4F2ME

Crystal structure of a tgev coronavirus spike fragment in complex with the tgev neutralizing monoclonal antibody 1af10
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
148
structure length
148
Chain Sequence
PSFYTHTIVNITIDLGMKRSGYGQPIASTLSNITLPMQDNNTDVYCIRSDQFSVYVHSTCKSSLWDNIFKRNCTDVLDATAVIKTGTCPFSFDKLNNYLTFNKFCLSLSPVGANCKFDVAARTRTNEQVVRSLYVIYEEGDNIVLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural bases of coronavirus attachment to host aminopeptidase N and its inhibition by neutralizing antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Viral protein/immune system
molecule keywords monoclonal antibody 1AF10, heavy chain
total genus 28
structure length 148
sequence length 148
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3130 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f2mE00
3KBHE 4F2ME 4F5CE
chains in the Genus database with same CATH superfamily
3MBEA 1DVFB 2VN5A 2ERJB 4HUWB 3O6LL 1LNUB 3NDZE 3V4UH 4LMQE 5IHLB 1MREH 4LEBA 5ESQA 4W9IC 4XPHH 1D6VL 1NMCB 4HV8A 2O1AA 1U8JA 3I02A 3QORA 3GKWH 3X13A 5HVGB 3MRGB 4FABL 2CLVB 2GEEA 3U2SB 2F58L 4A66A 4H0HB 4CN6A 1H9DA 1DJXA 2AK1L 3N1PC 1KC5L 2H1PH 4L5FH 2ZKWA 1I1FB 4BFBD 4XPBL 5J1AB 3P77A 5ACZB 2QFRA 1BM3L 2N56A 2VW7A 3ETBF 2AEOA 3ZTNH 3DETD 4OCXL 5DJZA 2CO7B 3DYMA 2VZUA 1JF1B 3CXHJ 3E1ZA 2GJ6A 1SEBA 2X9YA 2JIXA 4GI8A 3HN8A 4JE0A 5F3HA 1KTRL 4EBQL 3CC5A 4V33A 1ZHLA 4NQDB 1E3FA 4OD1H 2VR4A 2AZUA 2I69A 1ZEAL 2G75B 4H20L 1EHXA 4NC2B 1AIZA 2Q8BH 2FATL 3F7KA 4G8GA 1UJ3A 1U4EA 3FSVA 1DFBL 1BVLB 3UAJD 1S7QA 4NWTH 4I8DA 4PJCB 4ZUWA 3QULB 2H9GB 4G6AC 1VHPA 5CWSB 3RWDB 4PJ6A 4V11A 1CFTA 3H2WA 5AW3B 4XRCB 1EFXA 1X5FA 5ERWB 3FO1A 1B0RA 3RX9A 3V8CA 1L0PA 2OMNA 4DQOL 1HZLA 4ZO9A 5AYTA 5LDUA 4ZPTB 3VD1A 1BJ8A 2BIOA 4RDBA 3I3BA 4M4PA 2L04A 1RD6A 4ZOBA 5DUPH 5F44A 4O58H 4FL4B 2GITB 3KJ6H 3VG0L 3BZFA 2AJSL 4I1RA 2B0SH 1GKEA 3MZGB 2EXYC 3L3DA 4CRPA 3GTVA 4HIPA 4ZNEA 4FFYH 2BVOB 4FQJH 3UTQA 1JI2A 4H8WH 1G7PA 5GS1C 5BZWA 4IBQA 4M61A 2AXJA 4YDVB 2ORBH 4LDEB 1B4RA 4ZSOA 3GJFH 2WTRB 1XGTB 4GEJA 4ZG1A 4BZ1L 3QDMB 3NH7H 2CMRL 3QHZH 4XX5A 4WWPA 1YEKL 4YHLL 4XE5B 5MP6H 3TEZA 2YOAA 2DQJH 3V6ZB 3MHZA 4U1HA 1OCZB 4MD4A 4HKZA 5MEPA 2XBTA 3IU3B 4RFOH 3HMXL 3LJ3A 4A7VA 1KNOA 4OR1A 1INQB 5ADOL 2EIEA 1RJYA 4KKCD 1R6VA 2E4FA 5IB3A 1IFGA 1Q90A 4EZJA 4I0PC 4OQ1A 4ZMWA 1UZ6F 4FEIA 5KVFL 1QNIA 3QORC 4MX7B 1XX9C 4Q9RL 3TJPA 5FW8A 3DTUB 1FP5A 5LBGA 4LASH 5ISZB 2FX7H 3DPDA 1A1MB 4FG2A 1ZIAA 5KYNA 4PJGE 5K39B 1FORH 4IGBC 3VFGH 3ABMB 4IOSA 4M6NL 3HS0A 1P4IH 3MLXH 1TVHB 2YGQA 4LU5H 2YSTA 5EEYA 5C2BH 3PAVA 2XZCH 3IMUA 2GCYA 3HEIB 4Z78A 2BWDA 3I9PA 1EJFA 4RMWA 3RWFA 1LK3L 5MP6L 5DUJA 4FG0A 4HMCA 4G5ZH 3CPLB 4HMEA 5KBKA 1NM9A 3LNEA 4WKZB 2AKRB 3QEQA 1QRNA 4S0HA 1HHIB 2ZUUA 3LN5B 3D69B 2BIPA 2ESVB 3R1GL 2BERA 4JRYA 4LSRH 3N43F 2B0SL 1L9RA 4F9LC 3NCJH 2O93L 3TV3L 5KTEH 3SDYH 4QRQB 1J18A 1F4WL 3P30H 4AL8C 3CV5A 4JKPL 1AD0A 1TETH 1MCOH 4LIQE 4Z7OB 3HFMH 2OW6A 4AYGA 2CIKA 4GKLA 4J3OD 4NOFA 4P4KC 3U9PL 1XIWB 1JPSH 2JKJA 3WGVB 2BO0A 3LNIA 5F88A 1F3JB 2YAOA 4ZO6A 3WFDL 3LN4A 1QACA 3IJ8A 1E6OL 2X70B 4FFZL 1UT1A 4TRPL 5DHMC 5FLVA 1JGLH 1QI4A 3H0TA 1IO4C 3HG5A 5EN3A 4OFVA 4PJCF 5C0BA 4MJJA 3ZYIA 5BS0B 2XXMB 1ETJA 3P9WB 2AXGA 1A14L 4HIJB 1TZIB 4PS8A 3MRKA 1OAKL 5I1IL 2NTSP 4NC1E 4DPRA 3D85B 4M5YH 1JCKA 3QO0B 4KKPA 2WZ5A 4ODVH 4X7FC 2B15A 2OMXA 4JM2D 5ISZE 4EZMA 1WAPA 3HMXH 1H19A 5TJWK 1KMGA 1JZHA 5AOMA 5GSVA 4PJ9B 2GC4C 1PL3A 1PNDA 2YD4A 4HUWA 5IOPA 3CFNA 1K8IB 3AREA 5AW4B 3ME0B 4GH7B 3T4AB 3HZVA 2E74C 5I19H 2CD0A 2WYHA 2QPUA 4Z7AA 2JK5B 3FH8A 4E68A 2AV7A 1JNJA 4ONFH 3S36X 2R0ZL 1FN4B 3UBXI 4J3OC 1GOFA 1AY1L 4EIBA 5B7FA 1MEXH 3ZO9A 4ELMB 1NQBA 4QR7A 3CWGA 2XWRA 3DJSA 3JWNH 3QFJA 4G5AA 4JZOA 4N86A 4MJIA 4Y4HC 4PRNB 1TLKA 3EHBC 5IVZB 1FFPA 3RGVB 2ZKMX 1XCQA 4AEIL 2VTFA 1V7MH 2XVLA 3O3BB 2DM3A 1W80A 4X5PA 1A9BB 2G3MA 2VB5A 1I8IB 3CVDA 4YHOH 1XGRA 2PPAA 1U3YA 5DQ9B 1WT5A 5B1BB 1BQ5A 5DQ9A 5TQ0H 4DO5A 1UXMA 3BRGC 1NBVL 1U8CA 1CE1H 3MUY1 5GRJL 3QFDB 2GJ6B 3QW9A 5IW1B 5J6GB 1LEGB 2OTUB 2DTML 1DQTA 1XB6A 3EYVB 4AVHA 5L2KB 4RFEA 3O3DA 3DO7B 2WWMC 5T1LD 5CEXA 2OMTB 3QIWA 3QDJE 4LRIA 2F68X 3GSQB 1JYWA 1TTAA 1TO5A 3SGKC 5C0AE 4AXWB 3BYTA 3FF8A 1G9MC 2JKIS 1SRDA 4OCSH 1J12A 3BKMH 2J12B 4EN3A 4F3FA 4PD4J 3MLWL 2X4TB 1MRCL 2WXPA 2H3NA 2DMKA 2H3NB 4IEFA 4K7PH 3FN0H 1I1RA 3U7WH 4OGAD 3KNBA 1EGJL 1CFTB 5BXFA 3UJTL 3HHRB 4JANB 1CTOA 4ISVB 3S9DB 5AENA 5TF0A 3IDJA 1U36A 4C47A 3GTTA 5AG9A 3RZCA 1E28B 3BUQA 2HRGA 3VWKA 2BP0A 3MOQA 1YNLH 3QA3A 4PS3A 5KG9B 3ZMEA 5AOIA 1YY9C 5IG7A 3F84A 1IAIH 1P1ZB 2NZ1A 1PU0A 1OOWA 1Z3GL 4AEFA 1YG9A 3DVNA 4I18C 1UA6L 4W9JC 3ES6B 3HMWL 4NM4L 2P26A 4O9HH 4XC3H 2RH0A 5ESAB 5L8JB 1S9KC 2JJSA 5F7EL 1GA2A 1YMME 3T2NL 5C0IA 5CEZE 5H37H 3QORD 4XBMA 3I75A 1WLHA 4ZS7H 3G6JB 3ECWA 3W0WA 5GGTH 1MH5B 1YC8A 2APTA 1IARB 2VE6A 4JFZL 4D3CH 5BJTA 4OF5A 3EH3B 1V7NH 2YRZA 4ZT1A 3BRFA 1JXKA 2RR3A 2X42A 2UZPA 1BW8A 1FSKC 4QNPF 3MRPA 1P6FA 3ATDA 4ELMA 1OCCB 1JN6B 1KYDA 3TWCL 4AQEA 3LVEA 1Q1JL 3OSKA 5TTRA 2XTJB 1IT9H 5JNYB 2KZKA 5HHPA 1TQVA 4JDEB 1IVTA 3WY3A 2YN5A 1I1AA 