4F2MB

Crystal structure of a tgev coronavirus spike fragment in complex with the tgev neutralizing monoclonal antibody 1af10
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
213
structure length
213
Chain Sequence
DILLTQSPAILSVSPGERVSLSCRASQSIGTSIHWYQQRTNGSPRPLIKYASESISGIPSRFSGSGSGTDFTLNINSVESEDIADYFCQQTDSWPTTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural bases of coronavirus attachment to host aminopeptidase N and its inhibition by neutralizing antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Viral protein/immune system
molecule keywords monoclonal antibody 1AF10, heavy chain
total genus 44
structure length 213
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f2mB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f2mB01
3ZDZE 2FIKA 5K9OA 5J3HD 1E6OL 5BQ7B 3D1MC 3IFNL 3L3IA 4JCLA 4MJIB 2PYEE 5C07E 2IPTH 3F12A 4NOBA 2X4OA 5H94A 2VZOA 1SEBA 4XXDB 1N64H 2I07B 2FX8H 5JIHA 4NM8H 5KSAC 3KPNA 1CLYL 4QHLB 1AGDB 1XZ0A 2H1PL 4YHZH 5DXWA 4X7TB 5CZXC 2DIAA 3EYQD 4RA3A 1KT2A 2XA3A 1FDLH 4XBEL 2VLRB 3JWNC 4NJ9L 5FA4A 2AERT 4BZ1H 3FQRB 5BQ7A 3LAFA 3VRIB 3S88H 1NDGB 2VLKD 4XAKE 3VFGL 5SWQB 3SGKA 4PRHD 5IK3B 2XOTA 3CMOL 4OZFG 3CFEB 4GS7B 4HC1A 3RX7A 3WFHA 2QTEA 1IGML 5FHBH 1GRWA 5MERB 3V0VA 4WHTA 2VLKA 5GSVA 4BUGA 3LDBB 1K3IA 3AREC 1EEZA 4K3JL 2LU4A 3C6SB 2FEDD 3KPRD 1GGTA 5D7LD 1RK0A 5IMOA 4EDXB 3CFEA 3SGEI 1MCEA 4YHKL 2MOVA 1KOAA 4P3CH 4NQEA 5GHWH 4M7KL 1S9KC 3MBEB 1WIUA 2X4QB 1A7PH 2FD6L 3J8F7 4KKNA 5HDQL 4O2EA 5A2LH 1XCQA 1RV6X 3P4MB 5DI8B 2IEPA 3QUMB 1P53A 2YA2A 1F4XH 1FV1B 3TGXA 1F4WL 4GUPA 3LPWA 1G7MA 4JKMA 1EBPA 1WFOA 1FIGH 5IVOA 1FNFA 1OAXH 3EJYC 4LKCA 2XRAH 3VXNB 4DGVH 5HYJB 4X99A 3MMEB 4U0RC 4E5XB 3GGWA 4YUEH 1QP1A 4JFOB 4L4TB 5DVKA 5F6HJ 2HTLC 1K3ZA 4NKOA 4YHLL 1RURL 3QDGB 3EYVB 3AB0C 3NFNB 3T4AA 3L3IB 3TVMA 2PF6A 4MAYC 3IDXH 4CVXB 2XFXA 3TIDB 4OLVL 3D3VB 1PZUB 4X6DB 2F58L 1RZ8B 4P46A 3PWLB 5IBUB 1TNNA 5FCUL 2V9QA 3SGJC 5GJTH 3DGGA 4QRUB 2D7QA 3SKUD 1MFBH 3WKNA 2F74A 1JP5A 2JJUA 5SWZD 4OGAD 4RMRA 5LGJA 4LNRB 2WMPA 4LQFL 1P4LB 5EUKB 5GGTH 5C0BB 5JZ7D 5E00A 1TCMA 1NH6A 5EZIL 1MFCL 2B1AH 5DJ8B 2YXMA 1WTLA 1UEYA 3IFOB 4LARH 2JIXA 3WN5C 2CJUH 1DN0A 4UU9A 4JFFB 5C0RH 3IDMB 1IAKA 1CFQB 5H2BA 1GOGA 4KH2A 4KZDL 3LKRB 2BMKB 5BV7H 3LKSB 3NIGF 3OJVC 4L4VB 1QFHA 4BZYA 4I1NB 3SN6N 4M4PA 4OLZL 4PJ5B 4WFED 4K3GA 1MLBA 4K23L 4HFUL 3WIHA 4JKPH 4BZ2H 5IM7A 4PLOB 3DUUB 8FABA 4BSVA 1NC2B 3QXTA 5DHVH 4G7YL 4K3EL 3BYTA 2FR4B 3RTQD 3LQZA 5HHNB 1EHLH 4PJFA 1F90H 3F7PC 4L29B 5KZCD 4JM2C 1IGFL 3ZE0F 3BVNB 3O11A 4PJ8C 1XR9B 4Y2OA 2GSGB 1BVLA 3BP7A 3KPLB 4ONGH 4D0CB 2A0LD 1NCCH 1JHTA 2HRPH 5GS0L 2Y9RT 4KDTA 1UWGL 5FHBL 1LE9B 2AJZA 3B8SA 5J1AA 1DUYA 3L6FA 4KUZH 5FYKL 4OM1L 1A6PA 4PJCF 2NZ9C 5SWSB 3WFBL 3NZ8B 3ZE1F 3LH2L 4U1KB 1BGXL 4XZUA 4FQHB 1MIMH 2YN3A 1VFAB 5FECB 1ZHKB 4F7CA 1ADQH 1RVFH 4LSTH 4Z6AT 5LKNA 2I5YL 3GJFK 5EOQL 4H25B 5DMKA 3V0WL 2IPTL 2R2CA 1UB5B 3U2SA 2WINB 3JWDL 43CAB 5BJTA 1JHKH 3SQBA 3MV8D 1AO7D 4YDLB 5BW7A 5F9OL 1AC6A 4JAMA 2ADJB 5ISZD 1OM3L 5IHLB 3MRMA 2AP2A 2QSCH 2XTJB 4PJBE 4L9LB 3ULUE 3AREA 2R39A 2X4SB 4XZUB 5GIRB 3MLWL 5DR5H 2OQJB 4WI6A 3EKCA 3WL9A 2XPGB 4ELME 3LD8B 3PP4H 2AABL 2D0FA 5BS0B 1JBJA 1JHTB 1NCBH 4X9BA 5TF1H 5T5NF 1RZKC 1T5XB 4QWWC 4LEXL 5B4MC 1IGMH 4ZTOL 4QHUB 5IB1A 5TH2A 4Y7MA 1XR8A 2NY2C 3BKJH 4YX2H 2I9LA 4Y2DD 4GBXB 3QWOA 2HMID 1CLOH 4F33A 3UTZB 2E3VA 4IIQA 2VISB 1T2QH 4HKZB 4UOW1 4Y4KD 4ELKB 2DQCL 1IFHL 3O9WC 4XPTH 2WP3O 3MOBH 3SGEH 4TQEH 4APQC 4Y5XA 4WU7B 5F6IB 3GHEL 5SV4A 2DIBA 2MQ3A 2H1PH 4MZ2A 1K8IB 3VD3A 4FQQA 1CD9B 8FABB 1FH5H 5KN5B 3F7VB 1IZKA 4WDIB 2P45B 4FZ8H 4AQ1B 4EN3A 4QRPA 2GJJA 3VW3H 1HI6A 3NPZB 3NH7L 2D31A 3WCYA 3C6LC 4OD3L 4YJZL 3LKSA 4OT1H 3FL7A 3OJMB 4KRPC 4LVHC 5ICYA 4DN3H 5LBSH 4I3SH 2C3GA 4FXKB 4ZD3H 5C92A 4JFFA 3VXRA 3CMGA 1NBQA 1Q9KB 4KK8D 2YHGA 4CMHC 4R4BA 1MCPH 2DN7A 5DMJB 4PJXB 2GJ6D 3NCMA 2Z31D 4G8FB 1QFOA 3RVWC 4R9HA 2R69L 3JTTB 3JWDH 4ZSOA 1FAKT 2BVEA 2FBJL 2OM5A 3O8XB 3WXVH 4KI5D 2A6DB 5C08D 1MFEL 1UWEL 2R0LL 3R1GL 3EOAA 5C0CB 2DM2A 2E6PA 4I5BB 1NL0H 2O26U 4CVXA 2P5EA 4RMUA 4NM8L 4YDVB 3WJJC 3SY0B 1GGIH 2VH5H 1CDIA 1BIIB 7CGTA 1P4IL 3GMLB 4P4KB 5F97E 5TFSL 1LK3L 2DTSA 2UWEA 2HRLA 1TVHA 1ZLSL 4G6KH 1LGVA 4KQ3H 4PYHA 1ZKAA 4UBDC 1D5IL 4ZOCA 2CRIA 4HUVA 1T7VA 3D2UD 3N9GH 1JNLL 2AJ3A 1MOEA 2DLGA 4GT7A 4X6FB 4OCXH 3V2AR 5IIEB 3MODH 4BQ8A 2BP3A 1NCCL 1ORQA 1Q72L 2F54A 1KJVA 3R8QA 3D9AH 1PVHA 4KZEH 1D5BB 1I7UB 1MPAH 4P2QE 4WEUD 5CLWA 3TT3L 1CFSA 4MXWL 3DMMA 2FBOJ 4PRDB 4F2MA 1ONQB 4JPVH 1BBJA 2Z8VC 1IM9B 2HT4C 3S3SA 1BFSA 2WWMD 4KPHL 5I8EA 1N4XH 1IC7H 3BZ4B 4POZD 1AO7A 4YK4B 3GMNB 1Q0XL 2H32B 2XRAL 3FOMB 3RAJL 2ILLA 1XIWD 1EEYB 5IR1B 4NO3B 4ZPTB 3ALWA 4QHMA 1AO7B 2NY3B 1ZTXL 4JFPB 2F15A 4ZQKA 1U8MB 1XGRA 3ARGD 4I0PB 4U7KA 4X7TA 3CFCL 3T3PE 5CD3A 4ZOAA 3LKPB 4JQVA 5LAXA 1IARB 3MTRA 3MRCA 1PSKL 2J88L 5D8JH 1AD9B 1D5BA 2ZUYA 2NW2B 1KJVB 2AK4B 2J1KA 4M6NH 4X6EA 3OKEA 5BS0E 4LU5H 4G9DB 3O2DH 4N8VG 1OGAA 1R5WB 3W39B 2CQVA 2CUIA 1K85A 1OSZB 5D5MB 2F5AL 4UV4L 3BIAX 2OJEA 4X4MA 3KYOB 1BLNB 4BZ1L 1CN4A 