4F2ME

Crystal structure of a tgev coronavirus spike fragment in complex with the tgev neutralizing monoclonal antibody 1af10
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
148
structure length
148
Chain Sequence
PSFYTHTIVNITIDLGMKRSGYGQPIASTLSNITLPMQDNNTDVYCIRSDQFSVYVHSTCKSSLWDNIFKRNCTDVLDATAVIKTGTCPFSFDKLNNYLTFNKFCLSLSPVGANCKFDVAARTRTNEQVVRSLYVIYEEGDNIVLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural bases of coronavirus attachment to host aminopeptidase N and its inhibition by neutralizing antibodies.
pubmed doi rcsb
source organism Mus musculus
molecule tags Viral protein/immune system
molecule keywords monoclonal antibody 1AF10, heavy chain
total genus 28
structure length 148
sequence length 148
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3130 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f2mE00
4F2ME 3KBHE 4F5CE
chains in the Genus database with same CATH superfamily
1NC2B 4PHZA 1T7XA 3HC3H 3FRPA 3P3UA 1CE6A 3LKRA 1PG7X 2WBJA 4K15A 4XVJH 3FQ1A 3STBA 4K5MA 4GW4A 2RH0A 3QIBA 4R7NA 3TEXA 3O2DH 1M2VB 3P73A 4GSUA 4RMTA 1K4CB 4O9HH 3PAYA 1INDH 2NNAB 1E4WH 3B2MA 5KN5B 1IGTB 3MKGA 3QJHB 4XNMB 5ACZB 1A1NA 1I7RA 1M53A 1R75A 3IMSA 1HX0A 1TQTA 1BJMA 4YZFF 4N90E 3BUBA 4OZHA 4PD4K 3DOIA 4GRLA 2VN6A 4F9PC 4L37A 4L0YA 4NSKB 2Y7OA 2Q10A 1U3ZA 4EDWH 5C0BB 3VA6A 4TTDC 4YPJA 4QNPF 3V8CA 3K8KA 4J6RH 1M4KA 4X6BA 4HJSA 2DWDB 3B2VL 4FNLH 3FZUD 4HCRA 1KJ2H 4Z5RA 3RX9A 3THMH 3UP6A 3ATFA 1EXHA 1RURH 2HX7A 3EYQC 1IC7L 1JOIA 3I9GH 2GJ6A 3CFMA 1WEJL 2QGDA 4XMKH 4TUKH 4MMXC 1U58A 3KE0A 3FO9A 4ZX6A 1WBZA 3MUJA 5A2IH 1V8HA 1F3RB 3QHFL 4I13B 1SM3H 3VG0L 1XT5A 1UOVA 3F62A 1RJCA 4FGMA 3SHSA 3K0YA 3RWHB 5HGAB 5JPNB 3FAXA 1J8HA 3ABKB 5IMKB 1OD9A 5D2LA 2V17L 5DZVA 4BV1A 2HVKB 5C07E 4IK7A 1T4KA 2ENPA 2DD8H 4W81A 4Y5YC 1X4XA 3EH4B 5E4IA 5DEFA 1U92A 3KEHA 5EIIA 1ULVA 3MLXL 4MMZC 2XT1B 1PQZA 1CFSA 2JI2A 1YQVH 3BP7A 4FXKB 1R47A 3O3AB 5C0FA 4PIRF 2O5ZL 1CD0A 1R3LA 1AHWC 2YUXA 1YAZA 4WHYH 3QJRB 2J56A 3F5WB 3GMNA 2H26B 3S48A 3GJEB 4WI9A 5FWQA 4A7GA 1TETL 1H8SA 1RJYA 2YC1A 3D7PA 4J1UB 3ZIYA 1PDKB 1SVBA 4PRHD 3VQ1C 1A7QL 2I32A 5CGBA 4R0LA 4MMZA 2JK5B 3QFDA 1JMZA 4P5TA 2A77H 3OXSA 5AB0A 2EIZB 2LU3A 4I3SH 3WTWA 4KNTA 5IFHL 1AGEB 2JTDA 4PJGF 4PM1A 1KTDB 5HHVL 1FYTE 4NPJA 3R7QA 1HI6B 2CR0A 3BSZL 4HQQL 3DNKA 2ATPB 3QJTB 1RK1B 1HHGB 1BZ9B 3C5ZC 2EUWA 3A6OA 2IPUG 2LAGB 1S5HA 1OGPA 1OAYH 1SY6A 4HSAC 4HGWB 3X13B 1H3PL 3VQMA 3B3BA 3OF6D 5HSFA 2F58H 3DYMA 4P2OC 3UROR 1FFPB 4F7PA 3KR3L 2EH7H 1NGPH 1JRHL 1AQHA 1LYQA 4S0SD 1QW8A 2YAFA 4LLQB 3V0GA 1IGFL 3SPVA 1NEZA 5IHUL 4XHJC 3DGCR 4RQQB 1HHIB 2W91A 2J4WH 4XWGL 4TSCL 1IL1B 4PB0L 1MCPH 4JW3A 5ESVB 3P11H 3PWNB 3AREC 4MLIA 3L45A 3ZDXB 3DTUB 3STLB 3O6MH 3O4OC 3E9TA 1D7FA 1E4HA 4U6XA 4A6YA 5A16A 1I1CA 1T3FB 2AXGA 2CHDA 3MJ9H 3BSGA 3EGDA 4ZUUA 2R23A 1FIGH 4ZFZB 1SJMA 1U3YA 3GMQA 4EPSA 4KGLA 3K2UH 1RIHH 2WXPA 5I73B 3JTTA 1GY1A 4LLQA 3QXVA 3Q44A 4XO5A 1HOCB 3GPSA 1NANI 4LQFH 5C97A 3ATEA 1IQDA 4HIXL 1T4WA 4GI8A 5BJTA 2A9AA 4AYSA 4OM1L 5IESL 3C6EA 4XNZB 2C3VB 5IT2L 4G9FD 2DQCL 1GAFH 1JVOA 3VFPB 5JHAA 1CL7I 3T8VA 1UFGA 3T0DA 3T0EB 4JFHE 1MW0A 5E4EB 1CJYA 1Y6KR 3LS5L 4JY6B 4QRRE 5F7KC 3RB5A 1XD0A 4U1KB 4NZRL 5KZCB 3EOYG 3LQAH 4Z0BH 3D39B 1JCKA 5EC1A 1YYMH 4JFWA 4KXZI 1QO3B 2VXUH 1PD6A 1UH3A 4ETYA 2W0LA 3E2HB 3CDYA 4GBXB 1OTTD 3MJ6A 1F6AB 2AK4E 1HFUA 4A63A 3GSUB 1HEZB 1KXVC 2IV8A 5E6UB 3LNDA 2WUCL 2E3VA 3MRGA 3CFEB 2O6PA 2V5MA 3L4VA 5E5UB 4F1SA 3VD0A 2P8LB 2W0PA 4K5LA 4MKMA 3F6IA 1P7HL 5DYFA 2HT3D 3T3ME 1KLUB 3VWKD 5HPOA 2H26A 5JPMB 3AWEA 4PJ9A 4RNRB 4I48B 2FJFA 2GQHA 3AT8A 1AFVH 4FZ8H 4U1HA 5CIPB 1NDTA 3H9SA 5DK0B 1X4ZA 3PWUB 4KXAA 2ZT9C 3D6GA 4J4PA 2NY1C 2DJ4A 1JI1A 1NCBL 1GGIH 5F9WB 3FUJA 1LMKA 4GO8A 3BAJA 3VXNA 4X9HA 2KHAA 2XTLA 1U92B 4XVSL 3S3JA 2PPFA 4TULL 1OQXA 5E8EA 5D6DC 5JIIA 3L8QA 3D52A 4UIKH 3MFFB 4ZMWA 4NO5A 4WJG3 5GRYA 2F5BH 4JREB 2DKSA 3OX8B 2ITDB 5D2LB 4DIXA 2K4AA 3OMNB 2H3NB 2QVIA 2W9DH 2JF1A 3H9SB 4MB1A 2F15A 1IV8A 4ZW8A 5IEKA 2IFFH 1H3TA 3TN0C 4J4PC 1WAAA 4XMPL 5AW6B 1UWEH 3E3QC 4FXGA 5F89A 5AB9A 1UUNA 4DEWA 2QEJA 2CD0A 1MWAB 3ZE2B 5IOPB 3Q48A 5SX5K 3MNVB 1ETJA 5TDNA 4LRNH 1AGCA 2A6KB 1R1CA 3QO1B 1BD2D 5DR5H 3CH1B 3MACH 4HS3B 2OM5A 1X5FA 4MJ4A 2P5WD 1P4IL 2Q5BA 3HJEA 2YPKB 4IRZL 1GMEA 2GG1A 3MC0A 5EDSA 1WPCA 4Z95L 4QCIB 4HWZA 2ZP0T 1QO3A 3VACA 3BQUB 1I7TA 1UWFA 4HWEL 2AK1L 1E42A 3VE0B 4AYID 4XB8A 5F3BB 5BV7L 4XBEH 2IDQA 1U8IA 4JY6A 3H6JA 1LP9E 4AYBA 1OAJA 1PTZA 4GRLB 3NSCA 1A6UL 1CZ8H 2W65B 4M1CC 4YFDB 2DQTH 2BVTA 4P46B 3VI4F 4LKCA 3BD4A 4WHCA 5CFAA 3O4OB 3OHXC 1DFXA 2AJSH 3WJLA 1XB6A 3UERA 4ZO7A 5DJ6B 5FDWB 5T33L 1YUHA 4AXWA 5KN5A 2QKSA 2PF6A 4GRLD 5ALCL 