1Q72H 4J3WA 3CCHA 2PTTB 3I2CL 1HYRC 3VMPA 2BRRH 5DJ6A 2OXGA 1M7IA 1BZ7A 2Q2LA 2ED6A 5C0DB 3BH8B 3U4EA 3D3VD 4PHZA 4JG0L 4WUUA 1A7PL 3ZBMA 2JB5H 3L4TA 1KGCD 4Z77B 2IWGA 4Z3HA 4L4TA 1ESOA 3RB5A 4GFTB 4MB3A 4P9HH 43CAB 2QPEB 4GRWE 3EH2A 3UYPB 4G80A 4ODSL 3IGKA 4BUHA 5IMLA 4XNAA 5I8KL 3HE7D 2K78A 5CINH 5T1KB 3K8MA 1KFGA 3FTGA 3FTGB 3WIIL 3MKGA 4QHLB 2H2SD 2X53A 4YMPA 3ZKQD 1Q1JH 3KGRA 3TP4A 1KCKA 1N8ZA 2CKBB 4R26H 3RU8H 3SZKC 4S1QL 4AVKA 4RIRB 2NT1A 2N7SA 4Q6IB 1LWJA 4DCQA 2V3FA 4W93A 5JO5A 1N5YL 3W82A 2XZAH 2JJUA 3OB0K 4YGVB 3EOBB 3MBXH 5GXBB 4HKJA 1I8IA 4JG9A 1M6UA 3KH4A 3CHPA 3A4FA 1GH7A 4PJXB 1MVUB 3ULSA 1FFTB 2JKRM 3ESPA 3V9EA 5GPRA 5B38A 3V4PH 4S0TD 1M71B 2A1WH 2WWOA 4UYQA 4KXZH 3NCFB 1KB5H 1IAIL 3PHQB 4P2QD 2AERT 4Y2DC 1H6UA 1HH9A 4XC1H 5KS9A 4ZQTA 5IWLA 3RZCC 3QIUA 2DH3A 5HHVH 2W1NA 3TPUA 1ZA3A 5KSAC 3BRDA 1JN6A 5FDYA 5J9PB 3QDJB 1J48A 5DC0A 3RGVD 4RQQA 3WEAA 4CA4A 4QJ4B 4OIFA 5D1ZA 1QSFE 2HVJB 1G5GA 2EP6A 5B1KA 4P9HL 5BVJB 5K9QI 4PQXA 4ZZFA 4AL8L 1Y6NR 3BUBA 1E6JH 1FCCA 4R0LB 2OJZL 4OUUB 2Q6WB 2NSQA 1WWWX 4HIJA 4Y1AD 1LK2A 4MMXB 1E4XH 5CZKA 1ORQB 2NYKA 4C4UA 2V17H 2DQTL 1P84J 3WE6B 1D6EA 1THAA 3UTSA 2NNFA 3DVNB 5FYKD 5K59F 1U21A 1IGFH 3F04A 2V7NA 4M00A 4IMKA 3T77A 4H88L 4JG1L 1OAZH 3M88A 3WIFA 1J1XL 5TGBB 2CZNA 2ADFH 2G9KA 4WV1B 3VGBA 4YHOL 4NN6C 3VXUD 4UQ3A 2RMNA 4WFEE 2VJ8A 2Q7AA 1QFUH 3M6DA 4GQRA 2VLJD 4XBEH 4Z95L 4JLRA 4L05A 1KN2H 2DQDL 2IALB 2HFEB 4ZX6A 4AMWA 4JVPA 3WIHL 2OR7A 2OL3B 4FFWD 4CVZA 3MAWA 1SHMA 4MNGA 4PGCA 5DUBA 1KCWA 3S34H 1QUPA 1LTXA 1E4JA 5IHUH 3MREB 4H8HA 2GBUA 1E4HA 4FQIH 1SM3L 3IDGB 2VO8A 1OE2A 4PJXA 2Y22A 3GSWB 4L29B 2EUZA 4L29A 5B38B 4BYHA 2VUKA 3L95A 1KJMA 4PJIE 1LEGA 5K1VA 3TCLA 5IW1A 5J6GA 3NFPB 4XNMB 2A4CA 1A6AB 1BCIA 3JV5A 1S9VB 2HKHH 2R2HA 4UIKH 1A1OA 2XG4B 3GHBL 3EUDA 3GIZH 4YGAB 4OLYH 1JHKH 1HSBB 4FQCL 4N2NA 1SVBA 4MDIB 3GK8H 4X5WB 5I75C 3MV7E 2X7LA 3A47A 3EJZC 3FUEA 4EDXA 3G5ZA 3B2XA 5A2LH 5I1HL 5DHXB 1KG0B 1SHWA 2DQHH 3ARDD 4ODTH 2OK0L 3KPSE 2H9GA 5GGRY 32C2A 4MMYA 1JZ5A 4IRZL 4HJUA 2WLYA 1U91B 4L0PB 4JFQA 2VKXA 4NO0D 2UXGA 2I85A 2VDNL 2ZWKA 5LXGH 3QNXA 3S34L 2PYEB 1RU9H 3QBTB 2O72A 4BE6A 4H5SA 4NQSA 1D7CA 3LNFA 1W6WA 1LK2B 2XYBA 3VB8A 4D9RD 1OLZA 2HVKB 4I9XA 3T0BA 4XP1H 4P5KA 3WIHH 1ORQA 4Y4FC 3VRIB 4X0KB 1MHPH 1OP4A 1WC7A 1XB3A 2AABL 5ISZD 5EC2B 3UPAA 3VWKC 4PJIA 1QRKA 2ZSWA 3QCTL 4UOQA 1TCMA 4NDMB 3WN5B 3ZHKA 1M56B 4Z7IA 9CGTA 5DJDA 1S7UB 3CLEL 4J8RB 4L4VD 4MXWH 4O2CA 4PJXE 3Q2NA 4M6AA 5C9KA 2GUOA 3F6LA 3TGXA 4URTB 5FOJA 2AMUA 3KWUA 4G1EA 4C83B 5KW9L 5HDBE 3QQ3A 4DUXA 4YDVA 2X4UA 3VFVB 2DMBA 3N1MC 4BFIB 1L9SA 4PBVC 5DMJB 5T8IA 2OL3A 1B9KA 3DOSB 3PG2A 2H47C 2FWUA 3QUHA 4Y4FB 4LPVA 1OGAE 3V5KB 1DQIA 3MRLA 3AU1A 3PDOA 4UUJA 4YSAA 2QVMA 5CEYA 3G7TA 4UDUA 5C2BL 2WBXA 2W0KA 4GEIA 5DZJA 3CHRA 1TFPA 1YN7B 1T21A 2HA1A 1OP5H 4F8TA 5I1LA 1QEXA 1REIA 5ILTH 2ZYSA 1SY6A 4Y4KD 1TG8A 5EEZA 3QJFA 4XP5L 2KDYA 2X1PA 2YPLB 4TNEA 4XO8A 3IETB 5AEAA 1AHMA 3T0ED 4Y5XC 2R69L 2R15A 5I0YA 1RZKC 1DVFC 1YHPA 1NCBL 1S9WA 1GXEA 3MRJB 3ZUNC 2YGNA 3AM8C 2HB0A 4WKXA 3MACH 1OCRB 1TQWA 1X9LA 3IF1B 4YBQD 1B2WL 3B2UC 2VR6A 2V9QA 2X1XR 3AS1A 4E9SA 4F3FB 5BV7B 3LXUX 3NJVA 4CC4C 2I60H 3V52H 1KTDA 1AYOA 4Y16C 1XWVA 3RWFB 1AI1H 2F1AA 3HE7B 5F0LB 4FKEA 4APXA 2C9SA 4BV1A 2KL6A 2OSYA 1SXNA 5TFSH 2D4DA 4XN5A 3BGFB 1KPUB 3KDPB 3T0EB 3UABA 2A0LC 4EQ2A 3PE9A 5F9DC 1F4WH 5L2KD 3OWRA 2WCSA 1PD1A 2DLFH 3ZZQA 5F9JB 2BSRA 2HYMA 4MDRA 4ZAKD 1KIPB 2F74A 3GSVB 1PLGL 3JUYA 4Z7NB 5E94A 2C5DC 1XGRB 2VQ1A 3V6OC 5IHZB 3UZQA 3NA4A 1F3RB 4CVXB 1U8CB 1U8NA 3C60A 2VDKH 3FHAA 4WWKB 1CXIA 3FCSB 4PJDA 1O9VA 2VDPL 2F9BT 1LWHA 2CHZA 4KMLB 3PP3H 1WFNA 5C6TH 3CIQA 5DD0L 5DZPA 5HPOA 1E9QB 2CHWA 2HFFA 3SE9L 4NJ9H 1ZS8A 2IWKA 4Y4FA 1XAKA 5FYKU 1ZHBB 3GB7B 4TPRH 1OGTB 3UCQA 3OVUB 2XN9B 1HHHB 2YUVA 3H9SA 4ZXBB 3UH8A 4CGTA 4ZFQA 1FGVH 3VMOA 2EDEA 1P5UB 2AXHA 3D2TA 2NT0A 4FMFA 4HUMB 4BHUI 1KTLB 3EFFB 4FYSA 4YHKL 4ES9A 4UNVA 4XN7A 4LO9A 3L3IB 4UAHA 1H15A 3A6OA 3EADA 2QV4A 3QR1A 4Y2LA 1OE3A 2HTKD 3D85A 5IFHL 1SN5A 1NUFA 2WWKO 2OMXB 2IADB 1LE9B 3DX9B 4RZCB 5BQDA 4POYA 3SPGA 2B7DT 4MWFA 1AR2A 1DJWA 1T5KA 3WCYA 2DQJL 2JKTM 3NJLA 4NSKA 1KCSH 4XXDA 3MJ8B 5KUKA 1EO8L 3RFZC 4ODWA 5E6IC 1CIDA 1V05A 1L3NA 4YBLC 5D7KE 2F8OA 2K70A 4W9CC 2FR4B 3WU1A 2YBRB 5DYOA 1LP9B 3HNSH 3HI6L 2YLKA 1WUNT 2FB4L 5CJOH 1OQXA 4M7ZB 3NPZB 2BVYA 2J2ZA 2IAAC 3WXVH 2C9VA 2DQDH 5TDPA 5LGJA 4GAJL 1XGUA 4NKOB 1II4E 4X4XB 2F6AA 2B20A 1OGAB 1GL4B 3FRUB 4YGVA 1UZ6E 4JO3H 1KGYE 3N3EA 3OGOE 4E9YA 4F24A 4HIQA 1WIPA 3DO3A 4JGNA 2ZPKH 1T21B 5I1EH 4AEIH 3VGAC 2HMIC 3L54A 4AGQA 4N0CC 4Y2DD 3SEPA 1HXKA 4PRBA 2HX8A 4B9PA 2UWEE 1TNNA 3I3DA 5CGMA 3P73B 3WO4B 3ZTDC 3Q6GH 2VLKB 2V5RA 2Y7QB 3EH5B 4P2QE 5T3ZE 1YNKH 2NNCA 3E6FB 4M1DH 4OLXH 4Y5YA 4J2XA 4ZMAT 3PV7A 1UTDA 1MG2C 1JGDA 3MLSH 4DKAA 5JIMA 1LDSA 5BMFL 2K4AA 3IXAB 4YUEL 2BWIA 2VLKE 3IXAA 4RGOL 4WEEA 4P2AA 3CFTA 2ENYA 3NDYE 4ZS6C 3FCUB 4WNQA 4BWWA 4OCNC 3RNQB 4ERSH 4HT1L 3AT8A 2DICA 4NP4L 5C0AA 3WNLA 5JW3H 1IMHC 2Z8WC 1X7QB 1ACCA 3DMMA 4FYTA 1ED3A 4KZEH 2BVUA 3D05A 1C12B 3O4LB 3FNKA 4QLWA 1U3ZA 3X3GL 2H4EA 3AGWA 