1IAIM 4JZJB 5H37G 3RWGB 1J5OH 3L7FB 5FGBC 4RISL 1WK0A 5JW4N 1GIGH 2XZCL 3S37L 2R0KL 4PP1D 1BIIA 4XNQA 4LSDA 5IQ7L 1A6UL 1A9BA 2P5EB 1T7XA 4UIKL 1LP9A 3C08L 3EDFA 2DM7A 3U6RA 4I5BA 2X1XR 4JRYD 4K55A 4C4KT 3O9WA 3BW9A 5F7DA 3H9SE 1D9KA 1YJDL 3BPLB 1YN6A 4EUPG 4Z5RA 1JI1A 3MROA 2EKSB 2DL2A 2PW2B 5HGAA 3HC4L 3FOLA 2WLYA 1GH7A 2R29L 5HHQB 1MAML 3P4NB 2ATKA 3OR7B 3M8OL 2A83A 5DLMH 4DGIL 1XF2B 4Q7DA 3SQOL 3B9EA 1KCSH 2FO1A 2X4PB 4KTEL 2AEQL 1AHWB 3SDAC 5F3HB 4H26A 4OZIF 2VDQL 3T04D 5DFWH 2H6PB 4YO0B 4HWBH 5FYLL 5I30L 3OKLA 4GXUN 1U3YA 2W38A 4FFZL 1YYLH 3G9VA 4M1CD 3QIUD 2D4FA 1NJ9A 4HULB 1RUML 3KLSA 4MCYB 4QRPB 1CZ8H 1XGTB 4QRSA 4ODSH 1H3WM 5KN5A 2P1YA 3JV6B 5J9PA 1CGTA 3R4DA 1QFWH 4FQPA 3TF7C 2OXGA 2ZJSH 5J6GA 1KFAL 1OARL 4Z7UF 3TV3L 1RMFL 2AEPL 1JZ7A 5KSBB 3G5YB 3QFDB 1I85C 1H0DA 3GMPA 4XC3L 1S7SB 3MLTB 4IRJC 1HH9B 4JJ5B 4DK6A 1KIUA 2VWEC 5I1EH 4OAWA 2CR6A 1CS6A 1A4JB 2ESVD 1GGCH 1YZZA 4MLIA 2ZCHL 1NCWH 5TE4L 3TH4T 3AM8C 5E8NB 3MUY1 2BOCB 2VXSL 4I2XB 1NGYB 5I18H 2FJFB 1GC1C 4NBXB 5E7BA 2GCYA 3U7WH 1E4XL 4HJJH 2APTA 1RUPL 4G80A 3ARQA 3ULUL 5IEKA 4UUJA 1NCWL 4LGPB 3RWHA 3FTGB 5JPMB 1SQ2N 3OV6A 1I7RA 5GS0D 2QSTA 4NQCD 2FL5A 3FO1B 2OZ4L 2P5WB 3G04B 3QDJE 3SCMB 4ODTL 2FEEL 1VGEL 3BKMH 5ERWA 1JGEA 5FOBA 2YN5A 3DETD 1ETZB 3DMMC 1IGCL 4AIOA 2X1OA 4FNLL 1OP5K 4U6HB 2IQ9H 2BRQA 2FATL 2IMNA 1NGPL 2SEBB 3HNVL 1AGEB 4XTRC 4F7EA 4TULL 1ZEAH 5CEZE 5DHVA 1MNUL 4TSBL 3EO9L 3BKCL 3EOTL 4L3EA 4OZFH 3TBVA 3GIZL 3L3JB 3BSZH 2CPCA 3DX6B 3JV5A 1WZ1L 5E4EB 3EIFA 2APXA 4P5TA 1Q94A 4PJGB 4N1CA 2J2ZA 4F8TA 2W60A 3BH8A 1RU9L 1F58H 4YHIA 4IDLA 5I30H 3KJ4B 3QHZH 1PEWA 3LKOB 1PGRB 2UWEF 3FAWA 1A9EB 1QBMH 4PIRF 1A1MB 3UTPD 1R5VA 1RIUL 4ZXBB 3FN0H 1N59B 1W8NA 1ND0B 4MXQC 1D5XB 1BOGA 2CH8A 1C8PA 1CE1H 3CUPA 4I9WD 5HI3C 3DECA 3WLWC 1MI5B 1A7RL 5I1JL 2GSIB 1S7XA 5FB8A 1GGBH 1DL7L 4JO4L 1CXKA 1NDMB 1HINL 1HN1A 4LVHB 3WJLC 1LE5A 3O4LB 5TQ2L 5JIPA 2XZQH 1AI1L 4FQLL 1MCQA 1CL7I 1MIEL 5F6HI 4D8PB 3GK8H 4HH9B 4U1NA 4UIKH 5FDYA 3TBTA 1CBVH 4PJFB 2FYYA 4PYGA 5E8PB 4PRBB 5DHYA 1NEZB 3KPOB 2R0KH 4TVPE 5IJKA 2JB6B 1KEGH 3U4AA 1YNKL 4LLUA 4UZGA 7FABL 4IJ3B 3RBSA 5JHDD 1OD7A 3FFCA 1DQLL 3PDDA 2R1WB 4U49A 3ES6B 5E56A 1KBGH 3QIWC 4RAUB 3WS6C 4Y4HC 3PGFH 3O3DB 5E94B 3IRPX 4ZNCD 2BMKA 1K4DB 3K4DA 5DEGA 4XCNA 4MQ7B 4LGSB 3TN0C 1MJ8H 5D7JC 1E6JH 1Y6KR 5E00B 1B2WH 4YHPB 3V4UH 1UFUA 4W4OA 2EICA 2ZUQC 3NCYP 4NFBA 3N1GC 2Z92B 2ZNXA 5C0AE 5DUMH 2BY0A 1FL6B 5HPMA 2BERA 1JGLL 3CDGB 1U3HC 4HC1H 3VI4E 4JDVB 4TNVF 4RBPH 1M6OA 2K7PA 4P2RE 5C0JA 2XTJC 1JUFA 3KLAB 4Z7VB 1VEOA 1AH1A 1X4XA 4U1IB 1I1AC 1DDHB 4NN5B 4KHXL 1IGCH 1TNMA 4P4RA 2AV1B 4PJ7A 1A64A 2BCKA 1QG3A 4Z9KB 2VO5A 4FN0A 32C2B 3P73B 5HHPA 1A7RH 1YMHA 4ALAH 5I1JH 3C9NB 1KULA 1NCDL 2OTWA 5DJYA 4GAFB 2BHZA 4I48B 1MFAH 2ZPKL 3BH9A 4X7CC 1JZ6A 3VI3F 3P3YA 4JFDE 3T09A 3VH8B 4BKLB 5KANI 1R5IA 1R3HB 4JFEB 4CADA 2DQJL 3ARGA 4OD1L 3TT1L 3UAJC 3X12B 2A2QT 4NC2B 3HG1B 3KHQA 4Z76B 4OM0L 3PWPD 3L95A 1NGZA 4XCFL 5GGSA 4Y8DC 5C9KA 2PKDA 3E0GA 4PB9H 1CDHA 4RX4A 1NSNL 1PZ5A 3GSUB 1FAIL 5GSVB 4LCUA 1IC1A 3MLXH 3NA4A 3U48A 5DSCA 3WNKA 3SKOB 4NKMA 3QUYC 1L7TH 5JNYB 5D7IB 5GGUB 3O6LH 4M8QA 3HPJB 3REVA 3STBA 2CRZA 4G5ZL 4OLYH 4HGMA 5ADOL 1TJHH 5K59E 3KYNB 2X4NA 1F3JA 2HVKB 4G6ML 5I6XC 5ISZE 2EDJA 1MCPL 1H5BC 5DJXB 5HHOB 2F8XC 4PTUA 5DC9B 3C6LD 1ZVHA 4OCWL 2CDGB 5JA8B 1G9EA 1H3PH 3MLVL 4UOJA 4PRHA 1CK0H 5KVGH 4GKNA 3CZFA 4IHOA 3VWJA 5MENA 5JXEC 2AQ2A 3ILPA 4FZ8L 5CEXA 2A6KA 3OTTA 3LS4H 4LPVA 1PYWA 4PJHB 2GIYA 1R3IL 3TJHC 3ESVF 2OLDA 4JFHD 1J1PH 4M3JA 2AK1L 3V6FB 4OSUH 1MHPH 2QADB 1A5FL 3C5ZD 2WZPD 4UI2A 4HMDA 3OWEA 3QFJA 1IFHH 2QHLA 1UH3A 2HMIC 2BOBA 1G9ML 4Y4KC 4P9ML 4RMWA 4FG6D 2Y36H 5FV1L 5I1LA 4LPYA 4Y1AE 1SVZA 2Q7YB 4ETYA 3LEXB 2Z4QA 1UXSB 3ARBA 1E27A 1I9IH 3D39E 3PDGA 2G5BB 3SDDB 3RNQA 3KVQA 4PRHB 2O5ZH 2ZCLL 3V4VH 2YPVL 4WO4C 1T7ZA 3VWJD 4M4RA 3T2NL 4B7LA 5EA0H 4TOYH 5IT2L 3BI9X 2W0FA 1SYSB 2IFFL 2YRLA 3BGMA 4Z7WA 5KSAA 3VRJA 3BN3B 4ONFL 1WWAX 4PJ8D 4HEPG 4Q0XH 1EO8L 4WV1C 3ISWA 4EI5D 2QEJA 3DYOA 2UUDH 2R29H 5F89B 1YEFL 3SE3A 4FXGB 4MS8D 4YXLL 1E28A 4PUBL 4Y5YB 1J10A 4NSKA 3WLWD 1PG7W 3GB7B 4WWID 5IFAL 4X4ME 1DBAH 1X6NA 3ZKMC 1T1WB 3PE9A 3G6JB 5DSCB 4MJ2A 4MHHG 3QG6B 2I60H 5KSUA 1FJ1A 4ONOA 2Y1VA 3RVXC 1QKZH 3X14B 3EO1B 3F7YB 2YWYA 2YD4A 3GSWB 4XPBL 2EDBA 4DKDC 2YUZA 3QWQB 2VLLA 3NMEA 5F9JA 3QXVA 5KS9E 2EYRA 3U4BL 2O5XL 1F8TH 1BZ7A 2ATPB 2P5EE 2DD8L 4JVUA 3RJDA 5F7HA 3CVHB 2XN9D 1Q9LB 1WITA 2EDRA 1YNTB 4CADB 2DBLL 4NKIH 1U92A 1IEAB 3BIBX 3SO3C 5HHOD 1DL7H 1ZHNA 4H88H 4RFNC 3H9SD 1L9MA 2OTWB 4KJPD 4NQUA 5DJYB 1S9VA 3PWNB 5I2IB 5JPNB 1DE4A 1DCLA 5L0QB 3L1OH 4AEIL 5AEAA 2HWZL 4U2ZA 3FZUD 2F53B 2NY1C 1AO7E 4K71B 4HCRH 1EPFA 1KLFA 2E5EA 5ESAA 2Q86B 4M7JL 2VB5A 1OP3H 1F58L 1U91A 2BVOA 4PV9B 2NY0B 4KQ4H 2BJML 2F8OA 4TTGA 4K3DH 4MJ5B 1YY8B 3MUGA 4G8IA 4G7YH 4W70A 3GO1L 5GISH 5ALBH 3T0VA 2BY1A 1X5HA 2CDGA 4QRPE 3CJJA 5SX4H 4JVPA 1GGYA 1GZPA 4KHTL 3ARFB 3B3IA 5DMIL 1P7KA 2WUBH 1C7TA 2HN7A 1MUJB 3D85A 3WO3B 2FWOA 3QXDA 4Y16C 3V95A 1AHWC 4O58H 4YGVA 4TVPL 1CFVL 3B9VA 4KZEL 3PWVB 5T1LA 3D18A 