3CFKA 3HNTH 1DQJA 3BP5A 3SZ6A 3ZRCC 2PR4H 1D5MB 2APWA 4CU6A 1JGLH 4Z8FH 3CFIC 3QIBB 2W0FA 5AW3B 3T77B 1VPOL 2QQLH 4Y4HD 4OLXH 4OKDA 4K5NA 1T2QL 5I82A 5KS9E 3NP4A 4LEOA 3SDXF 4PLKC 2F74A 3Q2WA 3ME0A 3KPNA 3KHQA 3GZQA 4R84A 3BSZA 5EO1A 4BXVA 1N5YL 1TG8A 3L3DA 4LBEB 3WKYA 2F6AA 3CAFA 5EUOF 4P9HH 1WV7T 2EJ1A 3OWRA 1ETZA 1WAAE 2XWJB 4DPBX 2X70A 1MIML 2VR5A 3R18A 4LLWA 5GJTL 5J56B 1OT1A 2ED9A 3FTWA 4NRXB 4FI6A 2WGNB 4PJ7E 1PS3A 4DOHE 1GSKA 3WSQH 4FN0A 3D51A 2DIBA 4MCZB 5BV7C 3BAEL 2WXRA 2Z92A 3M8OH 4QJ5B 1TXKA 4YLQT 1NEPA 1DBKL 3LRMA 4OJDH 1T04A 3EJZC 1E6OH 2YBGA 5I6KA 3MV9A 2I60H 2A1WL 5F9AC 3RBSA 3SDCC 2WSDA 1C16A 4XAWL 3VFMA 1B9KA 4BK5A 3W5NA 1RK1A 4L5FH 4KQ3H 2Z31A 3ETBJ 3KL0A 4MX7B 5HP5A 3LHPL 3H9SE 4WTQA 2MQCA 2BH0A 1IFGA 5FB8B 1NFDA 2X12A 3B2XA 3CQQA 4HETA 4F2MA 4QAWA 5CR1A 4GXFA 5D1ZD 5HI3D 4U05A 2FIRT 3TBSA 1A8ZA 3H42H 3BWZA 2JKXA 5JTWA 4PCYA 4X6CB 2HWZH 1G94A 5CD5C 3BVDB 5JA8B 2R2HB 4GRWH 3NFSL 2JFCA 1QSED 2QQKH 5F2FA 4I89A 4QHUB 2EP6A 4QHNB 2F0CA 2EKSB 4PS7A 3G5XA 2VDML 1FIEA 4XNYH 4YHIA 2NY0C 3D2UA 3KEDA 5MENB 3F7QA 3L9EA 4L4TA 5GS3A 2Y69B 3WNJA 2HX8A 4RH4A 1Z66A 2N0KA 2PW2B 3LKQA 4ZFFA 5G55A 4DKFL 7PAZA 1T0OA 1LDPL 2CGYA 4R2GD 3L4ZA 4GG6F 4AQAA 3US0A 4OH2A 1TO4A 2AK4B 1MAJA 1RZKL 4HWBL 1T4KB 2HVKA 1YZZA 1WH0A 1MPAL 1NL0L 1PZ2A 2GJJA 3G9AB 3UBXG 1D9KD 1YEIL 2DTMH 5CR8A 3X1EA 5BOZG 3M1BA 3KPMB 1D5XA 5B1JA 3ZDYE 2NW2B 4GMTH 3CPLA 4U7SA 2IBBA 3GMLB 2FWLB 5BO0D 4OZFA 5DSCB 4QIRA 4GP4B 4R96B 2VXVH 2JVUA 3OMAB 2ZP9A 4M4PA 4P5RA 3ELAT 3T4AA 5FKPB 3FN9A 4EUPB 2WCGA 5C07B 4D9LL 3NCMA 4PI2A 1R34A 2YGVA 4J3SA 5C0AE 2EDYA 2MKLC 3QXUA 1EIBA 5GGRY 3MLUH 3C5ZB 3FO0H 1EK3A 1G0XA 1J0IA 2DZEA 5B1JC 3TX4A 1MRDH 5HDOA 2Z35B 5HHPA 1KYUA 3QHTC 4Z7WA 3QH3B 2ED6A 2XKSA 3DX2A 1TJGL 1BMZA 1TKWB 2R29H 2Z6FA 5B21A 5F7BA 3RZCD 2ITCB 2E8YA 4PMEA 4DGUA 2X9ZA 1PNDA 4L8CA 5CUSH 3MV7E 3HG5A 3TM6A 4DSYA 5HYSG 4HS6A 4YE4L 3JVGC 2HKFL 1U30A 4G8FB 4ZSOE 1CT8A 3MBEB 2FDBP 4QHKI 3B3IA 3A0OA 1WZAA 3GMOB 4Y4KC 2MCPH 5DD5L 4FAAB 5ACLA 4MS6A 3WDHA 1RLBA 4NJAH 1CFMA 1DVZA 5IEHB 1GTFA 1I7UA 5ID1A 3N1FC 3DJRA 2HFFB 4ZMOA 4JO4H 2G75B 3SO3C 1XB3A 4IBUA 1BYOA 1JPEA 3P73B 4NZ8A 2Y36H 2AJUL 4MSWB 1M9SA 5DVPA 3CSYB 4ATTA 5JNYB 4ODTL 3B9KA 1USZA 2P46B 4N4YB 2YPVH 1ZLUK 4LLYA 3ZRFC 5FECB 4KK9C 4DP6X 1PKOA 2FNWA 2DL9A 4K3JL 1KTLA 1N10A 2C3XA 3GLDA 2GY5A 2OL3B 2AS5M 5IQ7H 2YQGA 4MS8D 1FPTL 3U25A 2LFEA 3N06B 3QQ9D 4XP4L 4DP9X 4HMDA 4PWIA 1NOFA 1L5GB 2KUTA 2NY4C 3QRBA 5D72H 4WY7L 5EFIA 3NAAL 1NAMB 4Y4FD 3ZL1A 2F7OA 1W6WA 4L8BB 3AAZB 5ISZD 4FQXA 4PJ5B 1T5XB 2YQ2A 3RWJA 1RZKC 2FJUB 2R0WH 2YAEA 4L8BA 4OZGE 5I66A 3OV6A 5KSBB 5JR1L 2LGNA 3EYOB 4XN7A 3MV7A 1MLBA 4RGNC 4U31A 2J6WA 3OR6B 1IM9A 4HXAH 2ATKB 4OFIA 1L5GA 4JPKH 5T1JA 1MFEH 3ZDYB 3KPTA 2JB5H 1CXEA 2BPBA 4K94H 2VAAA 4RRPA 4FQPA 4XPBL 1VZIA 2HTLD 3QCTL 4FTVE 3MCLH 1OK8A 1WE5A 2A9BA 4QOKB 1ACYH 3SN6N 4WAFA 2G0LA 4JQXA 5HDBB 3GSNH 4HZAA 3ALXA 4DCQB 1BOGB 1CDGA 4FQCL 1NPUA 1K2DA 4Z7OB 4WVRA 3EUUA 4G59C 1E8XA 4WW2C 2A74C 2BIIA 1IUZA 4ODSH 4LAQL 3T2NL 4QWWD 3VXME 4MSWA 4BQBA 1WBYA 1A3RH 1R0AH 1JZHA 4PGCB 5FUCC 1S7WA 3REWA 4FHBD 3OKLA 4MAZA 3SKMA 4EAEA 3P0VH 4Z78B 5ID1B 2CLRA 2VLRD 1JNJA 2FR4A 5AZEL 1G6RH 3N43B 4YXKL 2BINA 2A9NH 5IQOA 3BLKA 2Z1PA 3U7WH 1AZRA 2AF2A 4H26B 4W6XB 4BGLA 2IGFH 2QQNL 2Z93B 3BMVA 3L3IA 4WWKB 2AI0L 4XNUH 1YAIA 2AQTA 2A83B 1TOXA 2RHEA 3LIZH 4PJGA 4PJHE 1N64L 4PRDA 4RSVA 1IM3B 1BEYL 2X4QB 3L3HA 4XPAH 2EDHA 4H44C 1T7VA 2P52A 5LB1A 2IJ0C 2LQRA 3D4ZA 3RUGF 5HI4C 4F27A 5I5MA 4RGNB 5HGHA 1NQBA 1U6AL 2Z0UA 4U1SA 4OF7A 5T1MA 3IBOA 2WBXA 4POYA 4HUVA 4UM8B 3W82A 3OKDB 4LB8A 4CC0A 4A68A 1O5DT 3HB3C 1DANU 5D7JD 3CZJA 5FV1L 3RP1A 3SYQA 2Y3NA 3O2VL 1I3GH 3RIFK 1WITA 3LKOB 1Q72L 2WV3A 2JKLA 2YAPA 4N2KA 4OCSH 1GOFA 3ESPA 1UWYA 1I8IB 2R0LH 5B7FA 2NPLX 2CKNA 4NM4L 3P4LA 4NZTL 3PIQB 4PRHA 5FHAH 3WENA 3RI5K 1YEWA 4FCHA 3PP3H 3NPSC 1I1YA 3ZOAA 5FXCH 3MNWB 5D6CA 2NYZA 1IU1A 1MCSA 1JBJA 2X2IA 1CLYH 3Q05A 4RAHA 4YEEA 4YK4B 4YHZL 2IANA 5GS2H 2YZ8A 4FP8L 1XSIA 1TTAA 3I02A 4PJ5D 2DQIH 2PW2A 3IEAA 4AYFA 1HJBC 1TCRA 4IHOB 2HFTA 2YMXL 1FP5A 1LM8V 2TAAA 3RTQA 4M7LH 2CUMA 1SLUA 4JB9L 3BUQA 5ERWA 4DQAA 1KYAA 1S9WA 2BJMH 4NXSA 5CBEA 4APQB 5B39G 3AZUA 3MODH 1MCBA 3FRPG 4QY8B 2X44D 3IE4A 4PGEB 4Y4KB 3ZTJG 3ZHLA 2ED7A 3ARED 3IJ7A 4UINH 4K8RL 4J5VA 1QWHA 2H7WA 3F7RA 5BV7B 1ZVSA 3WFCL 1Q90A 1YMHB 5IB5A 3UABA 1KJ2A 2WQRA 3ZTJH 3BRGC 4UQ3A 4GSRA 4FQHA 1E9PA 2YPLD 1N8ZA 1U0QA 4KXBA 4OCMC 5EN2B 1JZJA 1NJ9A 3VFMB 1ZV2A 4G1EA 2AABH 4DZBA 4JN2B 1JV5A 2EUZA 3NQKA 3ZIMA 3H1ZA 1MI5E 3C6LA 3HE7A 3BKML 3GJFA 3HB3D 4B53A 4CW1A 1CD1B 1AQKL 4X4XA 4AGNA 1S7QA 1S7UB 2OQJB 4GAJH 4NKOB 1FO0B 4B96A 4YSEA 1BM3H 3V9CA 1XDTT 4YMPA 