4A2HA 2JH2A 3FTXA 6PAZA 1MW1A 3FN9A 4QXVA 4WEUD 4XMVA 4BZYA 5C9JA 3TYFA 5KAQG 3MLUL 2XTLA 3MRHA 2OJEB 5FHAL 3MRNA 3GM0A 4LSVL 4M6OH 5MI0C 4I18B 3GXPA 2XU9A 3NRPA 4LDCA 2CHDA 5I1CL 3EOTH 3Q9PA 4G8IB 5AAPA 2IPTL 2ITCA 7FABH 1RVFL 2RIKA 1LP9E 2DQFB 1XGTA 3FKUS 3EJZD 1T03H 4DSYA 2K6YA 1IBZA 4W9EC 1F00I 3GPSA 3QDGD 5KTEL 3ZKNC 4AH2B 3ARRA 3V4UL 1X5GA 2BSSA 4HD5A 1FSKB 2FEDD 1D7DA 1F58L 1X9QA 3HCVB 5DVMA 3RGHA 1YUKB 3QIBC 1FE8H 3DX2A 3FRUA 5CFAA 5L4FA 3TS8A 3LD8C 4WV1C 4DJMA 1AAJA 1JZJA 2ZOLB 5CD3B 3UAJC 4ENED 1PKOA 4NQCD 3DHJA 3AWGA 4YR6A 3WN6A 5A40E 1TEFA 2P24B 3ARDA 5DRZA 1ZWIB 3GO1L 3K1DA 1U8QB 4H8VA 4R5VA 4BA0A 4HLZH 3H9SE 2CALA 2J5LC 4JG0H 5DTFA 2CBPA 4LCCC 1NUGA 1UG9A 4FX5A 3IFLL 3Q43A 4KK9C 3RY5A 3NZ8B 3BVTA 2WYIA 3T6XA 3B6SB 3HG0A 3SYPA 2H2SC 3GNMH 4ZW3A 4BEIA 1A3QA 1KB5A 2WCPA 4AXWA 3F7YA 2KH2B 1OM9A 5IOKA 3HS0B 4FCAA 4MMZB 1AANA 1YEHL 4WV1A 3OR6A 5J1TC 3V0WH 4P59L 4DFIA 3ULUL 3O6MH 4JFTA 4KV5E 4HF5H 3DGGB 4JN1H 1JXGA 5DDHA 5EUOE 3KPRE 4L37B 3NIFB 4XP5H 1MJUH 4X6FA 5FYLE 4ZMNA 1AS7A 1KXQE 3PL6A 4I2XA 5DRXB 3K0WA 3CFJA 4AW4A 3D2UB 4G9FE 1UXSA 5DFVD 4PI2A 3QQ4B 5AW2B 3UBXA 4ZK8A 4JRYB 1WBYB 2ZX7A 3GSWA 2P5EB 3W3BA 1YAIA 4Z7UE 3TBYA 2MQGA 1CGTA 5EORH 3ZTEA 1RULH 4Q58C 5E8NA 2X89A 2Y36H 5DC4B 4PJ5B 5DT1H 1AQKL 3U1QA 3V6OE 3WMSA 5A2JH 4D2NA 3SBWA 5L9DL 5KVFH 1C7SA 1G6RL 4W9HC 3V0WL 3RDTD 2DPKA 1UCBH 4PGBA 1GRWA 3CSYA 1RZJC 1R33A 3PDGA 5IIEA 3KWXA 4DVBB 4NM8H 4FJZA 4QRTB 5IF0B 2OAAA 1VFBA 1XH0A 4LSDA 4H25B 2IDUA 3UFIA 3WNKA 4NRYB 5I17A 4BCXA 4PW4A 2BX5A 3IE4A 2BSBA 4ZS6D 1QR1B 4HLEA 3L3IA 1D5ZB 5KBPA 3GMMB 4JR9H 5EF1A 1AP2A 4CSPA 2HLAA 5ICXA 1ASQA 1YEKH 1WUZA 1CWVA 1W6LA 3K5SA 4I48A 2ZCHH 4HFUL 4M9PA 3PP4L 2EDXA 4GRWB 5IVNA 1DJGA 2C4FU 1NINA 4N2KA 4P8QA 5HHMB 3O6FB 1HC1A 1E40A 1YMMD 1NPJA 3UROR 3F5WA 2EEBA 2YEQA 1M3IA 4N3UA 1UUSA 4QAWA 1KJ3H 5E03A 1CFNB 5H37A 7PAZA 3SCMA 5GGVH 4ELME 4PLKC 2WIIB 2XIDA 3QRBA 4JFSA 3S36H 1NUDA 3MUGB 4HPYH 2AANA 1A0QL 1JWSA 1XH1A 4KUZL 2WTRA 3GJEA 3IBOA 4P5SA 2D3VA 5TE7L 2XN0A 3MRQA 1U8HB 3RG1C 3JWOC 2C9AA 4HK0A 2Z4TA 3TH2T 4M4RB 4L4TE 4M4RA 3LN5A 1ND0B 1T22B 3VXMD 1BFTA 4IRZH 2GTQA 4KFZC 4FMKA 1BVNP 3NK4A 3L3OC 3N0AA 3TEXA 5FV2A 1KC5H 2VLJB 1OW0C 1L7IL 3DSNA 3IDNA 2A4ZA 3CU1A 4ENEC 5DZAA 2BSDA 1ZJBA 4XB7A 1H3TA 1LJMA 1VDGA 3ZHDA 3L4UA 3ZKXB 2BY0A 4IKLA 2K9FB 4E9LA 3HJ0A 4KQ4L 4QRSA 1G1CA 3IS0X 1CJYA 3VRLF 4HJ0C 2IBGA 3I84A 4WTZA 4Q6YA 5IM7B 5EDSA 2XRAL 5TDOB 5A7BA 2VLLB 2GSGA 3ZE1F 1UM5L 2NY7H 3AB0C 4H44C 1EBPA 1RXLA 5DEFA 5D4HA 4Y1AB 2XWDA 1W72A 5D4QA 1NCTA 3N0PB 3HA0A 5IW3A 1I1YB 5FO8A 4YXHL 2VLRA 3DRTA 3HBZA 2IAMC 3DGCR 4L3CB 1I8KA 5C07E 4JM2B 1NKOA 3QHTC 1YY8A 4JM2A 3G5YA 3HOGA 2XV2A 3GMMA 4BM7A 4GUOA 2R1XB 1NFDB 1CT8A 1KFAH 2VXTH 2X38A 2JCCF 2EVIA 1EXUB 3CH1B 1F13A 4OJFH 3VXNB 3ARBD 1E28A 2V9TA 3CK0H 1A0QH 3I6KB 4FAAB 3WHE0 5EN2B 1ZTXL 1FC2D 2VLJE 2DIAA 4N25A 3QWOB 2V9RA 3AAZB 3EJCA 4RH4A 4UZUA 1Q0XH 1JV2B 5E9DD 1SOKA 2DKMA 1JZ7A 1UVQB 4MLIA 2X0UA 4L0YA 2CHNA 3HZMB 1N70A 2JJWA 5HHVL 5T3XE 3B2VL 1IBYA 4HIEA 5G4NA 3OM3B 2VSCA 2X4UB 3VFVA 3SYAA 3D39B 2JJTC 4OM0L 3HMXA 3M1BB 4GSDH 5AZUA 5C3IA 3QIUB 5C70A 4OGQC 3MPCA 3O2WL 4BDVB 1OLLA 3V95A 1RJCA 2IV9A 1JIBA 2VISA 3VI4B 4KZ0A 1F6AB 3CD4A 5I30H 1BMWA 3RL2A 2GKIA 2V8MA 4GKZB 3VXRE 1CDGA 1AZZC 2A6KB 4UU9B 5ABZA 2V5SA 3FFCA 4XVSL 5CSZA 1GC1C 5C0NC 5TK4A 4GMTH 5DLLA 2QQLL 4EUPA 1S7XA 1IU1A 5DRWA 4KO7A 1GZQB 2CPCA 3KPSD 1LYQA 1XTMA 4JN1L 2X2HA 4M7ZC 5JHDE 3M45A 5BZXA 2NZIA 3WY4A 4CJ1A 1S3KH 1A8JH 4NHUA 4XC1L 3ZDZE 2X41A 1HSAB 1IM9B 2Z34A 4RDQG 5ICYB 1KGWA 3T77B 3PPSA 2NX5D 3MOBL 2R7EB 4J6RL 3TA4D 4A7GA 4J39A 1G1KA 4MMZA 4NSKB 2OP4H 3C8DA 3CXDL 5T1KA 5J89A 4HZ1A 3TBCA 3RZCD 2K9UA 2HFGL 4KK5C 4WFED 1OM3L 2Z93A 1URIA 3MJ7A 4WHYG 5C6TL 4H0LC 4LARH 4U1JB 1TQCC 2H8PA 3D30A 5JPMB 2TRYA 4KWUA 4HU8A 1R5IA 4YO0A 3PHOB 1F4XH 4MJID 4PJBE 4AGPA 1GJIA 1HX0A 1PY0A 1T4KA 3DTXB 2J8UF 3PUUA 5EZPA 1T1ZA 5T3XL 4YK4B 4JO1L 4DN4L 3P0YH 2NY2D 5DU7A 1N64H 4XWGH 4OLEA 4RWHA 1PZ2A 1DBAH 3D2UD 3CN1A 4ZUUA 4FTVA 1RZJH 3KJ6L 1QVOA 2GUOB 4PHXA 5IZ7A 2W81C 4PCKA 1DCLA 1ACYH 5E1HB 2K8QA 3HG1A 2AQ2A 3GMNB 3JTBA 5I1CH 4URKA 2E9GA 1S9XB 1JBJA 4OLUH 2VSMB 4X7TB 4X4YA 3T2NH 5IR1B 1G87A 2W94A 3IMSA 4HCIA 5E1GA 5F1OB 4M02A 5EUOA 1UYWL 2CRIA 4LLMA 4P3DA 4DEPC 3OXSB 5EWIL 2B2XL 3K6IA 1QFWL 4LVNC 2FX7L 1RUMH 4UTAH 4NRYA 3QUZB 5CU5A 4R0LA 4RRPG 3L13A 4TQEL 5D71L 3TYGL 4Q9RH 1TU2A 1U8OA 2GHWB 1GAFH 25C8H 4DP7X 3TWCH 3BP5B 4K8RL 3RKDC 4WIQA 1M7IB 1OV8A 5AL8A 5C0JA 1YPZB 3A4AA 3GLDA 4YHYB 3VWKB 3W1ZA 3O6FC 2VRAA 3WN5C 4PJ7E 3FZUC 3H9SD 5FDWB 1MRCH 2HG5A 1BJ1J 1PZSA 4L3AA 4M3HA 4PRDA 4L3EB 2ITFA 1BIHA 4FFYA 4AQ8C 1PZCA 4DEPB 1I9JH 4OV5B 3DRQA 4WW1A 2JLPA 1N6QL 4XCYB 1PAMA 3PWPE 1JHTB 4R0LC 1DBJH 2YOCA 4UOJA 3EYSH 4QLRA 1RUQL 5FR3A 1F6FB 2VR7A 5F7DA 3IDMB 3B3BA 3MRQB 2X88A 1E8WA 4XP6L 4IBUA 1LVEA 1MCFA 4FLQA 3HUJB 1C1EL 4X7CC 3VI4E 4OIIH 1A9BA 3F85A 5D1XD 4DP5X 2J57A 5B7EA 2VUOA 3IU3A 2RA1A 1U4FA 4FP8H 5EF0A 2X89D 4P2RA 5IVOA 4HPOL 5ANMA 3F2LA 1JF1A 3H3PL 4HQQH 3PY9A 1MAKA 5KYUB 2OYKA 3BYYA 3FT2B 5C09D 3D3VA 1FL6B 3UBFA 3Q05A 5MEOB 3QG6B 1KENL 4JFHD 