4KXZI 4OI9A 4M43H 1FGNL 1HXYB 3MGAA 2V7HB 3E6HB 2WIMA 4A2MA 5LCVL 5DZLA 5AWNH 1MJ7L 1WZMA 3QUXC 1UT9A 3VI4F 1I1CA 4JQIL 4F37K 4PJ9B 4WU5B 4O5LH 4O5LL 4IOSD 4HKJA 4P48A 2VE6A 4Y4KB 5EOTA 1PZ5B 1DQQA 2NY0C 2D0GA 1NGZB 1IE5A 4X8JA 5CP3H 2V9RA 3IDXL 1WUNT 5MEOA 3E6FA 2OI9B 1KGCD 2R1YB 4RRPG 1DBML 3TA3B 4DFIA 1B4JL 5CJBA 1NUNB 1JE6A 3I6LD 1KUMA 1AGBA 3BN9C 4F37F 1CCZA 3BH9B 3R1GH 2W92A 4AIXA 3IDIA 4YUEL 3MCG1 3HI5H 4JG0H 2HJFA 1JN6B 2D7PA 4XNMA 3RZWA 5EIQA 3S35L 3MZTA 4LIQE 1UEMA 1VFOA 5IB3A 4OLXL 1I3UA 1A4KA 1BOGB 3ZT6A 4L8CA 1JCKA 1CF8L 2A6JB 4PBVC 1PLGH 2V7NB 5LBSL 1BREA 4DN3L 4I0PC 1G9NH 3RIFF 2C3WA 4Z7VA 1A3RL 1JUFB 3KLAA 2EDKA 4N1EA 2X7LB 4FFVD 4RFOL 1LMKA 4HT1H 5C6TL 3CDGA 2NQCA 3LIZH 2HN7B 3PL6D 5GSRA 4WFEE 1HHKA 1GZPB 3QO0A 2Z92A 2NY0D 2NY6B 3SDXE 1I7TA 1QSFD 4QNPE 2H26B 2FB4H 3T1FA 3X11A 1KB5L 4X83A 1T66C 5EDXA 3MRRA 4OQTA 4S1SL 1MCDA 2X09A 3QJFB 5FYJL 1ZSDA 2VR9A 2DLIA 5DYOA 1IGJB 4YDIH 2P5WA 3G04A 1JPTL 1I7RB 4S0SD 1M71A 2W65B 1QYGH 4S2SB 4RAUA 3BKJL 2CD0A 4IRZL 3OAYH 2CXKA 5JLZB 2EDHA 4WFHD 4G80B 3G5ZB 2DKMA 3QAZB 2D7TH 3WLBA 1F42A 3FRUB 4MYWB 1ZHNB 3F7QA 2F5AH 3IXTA 2VTFA 3S36H 1MRDH 5EOCJ 5EU4A 4D9RE 3C2SA 5HI5C 3MRNB 3PNWA 2Q6WB 1R3KA 3O4LA 1DQJA 5ESVB 4BSWB 1H0DB 1BD2E 4ZPVB 5DWUL 2FJHB 5MHSD 3M1BB 5EO1B 5TDPA 4HKBA 3FB7B 2YOCA 4N0UA 3BT2L 3QRGL 3G6JA 1T1WA 4RA0C 1CFTA 3MGOB 1D5XA 4PGJA 3W9DB 1XGPB 2XNAA 4GAYB 4S1DD 4EN3C 1G6RH 4RQQB 4J1UA 4MD0A 3NPSB 4PP2B 5J13B 1MFNA 4NPYA 3GRWA 4BH7B 4NCDA 2EE3A 1F2XK 4YHIB 1OHQA 1AQDA 4U1JA 3KPRA 1F45A 5C0NC 4KV5E 1IGIH 2Q3AA 3TYFB 2FB4L 2AK1H 1OW0A 1NLDH 5JOPE 1QLRA 4B41A 2GQHA 1RK1B 2HFGL 1CL7H 4U3HA 2EIZB 4MX7A 5HVFB 5DHVB 1ZXQA 1L0YA 4ZS7L 3SGDI 3DTXB 5SX5H 4CMMA 4X7SL 4NJAL 5I8OL 1NCAL 1FZJB 4M62L 3RWCB 4X4YA 1FGVL 4F15B 1DR9A 2HLAB 5DK3A 2ZCKH 4UILH 4JRXB 1C12A 1CTNA 3O9WB 2PNDA 1CQKA 1EDQA 1WAAA 4JM2A 3C5SA 3TA3D 3P9MA 4HV8A 2FJGB 3S36X 1OPGL 1LWRA 1S9WB 4UUJB 3ARPA 4HZAA 5D1QD 3BP5A 4Z7VE 3NFPB 3U30B 4AJ0A 2X9WA 3T65A 5KOVC 2DWDB 3O4LE 2FJFA 1DSFH 1WBZB 4WFGD 2B0SL 2ZKHH 5I1CL 4WTZG 3TBWA 5CEXB 5IB5A 1G7PA 4HLZG 3WHXA 1BZ9B 2XQYG 2X1QA 2WUBL 3GM8A 3V6OA 1AE6L 1R5WA 2PN5A 4NZDA 2BDNL 1CVSC 3L9RB 3H6JA 1FFPB 2R69H 2DWDA 3D3VD 4XHJD 3FQNA 2R9HC 4JO3L 5I1KL 1II4E 3CFIC 4KTYA 2R2BB 5IB2A 3BP5B 4PJBB 4PG2A 3C87A 4TUJA 1KCVH 2J8HA 2PCPB 3MRGA 2APFA 3FN3A 5C2UB 3C5SB 1VEPA 4M5YL 4P3CL 3UP1A 5GXBB 4U1HA 1FRGH 4JQIH 4OT1L 5ID0A 3PABB 5C07A 5GS3A 4EDWL 4R96B 4QHMB 1P1ZB 5CHNA 4LP4A 1U3HB 4WGVB 3NH7H 3MFGB 1F13A 3EUUA 4K3JH 2PYFB 4JPIA 5JNYA 2R23B 4HBCL 3KDMB 3OKLB 3UCRA 2X6MA 5C08A 4ZTPH 5TDNB 4MB4A 5FM5M 4LF3A 5EZJB 3SDXA 3QIBB 1UXWA 5D7JB 3D69B 1BBJB 2J3SA 3C8HA 1X7QA 3MJ6A 4ODHH 1J86A 1BZQK 5GGSB 6CGTA 3ARDD 3DMMD 1OAQL 4NQCE 5IG7B 1N7ML 3MJGX 1M7DB 1IC4L 4CN4A 2E9WA 1ORQB 4GXVH 4FP8H 2FH8A 3EYUH 3RDTC 1QBLH 2FX8L 1VFMA 3FQWB 4OKDA 5J56B 4I48A 5L9DH 3BOVA 3BUTA 4X6FA 2C5DC 1UJTA 1HHGB 2MTPA 4IRSA 4KMQA 3GBML 1E6JL 4UIMB 4BQBA 1T4KA 4XNQB 3MJ8A 1DEDA 1PJ9A 4NN7B 2BCKB 3T2QA 1JNJA 2XWJA 3GHBH 2UWEB 3NGBC 2X10A 4K3HA 1PQZA 4Y2DB 1XIWB 1IBGL 2I9TA 2NXZB 3J7HA 4BSWA 5AG9A 4E42A 5EC2B 3MRFB 4ZO7A 3X3GH 3W0WB 1UKQA 3EOAB 4MXVF 4I3RH 1P84J 2PTTA 1NCTA 2ITCA 2ZCLH 4EOWL 1KLUA 4J6RH 1FL6A 4J3VA 5HPMB 4N0CC 1V8HA 5DRXA 3S4SA 1BVKB 3NAAL 4P9HH 3IFLL 5FO9A 4G8GD 1A2YA 5I1HL 3VFSA 4BQCA 4M1DL 3AXLB 5GPRA 5JW3L 3KHOA 1M71B 2W65A 3CH8A 3GSVB 5ADPL 3MV01 1XGUB 3DROA 4XPHL 3QYCA 4NCC2 4XP4H 1S7UA 5LWYL 1VDGA 4OSUL 1WISA 4OFYD 2D31B 4PS4H 1WAAE 2ICWB 4TVPD 2Y6SC 1E4JA 1ULVA 3FB8A 1D5MA 4XMPL 5C0GA 1PG7L 1UC6A 5EOCL 4M00A 2FNBA 5T3ZH 4NRYB 4HWEH 5D1XD 5IVXF 3RWIA 1CFSB 1RJYB 3FONB 3WHE0 4YHMH 3JSSA 4IMLA 1I85A 2DMKA 2KUTA 4M6AA 3FT4A 1EFXA 2V7NA 3OGCA 5M95B 3WFCL 2OZ4A 4LIQH 2IAMC 3UYRL 5TH2B 1AXTL 1FVEA 2X70A 4P3DA 4JANA 4FZEH 5FYJE 1UA6L 3HI5L 3KS0H 3P2TA 2HJFB 4YWGL 5ENWA 3HRPA 3WL9B 4NQVB 3GSNH 3O6MH 4ZXBA 1BF8A 4ODTH 2XXMB 3V6BR 4RWHA 1AR1D 3RL1B 4C55A 1AIFB 4R26L 4NBYB 3VXRD 4NRXB 4TYUA 2DLHA 5MEOB 3MRMB 5JORB 4GS7C 4YBQD 4CKVX 2J5LC 1LNUB 2A77L 4NFDA 4A6YH 4KRNA 3GDBA 2ED8A 4X5XB 2IMMA 5IOPA 5EC1A 2WIIA 3QDGD 3IDJB 3OHXB 4LKXB 1TQCB 2XTLA 3CFBA 3VDBA 3LEVH 1NFDE 1JK8B 1V3MA 3CC5A 3JVGC 4JQXC 4OLEA 4GBXD 2HT3C 4R4BB 4JY5H 4UDUA 3A6CH 3BDBA 1U8JB 4MDJB 1NCDH 5FKPB 3W0WD 1HYSC 4HMCA 5FKAB 4OF7A 1MCNA 2HYMA 1IKFH 2XWBA 4KROD 1DLFH 4WUUD 5I16A 1KF9B 5BS0D 2AEPH 1RZ7L 1BP3B 5C0BD 1A7NL 3I50L 3VFMB 3WN5B 5C0AD 4GMSL 1HH6B 4RWYL 3GSOB 3QXDB 4TSCH 5FYKU 2P24A 4KHTH 5EO9B 3KNBA 4WHDA 4FQQB 3WDJA 2VZ3A 2CXGA 2DDQH 5DUBA 4TTDC 4EI5A 4OKVB 1KJ2A 4R7DB 5GZOC 1UACH 3WE6B 2JELL 2EYTB 4BH8A 2RBLA 2QKIA 4LRNL 2YD9A 4NZUH 4PRPD 1IVLA 1E4KA 4JRYE 4JJ5A 2ADGB 2NZ9D 2OSLA 2D7NA 3A6OA 3OAUH 3SQOH 5FK9B 4WUUB 1ZLVH 1DJSA 1JRHL 4F7MA 2GT9A 4LPWA 1F3DJ 2QBWA 4GRWE 3UZQA 3I85A 3JV6A 1M1SA 3DUUA 1RUAH 4JJHA 5T1KD 2P24B 1QSVA 3BJLA 1J12A 5D2NE 5DRWB 5DUPL 2XV6B 3V79C 4RIRB 5CBAA 4V2CB 3NOIA 1INQB 4L4VE 2O5XH 3UBXA 3U4BH 4DVRL 3O4OC 5FYKD 2V2XA 1KACB 1CE6A 1U36A 3DGCR 3UBXG 3D3VE 4GAJL 5DD5L 5EU6A 3NCJL 3GSWA 4LPTA 2APBA 4MQXC 4YHZL 5BZDB 