3W2DH 3HUJF 1ZE3C 4R7DB 5GS2D 1T80A 1DLFH 4PJ8B 1UEYA 5ICXA 5JQHC 5IKCA 3KPOA 4G6MH 1D5BB 4XNUH 4G7YL 1GL4B 5HHVL 3MXVH 4JGJA 1VGKB 3RUGE 1RZ8A 2M1KA 3CSYA 4JN1H 1KJ2B 3H0TA 4F37F 1YMME 3MPCA 4NQUA 4HXBH 5B22A 4DCQB 4TNVF 5IFJB 1RUPH 3PWJA 3W0WB 3CFJB 3QIBA 3AVEA 2ICWI 2EDQA 4XMPL 4KTDL 4Z7OE 2QADC 5EIIB 4XRCB 3E2HB 1KLUA 1LO2H 5C71A 1KCSL 3RWEA 4PR5A 2YUZA 2QADD 4YAQA 1ZVSA 4WNQA 2XWTB 1HIML 4ORGA 5T5FH 5CJOH 1QA9B 1ZHKA 3VD9A 3DVGA 2I27N 1EZVY 2YPLD 3VWJC 2FWOA 2ZOLA 1VPOL 1F90L 2I5YL 3VWJD 4OAWA 2PW2B 2GTZB 3N0PB 1N26A 2V2XA 3NIFF 3WFEL 4U2ZA 3TCLA 5E5UB 3RKPA 3VFGH 2FEEI 1YEFL 3SY0B 4F33B 2OK0H 1GSMA 3VFUB 5F9WC 4D3CL 5E8DH 3QDMA 3HC4H 1KN2L 4MX7B 3IAGC 5DVNA 3QA3A 3CX5K 1GGBH 1T21B 3MV8E 1S9YA 3IB4A 1KCRL 2PYFB 1F42A 3QG7H 4I0PC 2HVJB 2BDNL 4RGMB 4K9EH 2ADFL 4OKDA 1MFNA 1NLBL 2OI9C 4I0PD 3PP4L 5LG1A 4BQCA 5DGRA 3FONA 1X5LA 3MRMB 1MJUL 1EK3A 2BC4B 1EERB 3QI9A 3RL1A 5KJRL 2PW1A 4KKLC 2G75A 3RJDA 4G6JL 2FH6A 2HRPL 5K9OB 4PGBB 3P3YA 4NRXB 3EYSL 2XKNB 2Y06H 3BD3A 4KKLD 4Y4FC 4F80A 1LE9B 3K3QA 4G6FB 4BZ2L 1NQBA 1G6RH 1QTYT 4Y4FD 4NQSA 1LP9E 4Y4HA 2DQEH 1F11A 2NY3B 4E5XA 5KSUA 1P7KA 2IBZY 1RUKL 4Y19D 2CD0A 2XXCB 1MRDH 4MCZA 3X14A 2ZP0T 1UENA 2FGZA 1DANT 2YS4A 3G6JB 3MRLA 4RZCA 3VGFA 2VLME 3NIGE 5GPRA 3S35X 1FO0A 3C09C 5K33A 1GZPB 4HK3J 3CDYA 4JFEB 4TTGA 3MV9A 1JE6A 4RNRB 5GRUL 2IADB 1LVEA 4ZO8A 2NZ9C 1TENA 4LIQL 4RQQB 1T83C 1N64L 5D2LB 3CXHJ 4OJFL 1NCTA 2X4PB 4LL9A 2NZ9D 1D5IH 2GSIA 3V4VL 1SJHB 3WL9B 3CFCH 4G8IA 2C3VB 2D0FA 1XF3B 4LCWB 3KYKH 4BH7B 3GSUB 1ZVHA 1AGBB 1A7OL 5LAXA 1KPRB 2N7AA 3D2UD 4XCCL 3ZHLA 2DI7A 2VR9A 5IB1B 3OWEA 4Z7VE 4R9HA 4XC1H 5MENE 1U2CA 2ERJC 4D94A 1HXYB 1BECA 5TFSL 1QHOA 4C56E 2P8PB 2QQKL 1AD0B 4XVTL 2EEDA 1JGLH 3UXFA 4UINL 1CVRA 4GLRI 2DICA 1RUAH 4M7KL 4EBQL 4Z5RB 1CGVA 1Y18B 5IHLB 3V7AG 4LNRA 1JPFB 2VNCA 3SE4C 3D3VB 1J12A 1RZGA 4OZFG 2BOBB 5AAMA 1X5ZA 3G5ZA 3UBXA 3D69B 4WGWB 3L7FA 4LCUB 2VQ1B 3IDIB 