2ZKXA 3ZL4L 3FCGA 3KYMA 4MZIA 5JLZA 1TENA 3IWUA 1FZJB 4QHUB 5F7MC 2DTMH 3RX7A 3VSQA 1T0PB 4P5MA 5FIEA 4Z5RB 2QT6A 3TASA 3U7YH 2FSEA 3MFGB 3TPKA 5IJKA 5CO1A 2F8VA 1K8DB 2F8XC 2Y4SA 1TVHA 3A67L 2HVBA 3O4LE 2ZXBA 2XRAH 4P2CG 3GS0A 3DURB 1VZGA 3VU1A 5HVHC 5CCJA 1D5ZA 5I8OL 1HKLH 4DVRH 1EDHA 1EEZB 1U8OB 2WQVA 4GLRH 4FQLH 3SKOA 4D9LH 3I50L 4TSAH 1B4JH 5A2AA 4CDGC 3DGDA 1KBGL 1J0ZA 2K7QA 2QBWA 3FUFA 3B5HA 4MZ3A 2QR0A 1KJ2A 3JYCA 5E9NA 3TBWA 4DUWA 2VAAB 4LOUC 4HHAB 4NHCH 5M7QA 3OR7B 1GW6A 4UCFA 3OV6A 2ZUXA 4I4WB 3A23A 4W6WB 1S7RB 4LVOB 5FYJU 3WS3A 3PWLA 2A9BA 5IHUL 4YSSA 4Z3GA 2EC8A 2PCFA 1M71A 3NACH 2PCFB 3FCSA 1ZHKB 4PJDB 4NCC2 4N20A 5IHWA 2WXRA 5F9WB 5BJTB 2E8ZA 3DX3A 3F6JA 3AABA 4G11A 3OAZH 2C3HA 1ZDSA 4Q8BA 4QOKE 5DD3L 4OI8A 5AOKA 5GS1A 8FABA 3L81A 1EDYA 3KAAA 1L5GB 2R8SH 4ZX5A 4EVNB 4R4NC 2GJPA 5HD8D 3ULUH 1IAII 5E4IA 1PLGH 4N8PA 2Q7NA 5INDB 2IOOA 2ZWZA 4JFEA 2ERJC 4TUJA 2IC2A 5DD5H 1OTTD 4UANA 1ZT4B 4M48H 4LMQI 2HMID 4PB0H 2EIMB 4H2CA 2VABB 2C1PB 5T1MA 4NO3A 3PUCA 4U7KA 1HOCB 1K2DA 4PREB 4O51B 5DF0A 1RJZB 1RJZA 2BRRL 1A8ZA 3CFCH 1P84K 1YJDL 3B6SA 2GQHA 4R2GC 4JKPH 2R7EA 1E9PA 2A74C 2VW6A 3OKOB 4K9EH 4AEHH 2YA2A 3HHMA 1SEQL 4NC1C 1BZQK 1KXHA 5LBSL 5SWQA 4F57L 1AQMA 3VM5A 3VXPA 5A16A 3F12B 1YJDC 4W4OA 2XWCA 3BHBB 4XO5A 1I3RA 3PGDB 4DN3H 3PF2A 1XQ4A 4UV4L 5D5ME 2EIZB 3CPUA 1A1NB 5HDLA 4OCWH 1N0XH 3EOAB 3WJMB 3LVTA 1RZIA 1RK1A 2X4PA 4IRSB 3FAWA 5EORL 3ZO0A 4NZRL 5B4MD 1GY1A 2F7QA 2CUMA 1RZ7L 1NCDH 1IKFH 1N12A 1HWGB 5C3TA 3KPOA 1CDJA 2J6WA 2CO7A 3RWIB 3VD2A 1XH3A 4PJCE 4RA3A 5D1ZD 4DO6A 3K6SA 1PX3A 2WP3T 4FTVB 4MJ2A 4PIRF 3QXWA 4QTHA 3C60B 2CIKB 1BXUA 3MROB 2IOMA 4H1LH 2XKUA 2EIKB 2VQ4A 2Y6SD 4ZNCD 1HH9B 4Q52A 4GPVA 3GBEA 2EUVA 3B2VH 2X9XA 2J88L 2WK2A 1G43A 4KQ3H 3NFNB 1J10A 2V2TA 4IMLB 1EUTA 4GB9A 3S6CA 4F57H 5IBTL 4R2GD 1GZPB 4M8UA 1F3DJ 1PVHA 2WOYA 3OPUA 4W1TA 3MV11 1PG7W 1TJIL 4UT9L 2XCMC 5HPMA 3QQ9D 5I17B 2CKBL 4BFNA 4G9DB 1TTGA 3HPJB 2V5TA 3TO4A 1H15B 2CR3A 1K85A 1CT8B 1TZIA 3FO1B 2AXGB 2MHAB 3QHZL 4PRAA 1U9KA 4NO3B 4OFYA 5LXGL 3PNRB 3WTYA 4H8WC 4RAUB 2X3AA 3Q6GL 3AS2A 4GT0A 4ZUTA 5CR1A 2MOVA 2DEYX 3OKEA 3L3KA 1AXTH 2VDOL 3CUPA 5K39A 2J4WH 2CXKA 1FE8L 1X6LA 1NIFA 2MNJB 3FN3A 3M7FB 1O7DE 3SSGA 3MNWB 1OSZB 3Q2CA 4CSSA 4EI6B 3BAXA 3FB5B 3KJ4B 4IJ3C 4QO1B 1CG9B 2BHUA 2CJTA 3MCKB 4BQCA 3O8XC 1MNUL 4GBXA 5AL0A 4PVLA 4M61B 4Q9QL 3VFRB 4HS3A 1PS3A 4KFMA 2I07B 3LKPB 1GSMA 3STZA 4E42B 2JIXD 3NVQA 2VISB 4MJIB 3JXAA 1CFMA 3GZKA 4ELDA 3QFJB 4JZOB 3AU1B 1QI5A 3PDOB 4FDWA 4X4XA 4XMLL 2APXA 5LGJB 2IAND 4F80A 1Z3RA 1TEGA 3OKLA 5L7XH 3IDGA 4KO5A 3G9AB 1B4LA 3NSFA 2YXVA 3UC0L 5AWNH 3KJ4C 4IJ3B 4K73A 2FCBA 3CN0A 3LPOA 4KK8C 2AEQL 5FYJH 1UM4H 4MZRA 1A6UL 3B83A 4LPUA 4TQHA 1DSYA 5IB5B 1FFNA 3QUYA 4PREA 2DLEA 4RBPH 5HGAA 4BFKA 4KJQC 4DVRL 1QFUL 1CXLA 1M1XB 5ITFB 3T3PF 4AJWA 1IC7H 5B39G 3RJOA 1CICB 1M6OB 3QNYB 3QUXD 4HUXB 4LCWB 2Z31C 3SDCD 3DIFB 4NKIH 2ENJA 1H3GA 4XVJH 5DWPA 4GMSH 1T0NB 2Y72A 1G0DA 2R9HC 1F8TL 2VN7A 4LNRA 2C1OB 1I9RH 4LNRB 2P5EE 4GAAA 4TUUA 1D5RA 2VLRB 4L1LA 3PAYA 3HI1A 3QP3A 1BVKA 1JZEA 3LZQA 1ZK5A 4JFQB 1OARL 4LPXA 4WW2C 3G5YB 4IW4C 3KPRD 4NJ9L 3EAKA 4Z7OE 3CMGA 3V9CA 3WO4C 2Q6WA 4PJHA 4QKTA 5E2TH 2E76C 3PDDA 1XIWC 3HNTL 3QC5X 3VD7A 1AO7A 1WSST 4R5TA 3TT1H 1JPTL 2G2NA 2BIIA 2J8UB 1JNHA 1O6SA 2X6BA 5CEZH 2ZUVA 1MREL 3ARGD 1N5AB 2FYYB 2RHEA 3IFNL 3L1EA 3LD8B 1DL7L 1FNFA 4KJWC 5I76A 5MERB 4WUKH 3FFDA 2GTZA 4QRFA 2TSBA 3OLGA 4AMXA 2Q3ZA 4PI0A 1A5FH 1G7PB 4Y5XA 1GGIL 1AMYA 3QORB 5E6IB 5DYFA 2UY7A 3L5XH 1FZOB 3C12A 3STZB 4E42A 2FHCA 3BPLC 1SLXA 3BE1L 2F8IA 4DETA 4C56E 2CDEA 1P4BH 1JXJA 3SJVB 5GRUL 1NC2D 1SHSA 2MPVA 1DVSA 4WI9A 1QUNB 2WAQA 1OM3H 4S1SH 4KKAD 5FHBL 3GMPB 4BRVA 4UTAA 4XPTL 4KMQA 4OZ4B 3PWPA 1NDGA 2AP2A 1UWXH 1F2QA 3QUMH 4UT6L 5I71C 4RDQF 3WFHA 4GRMB 3CLFL 3ZE0B 5E6ZA 3QZLA 4G71B 5K9JH 4XN8A 3K4AA 2H0JA 1HEZB 1BJMA 4IK7A 5F1SA 1GOGA 3RHWF 3SDXF 2YR3A 5BQ7B 3S88H 2FAUA 1HSAA 5GZNC 2BNUA 3WKML 3ZL1A 2NY0B 5A3IC 3AW5A 5AW8B 5JOEA 2D31B 1HQRA 4KBPA 3P40A 3QIWC 1K8IA 3BWUF 3IU4L 1Q0YL 1VFAA 2N3JA 3SGKA 3DYPA 1KJVA 2OZ4A 5L0QB 4IGBD 4P5TA 5MEQA 3LS4L 3WTTA 4J2QA 1A66A 1L9OA 1QLRA 5B1JC 4ZFFB 4E0RB 4GW4B 1J1PL 4K3DL 3TCTA 3QJXA 1OAUL 3K1KC 2Q3XA 4NKQB 1XMWA 5DJAA 4XP4H 5IROC 2Z7UA 3VD0A 4F33B 4HK0B 4YZFF 2A73B 5KW9H 3FQYA 3PWNB 4JB9L 1FO0H 4IRSD 1Y6MR 5AVWB 4GO9A 3C6LB 1DANU 3TVMB 3JV4A 3WLBA 4YK4C 3JV4B 4FXGC 1DL7H 1T1XA 2XPZA 1IFHL 2CUHA 2GY7B 4L5FE 4WU7A 2D73A 4QGYA 3KGUA 2Z7WA 2MIZA 5F3FA 4A6YA 1OGPA 4KVCL 3VU2A 3OGCB 4KJYA 3CX5J 2BVQA 4MXVF 5JIHA 2ICEB 1QTPA 2PW2A 3EJYD 4LXFA 2DMCA 3MNZA 3FT3B 3FXIC 1NAKL 4U05A 4PJFA 5E8PA 2ZX5A 3UJIH 3LHPL 1E43A 4LCWE 5C0BD 4W70A 3AUVA 3SIKA 1L7TH 3VTAA 4IOSD 2I7OA 3OXSA 3HNVL 4N85A 4Z7NF 3ULVF 1KUMA 1MFDL 1QR4A 4LLMB 4P3DB 2P47B 4Y5VB 3EFFA 4ATTA 1XH2A 4BE5A 3D4ZA 1B0WA 3RWDA 1DBBH 3MNVA 3R8BB 4PRHB 4WFGE 5BXFB 3R7RA 3RL1A 2Q76B 4NQEB 1I4FA 2HTKC 5DQDL 3L5HA 3T1WA 3F7VA 2ATKB 4NP4H 1GZQA 1KCBA 2VLKD 4PGDB 4XOEA 3N40P 4HWZB 4PRIA 1ZTXE 3HI5L 4XPTH 2PABA 4RFOL 5D6CA 5AKRA 3C5ZD 2Y1AA 1H6EA 3LKRB 1DE4B 3BPOB 3JT2A 2IG2L 4KI1A 2C9RA 4MJ6B 2D03H 