4UU9B 4FG6C 1KPVA 2JCCB 3JWOL 4AENB 5BJTB 1FJ1B 3G5VA 5EU6D 4HS3B 4L5FL 4I0PD 5IFAH 2DQGL 3I9GH 3F6IA 4QEGA 2EC9T 4HJJL 5I75C 3QUZB 4LVEA 4J12A 3GMMA 1A02N 1LNUA 4PRIB 1LEGA 2P8MA 2VLMD 1DQMH 1FLRH 5HYSA 3D3VA 2XXCB 3VI3E 5KAQG 4NRXA 3U6RB 3LEYL 2VQTA 3S5LG 1L7IH 1KXTB 5L6YL 1RIUH 1C7SA 2QQKL 4XCYA 5I1EL 1QBML 1FFOA 2OJZL 2IGFH 1QVOA 5KVFL 1F4YL 1IM9D 1V3KA 1U8QB 4L4TA 4LLDA 2LV4A 3L7FA 5DFTA 4WW2C 4PLJC 1BLNA 3KYOA 4PJDB 3BAEL 1NGQH 3FT2A 3TYGL 2J8UB 5DJCA 4KJWD 4LVOC 3PWUB 3FFCD 2QR0B 2ARJQ 2RIKA 2FATH 3LPFA 2Q7YA 3IFPA 5BZWB 4P46C 5C8JA 5I0ZA 2WBJA 5BV7C 4Z8FL 1RZIA 3VD9A 5MEPA 3ET9F 1YEJH 3NN8B 3IS0X 4JLRA 2VLJA 2LQRA 1MELA 2VIRB 4JFZH 4GMTH 4YHML 1TITA 2F5BL 5CD3B 1NC2A 5LJYH 1FO0H 1A6ZB 2A74B 3IU4L 3LZFL 5HYEA 3OX8B 3DSNA 2HJKB 3LEYH 5D96B 5AYUH 5F44A 5AYUL 1XGQB 1EERB 4YC2C 2EC9U 4QTIL 1FO0L 3B5HA 4ZS6D 4RAVA 3IAQA 3O2WL 3VRIA 3SKNB 4TRPH 2AJYL 4P5MB 4M7LL 4L8DB 4P2OB 1AR2A 3QPQD 5C0AA 1TZIB 4WTZA 4E41E 1T83C 4CMHB 3UTPE 5T1KB 1UM6H 4PRDA 4GW4A 4F2MB 3VWKC 4PTUB 2LVEA 4QHLA 2QQLH 4Z0XB 4XWOC 1JWUB 4O4YL 1A6UH 1ZA6A 5GS1B 1TTUA 1HNGA 1LO4H 2VQUA 2HVKA 4PRID 4AMKH 2X4NB 5HDBE 4FQJL 4KI5C 1LEIA 2RFXB 1AC0A 2YA0A 3C60C 3QDMD 2J6EL 2FIKB 5K9OB 1KC5H 1ORSB 5GGUA 3U1SL 4JHBA 4M6OH 2AJ3B 5F7UA 2XFXB 2Q20A 3UPRA 4JY4B 5E1AB 2PR4H 4X5WA 5HHVL 3F58L 5D2LB 1I9JH 5BRZE 1T1XA 3QQ4B 4ERSH 4ZAKC 1F4AA 4BFIB 3QWRA 1SY6L 2RAMA 1TVHB 3TCXA 1VPOL 4G6JL 5J89A 3VXTB 5J6HB 4AM0A 4X99B 1N0LA 2AJYH 1CYGA 1MCHA 2XN9A 4LP5A 1HSAB 2ADFL 3VXUE 1I3VA 5MHSE 4DTGH 2NY2B 3TP4A 2CLVA 4F7PA 1U58B 1NKOA 3QUMA 3ARSA 4DJMA 3I2CH 1Z0NA 5DI8A 5F1KC 2P5WD 4QRQA 3PV7A 1PEZA 2P7TB 4PGBA 1YEIH 1M7DA 2ORBH 3B9KD 5B8CA 4PJFE 1YEJL 5DD5H 4I4WB 1RK0B 1Q0XH 2IANE 3QCVH 3S6CA 3TV3H 3MBED 4RBPK 2W9DL 3TN0A 2AV1A 2VDOL 3D2UB 4RGNB 3SDCC 2RCSL 1HHHB 1TENA 5EZJA 2YZ1A 3TO2B 5IQ7H 2EYSA 3S9DB 3GM0A 5I76B 3V6OE 1U8KA 5DJDB 5GGVL 3KR3H 2R23A 5M7QA 4LDOB 1C08A 1TQBC 1NGXA 2GFBA 4M02A 3WIIH 1KENL 4I13B 2KKQA 4JFDA 2XIDA 1TQBB 2OK0L 4L4TD 2Q8BL 2OR7A 3A6BH 1P7HL 5EO0B 4NT6B 4Z0XA 3W0WE 4N9GA 5DJ2A 4V2BA 5FV2A 3UZVB 1Q0YL 1FLRL 2VDLL 3B9KB 1FO0B 2WQRA 3WD5L 2NY5L 3C8DA 3PF2A 2I9LB 5FF6A 1Z9OA 1N5AB 3PL6C 1MH5B 3ZHDA 1NFDF 3VGEA 4IIQC 1DVFB 1BJ8A 4U1GB 3WFDH 2FDBP 4OCSH 4U1MA 4WWKD 4Q9QL 3GSNL 5CAYB 5TQ0H 1UWEH 2R0LH 2HJKA 1S7RB 3PWPE 4EQ3A 1YEEH 5E5UB 6FABL 3FO0H 4WHYH 4J4PA 2XZCH 1S9WA 1NPUA 3FQUB 2CKBA 4H0GA 3BGAA 3EOBA 1V05A 1C5BH 3U36B 1GYAA 2Q76B 1HHIB 1RZIB 4DVRH 2EKJA 1T20A 5JDJA 3MZGB 3MRHB 2WBJC 2PW1B 4W6XB 1QO3A 1WT5A 3BPOC 3TNNB 2BSED 2ADJA 4PJIB 3QULA 4YHNA 3VMPA 1R3JA 2N1KA 3UROR 4V1DD 1T22A 1UWGH 3FT2B 5EWIL 5GRJL 3U2SB 4K2UL 2HJLB 2A77H 5HGDB 1TCRA 1D5ZB 2VJXA 2X05A 3VW3L 4P2QB 3CPLB 2A6IA 3DUHA 2BHYA 1QBBA 4J23A 5CGYD 4NO5B 3U4EB 1JNLH 3JTSB 1FFNA 2HFGH 2YEZB 5GS1C 2CGRH 1A7QH 3CH1A 1FFOB 4DN4H 3BN9D 3H3PL 1MCBA 3GHEH 3MYZA 5H8DA 1UACL 3B9DA 2JJSA 1T0MA 1MREH 4PR5B 1CICB 3QIUC 4CRPA 2C4XA 4P2OC 2ZUWA 4NPYB 3L5XH 3HUJA 4PP2A 3GMMB 3CH1B 1K8DA 2FHFA 3RAJH 1T21A 2IPUG 3ZTNL 3EOTH 4KAQL 5L2KB 1AY1L 1FNHA 3QUXA 3ZTJG 2HFTA 4J3XA 4WJ5B 1T7WA 3CPLA 4M1DH 3ZHKA 2ZG2A 4OLZH 2OP4H 3ABZA 1S78C 2FJHA 1GZQA 2Q87A 3IKKA 5JMOC 3AU1B 4Y1AB 2CUMA 3OKNA 5CD5D 4MNGA 2VXUH 4TNWF 1IAIL 3RTQB 4Z18A 3ZMRA 5DR5L 3X3GL 4ZAKA 4Q9BA 4NM4L 2AV7B 2DQTL 3V52L 1VADB 3SDCB 1OAZL 4OFKA 2VC2H 1A6WL 2DF3A 1QA9B 4WI7A 1VFUA 4Q58C 4QRRA 1NLBL 4B50A 1OM3H 5DRWA 5MEQB 4PD4J 4KI1A 4N1HB 4Z0BL 4PFEA 4J3WA 4I2XA 1OQOA 1Y6NR 3HC3L 4JPWL 2AGJH 1QA9A 1FVCB 2GJ6B 3FFCE 4S2SA 4JDZB 1IJ9A 2PXYB 3QI9C 3MBXL 3HAEG 3MRQA 4LLQB 3LKRA 3THMH 2NYYC 3IDYC 3MLTA 5LGKA 4CN6A 4KKLC 2KBGA 3HR5A 5SWZB 1JWSB 1DUZA 1OF2B 4S1SH 5C86A 1KJ2B 4R7DA 2H26A 1QFWL 1OAXL 4RDQF 1CLOL 1HOCA 5J6GB 4JHAH 1P4LA 5EUKA 4ZUTB 2WAHA 5DVOA 3JWOC 4LPXA 4JFDB 1HH6A 4N9OB 3LIZL 3OJDA 2CKNA 1QZ1A 3U0TA 5K93A 1WC7B 1QUNA 8CGTA 3HR6A 3VFVA 3IF1A 1W0WA 2EYSB 5DGQA 2A6JA 1UENA 1LEKB 4MVBC 3VG9C 2QQQA 3MMEA 3O0RL 5AUMA 4ZUVB 4JN2A 1QBLL 3D5OF 4HLJA 5E9DE 5B8CB 3RVTC 3V8OA 4XNMB 5DFVD 4PGBB 2P7TA 4P3WA 1TFHA 3C5JA 3CK0L 3I3DA 1IQWH 5MI0C 3KLHD 1EA9C 3Q1SL 2GJZA 1KB9J 4XPHH 3EBAA 1D9KB 4URTB 3W2DH 5HVHC 4WI9A 3TA3A 3E6FB 1CQYA 1B4JH 3N85H 1L6ZA 2RR3A 4X9GA 2D7MA 4WW1B 5TE7H 4ZTPL 1IKFL 1JPFB 1FPTL 1E0OB 4GXUM 1X3DA 4QY8B 2EXWC 3OR6B 2VQ1B 3HS0B 5EPMA 2VLKB 2ICEA 1FL5A 4BFIA 3IFNH 4JZJA 4UV4H 1MFCH 2B1AL 4XMLH 4R4NC 2YUVA 4JANB 4P5TD 5DMYA 1SEQH 1DQDL 3MV7E 5SWQA 1HWGB 3OKMA 1ZOXA 4I8DA 5LQBL 4IMKA 2ENSA 3OKEB 4RNRB 1EX0A 1CICC 1GAFH 5JO5A 5GGSY 1OVZA 2ARJA 4HW6A 2FO4B 3HFML 4MVBD 4OLVH 4FQCL 4A6YB 2EDQA 1ZA6B 4I0KA 5KJRL 2EDWA 5EBLB 3BE1H 4LPCA 1X5XA 3D48R 3L5WB 1ZT1A 3E3QC 3UTTB 3OL2A 1TZIA 1YPZF 3EYUL 4L8DA 4HPYL 4K3EH 1YUHB 4P2OA 5D1XB 4RX4D 4ZFOB 4XBGA 1JPSH 1P4BL 2H8PB 5I1AB 4PGZA 1K5NA 3HE6D 1S7TB 4JE4B 3NCBB 3C8KA 5JXAH 1NFDA 5T5FH 1JYWA 3AM8A 1T2XA 4XWGH 3OX8A 2XZAL 4DW2L 4Q2ZA 2BNQB 4N8CL 1X5IA 5F7EL 4C56B 4CNIA 1IRAY 1BQHG 4UILL 1X5KA 4I4WA 2ZCKL 4G6AD 1WF5A 3T0WA 4KZDH 3CFDB 3MR9A 3O4OB 4X0KA 3HZKA 1KPRA 3K2UL 4QRQB 4DZBA 3ZKXC 4KRPD 1O7SA 3BWAB 4R0LB 1BD2B 4G8GB 4FQXA 