3WFEL 1ZHLB 5E1HB 4N2BA 1NGQH 4HC1H 2ADFH 4NC2B 4D0DA 1M57B 4YUEL 1LO2L 1BAFL 4TM9A 2RD0A 3D25A 4ONHA 2EDRA 4N0UB 1DQQA 4LF3A 1ADQL 3NCYP 3ROOA 4AH2B 1BBDL 4U33A 1JNNH 3RYMA 4XT1C 2V2WA 2W94A 3LN5B 4UTBL 4M6OH 4PP1C 3I50L 2PYFB 2C4XA 2QGBA 3HMXA 1G9NC 1DVFD 3V0VA 4O02H 5CFHA 3ZDZE 4MVBD 1Y6MR 2VDLH 1GS6X 4EI5C 4JM2F 1KENL 3EO9H 4G5ZH 1QBLH 3BFOA 4A2FA 4YJZL 3QS3A 2FO4A 2YAHA 3JV4B 2VSMB 3OR7A 4GG6B 4JFDE 3LNIA 4FG6C 4HKXB 4ZRGA 2L3BA 2OSLB 3LN4B 4ZX5A 5BXFA 2A74B 3QG6A 5I18L 1IM9D 4PJIE 3Q1SL 3FB8A 4LFHG 3T0XA 3U79A 4PJ8D 1KCSL 4K9JA 5AW8B 3QEHB 1QNZL 3TVMA 1HEJC 3BKYH 1ZK5A 4XCCL 1QSEB 2DM7A 2EDNA 2ZNWA 1VFMA 1NGXB 2O5NA 3QIWC 5JIHA 3DOHA 4M62H 4G7YH 4ZMNA 3NJVA 5ETUB 3E1ZA 1T2JA 3CN2A 3KXFD 1PCXA 1PLGL 3FQXB 3HFMH 2XQBH 1U41A 3IPEA 5DHDA 2H6UA 5I5JA 5A2KH 3MHZA 1JZ2A 4M8UA 3LN5A 5K5YA 5FO7B 1I31A 1DQLH 3WY2A 4CJ0A 3U6XS 2QVTA 4LF3B 4BH7B 5C2BH 1AR2A 2CDEB 4DP2X 3W2DH 4ONHB 2IV9A 3US9A 3FTVA 1GJWA 1Z0MA 3ASWA 3CZUB 3DX4A 4JREC 1CFQA 4NHUB 1L6ZA 5FGBA 5L2KA 1GZPB 2VC2B 4KX9A 1AY1L 1ZHLA 1RQ5A 4NUGH 1A7NH 1U8JB 4BZ2H 1RSFA 4ZTOL 4DVBA 4D8PA 5JHLH 3HN3A 1GY2A 3KH4A 4NRZB 3RTLA 4X0NA 4PJ9B 3QNXA 3QQ4A 5E56A 5KEZA 1UM4H 1P2CA 3BUYB 3HLAB 4WO4D 1GZHC 1TZ8A 3IJ9A 3ULVE 3IDGB 2K9UA 3Q13A 1K3IA 1NFIA 3DXAA 1VB9A 3CN0A 3QDGE 4IKLA 4ZD3H 2EIMB 4JO5A 1V7ML 2NY0D 4BFBD 2ZCKH 1SFDA 2KZBA 1OF2B 1J9CT 5I6MA 4J2QA 4S10A 3VW3H 5DMJB 2ZYRA 4B9IA 4D9QE 1COBA 4U1IA 1O7DE 2XN2A 4YHYC 5B1BB 4X98B 4APQC 4Y88A 1R3JB 4IQHA 4L8SB 4MQ7B 1F11A 4M8QB 5L4IA 1F58L 2DM2A 4TXVB 1ZLVK 4ETQB 3MRNA 1FJ1A 3U2SB 5EO9B 2PXYC 3NDZE 2OW7A 3VI3A 4Y4FB 5HJDA 4GKSA 4K8RC 4K55A 4BQ6A 4X4ME 2AEWA 1L7TH 2PW1A 4E9RA 1YEHH 3ATDA 3R06A 4U6YA 1NC4D 3DOSB 1KYOK 2YMOA 4RGNE 3V4UL 2VDQB 4OF5A 5F0MB 2Z8WC 2ADJA 2NY3C 2WMPB 1E67A 4AZ8A 1ACCA 3MLWH 3TS8A 1T03L 4MA7L 4EBQL 1YY8A 3C9NA 4OQ1A 1BXAA 2R2EB 2YLKA 3FH8A 5F9WC 2AQSA 3LKOA 5I9QC 4MD0A 1LMIA 1MJ8H 3IMUA 1F6LL 3GSOA 4UMGA 1DVFA 5TQ0H 1ITCA 5GRWA 4I3RH 1U2CA 4KRPD 3PGCB 2F1EA 4YBLB 5FF6B 2E9GA 2ENSA 1CTMA 1A47A 1KV7A 2NYYC 4QRQA 2R39A 4NKIH 4MB4A 3B9EA 3GI8H 1ZLSH 5JW3H 2AXJA 4H0LC 4IJTA 5IJCC 2ZKXA 2DJSA 2X4QA 4CMMA 1A25A 1TQWA 4PV9B 4FQXC 2GSIA 2B1OA 1BIHA 3UX9B 2DQFB 1KTDA 2HB0A 3L95B 4KJQC 1VZHA 2V8LA 1G7PA 2R4SH 4O5LH 4QJ3B 4PWHA 2VISB 4U2ZA 2EZ0C 5DMGC 4WUUE 3SQBB 4FA6A 4NNPL 1ZANH 3MA7A 2DM3A 5IMMB 1KXQE 1T5WB 3LZNA 3GNMH 1DZ0A 3PHOB 4WFHE 5IW3A 2R1YB 1RV6X 2B1HH 3KYKH 2FX7L 3F12A 3QWQB 4J1UA 2OMXB 4JFQA 3TV3H 1ETA1 3FUDA 3P3RA 3PP4L 4CVZB 4XC1L 5T8IA 1UT1A 2BWIA 1OLLA 1EEYB 3MYJA 4Y1AA 4BQCA 3S9DB 4UQ2A 1E28A 5J12B 4ABQA 1K2DB 4Y16C 35C8L 1QFPA 2MOGA 3QNZB 1G5AA 1R6VA 4C56E 1UM5H 5C0FB 1IC1A 1PW3A 4WWKD 5EZIL 3MLYL 3UTPD 5E6IC 4PJHB 5D9SA 2VDNL 3QA3B 4OLUL 4F8TA 4ZG1A 4PW3A 5LKNA 1RLWA 4UNUA 2EO9A 3BKCH 5ITBH 4H8WL 2X7LA 2VKXA 4G8EA 5D2NB 2DIEA 3EYFB 5CZKA 5TE6L 1DJHA 4G9FB 3HOGA 3N1GC 4HKJB 1CFNA 3H85A 4AVJA 1A4KA 4PS4H 4R5VA 5I16B 4YHML 3DUSB 3PJSB 4YGVB 1FORH 1X5MA 4Y2OA 1LK2A 4GW5B 4F58L 3MCKB 2DYSB 3U2IA 2COVD 1N0LA 3QC6X 4M7KL 1Q1JL 1KGUA 2CK2A 2HH0L 4HCFA 4B9CA 1ZJAA 3CVDA 5DHVB 3PWLB 4OJYA 2KERA 4OLWH 4PJ5A 5D7KE 2YEZB 4X83A 3W9EA 1RUMH 5C6WH 1IGJA 1QUNB 2CBQA 1NC4B 1A8JH 2EE2A 2FECI 1PY4A 2V6HA 2X4SB 4G43B 4NGHL 9CGTA 4KNQA 4N1HB 3T65B 5EOQH 2V5RA 5CP3A 4M1DL 1IEAB 5KYXB 3VXMB 1FNSL 2KPNA 4P46D 2DYRB 3KWVA 3MREA 1NBVL 4IOIB 1JXGA 2AEPH 4RA0C 4TUJA 4DP5X 1CU4L 2RQEA 2K8MA 1XGYH 1QI4A 2CO7A 1G4RA 1SOXA 3AQYA 4MJIB 4GQ9H 4Q0XH 5D7JA 2FLRT 1XBDA 3NFPA 1JFQL 4E9YA 3MRPA 3HKFA 3D85B 4FC3E 3S8FB 1D5RA 3O11B 4QTHA 3QG7L 1KPUB 2VC2L 3IMTA 5DD0L 2WLLB 4HIJB 2LABA 2UXTA 3DARA 3ULVL 4N2LA 1BD2E 2G75A 5IBLC 1JPTH 1QSFD 2X3BA 4GW4B 5GQBA 5C1MB 1W0WB 4GSDH 4JVPA 3C08H 2CJUH 2CK0H 5CM1A 2EAEA 3ARGD 4X6FB 4GW1A 3APDA 5FR3A 1OQOA 4ERSH 2AEIT 4G1MA 1SHWA 3L1OH 5HJ3B 3SDCA 1G87A 1JG9A 4G42B 1WT5C 4CGUB 5HHPB 1X5AA 1KYFA 3VMOA 1VIWA 3IMVA 5IG7B 2WPGA 3T65A 3NK4A 3T6XA 3VXUA 2ARJB 4GG8A 5BW7C 2Y07L 4WFFD 4KTEL 3A5VA 3HPLB 3I85A 5F9OL 1IGJB 5C0RL 1MREL 4MJ2A 4M93C 4WI5A 4GI6A 3RVUD 4A7TA 1WZ1H 3LEYH 4Z7VF 4UTBA 3DMMA 3GHPA 2R56H 4LPVA 25C8L 2R0ZH 2UZXA 2FQEA 3KW8A 4WCYL 2Z7UA 2DOCA 3CPLB 1ORSA 1TYJA 3FK3A 2XG4A 3Q7JA 5F9OH 2FWUA 1ID2A 1QWUA 2DMGA 2VKWA 2YSSB 3PABA 3FU8A 4N0FA 3S3CB 4DGIL 3NBNA 2ZOOA 4PJAA 1BCIA 1OK0A 4G9FA 2X7LB 1VESA 4JQVC 4LARH 1CUOA 5CZVH 5FKAA 3V0AC 3WIIH 2VL5A 3MGOB 2BXYA 3L5XL 4PG2C 4U6HA 1DUZB 1JXKA 1RZGB 1OW0C 4NAJA 3U4BL 4PMFA 5BOJA 5LO7A 4Z7NB 4XN5A 4N24A 3GLEA 2WNWA 2ODHA 1MCFA 2WKGA 2Y24A 2X3AA 3DVGA 3NZ8A 4DGWC 4GFTB 3TFKD 5GGVL 2O93L 2CJUL 4RAVB 4OM0L 3FFOA 1E27B 1T89C 4GSDL 4F2FA 1RZIB 1JPTL 4B0MM 5E2UH 1TYEB 4LU5H 5FKAB 4AYGA 3SDCD 1QKZL 2VGLM 2MKWA 2R7EB 3SQRA 