4RNRA 2NY0C 3LKOB 3EBHA 2VR3A 3HMWH 4XMZA 5G4MA 5I6KA 1O6TA 2OBGA 3QS3A 4JDZB 3W39A 1KENH 1ES0B 1Q94B 4ADIA 2QSQA 2BNQE 4Y5XB 2IH3B 2QVTA 3OJDB 5H35A 1SVCP 5JW5B 3TL5A 2WM0A 3GJEB 3ZIYA 4Y2OB 4JQIH 3D34A 4XO3A 3FMGH 4O5LH 1FFPB 4C56B 3LYRA 4FNLH 2QADC 4HKZB 3M17B 5BV7C 1JGUL 1UWGH 3WNMA 3DETC 3ARBC 3AT9A 4GAJH 2DKUA 3PQYB 5ID0B 1HH6B 2IAMB 4UQ2B 4ZYKA 3JTSA 2EDYA 2E7LA 2RAMA 2NDGA 3O3AA 3KXFD 2HJLA 1J8HB 4E5XB 3BGFC 4UDTB 4NKMB 3DMMC 5LGHH 2YC1B 2CU9A 2DWSA 3QYMA 1J86A 2VC2H 4N3TA 1KGIA 5B38G 2BSCA 4P3CL 3ULUC 3V7AE 43CAA 2PYEE 2KZWA 4GKNB 1KCSL 3ZTCC 4R7NB 1G7MA 12E8L 2XETA 1RUAH 3C5SB 3IMVA 4NQED 5AYUL 5FUCE 1T4WA 1YEIL 3RNQA 1SOXA 3EZ8A 3KNBB 5GS2D 2ZAGA 2VL5B 4JY4B 5T1LB 4JPVL 1AFVH 2X3CA 2CO2A 4XXCA 1SMDA 4WU5B 2OTPA 2CGRL 2PWFA 4XZ4A 1IAOA 1UM4L 3BZEB 3NPSB 1U58B 4XMUA 3P3SA 1NTDA 3ESOA 3QDGB 1CFVH 4N28A 2QLVB 2WQWA 4Z7VA 1CFSA 1CVRA 3IFPA 5KAQF 1IIKA 3HC0A 4H26B 1CR9H 3SGDH 1HXYB 3RLSA 4YHNA 3RWIA 1JE6A 3EF7A 1WFUA 1EHLH 2FL5B 1IGCL 2DW5A 3QCUL 4P04A 5FO2A 1NKRA 3U9PH 3CX2A 5F89A 2WZ6A 5K9QG 4Z7OF 1FZKB 3C6LD 2D7QA 4FZ8L 1UKQA 1FZKA 1S2EA 3ABZA 5JOFA 1A7QL 1A4KA 3FU7B 4BFEA 2J2ZB 5IJCC 1UWYA 4BSWA 1DJIA 1SJMA 1UA3A 4PRNA 5IVZA 3QISA 4S1RL 3QUZC 5BVPH 4TQEH 3O11A 2HKFH 4X6EB 1HL8A 3ZDXF 4F93B 3CX5K 4DN4H 4K15A 2B2XH 3DVIA 1NGPL 1ZKAA 1FVCA 4EEEA 3TEWA 4Y7MA 3O0RH 4I9WE 1UH3A 3OJMB 3T1FA 1U95B 4HCRA 2YJLA 4GRMA 3MN8A 4K9EL 5JXEC 1ZTMA 4Q89A 4RMTA 1S7VB 1WCBB 2WBWB 4NQQA 3ZRCC 4ONGH 2DLIA 4OCRH 5DLML 1UFUA 4NQEE 4DZBA 3GSNA 2A0LD 2F7OA 2YRLA 4RAUA 5J4MA 4KX8A 4Z77A 5EEVA 1FYTB 3E2HB 1DQLL 1BXAA 3DX9A 1CD8A 2BS71 1T3FA 3P11H 1PGRB 4F58L 3WAKA 5C08E 2WD0A 2MKLC 3CTTA 5EIIA 4LCIL 2IGLA 3T9WA 5ABAA 4GQZA 2O6CA 2FSDA 2H32A 4NI3A 1ZLWK 3OF6D 4F9PC 4F2FA 2M1KA 4JAMB 5B39A 3OLIA 2ZYIA 5ETUB 4KNSA 2VXSL 3BGMB 4UTCA 5EBMA 3VH8B 3MA9H 4XVTL 3VFRA 3QXUA 4BQ9A 3HG4A 2J1WA 5FO7B 4PMFA 3SJVD 4HBQA 2ALAA 4PRPA 3WLWD 5B1JA 5HGDB 3DBSA 3GS4A 5TDPB 3WD5L 3QK0A 1H6FA 3LKNA 4PV8B 3RWJB 5F7NC 4CNIB 3BD3A 4Z7VE 1BGXL 2Z4QA 2ITEA 4KKBC 3WY2A 4DIXA 5DA4A 4DGYH 2QADD 1CD0A 1WBYA 3L5JA 3JWNE 5I30L 1OVZA 1DQDL 3JWOL 1N6UA 4WU7B 4G6ML 2X40A 3TEUA 4OSUH 1AD0B 3CVIH 3G6JA 5C09E 3DARA 3UTQB 5EU3A 2XICA 2NCEA 4TNWF 5CN3A 1BAFH 2Z92B 4FFTA 4AENA 4DGVL 4YSUA 2IGFL 5T3ZH 1HCFX 1GMIA 2WUCH 4X80H 3C60C 4J23A 2WO4A 4ANXA 1VEMA 4K7FB 1OT1A 3SDDB 1PY9A 3WKQA 2Y1YA 2JKWA 2GIYA 3CLEH 1NGWB 1Z1WA 1HK6A 3QUML 3WFEL 1JJUA 3LZNA 2XFXB 1VFBB 1HZHH 3PCYA 4ZUVA 2IBZY 4QRTA 4TSBH 2VXQH 4IEFB 3AMKA 1KTCA 5C0BB 1PJ9A 2YMXH 5J0BA 1IC4H 4JDTL 3S5LA 1JMZA 3CVBA 3C8KA 4P2OB 5E6YA 1B0RB 6CGTA 4R90H 1NIDA 4P48A 2VDNH 1K2DB 2MWCA 1S9WB 1TZGL 4JZNA 1Q72L 5DMYA 1JZIA 1CXHA 2L3BA 3MLYL 2YXMA 3DX6B 5FYLL 1WBXA 1EEQA 1SJVA 1X4XA 1BREA 3FT0A 1KYOK 3H42H 4YS4A 5BW7C 2DDQH 4MJ4A 3OHMB 1CG9A 2XZQH 1MI5D 4W4NA 4HXBH 3VVVA 3EJTA 4KKLC 1AKJA 1AYRA 1NA8A 2DBLL 1ZV2A 5JW5A 3ARUA 4XP1L 3KW8A 2G9HA 4WLCA 4J5VA 1FAIH 1BM7A 2XI9A 1A7OH 2QADB 4PLNC 3QFJD 1F6AA 1VGEL 3T6ZA 1FPTL 1T7VA 2WHVA 4A39A 3W11D 1I1FA 2B1HL 5F7EH 3RGVA 2DM7A 4PJAA 5LQBH 2G60H 3VXUB 1WA0X 2NY1C 2QKIA 3FSWA 2PO6B 4M5SA 3D48R 2H6OA 4JQIA 5KEZA 1AGCB 1YPZE 2EDLA 3NFSL 3SDAD 1JPST 2IMNA 3F58L 4ZTPL 5FA3B 2DY2A 3KXFA 1IE5A 3RUGB 3VGAB 4GXUN 3N55A 4D94A 3KPQA 3VFUA 5DJXB 1XB8A 3BUYA 3LQZA 2PR9A 2IANA 4X4MA 2QZ5A 1GJWA 3MRJA 1AHWA 4NRZA 4NGHL 4JO2H 5BZDA 3GT6A 2PR4H 1DBBL 3TVMC 4F8LA 4MGXA 3TBTA 4R7NA 3A0OA 1OO2A 2D7PA 4QYOA 4JCWA 4NC0B 3JV0A 1RZGA 1XEDA 3T09A 3GEWB 4L3CA 2PYFB 2YK1L 3G04A 1LO3L 3UTTD 2X2YA 1KDIA 3D07A 1Z9MA 4HUNB 2BRQA 3II2A 3MFFB 2BC4A 5GS0H 1NGXA 3D9AH 5EOQH 4J3OF 5IUSA 2MH4A 4PJFF 2XQYK 3Q13A 4ZODA 4D8OA 4UTBH 4NKDA 5BUPA 1Z0NA 2VXQL 2FT6A 3S36L 5DSCB 5IUCA 1MRDH 1YQVL 2HJFB 1RHHA 1I3GL 2AK4D 3E8UL 2PO6D 1R3LB 3TVMA 3MRNB 4FI8A 1FVEA 1Y6KR 5GRZA 1NEPA 2OJEA 3TIEB 1AOZA 4HWUA 3Q2WA 1AMXA 2PWEA 5EPMB 1M42A 1EVUA 4GW1A 5ALCH 4PUBL 1YSOA 1YO4A 3EXJA 3OWEA 4N2EA 2CH8A 4A6YH 2YA1A 2R0ZH 2YUXA 5FKAB 2CBTA 5JMRA 4A38A 4IBTA 4POUB 4QXGH 4WSGA 3ZX1A 5DUBB 2YHGA 5K1NA 1PQZB 4JREB 4NNYA 35C8L 1FO0A 1RURH 4PTUB 4X6DE 5KSVB 2EUXA 1JI1A 5D2LF 3D06A 1I7UB 2E7DA 4XNQA 5DJ8B 3T2PA 5LLIC 1IKFL 4E9RA 1S4IA 2FO8A 1RL1A 3K80A 3IJYA 4U6XB 3D12B 4U1KA 4AIOA 3S8FB 2D7OA 2OM5A 3AC0A 3B2PA 2ZCLL 5FXCH 3ARDB 5DRZB 1TQUA 2C1PA 1L9PA 3A22A 3NIFF 5KYUA 1HEZA 2GB2A 1UATA 1IFRA 1KTJA 2P80D 4BINA 2AVFA 3K2UL 1DR9A 1A7BA 1D6EB 5FX3A 1TVBA 1XO8A 3N9GL 3V7AG 4Y89A 1I7ZA 3GDCA 3T8MA 3KH3A 2WSKA 3D51A 3EYFB 2A6IA 2IH1B 2D8KA 4JVUA 1TCRB 4FG6C 4N2FA 3DUUB 2ZKHH 2YAHA 4WJ5B 5E00B 2BCKB 3NCCB 2XTJD 1ICTA 4B27A 5D9SA 5FGCE 2IBZX 2NXZD 1B6UA 3ABLB 4OIBA 1AGEA 2QGCA 1IQDA 5LWYH 1KIRA 4XAWL 1NPUA 3ZKND 4PJEE 3CFEB 2ROXA 2V2WB 3MA9L 2J8UE 3CZUB 1KJ2B 3PWNA 2A6DA 2F7PA 4YEEA 1CFSB 1QSFB 3VXUA 1AO7E 1ET7A 1QSFA 2FEEI 3FQ4A 5IHZA 1UJ3C 5E99H 5CINL 3RWGB 2XKNA 1JYVA 3K6SB 1OGAD 3BSZL 3M1CA 3JZYA 3P69A 3MUJA 2D3NA 3OZKA 4ODUA 4AEHL 3TA3D 3VH8G 4NNPH 5DMIH 3C6SB 3CFCL 4CL7A 5E5RB 3U36A 2NUTB 1AD9A 3MGOB 4AY0A 1BQRA 4IRJB 2QSVA 4N0UE 1NICA 4CN4A 3ILQD 1WZ1H 5EFIB 5J06A 1H5BA 4QF1A 4HK3J 5KBDA 4WAFA 1NCUA 2NLJB 1VSCA 