2DBLH 3QUYD 1MRFH 1HSAA 1H9VA 1FYTD 4K8RL 2DQIL 3HE6A 4ODWA 3VFNA 4HIXL 1ZT4A 1FORL 5F3BA 4JFQB 1EMTH 4PG2C 3GMLA 4P4KA 2AK4D 4XCYB 5ETUB 3MLZL 1JPTH 1TTFA 2MNUA 5JHLH 1D3CA 4RRPA 4HXAH 3MRBB 1RUKL 4EUPA 5C0CA 4Q9QH 1A0QL 5E2WH 3CCHB 1YNLH 2C3XA 5CD5C 4PRIA 3FQWA 3Q1SH 4EOWH 4KI5F 4HX1B 1KB5H 4NQED 1NAKL 3EHBD 4GG6F 5ABDE 5C3TA 1I1YA 2ZOKA 1HKLH 4CUCA 1U8IB 5J12C 5IG7A 2AJSH 5GGVY 2W91A 3DX9A 4MA7H 3VRJB 1XCTA 4FQXD 5BVPL 5I9QB 5DA0B 5T1KA 1WBYB 1V7MH 5C0AB 3SBWA 5IWLC 4LF3B 3SDXB 1IGTA 1ZHBA 1KTLA 3BP4A 3DXAE 3UMTA 5E6ID 2HH0H 2PYFA 4JPIB 5HDOA 4YNYB 3Q3GA 1P1ZA 1EVTC 5AG8A 4NUGL 2OMNA 4OIIH 2HT2C 5I1LB 2A74A 2Z31C 4QXTB 3RVWD 3TCLA 5CGMA 2ZUXA 3B5TA 3HMXL 3K80A 1C5DA 4PBWD 4YAQA 2RCSH 2VIRA 5DD1H 1IL1B 3LQAL 4NJ9H 3CFKA 3NN8A 5ITBL 3VE0A 5EBMA 1KTDA 4TPRL 2D2OA 4KKLD 1JNHA 3VXPA 5KVMC 2VKXA 3UTZA 3L9RA 1VEMA 3QWOB 4QXWA 2A6KB 1CT8A 3GKWL 4MAYA 5FUCE 5A2JH 5C0IA 1GJIA 4N0FB 1UZ8A 1Q1JL 2H2PC 1ZT7B 3GNMH 1IGYB 2EDFA 3CZFB 3WBDA 3KPMA 1BZ9A 3HC3H 4JPWH 1HILA 4K07A 1ZS8A 4ODXB 5C6TH 4PJAF 4PJDA 4IOFC 5EUOF 4CDGC 2E7LA 1JV5A 2DQHL 3REWA 1UH4A 3MLWH 3GSOA 1AKJD 3P11H 2F19H 1OW0C 2X4SA 5GIRA 2ZSWB 4H20H 1FZMA 4D9LH 4GG8A 4JO3H 3B9KC 2UWEE 3TZVA 4MS8C 2PR4L 5I1KH 5HYSB 3KLHC 4XAWH 3T0EC 5FCSH 1U3HD 4NNXB 2HLAA 5ADOH 1QACA 2ZG1A 3CX5J 3QUZA 5E8OA 3A0OA 1MVUA 5CJXC 3ME0A 4KRLB 2I26N 1UB5A 4G3YL 1MHEB 2ERJB 5EOQH 2BVUA 3WIFA 2AXFA 4HZLA 3IU3A 5FAAA 3THML 1FNAA 1I8KB 2BRRH 2EIZA 1AY1H 4MX7B 3BGFC 4K7FA 5BRZD 1BPVA 3DWTA 3C6LA 5BZDA 1JTOA 4MNGE 5EORL 1OPGH 3CSGA 5EIIB 3MNVB 1MY7A 3H9HA 1W72B 1WSST 3ETBF 1EZVY 5CBEB 5E24E 4WFFE 4XMKL 1JWMB 1Z3GH 5D71L 2WLZA 4F58H 3UBXB 4LHJB 4R90L 3WFBH 5K9QI 4BKLA 4RIRA 3ULSA 3MLRL 3NZ8A 4CVZA 3KJ6H 1CR9H 1G1YA 1MJUL 3BP6A 5EU6E 4NQVA 4S1QH 3WNNA 2A9MH 1CFTB 1LE9A 5TPWL 4KKBD 3BGFB 3L1OL 4AEIH 4Y5VB 4F7MB 2VXUL 1X6LA 3SDYL 1JMZA 4P3DB 4H88L 3M1BA 5EO1A 4KVCL 4Z7OE 4JRWA 5JQ6L 4PRPA 3QR2A 4P57A 4D0BB 1UJ3A 1YYMH 1SM3H 1CXHA 2B4CH 4L29A 1AD0B 4OZFA 1XFPA 4PY8I 5KOMC 3VMOA 4YZFE 1J1OH 4PRHE 1JPSL 4LCWD 4JG0L 3MOAL 4BZ2L 4LQ1A 4KQ4L 1MREL 4YBLB 5CUSH 2D03H 5EO9A 5HJ3B 3UZEA 4BSJA 4D9RD 3FB8B 3RRQA 3RZCD 3GSQA 3H3PH 1WWWX 3W5MA 4CBPA 3S97C 4KKCD 4WHCA 1JHLH 4DKEH 3OG4B 5JOFB 1UQSB 3RWDA 5GGRA 5HGHA 4OZGA 3MLSL 5CIPH 1UB6A 5I8KH 2L0DA 5H2BB 2DYPA 3QNYA 2YPLB 1XGUA 5E08H 3ZYIA 2A73B 1EO8H 2GK0A 1Y18A 5J06A 3KPPA 4NQDB 2MCPH 2VDMH 3ALXA 5GGRB 1UQSA 3RWDB 2YRPA 2IFFH 2Q8BH 5DJ8A 3HG1E 1FN4A 3AXLA 1F2QA 2OX5A 2V2TA 5AWNL 5FYJD 1YEKH 3ELAT 5IOPB 1I1FA 1JI2A 3H7BA 3HMWH 1QEWA 3BESR 4RGNE 1WLHA 1J05A 1C5BL 3QNXB 5BXFA 4JKKA 4NZTL 1CFVH 3TBTB 4EN3D 3W0WA 1L9NA 1AIFA 5DJ0A 4ZXBD 1ITBB 5D72H 4R7NA 2MQ0A 4BK4A 5KS9F 2C26A 2OL3H 4Y0GA 1ZA3B 2ZUTA 4JFOA 1NMBL 4OBSA 3SE4C 1CG9A 4GH7B 1G7QA 4XP6L 1RZKH 2ENYA 2VDRH 4PUBH 4FQ1H 2AJVL 3OSKA 1BHGA 3LN5A 2X70B 3OKDA 1QFUH 1JF5A 3CUPB 4HG4K 4IRSB 3QZWA 1CE1L 4NQXB 1N59A 4Z78B 3IJYB 3QCUH 5BCAA 3I3EA 4R4FH 1GOHA 1MWAL 2BVPA 5K59F 3BZEB 4CW1A 5IT2H 1CXIA 1NCNA 3ZHLA 1T66D 1G6VK 4KC3B 1A3RH 5D7KE 2W9LA 3BH8B 3GZKA 2FSEB 4KROB 4CJ1A 3C6SA 3UJJH 4XVSH 2NTFA 1SY6H 4QOKD 3WSQL 3DJ9A 4L3EB 3TBVB 3QIBA 1KELL 4G9FE 3F58H 2MCG1 5B39B 4OF8A 4L3CA 1EGJH 1I7ZB 2BC4A 4YDJB 3EDDA 2UZYB 3U1SH 1TJHL 1EFQA 1OTTD 3S7GA 3GIVA 2NMSA 4P9MH 5GRYA 1G9MH 5CEZH 2R4RH 5EZLA 2Y23A 5CJXA 3GSRB 4AEEA 4R96A 3MXVL 4LOUD 3SE8H 1DBKL 2UZIL 2ZSWA 4OCNC 5GRUH 2VDNL 5EBWA 3L5IA 3VFOA 4NQDE 2G9HA 1MRCL 3U9PL 1PKQA 3ULUD 5IEKB 5IB2B 4LGRB 2D9QB 1XF4B 3FFDA 4WW2A 1N26A 2BNQE 2CLZB 1OWWA 1NGYA 5HD8D 3UTSA 2VLKE 5C6PB 2YS4A 4NWTL 4ODUB 2DQJH 4OD1H 4GAGL 3RUGA 4NKDB 3RBGA 3QIBD 4PV9A 1EJ6A 1A6WH 1GOFA 5HXMA 3E8UL 1LD9B 3OAZH 3QQ9C 4ERSL 2CIIA 1CD8A 5IMLB 2XKSA 5A16A 3O6ML 4WI3A 1ZANH 4P2RA 4AEHL 1S9YA 4NO0B 1WZKA 1D6EA 1JYNA 4NOFA 3RZCA 4YAQB 2CRYA 1DE4B 4M9OA 5A3IC 2WUCH 2P5WE 2FLRT 3T2PA 5JUEH 4XBPA 1OAUL 1EGJL 3H9SA 3ZLQC 4MCYA 1OLLA 1P7QA 2DQFB 5GISL 4LIQL 5F1IB 1HZHL 2EDEA 5T3ZD 2ATPA 1BZ7B 3U7AA 5DK2A 1EO7A 4FFZH 3DTXA 1QNZH 3G5XB 3OMZA 4GSDL 2DLFL 1N2RB 1S5IH 5C71A 3CXDL 2VERN 1MLCB 3CX2A 3CNKA 1ZWIA 4G6FB 5IGXH 2JJWA 3QIWD 1VACB 3TT1H 4G8EA 1A1OB 5DVNA 4HWEL 2AEQH 3KWWB 5DT1H 1E4WL 5DD0L 2AKRB 3TYFA 1RUQL 1I3RA 2IPUK 2AXJA 5I1GL 3MRIB 4PJXE 3TBYA 1NC2D 5DK2B 1DLHA 5E9DD 4K2UH 5DVMA 5FUZL 1YECL 1YN6B 3C60A 3H42H 2UY6A 4L4TE 2ZSVA 2EIDA 5C08E 1G9NC 5MI0B 4YQXH 4O2CA 1E4KC 3IXAA 2N7BA 2YC1B 3BIKB 4HKBB 5TDPB 1SYSA 1XH3B 4RMSA 1EVUA 1ZT4B 4FA8A 2APVA 4PJAA 1DQJB 1SJXA 2I60L 4JDTH 5IROC 5L0QC 4QRTB 5CP7A 1I75A 1L7TL 1OSZA 4LSPL 3W39A 1PG7X 2EXWD 2VXQL 4I3RL 2R56H 3DURA 3SE4A 5IB5B 1ES0A 1ZE3C 4YEFA 5D6DC 3BHBB 4GG6E 2CLZA 3LRGA 4G7VH 3SDDD 2CK0H 4GG6B 4LBEB 2BOBB 4M6NL 3QFJB 1B0RB 5JLZA 2MMXA 4Q0XL 3P9MB 3UDWA 3H8NA 3G6AB 3MLYL 3OB0H 4M93C 3MRLA 2BNQA 5GRVL 2VSCA 4LSUL 2DB8A 2DQDL 4H5SA 4N0YH 25C8L 3VGAC 1RQ5A 4PJHA 3V4VL 1IGJA 5IJKC 2DAVA 3BPCB 5CUSL 3BMWA 3X11B 1IMHC 3RNKB 4YDJA 4KJWC 4O2FA 1RZKL 2O5YL 2Z93B 2DMBA 1ED3B 1N7MH 4UB0H 3UO1L 3QJHB 3T4YA 5D1QA 3MJ9A 3EJJX 3P4OA 4V1DB 2VWEE 3MUHL 5EBLA 5DEZA 5TQ2H 1E4XI 2FSEA 2YK1L 3E1F1 2M1KA 4A6YA 