4IBQA 1NBYB 5K39A 4JDTH 3O2WL 5DD0H 2VC2H 5DVMA 1G9EA 2Q7NA 1NFDB 2P80D 4O51B 2QKIC 3D3VE 3GGWB 5EZJB 1K6QL 3VRJA 5A6IA 3FO2B 3KPRE 4MCYB 2V9TA 3RILA 5JXED 1Z9OA 3RFZB 1TF4A 3IAGC 1OCZB 2C4FT 3HFFA 3TBYB 2LU7A 1RH8A 3FOLB 4R83A 5DURB 1U8CA 2AXFB 5KOVC 3S37H 3U0WL 4X9YA 1BQSA 5H94B 1FNSH 2WQUA 4CVXA 4GAGH 4L8DB 2B4CH 1U8QB 2C3HA 2XPGA 2F61A 2JCCE 1TZGL 2WCPA 4AIEA 2KLRA 5DFAA 3H0TB 3SKJL 1HKLH 2OZ4H 3V55A 5CXPA 5TK4A 2EYTA 1XGTA 1FFOB 1TR7A 2OCCB 3OJVC 3ZTEA 2X70B 1N5AB 2NNRA 1EANA 1ACZA 4L1SA 3IDJA 1GCFA 5LCVH 3WE6A 3WFHA 2G60H 3ULSA 3TA3C 4OCRL 2Y23A 1FC1A 1KBPA 4M7KH 4W68A 1QASA 1JGEA 2DEXX 4LPXA 5BS0A 2XRAH 3BGFB 3N42B 5F1IB 5F72S 3DOSA 3EFOB 3HVDA 3L4TA 3T8XB 4JQXC 2NZ9C 5IY5B 3WNNA 3S5LG 1ZE3H 1IKNA 4HUWB 1JGVL 2LHAA 3EUDA 1IAOA 1XCQA 3BKCL 1UATA 4Z7QB 3SKOB 5DLLA 4PP2A 5H35B 3VI3B 2BVOA 5I17A 5EZIH 3G6DL 3BOVA 3QDME 1O6VA 5J6GA 2WBKA 3HI5H 5BRZB 5AW1B 3F8UB 1INEH 3BWUC 3GKWH 4PIBA 4Q4EA 3D85A 5AVWB 3CXHK 4LKCB 3E0GA 2EC8A 3OJDB 3MU3A 1F11B 4M8QA 5JUEL 3O6KH 2BSSB 3WEAA 5FM4A 5GXBB 4MQ7A 3PP4H 2XU9A 5EU3B 2CO7B 1WC7A 2NY5C 5B4MD 3FQWA 3L9RA 4ZTEA 3HZYB 3KYKL 5HDLA 1ZS8B 5F3BA 2V2TB 4GRWE 5CZXC 3U9UA 1I1FB 3GNML 4HWZB 1WK0A 3HZMA 3JSSA 4QCIA 1IEAA 3CUPA 2DEWX 1OSYA 1PX4A 4MB5A 4Y1AD 1OAKL 3PV6A 4G43A 1AVAA 1DQIA 4HS3A 2R4SL 3CH1A 4WU5A 3NIGE 2JLLA 2ZX6A 3NT0A 2H6PB 2EICA 4H1LB 4PSPA 4XX5A 4F1ZA 4DW2H 1BF8A 1HEHC 4HKZA 1ZT1B 4YPGA 4H2AA 3QNXB 3BP6A 3WLWD 2B7DT 1P5UB 2G5UA 3LAFA 4OCWL 4AEHH 1DN2A 1LK2B 3OG6B 4GW5A 1KMGA 12E8H 1HQRA 3NEOA 4XPGH 3X1FA 3AS3A 2OTUB 4HHGA 4MJ6B 1NSNH 1SJXA 3IXAA 4EZLA 4I3RL 3PDOB 1FRGL 5L2KB 3D18A 4B9KC 1XX9C 1LP9A 2D3LA 3AREB 1FFQA 1AR1C 4F93B 2PNDA 4XNQB 4JFUA 4JE0A 2Z7WA 3ZMNA 4WK2B 3L3GB 1A2YA 5CU5A 2IC2A 3J07A 3MLWL 1KBGL 3X14A 1UJTA 3NJXA 1BXVA 4HF5L 5D7SL 3RURA 1BECA 5DJDA 1FYTB 1QQDB 3RVTD 2OR7A 4R7DB 1AMXA 2H0FA 1IEHA 4JFQB 4PVNA 1U36A 1NZRA 4P2CG 2DY2A 1YEDB 4JHWL 2WAQA 3NQIA 3SKUD 1Z9PA 4LEEA 3TBWA 2Y22A 3ENEA 3NJJA 2X38A 3TPUB 5AOKA 1P69B 4KKCD 3LCYA 3REVA 4F33A 3CQPA 2VISA 4MDIA 4FLSA 5DDHB 1FL6B 1LK3H 4QNPE 1XSOA 2GSIB 4M5YL 3RVXC 2WNKA 1SDAB 1FDLL 1AHMA 1WZLA 2P7TA 4KMLB 1MZYA 1G7JA 1V7NL 3QUYA 4X6EB 2VQUA 3BMWA 5J9PA 3NJLA 2BSEA 4EUPA 4I3GA 5A3ID 1AZUA 1BYPA 2ZCKL 3EBHA 5F7DA 4FNPA 1BOYA 1V7MH 2VH5L 1OAUH 4PCSA 1DVFB 4JO3H 1XR9A 2X3CA 2DN7A 1D5BB 3QORB 4OF0A 3UG3A 1G43A 2VDNB 2OPCA 3V0VB 1Q8MA 4R7LA 5ISZA 4Q9RL 2G9HB 3GMQB 4PREB 3TCTA 3HPJA 4WHTA 3VFTB 1CDHA 4BCZA 2R23B 4ZFZA 4Z7IA 2X6AA 5DVNA 2K8QA 1WWAX 3VGBA 4M7LT 2WWOA 4TQEL 4XOEA 3FFCB 4WV1B 5I5RA 1A02N 1YQ2A 1KT2B 4XZUA 2AZUA 5JHLL 4GG6E 5C9JA 1CE1H 4X8JB 1C7TA 1QRKA 3G6JF 5I1HL 1JUFB 4ZW6A 1A7NL 1P5VB 3R06B 4U6YB 5ICUA 5IQLA 1Q9KB 4Q6IA 4G7QB 1EZVX 5JPNC 1S7TB 5BVJA 2JI1A 2Q7AA 1PG7L 3O6FB 2BOCA 4ATWA 5ITFB 2D9QB 5GSVB 2WXIA 4MNQD 3B9KD 1BWMA 3U4EB 1QSEE 1OLZA 1B0WA 1H5BC 5BQ7B 2ZAGA 5L6YH 1FH5H 2EE3A 4G1EB 4JZJC 4NO0A 3LNGA 5JDJA 1KXTB 1CGWA 5DWPA 3QQ3B 2XQBL 5T5FA 3RX8A 1D9KB 3VX1A 3WS6C 5KG9B 5C09D 2A6DB 3WTSA 5EN2A 3SJVB 3KWWB 4FKHA 1HC1A 1EEZB 1L4IA 4FQ1H 1H9DA 1R5IB 4JE4B 4RZCB 5FYKL 2V5YA 3H9SD 3P9WB 1ZVSB 4DO6A 3MOBH 1JGUL 5IWLC 5FK9B 3HB3B 4OVUA 1TQSA 1RUAH 1MQ8A 3N50A 3WFDL 2D2OA 32C2A 4W6YB 3BUYA 3ZE0E 4WQOA 2VSCA 3TLRA 1R46A 2MJWA 2WKLA 4Z76A 1C08B 4HFUH 1LO3H 4YL4A 1ADQA 3SDYH 1X9UA 1EH9A 3CTTA 3GUTB 5BUPA 1QR4A 3RWCA 3QUXC 1RIUH 3TFBA 3ZY7A 3I02B 4BUGA 3PWPB 4YHYB 1F3JA 1H19A 1YYLL 5D93B 4HJGB 4NPYB 1PQZB 1GZPA 1OCCB 1OE2A 5ICZB 3H2WA 3MNWA 1JF1B 2NUTB 3TTYA 4LSSH 1T0MB 3KNBB 2NY0B 4M6OL 1KLGB 1Q9WA 3T4YA 4A7SA 3UCRA 2Y7QB 2A0LD 2I25N 3QIWD 3GQFA 1AO7B 1EO8L 5KVDE 1MKFA 3CLEL 4KUZL 2GIMA 1BAFH 4HHAB 4YUEH 3O3DB 5DLMH 2ADFL 1JZIA 4PRPE 1XF5A 2MNUA 3FQXA 5EIIG 5KYUA 3I84A 4L9LA 1WBXA 4N0YH 4N28A 4R26H 3ESOA 3S5LA 2BMKB 3QPKA 43C9B 3ZYOA 5DO8A 4C56D 3UPRA 2F1BA 3UDWC 4ZMXA 3I3BA 3GKZA 4OZGF 4U1GB 2ZWYA 3B1UA 3TVMB 4KMTL 5HHNA 5DJXA 4MQTB 4LP5A 5D8JH 2AC0A 4KRNA 3KCWA 1FG2A 4MVBC 3SPIA 5L4MA 3BSHA 3LN4A 4MXVF 1JHKL 2EDQA 2H9GA 3B8YA 4N8VA 4XXDA 5GS0D 3MPCA 4XP9H 3AVEA 3KYOA 4EMZA 2VDOL 5SWSD 3QR1A 4F80A 4HX1A 4MNQB 2W9EH 1VLXA 4KX7A 4AIXA 1HILA 4M7JL 4ZFGH 3WFCH 5I1GH 1MCHA 4PWEA 2Y6SD 5GRUH 4A38A 3VDBA 4HMEA 2XV3A 4GRMB 4JFEB 2I69A 1MOEA 1AZZC 1WA0X 4I9WE 5F3FA 2ZYHA 2R27A 5DUBA 5E2JA 3VJ6B 2Z91A 3EF4A 4TKWA 2OXHB 3EOBB 3AWGA 2CLZB 2YPLA 1TTBA 3FRPB 3X3GH 4GBXC 4UT6A 5IMLB 4OAWA 1QEWB 2ZG2A 4C8XA 1HXYB 3WHE1 1REIA 2P44B 4M7LL 2NY4D 4X5WB 2YMXH 3B7UX 3AREA 4IIQB 3T8MA 4M8VA 1KCBA 4WENB 3X1GA 5HGBB 4N25A 5DHMC 3VSUA 3RWEB 3BDYL 3VWJC 3A21A 4PBXA 5FGSA 2FQDA 4W9CC 2GJPA 3GSNA 5SX5H 4M5ZH 4NO3A 3SE3C 4D0BB 3V0IA 3SDDB 1CD1A 1S8DA 2I85A 3IDIA 3LNEA 4HWUA 4NM4H 4F8LA 5I71C 3NABL 