3EDFA 4AQ1A 1IGML 1QEWB 1UA7A 2WXKA 2ZUQB 1I9RL 1KIUB 1I1YA 1NCNA 4PJXF 2ZNXA 3QB7C 2XVBA 2HX7A 2WBJC 1TSRA 3NSJA 1OQOA 3GMRB 2OZ4L 5CBAB 4ISVA 3C8KB 4JM2F 5CBAA 4OTXH 4XO4A 1CF1A 1WV7T 2PWGA 3MV8E 3RIAF 2Z35B 1AZUA 1A47A 2DQMA 4I48B 5ICUA 3OKDB 1GS8A 2WXHA 4FEMA 2IPUK 3SYQA 4QTIH 4XTRD 5JR1H 4YHIA 1W2KT 5KZCD 5FFGA 1BAWA 1JF6A 4HMDA 1LMKA 1J0IA 2YPVH 2DM4A 3FU3A 4WUUE 3S5LG 1JWMB 2Z31D 2YBRA 5ANHA 3SDCC 5BUGA 3U4AA 1JWSB 3AWEA 4KI5D 2UY7B 3SBQA 4D7PA 1JVOA 3CHOA 2PP9A 3BPCB 3M7OA 2WCGA 1HAUA 3D18B 3MKKA 4MNQB 1HVXA 1U8HA 3AMLA 3WIHA 5HVWA 3RJDA 3GKWL 3GSRA 3QZWA 3BIKA 1B0IA 3FONA 4EKXA 1DJSA 4ECNA 3SJVE 1MFMA 2Z31B 4YWGL 5F7HA 1DSFH 2AJSH 2DQGH 3NRFA 4FQQA 3O3BA 4OJYA 4ZFGL 3RI5K 4N8UA 5D1QA 5D6DA 1YEIH 3D4YA 1KCUL 4IRSC 4XZUA 5FCUH 3VXOB 3MLTA 2ADFL 2R0KL 1E4KA 3HS0C 4Z7WF 2Z9TA 1FNGA 2PNDA 3KPPA 4I3GA 2HPTA 2Q5BA 1ERNA 1D5IL 1FNEB 2QKIC 3IEAA 4HJ0D 1RV6X 4OBRA 3VRJB 3NG5A 5IT2L 3ULVD 2AW2A 4XE0A 3CFKA 1DBJL 3CFKB 4ZRGA 2X4RB 4NRZB 3U1SH 1AHWB 2YD9A 4OVUA 3DIFA 1WF5A 1FGNL 3NSCA 2P3YA 3MV8D 5DEFB 5BZDB 4H2AA 4OZFG 5HP5A 3VB9A 4BK5C 3LSOB 4LLYB 5ACLA 5KANI 1UOLA 4NGHH 3IDIB 3G6JF 3Q06A 1WZLA 1MWAB 4M56A 4OQTA 3HJEA 3ATEA 3QUZD 3K6NA 3BJ91 3NABL 4GI6A 5SWZB 5KVGH 4M7LT 1WEJL 3DDFA 4JMNA 1JG9A 2SEBB 1KYFA 1ZCRA 2H5UA 5IY5B 4JHZA 4P4KA 3N85L 3TNNA 5IHBA 2GT9B 4F33A 2N1KA 1PAZA 1GVIA 5CUSL 5I73C 3D08A 3GSVA 3LEYH 1U8IB 3WOVA 1NLDH 1JZ3A 4WWNA 4WRLA 3KGTA 3QXDA 2O26U 4FQHB 2GTZB 4G70B 1UT2A 4RSYA 1L4IA 1FL3A 1S5IH 2LLGA 3LXBA 1PD0A 3A24A 4ZOCA 5CD5C 1VFMA 3RBGA 2W65A 1N7MH 4YLBA 1GIGL 1T04B 4OF0A 4UQ9A 4NRXB 1XCQB 1MVFA 4XNYL 2EDRA 2AGJH 2YPKB 3H9ZA 2F7IA 2E86A 2LTQB 3MO1A 1FBIL 3IKKA 4YSTA 1RY7B 3SE8L 4DKDC 2X4QA 1C5BL 4QRRD 1HEHC 4YOKA 1F6LL 4GLRI 3DKHA 3NN8B 4LBEB 4X8CA 4LZKA 2Z64C 4K9JA 2QL1A 4GG8A 1FIGL 1U8QA 3INOA 3GI8H 1QSZA 5PAZA 5T1MB 1A6AA 3BDBA 3BH8A 4N2GA 3VSUA 1OCWL 3DJTA 1OZUA 2XN9D 3D1MC 4K7PY 1CI3M 5GGSB 3UZEC 1IEBB 2JMRA 2XQ0A 1IM9D 2RFXB 2FT8A 3QNYA 4HUXA 4PJ9A 3IDXH 1IV8A 1NIAA 4FFVD 4XCFL 2MPAH 5CGYD 3V4PA 1XGPB 4IOIB 4G83A 4P46B 5I5IA 5BCAA 1MCKA 5JA9A 1DN0B 4R4BB 4L8CB 2GUYA 4U1MA 2KDGA 2WUCL 2WVUA 4W6XB 4EF3A 4IIQA 2KPNA 1WFJA 3MRRA 5D7IE 5DJ0A 1UB6B 4FHKA 3FL7A 4CVZB 1IQDB 3ASOB 3QPXL 3CFEA 4NBYB 3QDAA 3ISWA 4HG4K 1YEJH 2DEWX 3NACL 5JORB 2XX1A 3BMVA 4E41E 4GG6F 4NLAA 2FBJL 1EAOA 1TITA 2P5EA 1BGXH 3MNDA 4LESA 3S3DB 4XOCA 2PCYA 4AOFA 2LQRA 4MCZA 4PS4H 1EMTH 2B16A 3BD4A 5SX4I 3D5OF 5IBUG 1FH5H 3ZPDA 2CO6A 1LO2L 2QQQA 1NCBH 3VD4A 5DA0B 5H8DA 3WHE1 1T5XA 2FHBA 1MWAL 3L48A 1CLCA 3FUDA 3LS5H 1ZT1B 1X5MA 2WMPB 4AZ8B 5HHNB 3LRSA 1AC0A 2OMUB 1Z0MA 5D96C 3O3EA 1JRHH 3WI9A 3CZGA 4Z3IA 2CJ3A 4MRBA 1UKTA 3ZR6A 2ZCLH 3A4EA 1GYCA 3BCDA 5DZOA 2X4TA 1KJ2H 5AYUH 2E46A 2CBMA 4JRXB 4O02B 2CLRB 2Q7YA 3QEQE 4PJ8C 1J0YA 5G5DB 1XV8A 1BEXA 3TO4B 5CKGA 3MCG1 4YFLF 3S5LB 5DVKA 1S7VA 4NQDD 1YPZA 1AZBA 2J20A 2E5EA 4HBCL 4OV6F 3AT0A 1LD9A 5IMOB 5DTFB 5DEGB 4HEME 5IWLC 1IZKA 4X5XA 1VACA 3K8LA 5C86A 3ISRA 4NHUB 1JGEB 1K5NB 1ZHNB 4RESB 3SE8H 5GGUA 2VMDA 1GOHA 4P57A 2DYSB 3TTSA 3FO9B 5GGTA 4QXTA 3GXIA 3TIEA 1NCCL 3HC2A 1I1AC 2KI6A 5E1QA 3FQTA 3BAYA 2GK2A 4GBXB 4KRMB 3FQWB 1RFDH 3MUGA 5BOPA 3VWJA 2NY1D 1AZRA 3QUYC 2UXTA 1EQWA 2NYYD 5GGTL 5D2NE 4MQ7A 4OGYL 4PG2A 4O00A 3ECBB 1RU9L 2ADJA 2VOTA 3MU3A 5HGDA 4J3SA 3QEQB 5GGQL 3V5KA 5F3BA 1JWUA 3R4DA 2Z4QB 1TVDA 2WQAA 5D2NA 1HEJC 2BVPA 1K3IA 1QBMH 2GAZB 5DJ2B 5DHYB 4A37A 3THML 1PD6A 1X5JA 3E8VA 3GUTB 4GSQA 3T0XA 2XBZA 3U2JA 4L8DA 3QI9D 5IJVB 2WWMD 1RZ8A 2CRYA 3EO0B 3QEUA 1DBKL 1NANH 3EYUH 3LQZB 3QJUB 4LSPH 1MNUH 1KLUB 2NQDA 3QS2A 3UTSD 3W9EB 3OG4B 1A1MA 3LPWA 2GK0B 1AIFB 1A6UH 1DVTA 4K7FA 2ZTBA 4NQDE 3SY0B 3GRWH 4LPWA 2EYTA 3FT4B 4FKHA 4GKNA 4QRBA 5IJBC 1KELL 1HHHA 4ZXBA 2FSEB 1WD8A 4EN3B 2PP7A 4CBZA 32C2B 4U0QB 3DRTB 1M7DB 4ZFOB 1S7SB 2QQNL 1OT2A 4IU2B 1KEML 3LB6D 2RQ8A 4CMHC 5FUCC 1NAKH 4U0RC 4DO4A 2ZWSA 1ZAGA 3FSAA 5SWSD 3IDUA 5KVGE 1CLOH 1T66C 1MQKH 3PFUA 2JWYA 1J8RA 5GJSH 3RWJA 5IKCA 2VDOB 2CCWA 4NS0A 1BOGB 5DFTA 3K46A 3ZJAA 6FABH 3QQ4A 4NQTA 5B8CC 2D4FA 1J8HE 4PJ5D 1DBMH 4N1EA 3IMBA 2P5WD 3O6LH 1OB0A 4D0DB 2BDNL 1N64L 2GSMB 3FFOA 4L4TD 1XF5A 3MJ9A 1I8MB 3WSQH 1UHVA 1JHTA 4G72B 4B97A 1Q94A 5F0JB 4FLSA 5E2UL 4BXSV 3GSXA 3DOSA 4IOFC 1Z5LB 1UOWA 1VB9A 2JNZA 3NIDE 4OI9A 4R90L 5FM8A 5L6YH 2VDMB 3CVHB 4XX1E 4JFDA 3KLLA 4PG9A 2YD7A 4F91B 3QR0A 4XN1A 5IROD 4A2MA 3RPIB 1BIIB 1TYRA 2QGEA 1ET8A 3GC3A 4WFFE 5DD6B 1RKRA 2YMXL 3US9A 3G08B 1VADA 2HZHA 2K4WA 2VDQH 2F2HA 3MBXL 4P0DA 2Q7YB 2X4QB 4MQSB 2CCLA 4P23D 4GAGL 3EBIA 3X12B 2OI9C 4MKTA 2ZG3A 4X7SL 3LTVA 1MLCB 4K4KA 5CCKL 4MX7A 3NT0A 3MXVH 3OC5A 4QOKA 4PGJA 1EO5A 2DQCH 4JFYA 4JY5L 5ISZA 1EEYA 2ZJSH 5K9JL 3SD5A 2F19L 2V5YA 1K4CB 3PNWA 2O5ZH 3CN2A 4Z7WA 3P0GB 3ILQC 4G6JH 4UNUA 3UERA 3DI2B 2O4EA 1UD3A 3BEWB 2G5BB 3GXNA 5EC1B 4C59B 3MLVH 5A2BA 1JXFA 2PCXA 3UOAB 3CZFB 1FH2A 1NCDL 4ALAC 5I1KL 3OPZH 5IB4A 3KYNA 4PJ5E 3WL9B 5KANG 5MEND 1PX8A 2VDRH 3TBVB 1MFNA 2VDPH 2BC4B 4EUPH 3ZQXA 1Q9OB 1RSFA 3T6QC 4HEPA 1CICC 2A73A 3ZXAC 2Q10A 1H8SA 3TF7C 1G7JB 3W9DB 5E24E 3WSQL 2X2IA 4C56A 1T1ZB 4DN3L 3BVNA 5E94B 1N3NB 2WANA 