1F8TH 3OKYA 1K3ZA 4QHMB 5EOQL 4XCFL 2F54E 1N4XH 2YXFA 4H5SB 4UQ3A 2JK5B 3OAUL 1YC7A 1W0WA 4ONHB 3NA9H 4Y1AE 5MHSD 2XY1A 1X7QB 5GRWA 3UTPD 4KQ4L 4XCEB 3PP3H 4GT7A 2QL1A 3KPQB 1HNGA 3BRGC 4IOIA 1ZANL 4IEFB 3ZYJA 1HH9B 5K9KB 4HFUH 1BF2A 2XN9B 1YMHB 2IQAB 3KPSD 4JY4B 2NCMA 4MB5A 2DRUA 2Y23A 1NDGA 1QR1A 3PGCA 4QCIB 1IVLA 1MCOH 3NFNB 4QRPA 4L8SB 4YEEA 1KGCE 3TT1H 3QO0B 1AQDB 1G7LB 1KJVA 5I76B 2O5XH 2H2SC 1T22A 5DMGC 1G7QA 1HHJA 2H2SD 5LGJA 3FN3A 5DMGD 1BQUA 3S97C 3HI5L 2X4NB 1BJ1H 4XNMB 4HUVA 1KCUH 5JORB 1WBXA 4XCNA 2IJ0C 1NKOA 4FRWA 2FLRT 3GJEB 4LHUD 5EFIA 5J8OA 3JV4A 2FZ3B 3QHZH 1FVDB 5IHBA 2XZQL 1EX0A 3ZE1F 2PO6A 3F7YB 4L29B 4Z6AT 1ONQB 1AO7A 1YUHB 3BQUB 5CSZA 2XQYK 5F97E 2XIDA 35C8H 1J88A 4Y16A 1FNGA 4GAYB 3WJJA 4MS8C 3MA7B 2FHBA 1MH5B 2HFGL 3IFNL 4MS8D 3B3IA 3HE7C 4OCRL 1I75A 3HE7D 4CVUA 1A6TB 5CJQL 3S5LG 3VXSD 5EBWB 3TBTA 4YWGH 1F4XL 1F2XK 3RUGA 1GZQA 1INQA 4N8VA 1QR4A 3DBXB 4XGZB 5BRZD 5HHMB 3SDYH 1QBML 2EIBA 1YMMA 4NKDB 5BZDB 1P6AB 5DWUH 4AMKL 2R23B 4B50A 3ZKXC 5C7XH 4AEHH 1Z5LA 3CVHB 4WRLA 2E6JA 4ALAH 5ICZB 4KK9C 3FQRA 3QIUB 4K94H 3U0PB 4KK9D 4UT9L 1B4JL 1TNNA 2CKBA 4PRHD 2MWCA 3TBSA 5CMAA 5AWNL 1DE4A 1JGEB 1ND0A 5FECA 2VLRE 1TVBB 3EFFB 1ZGLA 3QUMH 4ZUTA 2R8SH 3GRWA 2DQFB 5CGTA 2IWGA 4UDTA 3M1BB 4A2LA 2X7LB 2ADGA 3AFLA 1MCRA 4NRYB 1WIPA 2VQTA 5I1HL 4YXKH 3FB7B 2ARJB 5IT2H 1KN4H 4KAQL 1N0XH 1J5OL 5CJXA 4OM1H 4TSCL 5SWQA 2RB8A 1QSFD 5C07B 1JPSH 2N1KA 5HJ3A 1MIMH 5IVXA 5IFAL 3VXTB 1P6FA 1OAQL 4HW6A 1ADQA 4DVBB 1H5BB 3L7EB 4K3EH 3NCYS 1OSPL 3S88L 4W4OA 3MV8A 1AJ7L 5JW3H 2ESVA 1CI5A 4CADA 4O2FB 5EO1B 3BXNA 4P0DA 5MI0B 1YQ2A 2NTFB 4JHAL 3MRGA 4CMHC 2H9GA 2X4UB 3THMH 4OQ1A 3DGCR 3VFSB 4JR9L 4Q97A 4JG0H 1NC4A 1N3NB 3FCTB 3CXDH 1PDKA 1N7MH 4LSSL 4ACPA 5FK9A 4DQOH 1LEGB 2K7PA 5DD1H 3PXHA 4I3GA 4QHLA 1LP9A 2LFGA 2WZPD 3KYNB 4URTB 4MNHB 2DQJL 4DKFH 1PSKH 3CAFA 3PWPA 2Q3ZA 5EPMB 5BOZG 1Q9LA 5E08H 4OLZH 2DQCH 2EXWC 3SDDA 4H8WL 3JBG7 1NMCC 