1VCBC 5KSBA 4K7FA 4Y4HA 1UQSA 2QL1A 1QNIA 5I6XC 1JAEA 2W60A 1Q94A 3GDCA 3WTXA 3F83A 1WRFA 4WTXA 3ZKQD 4OI7A 2DQDL 1H6TA 1CL7H 1QFOA 2VR7A 3NFNB 3RL2B 1OT2A 4EIGB 2EDFA 5AW9B 4N0CD 3GMRA 3C8KA 2HMID 1JHLL 2IQAA 5GJSH 3C6SA 3G5YB 3IKKA 1HSAA 1K5NB 2QHRH 3DUUB 4WTWA 5D7LA 1MCCA 1U6AH 3WTVA 3WMPA 4L2LA 1J8RA 1Z1WA 3DJ9A 2VDRB 3LY6A 4JG0L 3RJDA 2FH8A 2OL3A 2L7EA 1ES0A 3KPOA 4X7SL 3HZYA 5CLTA 1JYNA 3OKNB 2WLJA 2XIBA 1KJ3L 2AERT 2E9JA 1XF3A 4OFKA 1LP9F 4BHUI 1F1DA 2BSSA 4JFFD 4Y1AE 3RAJH 1FZOA 4BFGA 2NTFA 2XWZA 2IDCA 4XNUL 3Q2CA 2XBZA 2P5WA 5DMIL 3RWGA 4FFWC 1AI1L 3BEVB 5B39B 3HHRB 4LL1A 3QQ9C 4NNYB 3U7WL 2A9NL 2H32H 4YXKH 2CJTA 4IBLT 3EDFA 4GRWB 4MFHA 5ABAA 2YBRB 2E6JA 4LSUL 4R4NC 3KAAA 5E6IA 2ENQA 4AITA 4BFOA 4QDGA 3T2NH 1M71A 4N8CL 3TCLB 5K9OA 4PRHB 1FLRH 2E7MA 2KZKA 5D6DA 2D0GA 4FQJL 1VGKB 4TS6A 1FL3B 1AQ8A 5CIPH 3R4RA 1FAKT 2YAQA 3NIDF 1N9PA 5K1NA 1V55B 3LKPB 2LTQC 4YXLH 3FYEB 4A55A 5C0EA 3I2CL 2JB5L 4K71B 1MFEL 1RXLA 3F64A 4NRYB 4L8DA 2G2RB 4HXAL 1ECZA 3MJ7A 2BFVL 3P4OB 4I77H 1MEXL 1KB9J 1NMBH 1K8DB 3CZEA 4GAYB 1G7LA 2HRLA 2R0WL 3QI9D 3BPOB 1IM3A 3L3HB 4JR9L 4LCWE 2BNRD 3BEWB 3VH8A 2AJ3A 4IRSB 1BD2B 4OJFH 4D9QD 4ELKB 3DX7A 2GUOB 3V10A 1OL0A 3C5SB 3NAAH 2BDNH 2VXSH 1BFVH 4ANXA 4K3EH 2XA3A 1S7XA 1L9PA 4AQAB 2VR8A 3MXVL 3V0HA 3QHZL 3GS7A 3QCUL 1LEIA 1EFQA 4K9EL 4YSOA 5GISH 2R69H 4L0PB 2VZ1A 3OKLB 3GMPB 3BP4B 2FTAA 1BW8A 4BE5A 1UD8A 2B77A 1GRWA 3DVGB 2O5YH 4KKBC 2F54B 2C26A 4ZUSB 3TPKA 1RAMA 2VXQH 1AE6H 4OF8A 3OHXB 1JZFA 4PVBA 1KIPA 4F9LA 1DUZA 2D31A 2GY7B 3U0PB 5ANME 2FUQA 5KTEH 2Q8BL 5ES4B 2X4UA 2ZXQA 2B14A 2CHWA 2ICWI 3BE1L 4NJAL 2HN7A 4NQCA 5DVOA 4QRPB 4KVNL 1MCEA 2MCPL 4EZJA 2VAAB 3GIVA 4NX0A 2BOBB 1NWPA 2OR8A 3DUHA 3ZHFA 1KPVB 2W1NA 3E9UA 5AB1A 3ZE1E 3V5KA 3OR6A 5ENWB 3DO4A 1NOLA 4WU7B 3QUMB 3DMMB 1T5XA 4GBXD 4TRPL 3QPQD 1BMWA 4P3DA 3HS0A 2O6DA 4Y5VA 4BSVB 1SXSA 1BMGA 2OK0L 4GLRH 3CFBB 4H8WC 4OGAC 2IADA 4X7CC 5C71A 3QPXH 3RU8L 3S35H 3OF6A 3H53A 4KDWA 1SFHA 5EF1A 3B2DC 1G7HA 3EO0B 1P9MC 3OKKA 3TEWA 2H0PA 2ZWSA 3FTGA 4YE0A 3MRRA 4GY4A 1YC7A 3NCFB 5CJXC 1XB8A 3SDCB 3ETTA 5LBGA 3OM3B 3PLYA 4LBEA 1EBAA 1OM3H 2LV4A 5GGUA 2XWRA 4H0IA 5I19L 1AC6A 3D06A 2IDUA 4GMTL 3V4PH 3ROLB 1XF2A 3VI3F 4GUCA 1GS8A 1MFAH 2DTML 2NY5H 1G0YR 3KPNB 1JK8B 5CN1A 2YARA 1MW1A 3OZLA 2G9KA 3ML8A 4A39A 3FU5A 1OW0A 2H45A 3NIFF 4DZ8A 1GYWA 3FOMB 4NUMA 4PJ9C 1F4XL 4R4ND 4RBPH 5AVZB 4L29A 1WA1X 3US1A 2Z1KA 4HD5A 2XHNA 3BISA 1CR9L 3EJYD 1GMIA 1SJVA 3H3PH 2WLLA 3LH8A 3TA3B 3OLGA 5E5RB 1MRCH 3CVHL 2DBJA 2VT0A 4HCRL 2IXQB 2CDGA 2OL3L 2B1AH 4XNYL 2IH9A 2GK0B 4X5XB 3JWDL 1B6DA 2Q6WB 5F6HI 5IB1A 4L8CB 2QQKL 2ITCA 2D03H 4LK4A 1YEGL 1L9SA 3RIFF 1U8MB 1XCXA 3GRWL 5HHOE 5BZWA 5C92A 4Y8DC 4W1TA 3H42L 4KDTC 3ZMRA 4OTXL 5ID0B 1AGDB 4V11A 1WIOA 3D2UD 3MRMB 2G2PA 2RJMA 3DXAE 4RRPM 1NEUA 1EPFA 1P7QA 3VGAB 3W9EB 5J1AB 3PWPE 4Z9KB 1RZ7L 4L5FL 1QPKA 5HHOA 3SY0A 3TCXA 4ESKA 5CBAA 1PX8A 3PWPD 3PWLA 4RMWA 4ADIA 2AJVL 3O45B 4QPEA 4DEPC 5CWSA 3TO4A 1I4FB 4I5BB 3HI1B 2A0LC 5JW4Q 4WUKH 1D5XB 1UOLA 3UAJA 3WTTA 1I4FA 1ILUA 1MFDL 3BAEH 3OX8A 1QTPA 3SKNA 3FTSA 4EI5D 2W92A 1DJYA 1MW2A 5TE4H 4F2EA 3EYFA 1MHHA 4C4UA 1MIMH 1MWAL 1IGCH 3GINA 1I53A 3GWJA 4WW2B 5EBMB 2M2DA 5HI5C 3QYMA 2X41A 2CPUA 4RISL 1YN6B 3MJ8A 4MD5B 1UVQB 3VFNB 3H55A 4KNSA 1AGBB 1JF5A 2Z3FA 3FT4A 1T0NB 4I48A 1NCDL 1UZ8A 3LPGA 3P30H 1QSFE 2BCKB 3WY1A 1THAA 4G6JH 2YXFA 2QVKA 3QQDB 4Q9BA 3W0WA 5CLWA 4AV4A 1VPOH 3QJUB 2R4RH 3I6LD 4HZLA 2Q6WA 4E36A 3CFEA 3IFNH 3MRGB 1JGLL 3RA7L 4ZNCD 2DQUL 3HNTL 5I1DA 4UCFA 1ORQB 5C0RH 3A4FA 3EJQA 3S3PA 5JA9A 2DMCA 2HTKD 1MJUL 4P23C 5CEZL 1LQSR 3QZBA 3O0LA 2N4IA 3UADA 3WJMB 2GT9A 1QRNA 3TT3L 3TZVA 3BVWA 2XFXB 3CHSA 4NWTH 4U1KA 1W0VB 2K6WA 2PWGA 4CJ1A 1QR1B 5BUAA 1VERA 4AJVA 3OKMB 2OMYB 5BV7H 4EN2A 1YG9A 1EFXB 2AK1H 4FTVD 4LOEA 3T0EA 2IOMA 4FF9A 1BPVA 1K3ZA 1RK0B 1ZCRA 1AG6A 1T83A 3D05A 3OKOB 4Q2ZA 5CHNB 4JJ5A 3RKDC 3ZKXB 4F3FB 5JHDB 1KCWA 5I1IH 2KPWA 1UXMA 2D7NA 1B2WH 4Q89A 4ZFOA 1WTGT 4G83A 1A21A 4LCWD 2GTWB 2YEVB 4N2MA 5DR5L 4F5CA 2WLYA 1JZ4A 2IH3B 2DW5A 3HG2A 1G7HB 4LRNL 2DDQL 2WK2A 5EBLA 3MTRA 4IRJA 1LLAA 3APFA 1TU2B 5FA4A 1AIFB 4YBQD 2KDGA 4X5PA 2AKRB 2IVFC 4ANVA 3C9NB 3T0EC 3HS0B 5A16B 3LD8B 1FE8L 3LTVA 5BMFL 2LVEA 3CXDL 5DD1L 2OLDA 3QWRA 2W81C 4UT7L 1DVXA 3IAPA 4X8CA 1Q4NX 2QTEA 3HN5A 4YSAA 1UEYA 2A4CA 1Q9LB 4FZEL 3KLAA 3WLBB 1AGFA 2VM9A 2XN0A 4GJTB 3ZKSD 5MI0C 3P77B 4KZEH 1ZTMA 4A7VA 2X2YA 3ZT7A 1BQHG 4X5RA 3FF8A 4ES9A 4LOUD 1WFNA 4XP6H 4Y19B 2YGQA 3VXSA 5EUOA 2AVFA 3TA4D 2NTSP 4MMYB 3HUJB 1AFVL 1S5HB 1DBML 5EU5A 1UCTA 4L3CB 1GKOA 3N85L 4ZNEE 5F7FA 5DVLA 2X4OA 4U1IB 5E2VH 3CSBA 4ICWA 3AACA 5D70H 2Q20A 3QO0A 4Y2DC 3BQUA 3L1GA 1HHKB 1XF1A 3D2TA 5KSVB 4LCCB 