3WXWL 3HNSH 5ACZB 3EYFB 4NZTH 2FO4A 2EDDA 3KYKH 4BH7A 4Y89A 3D9AL 4HC1L 3PL6A 3DI3B 4K94C 4LLMB 4MLSA 4UNTA 4MD0B 4OQTL 2P8LA 1QSFA 1F6FB 1A6TB 3JZ7A 4YH6A 1A4KB 4D0DA 5E6IA 4E9LA 1J8HA 5D5ME 4HWZB 3FB7A 4N0UB 2ADFH 4YHYB 4LCUB 4O9HH 3CLEH 3D39A 3CXDH 4JFFE 4N0CD 2R0ZL 5GS2D 2M26A 3WKML 3ROLB 2ZCHH 4WUUE 1G7JB 3QPQC 4OUUB 5JOEA 1X5LA 5C0BE 4TSAL 4L9DA 43C9A 3VXMD 5K9JH 5IB4A 2GAZB 1XIWC 4G6MH 4MAUH 4K8RC 4TUOA 3MNWB 1WWBX 4MJID 3K46A 4NN7C 3C5ZC 4O00A 5K9KA 4UQ2A 5D4QA 5A2FA 3B83A 3W11D 5TGBB 2PYED 3PGCB 1U8NB 4QO1A 1FN4B 4JN2B 2V17H 2EH8L 3WHE1 3G08A 3N1MC 1Y18B 2H2SD 4N8VA 5J1TC 4NYLA 3GEWB 1Z2KA 5K9KB 2DYPB 1M4KA 4U4BA 4ISVA 3PXHA 5IVZB 5ICYB 3MV11 3D85D 1ZSDB 3SJVD 5FYLH 4LRIC 4QGTA 3BPOB 1E4XH 2BHUA 4EXKA 4MA1B 3U0TB 4WW2F 4XAKD 4JZOB 4DK3A 4C57C 1BX2A 4BJLA 4X7SH 1MWAH 4ELMA 5JW4Q 4WDIA 3F7VA 4EN3B 3STLA 4ZYKB 2VN7A 3TC9A 1Q1JH 1MAMH 4ZUTA 1CICD 4YIQB 5C09E 1H8SA 3V4PL 5E6IB 5D7LE 1OF2A 1DUZB 2XACC 1J8HE 3BFOA 3HRZA 2YMXL 4I18C 1DVFC 4C83A 4YLQT 4IIQB 4U6VL 1Q9WA 4WV1B 2ZJSL 3B8YA 5E2UH 4LLQA 4X4ZA 2DIJA 4NQDD 3TLRA 1UJ3B 3L3KA 4PJEE 1MCOL 5F7WC 5CSBA 4Y4FD 5TDOA 3PHOB 4M8VA 2N56A 5BS0A 4LSQH 5I2IA 5JPNA 2VDKH 4XNZC 3UXFA 5DUML 1SJHA 2R2EB 5KZCB 5MEQA 3IVKB 5C9JA 4O2FB 1FP5A 2IGFL 3RNKA 1HEZA 2VKWA 5IEHA 1KCSL 5FGCE 1ZV5A 1W72A 3C09C 4X8JB 5I1DA 3P11L 1RAMA 3NTCL 2IPKA 3O3BA 5DEFA 4AYFA 5GRXG 3Q48A 4MNGB 3ROLA 3RVTD 1DQQB 3U0WL 43CAA 5IFJA 2VE6B 4Y4KA 5KSUB 3GBMH 1JZ5A 2NCMA 4WJ5A 4LBEA 1FL3B 4Y88A 1QSFB 3O2DA 2VDNH 2V5YA 1R5VB 3GJEA 4NSKB 4F9LA 4G9FB 2FGWH 5A43C 4MA3B 4AZ8A 1XGYL 4HXBH 2JK5A 3TZVB 3PWVA 5B3NA 1TXKA 1T0MB 3NAAH 1IC7L 2R2HB 4KPHH 5EH1A 4C56D 3GBNL 2Y07L 4WFFD 3UJIH 2B5IB 4OQ1A 5L88L 2CDEB 3MV9D 5SWSA 2VABA 1MUJA 2RQ8A 2W0FB 3D85B 5SX5K 4HF5L 1HINH 3O6FC 1YC8A 4XVUC 1MPAL 1U95B 3RGVC 1SJEA 1UWXK 3SDYH 4F7TA 4HK0B 3TVMC 1Q72H 1UM4L 1BVLB 2GSGA 4DEPC 2GEEA 3GRWH 3MGTB 3NZHL 4H1LB 2BVOB 1LK2A 4ODBD 3ZDZF 3QHFL 3UTTD 2VDQH 4M7ZC 1G9NL 1JHLL 4QWWD 4H5SB 4OZHE 1WT5C 5DJ6A 4KK9D 5JPMA 1SY6A 1G0DA 1I3RB 4HD9A 1TVBB 3BUYB 1QFUL 1KIPB 4GRWF 3QSKB 1LK3H 4Z7OF 1S3KH 4MA8L 3WNMA 5E8EB 1BAFL 4UINH 1UKTA 4GG6A 4R2GD 4LHUD 4FS0A 1PYWB 4HPYH 4LLAA 1YPZB 1FCCA 3HB3D 3G5XA 4ODHL 4OUOA 3P4LA 3QUYA 3HNTL 4S1RL 1YNTA 3CGTA 4HXAL 1KEML 5EN2A 1W0YT 5T1LD 2J4WH 2XKNB 1BOYA 5CP7B 1P7QB 1IGTB 1ZHBB 1GHFH 1HH9A 2H41A 2ESVB 3WO4C 2VSDA 3BPNC 3FRPG 2VXTL 2YC1A 3CVIL 2B1HL 5HGBA 3IXAB 3ARDB 2VITB 1DBJL 5IMLA 4WI8A 1QRKA 2YD7A 3ARTA 4RGMC 1IQDA 1I8MB 3PWLA 4P46B 5GJTL 1MY5A 2IH1B 5FCUH 4R2GB 1C08B 1TETH 3MACH 3FB5A 1GGCL 5B21A 1RULH 5DJDA 4U2YA 5KVEL 4KY1H 2F8VA 4ODUA 2Y5TB 3T1WA 1GHFL 2Z8SA 4XNYH 5KAQF 4R26H 3EYVA 4DKEL 4Y4FA 5F3HA 3NA9H 2EECA 5ALCL 3OPZL 5F9WC 4XP1H 3PIQA 2AJXH 4HAGA 3UC0H 3CK0H 4Z7WE 3VRLF 4FQXB 4PJEF 4J8RA 4R0LA 3DRQB 2NYYD 2ICCA 2KDGA 4Q9RH 1KCRH 5KTEL 3GSRA 4X0KB 4FQXC 4ZTOH 4CVUA 2H32H 3CFDA 2RHEA 1WCQA 5FUCC 4NQEB 3OGOE 1A7PL 1LP9B 3C9NA 2C1OA 3P73A 4IRJB 1HIML 2EO9A 1IT9H 4JQXA 3WUZA 1CDUA 1N8ZA 1KN4H 3NCYS 3IYLW 1T1YB 4JGUA 1JTPA 4LHQB 2NTFB 5TPWH 3PDOB 1YDPB 3HUJE 3RWGA 1YQVH 3VFUB 1UZ6E 5BW7C 4QOKE 1KGCE 5K9QG 3K4AA 3I6LE 3OKKB 1S7TA 3VGDA 4NKIL 3MNZB 5F9OH 1T2JA 4F58L 5I1AA 4KQ3L 3UTSE 3PWPB 4XNUH 4LAJH 5LWYH 4Z78A 4XXCA 3QZWB 1A0QH 3LY6A 5JIKA 3ALPA 1RUKH 1T3FA 4S11A 4MQTB 1IZJA 2A1WH 3T3PF 2YPLD 2G9HB 1SEBB 4XXDA 4LOUC 3IETB 4XX1G 1CD0A 1WGOA 1BFOA 1ZA3A 3KYNA 4WO4B 3HHRB 4JO2L 4P23B 2AXHA 1U8MA 3KJ4C 5KSBE 4LSTL 12E8L 3DHJA 4MJIA 3AGVA 5DEGB 3NVQA 1K4DA 2YXFA 4K7PL 1OWRM 5EUOE 1H3XA 3KLDA 4POYA 1I8LC 3O3EB 1MAJA 1A1NB 3MV7B 3O6FA 4FFVC 5FHAH 1KG0B 5IP4A 1U8OB 1D7FA 4NN6C 3RGVA 4GO6B 4FQIL 3O41B 3FFCB 5FEBA 4QOKA 2ICEB 1AXIB 4NM4H 2AXGB 3V52H 5ANMA 2RB8A 2JB6A 4HT1L 3DMMB 3OQ3B 4OTXL 5CJQL 4Z76A 1VERA 2FYYB 5E8PA 2YD1A 4HMEA 4XP5H 2OTUA 3X12A 2VDKL 4CW1B 4JZJC 4PJ7F 1B0WA 2J8UE 4M7ZB 12E8H 3VMNA 5E2WL 5CS7A 3VH8A 5BZWA 3IFPB 5INDA 3RU8L 4XCEA 2GJZB 1UB6B 3PWUA 3EYQC 1QYGL 4KK6D 5JXAL 1DZBA 3BDYL 3RKDC 4PRAB 3DIFA 3GSNB 1YMHB 4NQEE 3EDEA 4XCCH 4LMQI 4WFHE 3S35H 4YDKH 3QDJB 4U33A 2BK8A 5ITBH 1URLA 5FGRA 1A5FH 1LDPL 5ALCH 4MNHA 4OCYH 1LDSA 3OZ9H 3QEQA 1A1MA 4NZJA 4DN4L 3MYJA 5KJRH 4MXWH 1GPOH 3MXWH 5I6XB 3VGFA 1DBBH 4G42A 5ACMA 3VFWB 3MLPA 1MCCA 1AD0A 1RHHB 3DARA 4EIZC 4YE4L 1JGDA 4ONGL 3WJJA 4UOW0 1EH9A 1CI5A 4X4XA 1OD9A 4RGOH 2PYEB 4EVNB 1N3NB 1JGVL 3CFJB 4LQFH 1ZGLM 4XMLL 1M7IA 5JTWA 3G5VB 4U6HA 2DQTH 1KCLA 1KLGB 4RFEA 4FXKA 5T5FL 4K94H 1AKJA 5T33H 4JFFD 2V17L 4FRWA 3GI8L 4PREA 3QDAA 3E2HC 2WWMC 3SDAB 6FABH 3N85L 1YNLL 2L7JA 3O6LL 5EUOB 3STZA 1RURH 3OPZH 5EIIA 1LHZA 3HNTH 1F97A 2DI9A 1G7HA 3SOBH 3NA9L 4NO2B 1VGKB 1H3TA 1LVEA 4IS6A 5E6ZA 1MCSA 1K8IA 1A7OL 1O5DT 1NEZA 3KPOA 4QRRB 1F4XL 3TO4A 1FC2D 1UJ3C 3FCTB 4OZ4B 4B5EA 3MJ7A 1MRFL 4N5UA 1S7WB 4L4JA 1IM3B 2G75B 5GGTL 4ZDHA 3TBSA 3MV9A 5DMGD 2QKIB 4I18B 1V3JA 2B4CC 1YY9D 3T3ME 1U3ZA 1H8OA 4D0BA 2C1PB 5IB1B 4RGOL 3OXSA 3MRKA 2DRUA 3X3FH 2GSIA 5FB8B 2BY3A 3EAKA 4YE4H 5E2VH 5J9PB 1FLTX 1JV5B 3KYKL 3BP6B 1KJ2H 4P5KA 1P2CB 1K8DB 4QRSB 2OQJA 4XRCA 3OZ9L 1A9EA 3C2AH 1ZS8B 4ODXA 2VL5A 