3MREA 2G5RA 5FUCC 2EXWD 3TNMB 3GK8H 4X6EB 4GUPA 5EU6A 1EHAA 3P4NB 5F7HA 1ORQB 3O6MH 1EXUB 1DQMH 4UNTA 4OM0L 2JELH 4RMTA 4JFOA 4BZ1L 2V2TA 4X6DE 2R1XB 3MJGX 5IFHL 1CQYA 3LPWA 4KJQC 4X5LA 5DJ6A 2AABL 4P46B 5EC2A 1MRCL 4KJQD 1E4KC 4L9DA 1JWSB 3KLDA 3PNWA 3B5HA 2BY2A 1CS6A 1YZZA 3GMNB 3MUHL 1CXIA 1DVFC 5DJ2B 4Z7VA 2Z8SA 2FJFB 1FSKC 2QKIB 1SEBB 1DVFD 1T0NA 2DJUA 3UTSD 5MENA 2WIMA 1NGPH 1OCWL 2BVTA 2IGFH 2GTWA 4X9IA 5I1JH 1TJHH 4O51B 4U1NA 4C56A 4PJXB 5JW4M 1QSED 3SKOB 5SX5H 4Z0XB 2GCYA 3H2WA 3H3KA 2G2RA 1A7RH 1OQXA 4HMEA 4XTRC 3TJEH 3QCTL 1T1XB 2D7NA 2LABA 4XTRD 4Y5VC 5D2NC 3PIQA 3GSXA 2BVOB 2YUVA 1IZJA 3WDIA 3FFCE 2W07A 1QRNE 3C6SB 3GSWB 2VDQL 2MCG1 3MCG1 1BZ7B 3TO2B 3UJTL 1I8MA 5KTEH 1CE1L 4PJHE 3R8BB 3RVVC 2F54A 3L6FA 4ZO9A 4ZFOL 1C7SA 2X40A 3AXLB 4WWKA 5GHWL 4HBCH 3RVVD 3SDCB 1X6LA 2RAMA 4NUGH 5GS1B 4Y1AA 1CICA 2R2EB 1MJJA 3UTQB 3QNZB 3W39A 1B88A 5GSRA 3NCEB 4LLWB 1F3RB 3MLSH 2FR4B 5LBSL 3W5NA 1KSRA 5GGRA 4IMLB 3P30H 1LE5A 4M8VA 4FZ8H 3O6KH 4MA3A 1IAMA 4JZJC 5F1KC 1AQKH 4C58B 5L2KE 1LO0H 4RWHA 1B2WL 5AG9A 3RWHB 5DVKA 2Y5TB 4KK6C 5DK0A 1MFAH 1T1ZA 4KK6D 4R8WL 2ZZUT 1CIDA 3C5ZB 3TO4B 1RZFH 4LSUH 5DJCB 5JIKA 1HWGB 1UCTA 3P73B 4GBXA 2EDJA 5KVFH 1PG7L 1FO0L 3GSRB 5IVNA 4OLWH 2ZSWA 5I2IA 1F45A 2MTPA 2DLHA 4X7CC 3TBVA 5JR1H 3FKUS 4O58L 4Z7WB 1U3HC 3RNKA 3RWGA 5DD6A 3B5GA 3P9MB 5DEFA 2EDLA 5DC0A 4OTXH 4AY0A 2HVKB 4EJ1C 3BKCH 4WW2B 2EH8H 3MOBL 3C9NB 2CRZA 4LHJB 3OJDB 1OAUL 1Q1JH 5DTFA 5I30H 3TA3B 4YBLB 5BS0D 4ODSL 2VZUA 3RGVB 1AFVH 3NIFE 3VXRE 2BNUB 3CFDA 4MA7H 3DLQR 3SQBA 3IJSB 3RWCA 3SPVA 1DSFL 2CDFB 1S7WA 4YUEH 2H32A 1FJ1B 1JP5A 1IM9D 1PKOA 3AS1A 3ESVF 5TDOA 1BD2D 1AXIB 4J1UB 4KH2A 4KVCH 4MJ2A 1AD9B 3TBWA 4S0SD 1URLA 5GQBA 3E1F1 4NP4L 3KXFB 3BP7B 4B41A 1A6ZA 1OF2A 2OR9H 1FZMB 5EH1A 4WTXA 3LQZB 5D71H 4E42B 4LOUC 2JF1A 1BFOB 3OKMA 5F7MC 3IDGB 4LOUD 4LFHG 1QO3B 4XVSL 2N56A 5L0QC 4YHOL 4LSRL 3M07A 3VW3L 1I1AC 2P1YA 4HMCA 4QXUL 3KPNB 