2C7UB 3WG7B 15C8L 1D5ZB 3DDFA 4PLNC 4IBYA 4E9XA 3ULAB 2DQGL 1N7ML 1LD9A 2XTJB 5EU6D 3DJZA 3AG3B 4BFRA 5AB2A 3KLHC 1KJVA 1LO0H 3OB0K 5EU6E 2BSBA 3QUYC 1SF3A 3QVAA 1T6VN 4U1JA 1S7XB 3BH8B 2EADA 4EEEA 3BRDA 1I8MB 1D9KC 1MWAA 5DRWA 5ISZE 4ZSOA 4JY5H 4QD2E 3WKNA 4A6YL 4HMCA 3KYMA 3GXPA 4NBZB 1Y18B 1FCCA 1SYSB 3F58H 1H5BB 5IT2H 2CALA 4G2AA 5JIKA 1JD9A 4O58H 3BJ91 1H8LA 3FONA 1AQDB 3DBXB 4J3OH 1K8DA 5ADPL 2J12B 3HMXL 2ZOLA 4LIQL 1JDDA 2OX5B 1IO4C 5ADOL 3FHQA 5BS0E 4OQTL 3K2UL 3VD4A 3QDGB 2EC9U 1MCLA 3FPXA 2UY7A 4NQED 43CAA 1KELH 4X7FC 4BGDA 2E9BA 2MQGA 4UILH 1GS7A 2CHXA 4MA8L 4UBDC 1NMAL 6PCYA 5JPNA 1QW9A 3P11L 3RWHA 2GFBB 1MCPL 4P5TC 4F37F 1OTUD 1UCBL 5HVWA 3C5JA 5FGCB 3TJHC 4BWUA 1X9RA 4JKKA 4GQQA 4GUOA 1IGFH 1P84K 3QWNA 3D30A 3CQFA 1WBZB 3DSNB 3V6ZA 3ZU8A 2K6ZA 5E6IB 3ZT6A 1JRHH 1R3HB 2EECA 3LB6C 4DTGL 1NGPL 4O4YL 3V52H 5KVMC 2VN5A 1QSEA 2E86A 4NT6A 2OYLA 4I9WD 3I75B 3CZNA 2F58L 5J7CC 3IXTA 1PMYA 1OAYL 3WNMA 5KSUB 2ARWA 4UOW1 4O00A 3FB8B 1L0XA 1AYRA 4DUXA 4ZMAT 3PNWA 4QHMA 3PE9A 4RMVA 1QA9B 2MHAA 2YD4A 3P4MB 5F1KC 1NIFA 2D9CA 3BWAB 4GQPH 4JDVA 4KVCL 4HHWA 4X80H 4M61B 5C0AD 2GPZA 2PYEA 3AU1A 1LWRA 1JHTA 5GRVL 4KV5F 5A2LH 1U93A 1WHPA 4EI5B 2O6FA 3KJ4C 2M83A 1QPXA 3EDJA 1NFDE 1HHJB 1TETH 4U3SA 4U7MA 3D87B 3QAQA 2VABA 4AYEC 3OC8A 1SYVB 1J8KA 3UMTA 3OPZH 2WY3B 5EZOL 4J8RB 1W15A 2PO6D 2DMHA 1SOQA 4EVNB 1T1YA 4UT9L 4DVRL 4I8DA 2NY2C 3WS6A 2X0VA 5C0BE 1W72L 3QUKA 2UVFA 3V2AR 1I1RA 2OQJA 3AROA 1O0VA 4I85A 5CKGA 1DTUA 1CFTA 2VXQA 5HGBA 4E41B 2H2SC 1I1AA 1XEUA 2VDQL 3IJEA 2CO4A 1PYWA 3UTZB 1LEGB 3SGKC 3ZK0A 3S2AA 3ARTA 4BUQA 4WEEA 2F53E 2IAAC 2ATPA 2GTZB 1SM3L 5CKAA 5F6IB 5A2BA 1NJ9B 2QTVA 5SWSE 3VJ6A 2C9RA 2YD3A 2YAMA 4BE6A 1BLNB 1XH0A 3LRSB 3MRLA 4Y4FC 1RPKA 1U93B 3G5WA 4JFYA 3TEZA 1Q38A 4NPKA 1RURL 2WXHA 1J8HD 4ZMYA 3B2VH 3THML 3IMRA 3QFDB 2PYEB 3JQOB 3HE6D 1ZLWK 1DQML 3IJ8A 4EOWL 3B7TA 4QY8A 5GS1C 3FQNB 4NLAA 2D4FA 3NPSB 4J6RL 5MEND 4J27A 5C3IA 1VF5C 3FQ2A 4QHMB 1T21B 3O9WD 1GZQB 2HT4C 3ARDA 1L6XA 1CO1A 4X4MA 3RIKA 4QHLB 4KKAC 2VDQH 4JVWA 4YSUA 1CDIA 2VWEE 2RIKA 3LXBA 4IU2B 4AYFB 5GZOC 2VITA 1E4WL 3O9WB 3VXQA 3FDWA 3S4SB 4O9HL 2P24B 4IYKA 4YBLC 3Q8CA 3APCA 3L4WA 4BDVB 1IBHA 5H37A 3RQ3A 4OGAD 5ABDE 2NSXA 4YIQB 1W72H 3S5LB 3GUFA 2XWCA 3M88A 4LIQE 5A2JH 1CXKA 5MEPA 1XTLA 4OJEH 5I9QB 1I8IA 1NGWB 3HW7A 5ESAA 4M03A 4GRWF 2YKKA 2X5PA 5EZOH 3ARFC 5BRZD 4Q14A 1I9RL 5IFAL 1GH7A 2AGJL 4YNYB 2HXAA 2WOBA 2Y7QA 2ATAA 4AENB 3GTVA 5T1KB 1PF3A 3FFDA 3BWSA 2R29A 5G4MA 4CN1A 3RNKA 4UM8A 1T0MA 4X7DC 3WN5A 4NZFA 2NT1A 3QEGH 1MG3C 5C0IB 1MI5D 2Y4SA 3IT8D 3P1VA 4CADB 1DLFL 1N59A 3SDDC 3U46B 4UM9A 2HPTA 6PAZA 4AJWA 2DWDA 1J12A 5FA3B 4GEIA 1ED3B 2OFQA 3FB7B 5C08A 4KVCH 1Y18A 1KCRH 1RULH 5KVGL 4QT5A 1GZQA 2A83A 3GRBA 4L3EB 1TJHH 2APTA 1UADC 1A5FH 4OZFH 3SO3B 1K4DA 1PPIA 1H3UA 2P5WE 1NCOA 4FL4C 3MLZH 3VFGH 3WN5C 4BZYA 4MA1C 1TFHA 3WS3B 5F96H 1CVRA 3LXUX 1MFCH 3Q6GH 4ANUA 2H1PL 1P4LB 4N1CA 1P1ZA 2AJXH 1WAPA 2CLRB 5EPMA 4Z78A 4G6FB 3D33A 4AJYV 1T6WA 4KKLC 4LCCA 3KDPB 2BY3A 2HFEB 4N6QA 2APVA 1EEZA 5G4NA 3T3PF 1I7ZA 4LLMA 4FLQA 4K07A 3WGUB 1EVTC 1NMAH 4HPOH 1MRFH 4FNTA 2QT6A 2HT4D 1BQHB 1W2KT 5D1ZB 1M2OA 4NDMB 5GSVA 5HYEA 3QUMH 5CS7A 4Z7UF 1RZQA 2NDGA 1TEFA 1YDPA 4LCVA 1PLAA 3ARFD 4BZ1H 2YOAA 3G6AA 2X89D 1J7VR 1OP4A 4LSRH 4Q74A 4P23A 1W16A 4AUUA 3EYOA 4ODVL 3SDXB 3VMPA 2GVYA 2JCWA 1TNMA 5CGMA 3MA9L 3NA4A 4IU3A 3F58L 3QS2A 4KK8D 2R8SL 4JRXA 5D2NC 4N87A 4YHPA 1QLFA 5IB2A 4DK3A 5FA4B 2YXVA 1CI3M 4C58B 3E38A 4ZXBA 2AK4D 1HJCA 3S34L 4UT9A 4BKLA 4OU3A 4PYGA 3T6VA 1JPFB 1AHKA 2O61B 5L7XH 1KIRA 3H9HA 1QACA 1N7MH 1VACB 2Z4TA 3V9FA 1BXUA 1X3DA 4OD3H 4LPYA 3U9PH 1F56A 2VZOA 1RK0A 5T1KD 3KZ8A 3MVSA 4KO6A 1NUDA 3DV6A 4G9FE 3CFTA 1QR1A 3ET9F 5FS5A 4JFPA 4AEEA 3MV8D 1DBMH 1EEUA 4P3WA 4D2NA 4YAQA 3GPEA 3ILQC 4UTAA 5KSUA 5C3TA 5C9KA 2EVIA 1W72B 4UIMB 3ZTNL 4XODA 1WA2X 2ZG1A 5T3XE 1UXSA 3I75A 1UWXK 1ZVHA 5IEHA 3TPUA 1F86A 3DPBB 4LHUB 4U1LB 1IQWH 4OD2B 2DYPD 3FUNA 3UO1H 1QFWH 4O02B 3BIBX 4QKTA 1AC0A 3DRTA 5IJKC 4H0HB 1N0XL 2V8MA 2BCKA 5EU6B 1YNKL 3N40F 3Q1EA 4XO9A 1MCWW 4G6AC 1MCNA 2FATL 3T2OA 4AGPA 1OOWA 1AGBA 3CXDH 4FYTA 4E2OA 2DBLH 2FJGB 3P0GB 2P28B 3UOAB 4ZUWA 3L3GA 4NN7B 5LJYH 5MP6L 4U3XA 2BLFA 4PJIA 4EZMA 2YS4A 4LPTA 3BH4A 3IF1B 4DPCX 1GW6A 3MGTA 1LL1A 2DDQH 7FABH 4B27A 3D18B 3S4SG 3FFCE 3DWTA 1A9BB 3BKJH 3LEVL 1ZT7A 4IS6B 3KBPA 1CK0L 2K45A 3O6FC 3SKNB 4OZFB 3V0EA 4CU7A 2ORBL 4JFSA 2NLJB 2J2ZA 1U2HA 4N2DA 1U3HD 3BT2H 1CGXA 5D1QA 3FCBA 3BIAX 4L4JA 1B3IA 4P2OD 4F91B 4Z7WE 5CBAB 2QPFA 3H4FA 4Y89A 1I9EA 2N7AA 3F7YA 5HHXL 2H6PA 2Q2EB 3H4HA 4L1BA 2C9UA 2O5XH 3I3DA 1LGVA 2PP9A 2VR4A 5CEZH 5IKCB 1QI5A 4IIQC 1NCJA 5FDYA 1AKPA 4ZFFB 3NZHH 3UEQA 4Q9QL 