4QCIB 4PJDE 4XXCC 1JWMA 1UZ8B 1XF1A 1UM5H 3H9HB 4KRPB 3MNVA 3BEVB 4JAMB 2CUHA 2YD2A 4LHUG 4M61B 5C0DA 5HYIA 2NXZC 4J3OC 4K3DL 4YX2L 2BJMH 4D3CL 2EE2A 4UDUB 5EB9A 3U46B 5IW6B 1XF2A 1S5HB 2IQAA 2AAVA 3R06A 4P2QA 3IU3B 5BMFL 2AVGA 3TNMB 5HGDA 3TWCL 4HKXA 4IJ3C 5TF1L 4FFYH 1MHEA 4YBLC 1J18A 2OYPA 3FB6B 2P46B 3FOLB 4LSUH 3LQAC 1ETZA 3CVHH 4JCMA 4K7PX 3K81A 4G6JH 4C59B 4HIJA 1OAZH 4PY8J 4L8SB 3BKYL 1KTLB 3BP4B 4ZG1A 1I9JL 5DO2C 4HUXB 1SEQL 4NUJA 5J1AB 1FBIH 1OTUD 4JFEE 5FDWB 1KC5L 4S1DC 1CGXA 4PY7A 1I3GL 3GBNH 4Z7UA 4JDTL 3V0WH 4AT6B 1KEGL 2E7LC 1CDYA 4NDMB 4OF0A 3Q2CA 3QP3A 4AMKL 4ORGB 3HAEH 3EYOA 4IRSC 4N0FA 2DM4A 3OF6D 1N5AA 5HYFA 4LDEB 5C0ND 1F3RB 1A6VL 1WZLA 2R15A 3JUZA 2GUOA 3CCHA 2VDOH 4K9EC 2WQ8A 1X5YA 2CLRA 3GJFA 2NW2A 4IMLB 4HIIA 4GRLB 4N5EC 2DYPD 2A38A 1T1ZB 4OZIA 3DYMA 4NRYA 4Y19E 4JFQA 5CEZD 4JO1L 4XH2A 5E8DL 4ONHA 3VFNB 3O0RH 4OIAA 3FRPA 4ZQKB 1NJ9B 2FH6A 4YBQC 2GFBB 3GSXA 5GHWL 2ICWA 3SGJA 5KVGL 4DTGL 4HCRA 3DVGA 4TOYL 5EA0L 3VDCA 5L2JB 5I76A 1BD2A 5D7IF 2WANA 4I0CC 4PV8B 4NGHH 4H26B 4OB5H 5I8EB 5ID1A 4M93B 1RFDH 3QUKA 5IBTL 4DKFH 3OR7A 3TEUA 2AEWA 3WFEL 3S88L 2IADB 2F74B 2J6EH 3TYGH 4DCQA 5JW5B 5HGAB 2OXHA 4KK5D 1CWVA 2IBBA 4G5ZH 3QIWB 4Z5RB 4J3UA 3MOQA 2DL9A 4KMTH 4YFEA 4LEOB 5HY9B 4J2XA 4EUPB 2DWEB 2MPAL 3MRFA 5IKCA 2GTZA 5CILL 1BQLL 2H8PA 1A9BB 4YR6A 1BEYH 2GK2A 1CGUA 3LS4L 5DURB 1CDCA 3RIAF 4PGCB 3QDGA 4AM0B 2F54D 4R6UA 3UTTA 4PJIE 4APQB 3Q6GL 1YEHL 2C9AA 1YMME 2XWTA 1H3PL 2XN9E 3RY5A 4O9HL 1RIHL 4GRLA 1ACYL 1G7MB 5CGYC 4G8GA 1ZHLB 2XQBL 3L3OA 4L5FH 4XVJH 4X6EB 1UYWL 5J13C 2EZ0D 1QLEL 3AAZB 4HIEA 4WHYG 3WNLA 2VLME 1T0NB 4XC3H 4WI2A 4KJYA 5JR1H 4AT6A 1A3LH 5FXCH 3WXWH 4BM7A 3H7LA 2IBZX 2GTWB 3HG1D 5DTFA 5AYQA 5IESH 2EDLA 4Z7UE 5FDWA 1F00I 1QR1A 4QY8A 1O7VA 3V0VB 2BNRA 1CIUA 3FQTB 3WFDL 3WJLA 5DUPH 4PV8A 3MLXL 4P5MA 4ZPTA 3H2WA 5IR1A 1EEYA 3UPCA 1IKNA 4EKXA 4RAVB 4X80H 5DS8A 3U83A 2EXYC 4X6CA 2H3NB 3WSQH 1INEL 5D9SA 1K5NB 3RDTA 2NY5H 4XBGB 5FGCB 1YUHA 5D1XA 3K4ZA 3VDAA 4ZFOA 4XCFH 3DYPA 1ERNA 1KT2B 4ZS6C 4FXLA 4HG4J 2GW5A 1G7IB 2DQDH 4N0YL 1FCGA 1XZ0B 4KTDL 5HHMB 2UY7A 4K9EL 4UBDD 1J88A 4ZUVA 2OK0H 5MEPB 3V6ZA 1ROWA 2R2BA 2NR6D 3AMLA 4OLWH 5A2IH 3DO7A 5JO5B 4Y4HA 1K6QL 3FZUC 3DVNA 3LHPL 2QR0A 4X6BA 2WBWB 3CAFA 3OKMB 2VZTA 3ZE1E 3HI6L 2Z91A 4NRZB 2ITDB 3H0TA 3VFGH 1A6AB 4H0IA 3ZKXB 4XRCB 1WBZA 3GKZA 1OTTC 3W9EB 4Z7VF 4Z95L 3JWOH 5EPMB 3T65B 3QNZA 1OSPH 2D9CA 1XF3B 2IG2L 3N50A 4AK1A 1YEIL 2ORBL 2DMCA 4LASL 4LSVL 4KWUA 1CLYH 4JM2B 2D7OA 3AREB 3GK8L 1UVQB 5I17B 4L3AA 1UM6L 2Y6SD 4PLKD 4UMGA 1C12B 4PB0H 3L3GA 2PO6B 3AS1A 5DC4B 5J7CC 4FTVB 3H42L 3O8XA 3MLYH 4H8WL 3RI5K 2A9NH 2C4FT 1YEFH 4OGAC 3G6DH 3QG7L 3MRJA 4PJXA 2BVQA 2Y06H 4HQQH 5I1GH 1VPOH 4AH2A 4PTTA 4YEEA 1RK1A 3UX9B 4H8WH 1VGKA 4YXHH 5F72S 5DT1L 3MCKA 2OCFD 1KPUB 4XPGH 1BM3L 3O4LD 2YPVH 1W0WB 1ZTXH 3TA3C 2OI9C 1OP5H 2CKBH 3OJDB 2DDQL 2NY6D 1J1OL 1HZHH 3MX0A 5T3XL 4XWOD 4F8QA 2X4TA 1CIDA 3EO9H 3PUCA 1N5YL 1X5JA 5DFVC 3WUWG 4LL9A 5T1MA 1RFDL 5SV3A 5KG9A 3DXAA 1NANI 2B4CL 1RZFH 3QUZD 3BP7B 1UH2A 2HLFD 3QDHA 2F53E 1PAMA 3BO8B 3TFKD 1OQXA 3HR5B 4ELKA 2VISA 4HKZA 5ESVA 3BVNA 3O11B 5IMMB 3RZCC 4IMKC 4LCWB 5IHBA 1H3UA 1XT5A 4XHJC 3F65A 3T0AA 3MJ7B 4C56E 2A9ML 2FLBT 3R8BB 2NNAA 1AGFB 1B6DA 4G42B 4NQCA 1DANU 5T3ZE 3LQZB 4RMTA 3S4SG 1T5XA 1E4WH 5DD0H 5DQJB 5EG6C 4GRWB 3VJ6A 3MLVH 3U7WL 3G5ZA 1NGWA 3ARFC 3U9UA 5F8QC 4W6WB 4NQTA 4XP4L 1C16B 5CJOL 2BNRD 3QDJA 1ZLUK 5SWZE 3U9PH 3IT8D 5DA4A 4MXVE 5HI4C 1R3JB 3ZKNC 3P0GB 3N06B 3DUSB 4Q6YA 3P9LA 4X5LA 1AKJB 3NCJH 3SE8L 4P46D 3BAEH 1QO3B 1RMFH 3N1QC 4FNLH 1DN0B 1FNEA 4X9IA 2JIXB 4HWUA 4AEHH 1QPPA 3DHMA 4YXKH 2CKBB 4PJCA 3QEUA 1I7TB 4LNRA 5I8CA 2VUOA 1J0KA 1CFNB 1QLEH 4UDTB 4N0RA 4CU8A 1WIOA 4R8WL 3ARED 3QNZB 2HVJB 1F02I 2PYEA 4H20L 4EVNA 1CLCA 1OTSC 4YXHL 1FAIH 1S7RA 1L7IL 2EDXA 4JGMA 4XC1L 3PWJB 5DQDH 3QFJE 3RGVB 2IC2A 5JORA 1MCFA 3O6FB 3OJ2C 4X6DE 3CVHL 1PW3A 2C4FU 2X44D 5FF6B 1CVRA 3MYJB 3NFNA 3PQYB 2LAAA 2ICES 2FRGP 5EU7E 4MJIE 4NKOB 4WO4A 1BFOB 2AJZB 1X5GA 5IB3B 5FO7A 1FVDA 3IU4H 3LZFH 2P49B 2WK2A 1D5ZA 1TCRB 3EJYD 3RIAK 2HJLA 3LD8C 4JFZL 3QPXH 5KW9L 2ZP0T 4TPRH 1IC4H 2VL4A 1OSPL 2FX9H 1PKOA 3QULB 4YHNB 3IDIB 2N4IA 2Y7QA 4GMSH 4RWYH 4MQXD 1EFXB 3FT4B 1NGXB 4MAYD 3P0YL 3C08H 2OR8A 2NPLX 2BZDA 3O6FD 4XGZB 1N5YH 1RZ7H 3Q5OA 3RGVD 4GQ9L 4EBQH 2NY4C 1RJYA 3FONA 3LHPH 3KXFB 3VFPA 4RISH 5F7YC 3ULVF 1SHMA 2HH0L 3WO4B 3X3FL 5MERA 3FQXB 5E0QA 3SDXF 5IWLA 4KJYB 3CSPA 1KG0A 2VLRD 3V4UL 4XNZB 4P23D 1S7UB 4GW5A 4MA7L 5B8CC 2VLRA 1YN7B 1IAKB 2HA1A 3Q0HA 4J8RB 2PXYD 1ZHLA 3GBLA 4P23A 3VG9B 4WUKH 4OF6A 4BELD 2DQEH 3IDNB 1DFBH 1AGDA 4NT6A 1YC7A 2FWOB 4FABH 2BFVL 3WDIA 5JIIA 5J6HA 4XB8A 4OFVA 3GI9H 5E6IC 4Y5XC 3DGGB 4OCRL 4PGCA 1A7NH 2X1WL 5JW4R 4IM8A 4YR6B 2ITCB 2CRMA 1SBSL 5GS2H 2NXZD 5HYQA 2FEEI 1GIGL 1PFCA 5D7SL 3UPRB 3OKKA 4HFWB 1FORH 1UM5L 1RVFL 3ZDYE 3ULUF 4Z77B 5GZND 2LFGA 5EU5B 2D4DA 1MF2L 1BGXH 1WICA 1XIWA 2I9TB 1FBIL 1Z5LA 5JW5A 2IADA 1LP9F 1JIBA 1EO5A 1HXMA 1BQUA 1IILE 2XWJB 3HI6H 2YA1A 2X9XA 2F53A 1KIQA 4LK4A 4EJ1C 1T4KB 1JWUA 4LU5L 4LKCB 4IRJA 4Y16A 1VA9A 