3HI1B 2KQMA 1I1AD 4MD0B 1OT1A 2IBBA 1GC1L 3GMQB 4J8RA 4H25A 4Y88A 5HVWA 4ERSL 5GGUB 4IRZL 1C5BL 2BSRB 2DMCA 4HLZG 1CU4H 4GXUM 3CC5A 4X99B 2X4QB 2C1PA 4MYWB 3RWIA 4RAHA 3MRFA 1KT2A 4CW1B 3HR5B 3RQ3A 1XZ0A 3L5XL 3F7RA 5E6IC 4NO0D 2HFFA 4XBPB 3VXUE 1DBBL 3LS5L 4Y2DB 5E6ID 1A7QL 1ZA3A 4U1JA 3VRJB 2VDPH 3DV6A 3GIZL 4HQQL 1NBYA 1FCGA 2O61A 4WI2A 4YFLI 2Q87A 1YEDB 2JJUA 2R29L 1W8NA 1FPTL 1ZV5A 2HH0H 4HWUA 4JHBA 2HLFC 3IGAA 5D7JC 5TDPA 1CG9A 4CN6A 3MTRA 3QFJE 1ZMYA 5F44A 2HLFD 4FQ2H 5D7JD 1U2HA 4AG4L 4YDLB 2CGRH 2YPKA 4UMGA 1NCUA 3MGOA 4PRHE 4MAUL 2X1WL 2YR3A 3WYRA 4EI5A 3MRQA 3FMGL 4FQXB 5IMMB 6FABH 3WFBL 3LQMA 5ERWA 3MGTB 4NO3B 5MERA 3S9DB 5ILTH 4TOYH 4GW4A 1INDH 3UO1L 1K6QH 1K5NB 1KXQE 3PL6B 4K3HA 4FTVE 3D0VB 4GW5A 5HHOD 4WIQA 1PAMA 4KTEH 4CN4A 3T0AA 2CLRA 2GSGB 3MA9H 4H88H 5H94B 4XHJC 2VC2L 4XHJD 5ACLA 1EA9C 2E9BA 3U1SH 5T3ZE 1JN6A 4HKZB 4HUXB 1I8IB 4FQ1L 4NFBA 2HN7A 5HDLA 3D9AL 3H7BB 3BZEA 4PREB 1ZHBA 3VDBA 1D5XA 2IFFL 4X6DA 3LD8B 1WT5A 2YN3A 3C6LC 3PG2A 2ZSVA 2KL6A 4P2YA 1N6QL 4NKMB 4JRXD 1CCZA 3C6LD 3ZMRA 3QHTC 2LTQB 3G5VB 2J8UB 3CFBA 5E8EA 1BGXH 3ESUF 3X3FH 5JOEA 1OY3B 2E7MA 2NQCA 3NACH 4HUWB 3UBXG 3S36L 4UUJB 1E4XL 4LEXL 1KNOB 2GK0B 4ZOAA 5T1LD 5IEHB 1CR9L 2R69H 5HGAA 3GRWL 2F74A 1Z9SA 4G8FB 1U58A 2BJML 3MLYL 4HPOH 2P5WA 4LCYA 2E8ZA 4K7FA 4RISH 2X4SB 2AXHA 1IGTB 3G6DL 1A6UL 5JO5A 2VLKE 5GJTH 1J8HA 4HAFA 5CUSL 3QDJD 1TJGH 4PJCB 3ZL4H 4FQHB 5D7IB 3RL2B 2IPKA 2ZNXA 1TFHA 2YC1B 5C0JA 4PD4J 4WENB 3N50A 4CGTA 4OZIF 4APQA 1S5IL 1ADQL 1IZKA 2D03H 3OGCA 3OXSB 3HNVH 3FFCA 5HGDB 3ZE1E 4NZRL 1QRNA 1BJ1J 5F1IB 2ZG2A 4ONOA 4YHYB 3H3PL 1TQBB 5DD5L 1MI5D 3FQUB 4G7YH 1RK1B 2YD7A 2QSQA 1GVIA 3PJSA 4P3DA 5D6CB 2P7TB 3QWRA 1MFDH 4DKAA 1U41A 4X5XA 2X9YA 1EUTA 3SOBL 3H6JA 1WQVT 2J88L 4K3JL 3VFOA 1S7XA 5L2KA 4J4PC 1TCMA 4G8GB 5C0RL 2LQRA 2EIZA 4KTDH 4J4PD 2I9LA 2OMNA 3BH9A 2AEQL 4HIEA 4GLRH 1NGWA 2XG5A 1WV7T 5DRZB 1N2RB 2BSTB 3S4SB 2ESVD 5CJ5A <