2C7UA 5AOIA 3TH3T 4AIOA 1S6NA 4JUTA 1PSKH 5D1XB 5CLXA 4N2CA 1N8OE 1ODUA 2R4RL 2ZAIA 2K0RA 3K71B 2ICEC 4NQXB 5A2FA 3KGRA 5EIVA 1NCDH 2IBGA 4P8QA 4U4BA 3OJDA 2HT3C 4HIEA 1A66A 2CDGB 4WZ9A 3X12B 2V5SA 5C0CA 2XA8L 2JE8A 1MHEB 4IMKC 1J0HA 1U3HA 4JL2A 4FMVA 1VKXB 1MLCA 4Z7UE 5HYSA 1RZFL 3QIUD 1UM6L 4U2YA 1IGCL 5CCGE 1WT5A 3HE6A 3KLAB 4CU8A 2JELH 4FDWA 3Q2VA 2VCOA 3IFLL 1ZS2A 2XZCL 4BWWA 1NH6A 3SZKC 1GC1L 4PRPA 3TJEL 1WS7A 1NIDA 1YECL 5JLZA 3NSXA 4FRWA 5F1IA 1I8KB 3Q0HA 5BS0B 5SWZA 1G9NH 3WYRA 2E4FA 4FMKA 3S96A 3GBML 2JCCF 4G8IB 3LSOB 1KCKA 3GBLA 2VLKA 3FTGB 1B90A 3BZDA 3K46A 3OL2A 1Z5YD 3QJOA 1NLBH 1FFOA 2LW3A 5I23A 3BT0A 4HD9A 5HDQH 1I1AD 3U1QA 4ODXA 1E30A 2IADB 2WXMA 3CFBA 3LSOA 4QYOA 4ZMPA 3L1EA 2FEJA 3KPRD 2XPGB 5C6PB 1U8QA 3T0AA 4OTXH 1Z5LB 5J3HD 4YFLI 3NGBC 4OFVA 1U8CB 2AXFA 4IEFA 1EFXA 2B15A 4JKMA 3KVPA 1GSMA 3G6JB 3POHA 2AJZB 5GGSB 4AUYA 3MOAH 4FE9A 4HPYH 2CBTA 3MV8A 4HPHA 1YN7A 2XFXA 1TTCA 3NESA 2EABA 2GT9B 3GSXB 4LDLB 6TAAA 4HBQA 2FEDD 3FSAA 1NICA 1UXWA 1WWBX 5E94A 1MLCB 1HSBA 4NQCB 4JAMB 5D5ME 8PAZA 2E7LC 1ORQA 4ENEC 4JPWH 1JJUA 2COQA 4PJ8B 3WY4A 4HT1H 4ZPTA 1KIPB 1C7SA 4PJCB 5IF0A 2HG0A 3HVNA 2YJQA 2VIRA 1R5VA 2NY5L 2BIHA 3X3FH 2HPOA 2FJHA 4GXVL 3VX0A 1IBZA 3GMPA 4PJGE 2ROYA 2QJDA 1CN4A 2X87A 1N6UA 3MJ8B 4FEMA 4GP8B 4R4FL 4YZWA 3MGOA 3GSVB 2XG5A 4GMSH 5IKCA 2IWGA 4JHBA 4W9EC 5IM7B 1B3JA 4LRIC 3WIHH 4PY8I 1NUFA 3D07A 3I9PA 4YDMA 4WW1B 5DQ9A 4ZO6A 3A23A 4TTDD 1L0PA 1RHHB 3AC0A 5CCHE 4AM0A 1E65A 2NR6A 3SODB 2XBDA 3FCGA 5DQJB 1GL4B 1FVCA 2VM4A 3OVUB 2ZX8A 1FN4A 1NIEA 3FSOA 2DAVA 4UF7C 3MSPA 4FFYA 1JV2B 4ORZC 1FGVH 4MRBA 5BRZE 1N4XH 3WDJA 3T2LA 2WYTA 4Q56A 3HUJE 3TH4T 4TUOB 2EXYD 4PVMA 4BELD 1P7QB 5T3ZH 2NY7H 3JUZA 3HPLA 2KLTA 1WZKA 3WO4C 2HZHA 3HZKA 1RZJC 2FQGA 3BZEB 2Y3AA 2XLLA 4YDLB 1ZHKB 1MVUA 3FNKA 2FYYB 4PJBB 2Q8BH 2Q7YA 1T1ZA 3SGDH 3SYAA 4KJPC 3MRKB 2PABA 1KEML 4GUQA 3TZVC 1S9VB 4XVTH 3OGCB 3QULB 1DVSA 5HJ3A 4GQZA 3QT2A 2VXQL 3TCLA 1NBCA 5E7FA 3K1DA 3KYNA 4RX4D 4P3CH 4UDUA 1EERB 3U1PA 4KPHH 2P8PA 3CXHJ 4MDRA 5F71A 4LHUA 3N42F 2BHUA 1BDYA 1F6AA 2J44A 4HLZH 4ABWA 1MJJA 2R69L 1USQA 4P4KC 3MLRL 5IHWA 1IM3D 1NCAL 2JMRA 4K9EH 2YFOA 5B1AB 3TEUA 3STZB 2N7BA 1EX0A 3KPSA 3B6SB 2DWEB 4KHTH 5FOBA 2VXSL 1AZNA 4OGXH 2C9VA 4LLVB 1SLXA 3NFPB 2GW5A 1F4YL 3JWNC 4TVPH 2QSTA 5FC9A 1CTOA 1YEKH 5C09E 4AK1A 4N3UA 4OGYH 5ECGA 4C56B 3BESR 1NCIA 5F97E 2QLYA 5EOCJ 1KCVL 3MREB 1KZQA 1ZPLA 1MEXH 2W59A 2BFVH 5LHDA 1ZA6A 3PREA 1C12A 1BVLA 1EHAA 1SNRA 2QV2A 3VXSD 4EIUA 5KBKA 3I2CH 2WIIB 4ODWB 4ZXBB 5IZ7A 1IILE 3MNZA 4BSWB 4YXLL 5F8QC 1O9ZA 1VFUA 4PRBB 3B34A 1CBVL 4CC1A 3N1QC 5DZAA 4IU3B 1RU9H 1ZHNB 2JQAA 1I9IL 1J1PH 1SUJA 3KHOA 5HYFA 4IBWA 2PWFA 3QUMA 5LNDA 1A64A 3ATAA 4HIQA 5CJQH 5E9DA 5D1XD 1F18A 1S8DB 3IDIB 1QYGH 3JWOC 5E0FA 2BRRL 2SEBB 3PAVA 2CO6A 4BHUA 4N8CH 4TQPA 2QSQA 2A9ML 3NCYS 3ZE1F 3BI9X 3DPDA 2WZPD 1DBBH 3EYSL 2CCLA 3LNHA 3II1A 2B9BA 5D5MF 1TPXB 5HYJB 2X4UB 2ZUWA 5HGDB 4X5WA 2XNAB 5I6XB 3L4YA 4J3OD 1KNOA 4B9FA 3JVGA 2MCMA 5JOFA 4AGOA 2A6IA 5KBPA 5E8DH 3BRFA 1I7ZB 2XWBB 2GJZA 1C5DB 5JW4R 3GC3A 5CMAB 1QPPA 2WO4A 3T0ED 1YY9D 4UQDA 1B4JL 1Z2KA 4I0PC 3RGVD 4DH2A 1TQBB 1D2PA 4X7SH 4EIZC 2FGWL 4AL8L 3RJOA 1JTTA 3V7MA 2ZCHL 2R0KL 4IIZA 4A2EA 2VQ1A 3CHPA 5GGTL 3WS3A 4HX1B 4RMRA 5I0WA 4JFHD 3QR2A 3MA7B 3SE9H 1K4DB 3CC5A 3BPNB 4XXDB 4W4OA 5D2NE 5KVDH 4FFZH 1Z7JA 4BFIA 2GUOA 3E80A 4JZOA 2WWKO 5EWIH 2JJTA 3F5WA 4MAYD 4Z7UB 4DKDC 2N01B 4L2YA 5C08B 2B9AA 3KPRB 5AYTA 4FQLL 4TVSa 3QDGD 4NAQA 1RPUA 3BAXA 4FXKA 3W11D 3OJMB 3QCVL 2WLIA 3KPPA 2WANA 3WKML 1ZLDA 3BYYA 3ARGC 3HUJF 3NACL 5EIIB 4NENB 1RVFL 1L0QA 5CU9A 5IV2A 4TSBL 2B59B 3BVUA 1CICD 5TF0A 3PUUA 1QBML 3FYIB 3GSOB 4RGND 2XPYA 1HNYA 2JXMB 2BIPA 2BVQA 5C0JA 1S7SB 1Y07A 3TA3D 4YFEA 3Q8EA 4X8GA 1DR9A 1ZV5A 5EHFA 5SWSA 3X3GL 5MEPB 5F7AA 1XQ4A 4BFEA 1ONQA 2V9QA 5GZND 1RUKL 5DWUH 1WF5A 5CILH 3ZN6A 4LPCA 4Z3HA 5J6HA 3QFJD 2VDKL 3PWPA 4ABVA 2F5AL 5GRUL 3FFCD 1C12B 1CPUA 4G11A 1DN0B 1FHGA 1D5IL 1KYDA 1BVKB 4S0TD 2VR3A 5HPMB 5I28A 4TV3A 4NHCH 5I75B 1SY6L 4MNGA 3TNMA 5EF0A 3V5HA 1XGRB 2BNQD 4BRJA 4J3OC 1JHKH 4OCXH 3GZKA 3D0VB 3HNVL 5EN3A 3TF4A 1FZOB 2LFGA 1CI5A 1SF5A 5E8PB 2YQBA 3L3JA 1MAML 1UKTA 2RBLA 4KMTH 4PQXA 1JK9B 4X0KA 3ARRA 1AP2B 4PRHE 3N1PC 1SEQL 4ZOBA 3IS1X 1V3MA 5DO2D 1V05A 3QEUA 1IZKA 4JQIA 2CPCA 4E5XB 2K70A 1M2VA 3ZLQC 3ARVA 3VAEA 5EB9A 1ZTXH 4N90D 2VDRL 3C8KB 4R26L 4X6DF 4QRPE 4NQTA 1KB9K 2UY6B 1LWJA 2FSDA 1KDJA 3D9AH 3EZ8A 4TNEA 1IGMH 3WEXA 5KG9A 5C8JB 2JI3A 3QQ3A 3L6FB 3WIFB 3KYNB 2DLTA 4KROC 3CLEH 2XX1A 1I1AB 1A4BA 1BPLB 4PWJA 2YJLA 1D3CA 3OGCA 3QULA 4OLYH 5AENA 5I74C 3MBXL 4KITB 3ULVC 3LPWA 1S9XA 3ECBA 3F01A 3CDZB 3B7RL 3BZEA 1MCIA 3BHBB 1J9TA 3CIAA 4Q6IB 