3NJHA 2LU7A 5DK0B 5A2FA 3L9YA 4JO1H 1DFXA 2JQAA 4S1RH 5J11B 1DBML 2YXWA 2ZCZA 3TH3T 3BP6A 4I1NB 2D2CC 3REVB 5C6WH 5IP4A 2ZSVA 4UQBA 4AGOA 1M7UA 3D50A 3MJ9H 3VXQA 5AOLA 5GJTH 3DBXA 3R7QA 3D9AL 5EOQL 3MXWH 1W8EA 1DCEA 4P23B 2GG1A 2HT2D 2VR5A 4NENA 4IRJC 3KXFE 1WHOA 4PRID 1MFAH 3SOBL 4P2OD 2XN9A 3H9SB 1W72B 4IK6A 3VNZA 1SBSL 2FBRA 5DVLA 1YVLA 1LMIA 4PJ9D 4TUKL 4X8GA 4O2FB 3T1FB 4DHLA 3HG3A 5H2BB 2IEPA 2Q76A 2FT7A 5DRWB 3L2LA 2Y2YA 4HSQA 1IC5H 2OCJA 4FOMA 3WUWA 4BCZA 4OLYL 4WK2B 1UC6A 3S3SA 4HVBA 1F18A 4WI4A 5I66A 3KS0H 3OLEA 4WUUB 2XSKA 3VQ1C 3WENA 1BQLL 1V7NL 3GJFA 1W72H 4NCC1 3DECA 3IPBA 4L4TB 5CLTA 3B9KB 2QZQA 3RFZB 2AEQH 5FYJL 3SCMC 5HHXH 1U8IA 3GRWA 4FNUA 2VR9A 3FZUD 4OF3A 4WI2A 5F9WC 4WW1B 4A2GA 4QRAA 4OV5A 2LU4A 1V54B 1E5YA 1J8SA 1FAKT 4GSDL 1CBVH 3B34A 5DYOB 3M1BA 1D5MB 4UAOC 4ZSOB 5DC2A 1D5MA 2VZSA 3U2SA 3TBVA 3V0HA 4DTGL 3BKJH 1OE1A 1KIRB 2EKSB 3I50H 2MNUA 4TXVB 4J8QA 2CGZA 2V2WA 1LO4L 1WPCA 3OKNA 4IRZA 3RP1A 3B9KC 3P2BA 3RQ3A 5KN5A 1CUOA 1KXVA 2B59B 4NEHB 3ZE1E 4F92B 1YECH 2F18A 4Z1PA 4LB8A 2EYSA 3UBXB 2BP8A 2AABH 2HSIA 3A6CL 1C1EH 3JWDL 3X11A 4BKTC 1Y18A 4GAYA 3FB8A 2QV2A 1MHHB 3KPMA 5DEZA 4FA7B 1FFRA 3ARWA 3FH7A 3CXHK 4MCYA 4KK6D 4WO4A 2BPBA 1HCZA 1P7HL 4Y16A 1AXSB 3NMEA 3EF4A 5EO1B 5D2LE 2XPGA 4YPGA 1PX4A 1MLCA 4WFHD 1X5KA 2FNBA 2YC1A 1MWOA 5CR8A 3T04D 1N6QH 3O9WC 4JFYB 4X4ZA 1CICA 4LCWA 3MI6A 1ZDQA 3Q8EA 4GYBA 3B2MA 2CO3A 3S35H 1R34A 5DGQA 1NBVH 1OGTA 5GRJH 2OCFD 4HULB 5I1HH 1OF2A 4IJTA 4H20H 4W9GC 4DPAX 5EOCL 3FF7A 5BVJA 4AE1A 1BQLH 1OTSD 2MMXA 5A2CA 1BFVH 3SGJC 3QEQD 2Z7YA 1I8AA 4G6FD 1KZYA 4M5YL 1BXXA 2R23B 1Q9WA 2UVEA 2KQNA 3EJQA 1UB6A 4HJTA 1IC5L 3D25B 5H4YA 4LLDA 4LQ1A 5AB0A 4PJBB 3ZN6A 4PJEB 4JGJA 5KJ4A 3VFNB 5IQ7H 5B8CB 1L7IH 1AE6L 2G0KA 4N8CH 3B9KD 3ZTNL 1EBAA 1RJLA 4I2XE 4J7RA 3FRPB 3ZE2B 3DJZA 2R0LH 5DK0A 4B5EA 2JKXA 4PFEA 4C4KT 1JV5B 4MNQD 3OD3A 1R1CA 1TZHA 4WW2F 5ITBH 4XPGH 3G5XA 2WIMA 2F58H 5LVEA 1S7WA 1SZNA 4EI0A 1KB9K 1W72L 2IALA 4HPYL 1QW9A 4G7VL 3JWNG 1F4AA 1QG3A 3X13B 4RMBA 5FOBB 3K6FA 1HHJA 3PQYE 4K2UH 4JHWL 1J9QA 2Q3AA 4K8RH 4NQCA 4OD3L 1S8DA 5IQ9A 3LQAC 1OD9A 2BFVH 2WZAA 5B1CA 1ZSDB 2W0FA 3TO2B 1K4DA 5JW4N 4X6DA 3UPRA 2VDOH 3S5YA 3NZHH 4AYFB 5CGBA 3K71B 4U1KB 2L4OA 3FFCE 4EUPB 4G2AA 4TNWK 2CNYA 1WGOA 3NK3A 5D7JD 1AP2B 4PV1C 2WTOA 4X9IA 3VCLA 2VDRB 4FI7A 1GGCL 2VH5H 4PVBA 1I85A 2HJKA 2VMEA 1BZ7B 3HBGA 4OCLC 3VA6A 4E2OA 3DNKA 3BEVB 3LCYA 5GZOD 2IADA 1YQ2A 2G5UA 1UD5A 4AL8H 4YLQT 2G0LA 1OWRM 3CVCA 8PAZA 1SDAB 3MLXL 4ELKB 4L3EE 3MBWB 2IJ0C 3ETBJ 4Z5RA 1INEL 4G43B 3IU4H 3QIBA 1ZPLA 3O9WB 2ICWJ 3GMQB 1GMEA 3TN0B 2UZXB 3CSPA 3Q2VA 5MENB 3EDEA 3WS6A 1JVLA 2CNZA 2GIXA 1T6BX 1Y7VA 1FO0L 4QRPA 4QWWD 4LCUB 4WVRA 3IK2A 4LCUA 2E75C 4LCYB 4RWYL 5TDNB 3VGGA 1E3ZA 4BELD 3L5IA 4PU2A 3B1TA 1DHKA 1XL6A 3L5WA 1UD6A 1DJHA 3PHOA 4N2BA 4L1BA 1ML0A 3AU0A 1INDH 1ZD6A 3WKNA 3L1FA 3CFJB 1U8LB 4AMKH 1EHLL 4R97B 1T2XA 3U30B 3ECQA 3AXLA 3EO1A 3CFMA 1NMBL 3OMIB 1A21A 3U0PA 1HWWA 4N0UB 3WYRA 4CVUA 4CMHB 4BZ1H 1A6VH 1MLBB 1IGJA 1XR8B 4NZUL 4FXGB 3N42B 2R4RH 1AE6H 4YN3A 3S3BB 2GTWA 4R26L 5T3XD 3VUAA 1G7LA 4AM0A 1DEEB 2GI0A 3NPSC 4IDLA 5FK9B 3F8UB 1DLHB 1JZ4A 5TK2A 3NA9L 4LKCA 5D70H 2BZ7A 3U7AA 3PL6C 5I82A 4D7BA 5TDOA 4NENB 5DS1A 4PSPA 2YEZB 5FC9A 1BIIA 2XN2A 1PKQE 1N0LA 3ARED 1N8OE 1D3CA 4QYOB 3OB8A 2EXWC 2ZX6A 2YEVB 4L1TA 4TVPH 4U49A 4NUMA 4WSJA 4XVSH 5G5DA 4R3SA 5KSBE 4ZFZA 3HPJA 3LRHA 3PWPB 4G9DA 3L1GA 5D7HA 4YDZA 1W0VA 4AQAA 5AD0A 2VABA 1K72A 3NYKA 3ESMA 2HG0A 1LO3H 4OQTH 1NAMH 3BSGA 3QO0A 3TJEL 1YYMH 1CF8H 3S4SG 1MFEL 4YNYB 5BV7H 5HDQH 1N4XH 3RPKA 3NQKA 3CDYA 3HFFA 1QYGL 2QHRL 2GJJA 3T4AC 4ZDHA 4YHIB 1KTKE 2LHAA 4W9FC 1CQYA 1A7NH 4LP4A 2LOEA 3HZMA 3LZLA 3MCKA 1FNAA 4UQ3B 1OSEA 1KT2B 1EAPB 4HV8B 4LSPL 2PXYD 3LPFA 4UTBL 4BJLA 5GSRA 3NRQA 4FN0A 3MRPB 1IAKA 5MHSE 3QDMA 3L5WB 1YPZF 3UIZA 1ADQL 1L0YA 4JO8A 4XBGA 3VG9B 1QLEL 1OT4A 1CBVL 4LSUL 3UO1L 1CGWA 2VW4A 5CJXC 4X99B 2OSXA 2BVTA 1RHFA 1I9JL 1BD2A 3LNDA 2IFGA 1Z9NA 2NTFB 3MV8B 5I1AB 1E9OB 2AJVL 3DUSA 4GSXA 3CHQA 3VGFA 4P2RD 3VRJA 2P42B 1EHNA 1HU8A 3X12A 3QI9B 4NUJB 4JPKH 4KZEL 3ARBB 4L8DB 5IJVA 5JPMC 1NEZB 4GRLA 5DI8B 3T2OA 3QXAA 4PY8I 3ZL2A 1K3ZA 3K4DA 4JPVH 5DUML 5C09A 5HGAB 2A4EA 1FYTA 2YPVA 1IEBA 1JNNL 4QRSB 1A64A 3PYCA 3NFNA 1FZJA 3C87A 5J9PA 4AG4L 1E9PB 3GBML 1E8YA 1O5PA 2NY3C 4P5MB 5SWZE 1WYJA 2WLIA 4XCCH 4WZ9A 3DX7A 1ZGLM 3KYAA 5HYFA 3MLSL 3L2NA 2NY5H 2BOBB 1LE5A 2HT4D 2UYLA 4MMYB 4PRPE 1CD1B 3OHXC 4PW3A 4PJDE 3W0WD 5IJDC 5CWSA 2ZP9A 1NOFA 2P8LB 1XMEB 2FECL 4XNXL 3DROB 5AVVB 4D8PB 3IGFA 1AGDA 3V6FB 1IRAY 1PYWB 1NC4D 3SGJA 3KGSA 4PRPB 4ANVA 1G7HA 1E67A 2NUPB 3QRLA 5C92A 2HT3C 2Q0ZX 2AJUH 2VQ1B 3F01A 3UZVA 2RQEA 4MNHB 2VZTA 4CMMA 1JNLL 4AJYV 1H6TA 5AAMC 1KEGH 1XXFC 1QWHA 2LAAA 4H8UA 4DTGH 2Y23A 1HXMB 2FR4A 3I3EA 3IKCA 3S48A 3M8OL 1NGQH 4BFIA 1DO6A 2Y24A 5J3HC 4QJ3B 3RURA 1OAUH 1C08A 3WXWH 1Y07A 4KKAC 3VQ2C 3WEXA 1IBGL 1VRSA 4YDIL 3RVXC 1EUUA 5I73B 2J1ZA 2IG2H 1N0LB 2VO5A 4IU3B 4LAQH 4XNQB 3AREC 2H0PA 1XCTB 1WFOA 5HPMB 1NJ9B 4KAQH 4N9GA 4P9ML 3BLKA 1FORL 1MJUL 5I8EB 2HJKB 2BY3A 3ARBA 4OY9A 2MSPA 1GS6X 1IB5A 1HYSC 2WQSA 2PPCA 