3T3MF 3QDJD 4GBXC 4H0HB 1H5BB 1NCAH 1YEHH 4GUPB 3PGDA 3AUVA 5ID1B 1MHCA 1FNGB 4QXUL 1IEAA 4ZS7H 4K9EH 3FN0L 4JN1L 1U58A 1DBBL 4U1GC 4M5YH 4W4NA 4LFHG 4NCC1 1P6FA 5J57B 5DZNA 1NANH 4N8CH 2C3VA 3VXUA 3C5ZB 4UAOC 3INUL 1JJUA 1YA5A 4L4VD 1IGIL 2P42B 2QADD 1OGAD 5IMOB 2MJWA 4YHOL 1A6ZA 1QSFE 3EO1A 4PJXF 2FX7L 1WZ1H 4RDQG 3HPLA 1JF6A 4X80L 4KJQD 3KXFA 3KS0J 3QQ4A 4Q6IC 2Y5TA 5KVDH 4KROC 5J1SC 3C60D 3UYRH 4TULH 3L5JA 4HIIB 4K23H 4XGZA 5I1HH 1ORSA 2E9JA 5BO1H 1G84A 4V1DE 3BT2H 4E0RB 3TT3H 4NGHL 5L2KE 5BV7L 3EYOB 5JQ6H 4PRPE 3MGTA 4H1LA 1NCUA 5DJCB 1CGVA 4FQCH 4ORGA 2E6QA 2OZ4H 1VKXA 1CD1A 4Q6IB 5DDHB 5GS1A 3MLUL 2PCPA 4XP9L 3BMVA 3LB6C 4I77L 3WDHA 4GRMB 3K0WA 4P5TC 2DJSA 4XMPH 3ZL4L 3GMQB 4PY7B 2WBJD 5T5NG 2ESVA 2VABB 4IBLT 4R90H 3QIUA 4R97B 1A47A 3RNQB 1ADQA 2JKXA 3FO9A 4X7FC 1SMAA 3Q6GH 2G5BA 3O45A 3SDDA 2Z35A 1F3DH 2JK5B 4TNWK 4OD2A 3DETC 4MSWB 3ARBD 4OCMC 1NLDL 5C7XH 3RHWF 3V0AC 3T8XB 2MPAH 1HQ4A 2NY2D 5ICZB 1TVBA 5DJAB 3TNMA 3RPIA 5T3XE 2VAAA 4LAQH 2YD3A 2DQCH 3K8MA 5IFJB 3AFLA 2WBJB 2VZ1A 4XVTH 1AXTH 3V9FA 4MB3A 1X5ZA 5C8JB 5EU6B 3VGGA 1YYLL 3LSOA 2FD6H 2VL5B 4QCIA 5TE6H 2ZZUT 3MREA 2AJUH 2VAJA 1IT9L 4HUMB 3QB7C 4OD3H 2BNRE 1FZKA 4E41B 4AIZB 3SDAD 4WNQB 4KTEH 3NABH 4PJBF 1S8DB 2NX5A 5DMGC 5TDOB 3QCUL 3TWCH 3ULVE 2R2HA 4EI6B 4LLVB 4Q74A 5I19H 1AGFA 2NNAB 4NQCB 1F3JB 1MRDL 4PJEB 5FM5O 3QI9D 4D3CH 1EK3A 1WFNA 1TPXB 4QGYA 2NX5D 5D7IE 2G2RB 3VFTB 4LCWA 4U7SA 5IMMA 3GJEB 3IGAA 2XI9A 4C83B 4LAQL 3WYRA 3W9DA 1MCKA 1AXSA 4XPTL 3P0VH 3DRTA 5DD1L 3QRFM 5D96C 2VXVL 1R24B 4OGXH 4HS3A 3ROOA 3RDTD 3C2AL 3RWJA 3QA3B 2JCCA 2VR5A 4NO2A 4ZYKA 2EEDA 2NY4B 1JNNH 2CMRL 4GW1B 4JFYB 2DQIH 3STZB 4PJIF 1QFWI 1IAOA 1LO0H 3EFFB 3MV8B 5JDSA 1HCVA 2V2XB 4WFGE 5GRVK 2X40A 5I16B 3HLAA 4PREB 2AS5M 4U0RB 1V7ML 4OTXH 5CJQH 1QRNB 3VRLE 2FEDC 3PJSA 1BF2A 1KPUA 3O2DL 3I6GB 4UT9H 4RFEB 3R0NA 3NIDE 5E4EC 3ZYZA 2B2XL 4HJGA 1IBGH 4KGJA 5D6CB 5I8KL 1U8NA 3MRJB 5D8JL 2YPKB 1NAKH 3Q5TA 1NFIB 2YZ8A 4P4RB 5FK9A 3BRDA 3V5HB 4F3FB 4JRYA 3N1PC 1BWMA 4PRIE 1BBDL 1RHHA 1G7LB 4U1IA 4AQOA 1OB1B 5L9DL 3MNWA 1M7XA 1EHLL 5AZEL 5DMIH 5E5RB 4OLXH 3MPCA 3MOAH 1UVQA 3VGAB 5C0JB 2RJMA 3T1FB 5KANG 43C9B 4NP4H 4EI5B 4JDVA 2XZZA 2PTVA 2W0LA 4QF1A 5IFHH 1S3KL 4MA8H 3UYOD 4U1LB 2K7QA 5ENWB 2XQYK 1QR4A 1ZLVK 5AAWA 1IEBA 2VLRE 2O61A 5IW3A 4ZMAT 4Y4FC 5CKGA 4NNYB 1A6TA 2XICA 3LVEA 5DWUH 2XWBB 3K2UH 4TNVK 4M62H 3OGCB 3LKNA 5INDB 1GAFL 1MFDH 5CINL 3ZE2E 2CJUL 4N8VB 1IC5L 3O2VL 4LHUA 1GVIA 4DVBB 5HI3D 1JK8A 1GPOL 3F5WA 1P5UA 3H9ZA 3RWIB 3ARRA 2CIKB 1J0ZA 2PTUA 2AXGA 5LCVH 1F8TL 3QJHA 1YQ2A 4ZOEA 3T4YB 1FHGA 4UQ2B 2DTML 4OGYL 2Z31B 1FGNH 4FQ2L 1U8OA 1FPTH 4GQPH 2VH5L 3FAXA 5DS8B 2QLVB 4UT6H 4Q97A 1UCTA 5IB4B 4JKLA 4OUUA 3I6KA 5EU3B 4NHCL 2VZSA 4UQ3A 3WXVL 1DSFL 1RJLB 1DFBL 2C7UA 3QQ3B 2E6JA 4QHNB 5C0FB 4LVOB 4BFGA 5FO9B 1BQSA 5IMKB 4HGKC 2BSSB 2DICA 2V7HA 5LQBH 1INDH 5DO2D 3A6BL 1CDGA 3H9YA 2PTTB 3MNZA 1JZ2A 4HCRL 4JVWA 1CLZH 3EFDL 3I02A 4KKBC 3DV4B 5HYSG 2HWZH 5I66A 4K7PH 5E70A 1PLGL 4PJAB 1HQRB 2F9BT 4Y2DA 3ARZA 1I8LA 5D1QB 1XH3A 3GMOA 5MEND 2W07A 2E8ZA 3MUGB 4G8IB 4EUPH 4D94A 1YY8A 4I9WE 3VXMA 1HHGA 4JB9H 2LE9A 2ZSVB 5FYJH 3V7AG 3HZVA 1T2QL 1XGYH 5KW9H 5C7XL 1J1PL 3QQNA 4UNVA 3NACL 1T6VN 4OIBA 3BZDA 1DEEB 5D93C 3D69A 3BYYA 4M7KH 2AABH 2ZG3A 5DRXB 3S4SB 1E6OH 2BOCA 3AMKA 5TDNA 3PP3K 5I71C 5C08B 1UKSA 1CFBA 3DVGB 3SJVA 3FB5B 2IAMB 4QYOB 2IBZY 4RCAA 3GSXB 1U3HA 4FOMA 4QRTA 2IH1A 2J8UF 4FQIH 2X2YA 1PD6A 1HHJA 4MMXC 4HF5H 4ONHB 1JL8A 1PQZB 4LLYB 3T2NH 3WNPA 1I1AA 2YD6A 3MRPA 1T1ZA 2Y07H 4RSVA 3MRGB 4ZUUB 3WUWB 4AEFA 4EXPX 5GGRY 4O58L 4XBEH 4XP1L 3ZKND 1LO2L 2CDFA 3WS3A 1I9IL 3IJHA 4ZUSA 3GJFB 4LLYA 4IRZH 4P2YA 1KJ3L 4XVUD 2X5PA 5KVDL 1XGTA 4J3TA 2HKHH 5K9JL 3TPKA 2WBKA 4ZFGL 5EN2B 1RULL 3CSYB 2EO1A 2YRZA 4LCIH 3WKMH 4Z0BH 3CZJA 4K8RH 3UTQB 2CR3A 3KWWA 3CLEL 4KKCC 1A1OA 4G8EB 3U0WH 1VESA 4KUZL 5FYKH 1NLBH 2IH3A 3HCVA 4QRRE 2A83B 4QXUH 2KQMA 2B1HH 35C8H 5HHQA 1MFDL 5CINH 1T6WA 3S8WA 1TZHA 5CIPB 4RFOH 2J7LA 5F1IA 5CHNB 5IF0B 3U7YL 4PLJD 1LK2B 4X4YB 4U1HB 1TQCC 1LO3H 4O02L 4LPUA 5E4IA 2CO6B 3SPVA 1S9YB 1T5WA 4M7LT 4UB0L 3NGBB 3FN9A 4KMLB 3B6SA 2DBJA 1QKZL 15C8H 3WIHL 1BAFH 4UINL 4DQOH 4M61A 4K8RD 2X4UB 3ULUC 4U6VH 1BWWA 4JG1L 1RHFA 5TQ0L 1BVZA 2V5MA 3KPRE 4CAGA 1H15B 3RL2A 1OOAA 4MJ6B 1Z6JT 3P77B 4PGEB 1KXQE 3INUH 3VWJB 5HD8C 3WHXB 4MAUL 4MA3A 5B38A 2QQNL 5ITFB 2BXZA 4JN1H 3VWJC 5IMKA 3F8UB 1XF4A 1OL0A 1XGPA 2XNAB 4GAYA 4ZUSB 3MGOA 5L2KD 4MDIA 3DVFA 5TJWK 3WS3B 4GKZB 3G6DL 3QG7H 5HHOA 5DJXA 4ZUUA 1B4RA 2CK0L 4EI5C 3VFOB 4KI5E 5GRWA 4UT9L 3OXSB 4I0PA 2KPNA 1NEZG 1OTUC 2R56L 4JFPA 4UT7H 3O8XD 3P9WB 4IOIB 4WEBH 1IKNC 5A3ID 5I1DB 5DJ0B 2HT3D 2JCCF 3SCMD 5ILTH 4YC2B 1HEZB 1OAYL 4KUCF 2IG2H 2BC4B 3GMNA 4P59H 5B3JE 4TVPH 4Z95H 3ULVC 1I1FB 2Y36L 2ICWJ 3CIQA 2KZWA 4R97C 1H3GA 5IBUG 4FQLH 4PRNA 3L95B 5CZVH 3KPRB 5KBNC 3HG1A 4JO4H 3JV0A 2L7UA 1FYHB 1L0QA 4NFCA 2YPLA 3DPBA 3QNYB 1MWAB 1JYXA 2NXYD 4TTDD 4WV1A 3DSFH 3QJFA 4HS8H 4NZRL 5HGHB 3VGHA 1OCWL 4ONFH 1EAPA 5INCA 5CEYA 3GSQB 1FG2B 5FA3B 2NY1D 3RA7L 1BQHA 5D1ZB 3CFJA 2JELH 4ZPVA 2DI8A 1QNZL