4HF5L 3BPOC 3WE6A 4N0RA 1UT9A 2JI3A 3BP4A 1BBJA 2D7NA 3LQAL 2A83B 1BG1A 3HNVH 9PCYA 4LCIH 4Y0GA 4BA8A 2ITDA 3ARGA 1QTYT 1ECYA 5JHDA 2W0LA 1S7QB 2WP3O 1R3JA 2WKOA 1DQLH 3DDGA 3C09C 4Z23A 4U1MB 3OMNB 1N5YH 2J6EH 3LNGA 3D18A 1E8XA 3D33A 1T80A 3GSRB 3QZWB 3CQFA 2F53B 1G7HB 1TJGH 1OSYA 2DWDB 1N68A 5CILH 4H1LG 1QHQA 4WUUD 2FEJA 1M57B 3AITA 3B9AA 2LAGB 4X9HA 3ROLA 2GITA 2OMWB 4UV7L 5F1KC 4C58B 4L9LB 4NDMA 4OGXH 4PWGA 4MXWL 5T3XH 4YHNB 3L3DB 2OCCB 2JQMA 4GW5A 2AJZA 2OL3H 1I3GH 5F1IA 3OB0H 5H94B 2VRQA 3TM6A 4AJVA 1EJOH 3GRGA 3FB7B 4KKQA 3ROOA 1YJDH 4P3WA 1QPPA 1XF2A 1A4JB 4NT6B 3MGTA 5TFSL 1T7XA 2FX8L 3PGFL 4FLRA 4RMQA 5C0EA 5CZXC 4ICWA 4M8QB 5E1IA 1R3KA 1IBBA 2LGNA 2NXYD 4J3BA 4OCYH 4WSKA 1MJ7H 2NX5A 2AI0H 2FD6H 4PVMA 3O3EB 4NRXA 2YEZA 1BVLA 1NGWA 1C5BH 1CR9L 1KIUA 3QJOA 4R5XA 3T3MB 4WW2A 5EO9B 3LIUA 2OLDA 3R19A 4UTBA 1PG7L 4NFDA 3X3GH 3C5ZA 2W9DL 1FVCB 2CJUL 2EDDA 4GMSL 1DFBH 3QUZA 1J87A 1I8UA 2HT4C 5BOJA 4PRHA 1YEFL 3QWRD 2FATH 3WFHB 5I9QC 1KCVH 2N01B 5E08H 1TU2B 4OZFB 3P4MA 2HLAB 1N7ML 5ICXB 1IC7L 2CWRA 1VERA 5KVGL 4RGMC 3QRGL 2FWOA 4Z8FH 4FQ1H 2R4SH 4P2QB 4YHMH 1G6RB 4Y4HA 1RVFH 1R3HB 4MJHA 4JREC 4KAQL 1BOGA 3B8SA 3L9RA 4B0MM 3UBGA 2W60A 3BAIA 3DX6A 1HXYA 2YAEA 1WWCA 2CRMA 4HIXL 4MFHA 5BPPA 4HU2A 1GYWA 3QNZA 4RNRB 1UM6H 4MAUH 3SZ6A 1HIMH 2FVNA 4FQXA 3NH7L 4C83A 1T7WA 3L5XL 1IBHA 1PBYA 1PZDA 3APMA 3CFDB 5SX5H 4B53A 3GI9L 2B9AA 2C9XA 1ANUA 4F2MA 2BDNH 4XGZA 3BVXA 2P43B 5I6LA 1S5HA 2FECI 3VXRD 1NGYA 5I8OH 1ECZA 3S96A 1T1WB 5CJ5A 4Y8AA 3KBPA 5EIQA 1B0GA 2OI9B 4MBOA 4ZTOH 1CLYH 3CZKA 3EDKA 5CJXA 4H88H 5J6SA 4YBLB 4F37K 4OCSL 1MCLA 3KHOA 3MX0A 4DEUA 2JB6B 5FA3A 1D7FA 2D3LA 2P8MA 4L4JA 1VFOA 1FNLA 2VIRA 3UAAA 4R84A 4UDTA 3DX8A 2EE2A 5DMKB 1U42A 4NXKA 1U41A 1L0QA 3E6FA 4QHUA 1IM9A 2HH0H 3C9NB 2V5MA 2NX5E 2ILLA 4OLWH 5IM7A 3WMQA 1F3JA 2DI8A 4EDXB 1M6OA 3ZE2F 2OK0H 2X7LB 2VLLA 3H3PH 4OJEH 1UJ3B 2DBJA 4R7LA 4CSZA 2JJSC 1QEWA 4AIZB 4PJCA 2F1EA 3IMWA 4AT6B 1URLA 4A7TA 4E9WA 3QH3B 2F53D 4EIUA 1MIML 3RTQC 2IPKA 3DYOA 3U6RB 4XAKE 3VA2C 5IGXL 3C5JB 4F7EB 4JPKL 1EZLA 3FQUB 4UIMB 2EIBA 2YSSB 3IN0A 1TZAA 2VXQA 3HNSL 4DH2A 5KZCB 2Y36L 1AO7D 1HHIA 4YNYA 2W9DH 1KIPA 2F74B 4YFLI 4DPBX 1N3NA 3HC0B 4H26A 1CGYA 3LKRA 1MVUA 3ULSB 1P5VB 2VJXA 4PEEA 4PCYA 4MD5B 4CU7A 4HS6A 4UQEA 4ODWB 1AKPA 5EPMA 2NY2B 3B3IA 1B6DA 4FLHA 1GYUA 3FFDB 2ITCB 4HIEB 3MJ9L 4G8IA 1U3JA 5E8EB 3I02B 2Q8AL 4QRRA 2ESVD 3BW9A 2CR6A 3HE6A 2D9CA 4AUJA 3FQXA 4X8JB 3KL5A 3ZYOA 1QZNA 4WGWB 4UV4H 3WIAA 5DQDH 1UFGA 4G9FA 4JFDE 1QFPA 3BWAA 3L3HA 4AQ1B 3I6LE 1GC1H 4KKNA 4V1DB 1AZCA 2MNWA 3EBGA 4EXKA 1TKWA 1UH2A 1OHZA 3O11B 2IQAB 5INDA 3E6HB 4GIPD 1LO5A 2C4XA 2X9ZA 1WIUA 5KSBF 5JIKA 2PYED 3HRZC 3WJLA 4MQXC 4OZHF 3H9YA 1ZRUA 1G9ML 2XWTB 1J8HA 4MMXA 4ZX3A 2GIMA 1A7PH 1L9NA 3VFUB 5GGRA 2G3XA 3ZOAA 5F7AA 5ITFA 4CBPA 4OCRL 4JRFA 4OZIE 1U3HB 5IESL 2GJ6D 3KWWA 3M46A 3EO9H 3OAWA 1HZHL 2H45A 3BZ4A 4ONOA 1RZJL 1DQMH 3B5GA 3SYCA 1V10A 4JZJC 3V4VB 5J11C 3K6DA 3REWA 4ZD3L 5E99L 2D3JA 2J1XA 3B56A 1SUJA 4IGBA 3GSNH 4K5MA 4XHJD 4H0IA 1IAMA 4PRPD 5D9SB 3W0WE 3WL9A 5CP3H 5IB4B 1XZ0B 3KS0J 4GW4A 1AGEB 2G9HB 2CLZA 4YC2B 2MQCA 1AR1D 4L48A 3UL4A 5LN8A 4HCRH 4ODHL 4UIMA 4BKSC 4W9ZA 4I2XB 3B7TA 3ZZSA 4P07A 1T0OA 2AQPA 2YIHA 4ILDA 1UXSB 3KEDA 5I6MA 1T0MB 4N1CA 2BJMH 3MGAA 4JKWA 4YSEA 3RNKB 1CXEA 1R3LA 2B1OA 3D0AA 4U1NB 1DYZA 4WWKC 3OKMA 2APWA 1U92B 1B2WH 2CCVA 1XBDA 1I53A 4Z7UB 1AZNA 2DM2A 1I1CA 4Z3EA 4PP2B 3U4KA 2CDGB 1M2VB 4IBLT 5I0WA 2Q86B 2XXFA 2WJ5A 3H56A 4RFNB 4RGND 1X5ZA 5I5MA 3MLPA 4KV5F 4KHXL 1T04A 1OAQH 2MPAL 1PQZA 4G8GB 1IZJA 2VWEC 3LDBB 5ADOH 4ZUVB 4PYGA 2Z1PA 2XFXA 2C1OA 1KGCE 2WTPA 4FXKA 4MA1C 1W0WB 4GQ9L 1FNSL 1UKSA 1ZA6A 2JLLA 3U7YL 4AQZA 1OCWH 2QPFA 5K59E 1Q8MA 3KVDD 5AKSA 1NUNB 1UXWB 5D7JC 3S35L 3UTZA 2X10A 3MRKB 2K8MA 5I1DB 1SHXA 4HG4J 4Z18A 2XQBL 3WJJC 4KKZA 4HX1A 5DWUH 3CDZB 1SDDA 4K5PA 2E9WA 5DJCB 4DZ8A 2LT9A 4ZZKA 4EIZC 4MNQE 1AGBB 2OYMA 1DE4A 2FYYA 2IMMA 5D2NC 4I1PA 1FVEB 4Q14A 5TF1H 1CZ8H 2XC8A 1R46A 1CPUA 3QNZB 1IILE 2BW4A 2H3XC 3E8UH 2OS7A 1ZHKA 1EAPA 2V0AA 4FQXB 2MTAA 2VE6B 4JE4B 5JZ7D 2BCKA 4ODBD 3FTYA 3FQWA 3TV8A 2ZOKB 5I26A 2BLFA 1HJCA 1ITCA 1JGVL 4B3EA 4KJQD 2I07A 3LKPA 2R1WA 5GS0L 3QJSB 1AZVA 4MTMA 1J9RA 3IYLW 5CN1A 1W9XA 4MVBD 4Z7VF 2W07B 3D2UA 2VNCA 2IF7A 1Z9OA 3RVVD 5HYSG 4PS7A 3AY2A 2ROYA 3N5AA 3D69A 4NCDA 1OALA 1P6WA 3ZDXB 1JUFA 2H1PL 4N9GB 4Y4KC 3VRLE 1YMMB 3U0TA 3KPPB 3A3YB 1PG7X 2N1TE 1MHEA 1TPXB 2JKNA 3AS3A 4DQAA 2EEXA 4TUOA 1RZ8B 3QEUB 1BQSA 4KUZH 5IB5A 1X44A 1IM3A 3DMMD 4U2ZA 4QT5A 1DVFD 1UOKA 5A6MA 1D6VH 2PP8A 1Z2KA 2GSIB 3APCA 4ABQA 2I32A 3BCFA 4Q7DA 5KS9E 1CIUA 3Q2LA 2EAEA 4PY8J 2EDMA 1V3LA 5PCYA 3EHBB 5IQLA 3E80A 1KB5B 5I1JH 2DQIH 3KDMB 1QHOA 2YZ1A 2P5WB 3ZY7A 1MFDH 3QULA 3F6IA 2VERN 5LQBL 5KBLA 2FH8A 5CIPB 5CKAA 5EF3A 1P6AB 1VGKA 3U6RA 3JVGC 1SXZA 4KXBA 4PJBA 3ORJA 1W0YT 2VYRE 3FQUA 5EOTA 3T4YB 3NCXA 2DJ4A 2ADYA 1RIHH 5IKCB 1DVZA 4D9QE 3EOBA 4TSBL 2NUPA 2XY1A 1NKGA 4I3SH 4P57B 3D39D 2WZ0A 1LLAA 4JPIB 1ZGLB 3BVDB 4G7YH 1P7QB 1CZ8L 1OAZL 1I7TB 1QNZH 1HINL 4I18A 1T6VN 2P49B 4XN4A 1L9QA 2JK5A 3QQ3B 1WWAX 1TZGH 1WH0A 2RBLA 1ACXA