2RA1A 1M6OA 2BM3A 1P5VA 5TJWK 3UP1A 4WUUB 1RIUL 4JG1L 4ZAKD 3ULUL 1CMOA 2XQYG 4ODBD 4U1MB 5TDOB 3LZOA 2YK1H 3PAUA 1E5AA 1ET7A 3ETBF 1XZWA 1A1OB 2APFA 4S1RH 4OAWB 4OI8A 4A7QA 3QXTA 5DD6A 3VXPB 4POUB 4L4VA 3HS9A 1MHCA 3DYPA 3IYLW 1MCWM 2WQWA 3ARDC 1CDJA 4AKPA 3C5XA 2UXVA 1G9MH 4OFYA 3KLLA 1CG9A 4MYWB 1S3KH 4ZK8A 4NO0D 3PPEA 2BP3A 3MNMA 1A6ZA 1JHTB 2VDMB 5LAPA 4XNXH 2Q2LA 5ETUA 5TPWH 2OSWA 1LE5B 4YSQA 2YD6A 5EULV 3D3VD 3DI3B 3F85A 2B5IB 2OP4H 3LZLA 3BGAA 3ILEA 4Y19E 1ZKAA 4JM2C 3IPFA 4CBZA 3GI9H 5A40E 3N44F 1O6TA 4FFVC 4NOBA 1L7IH 4JKPH 3D3VB 4PLKD 1A9VA 1I8LC 3ARFA 2ZKHL 3ECWA 4OBRA 4AG4L 3VCLA 4L9DA 4N5UA 1RL1A 2XXCB 1IC0A 4H5SB 3SCMB 1G1KA 5DQDL 4D0CB 1MCKA 2BMKA 4K9EC 4LNVA 2XTJE 4WHDA 5GGSY 2DQEH 3HG1A 4PTUA 1GGYA 3HMWL 5DJDB 5IK3A 1OP5K 2UUDH 4PD4J 3O3DA 1CE1L 4PJ5E 3N43F 1G7IB 3AMLA 2ZUQB 4EKXA 1A7PH 4RFNB 2LOEA 1NCGA 1LJMA 1ECYA 2OTPA 3FQYA 4GB9A 43CAB 2AQRA 3BH9A 1A14H 1SXAA 2YAOA 3KM1A 3EJRA 4E5XG 4Q9RH 5AWNL 1SDDA 1JF1A 3RVTC 4JO3L 3HR5B 1OAUL 2VH5H 4OKVA 3DTXA 3VI4A 1MNUH 4OCNC 4Y2LA 4EN3A 1A0QH 2QSCL 2ED8A 2OTWB 5AQ0A 3HZVB 2WBJC 1E9OA 1N68A 2VLMD 2UWEF 2H5UA 3NCCB 1QHOA 4HWBA 4G8IA 3KJ4B 2E74C 1G1YA 4W9LC 4Z76B 3MGAA 4GAFB 4HKZB 4YPGB 1FDLH 4AYDC 1SXCA 1FNFA 1PAMA 2DQHH 2OMWA 4BH8A 2VWEC 1I8KA 3QFJA 3RL1B 5I8CB 1CTNA 1LK3L 5JLZB 3PV6B 4R7XA 4WI6A 5DUJA 3BPCA 3A6CH 4DK6A 2PCPA 3U2JA 4XO8A 1D7DA 3U36A 2EDBA 4KKNA 1I1FA 4H0GA 5SV3A 2NOYA 2KQMA 2WTPA 4ZBJA 2CKBA 3DX6A 3L3KB 1PZSA 3AT9A 3JT0A 5IHZB 1A3LL 4JPIB 2X88A 3PQYA 2YD2A 3CMGA 4L3CA 4FKEA 4M48H 5D7SH 4NQDD 3RZWA 1NAKL 4IGBC 4NQEB 3GHEH 2OYKA 3WXWH 3ZO0A 3HUJA 4UT6L 3VXSB 1JN6A 3LQAC 3SDAA 1QATA 1XD1A 4AW4A 3CLFL 3ZE0B 4KROB 1MCOH 4F7EB 5E1AB 3TO4D 4LNRA 2ZSWA 1NCCL 3GO1L 3WU1A 5DO2C 3WJJA 3LRGA 1L9QA 2E7HA 3PXJA 1E9QB 1F97A 4Y5YB 1OY3B 1ZD6A 1EAOA 4HVBA 2WWMD 4MNHA 4RWYH 4R5XA 4X8JA 4XPGL 1DCLA 1I1YB 2ZPKL 4LE8A 2CDFA 2X6VA 1E6JH 4BH8B 1H8OA 3FRUB 3QEQB 4AEHL 1OSZA 1UT9A 1CF1A 2J88H 1HINH 5IQMA 4HJIA 1FCGA 2DLGA 2X2JA 3VWKC 1TZIB 1HAWA 1ZPUA 3U7AA 5EBLB 3MBWA 4OF6A 3T3MB 3T08A 5AOZA 4Z7OE 2J6EH 1JWUB 1XR9B 3QORA 4AM0Q 4HS8L 3NCXA 4EQ3A 3EGSA 1N67A 3WNIA 1OAKH 4HIIA 1KPRA 1CVSC 4ZO9A 3WMQA 4DGVH 3UG4A 3EJUA 5D7IE 1DQTA 3OKOA 3VI3E 1E40A 4R8WL 3ZKND 3UTTB 1G7JB 1J87A 4PJDF 4EJ1C 1KB5H 4RWHA 5J0BA 4CSZA 4PPTA 5TK2A 2VLRE 2N0MA 1BZEA 2CUIA 2NW3B 1FL6A 3FN0H 4WO4C 4N2IA 1J1XL 5JUEH 5INCB 3CN3A 2P4AB 1WCBB 3HG1B 4PTUB 5IK3B 4BCYA 3TN0D 3GKWL 1INEL 5BS0D 3REVB 3HI5L 2TSAA 3G6DH 4O02A 1G6RB 2PPCA 2ZP8A 4LLAA 3CFDA 4LMQE 3OKEA 5E9DD 1DZBA 4F9LC 4AQ1A 2Z7YA 3M46A 5FO8A 4FD0A 4DKAA 5KSAC 7CGTA 1BP3B 4PLOB 3IWUA 5I0YA 2YWZA 3GEWB 2GB2A 1ODAA 1JGVH 3AUVA 3EIFA 4B3EA 3OG4B 4JMNA 4XN4A 3WUZA 4N20A 5DJ0A 3NVQA 4CC4A 5IB4B 4UI2A 3MR9B 1YMMB 4P2QB 4WUUD 2Y1ZA 2W07A 2NY1D 3V0DA 1A6AA 4MZ3A 3KDMA 5I73C 2JTYA 3IVKA 4LXFA 3EGXA 4AE1A 5SX4I 1IAMA 5DJ2A 1JWMA 5GRJH 3QYCA 2DJUA 1LP9B 1NBQA 5GGQL 1ANUA 1X5LA 2WW8A 4RFOL 4TLUA 4Y5XC 4HIIB 1OGAA 3DURA 1KXVA 2V3FA 4ZFOL 1DFBH 3SKJH 4BKTC 4MJ6A 1BZ7B 5IGXH 4MDJA 4BKLB 2I9TB 2MRYA 4IBSA 4QOKE 5FYJH 5KWYC 2BHFA 4OZIF 1A4AA 1JVKA 3U0WH 3CSPA 1QLFB 5IB2B 4L8SC 1O9WA 5I66B 3FUKA 4JRXB 4S1DC 3RWJB 3E6HB 2WXJA 4PJEE 2AEQL 2BFGA 5HD8D 3WEOA 3NJHA 4M3JA 4ICXA 3QWOA 4N2AA 4UBDD 3OWEA 2CU9A 3RX7A 1HESA 1FO0L 3PV7A 3GSWB 4M4RA 1X7SA 1BREA 4L1HA 3RY6A 1Q0YH 1MH5A 1U3HC 2A9DA 2WZ6A 3SYOA 2MNJB 4JO1H 1OHQA 2E6QA 3FHAA 4XN2A 4IGBD 5EBWB 3RUGA 4CN4A 2HRHA 5GSRA 3R0MA 3AXIA 3I6GA 3KPLB 4NDMA 2CGRH 3FQWB 3VFSA 1QFUH 3CDFA 4Z3GA 3TONA 3UBHA 4JFOB 1THCA 3MRCB 3LIUA 4PBDA 4WW2F 1KGXA 1MCDA 2J8UA 4NQEA 4XC3L 1F4WH 1PAZA 1LO4L 1I9JH 1O7VA 5A1AA 1TMQA 3ESMA 3U48A 1SLWA 2UY6A 3WEXB 4JHVA 3U4BH 3IU4H 5F7EH 1OKEA 3L5XH 1UC6A 2CKBB 5I17B 3TIEA 5H35A 5DJCA 4XMLL 2YA0A 1YJDH 3ARXA 5CNHA 3UTSB 4E5XA 1HYRC 3LH9A 4UV7L 4PJ7A 4FL4B 5LCVA 3EFFA 2D3NA 2PCYA 4TF4A 4J23A 1CT8B 3EFOA 1PKQB 1OPGH 3Q5TA 4ONGH 5SX4H 3PL6C 5DT1H 1SJHA 4XBGB 1OOAA 2FBRA 1JPSH 4ZT1A 3W5MA 3L7FA 4KH9A 2YGNA 2VXTH 2GEQA 3INOA 2R0ZL 1TKWA 2QV4A 1SBSH 2MWCA 3WE6B 2R56L 3UC0H 2PR9A 3BW9B 3MRRB 1WZ1L 3LEYL 4JHUA 4K2UL 2Y72A 5E9NA 3EFDH 1E8YA 3S3DB 4W9JC 1Z9SB 4UM9B 2LU4A 3GTTA 2BP0A 4W6WB 5I15H 2IIJA 1M7IB 4P2QD 3LV3A 4RGMB 4HOWA 3COOA 1EJOL 3IBEA 4WWOA 5E99L 1TPXC 1SDDB 1UA6H 5D7IF 3VB9A 1ZEAH 4CVXB 5EORH 5I1LB 5EEWA 3T6WA 5IR1B 1F41A 1Z0NA 5IVNA 4PLJC 1J9RA 1M42A 3FOLA 1GCYA 2J1YA 4CMHB 4PS3A 4OB5L 1R17A 3L1OL 1EBPA 4N26A 4KK5C 3ALWA 3K72A 4KY1L 4YL9A 2ETWA 2XKUA 2D0FA 1EO5A 4PUBL 2GC4C 4OUUA 1SLVA 3VQ2C 2L0DA 4QRPA 4NEHB 1H3GA 4OCYH 1U8KA 4M6ML 4XP5H 2TSBA 4M00A 1IBGL 5HI5D 2XXFA 2WZAA 3HN8A 5BRPA 3ULVH 2WLZA 1U91A 4NP4H 5LGHH 3DHJA 5CCKH 2Y7MA 3LKQB 4IU2A 1RZJL 4Y2DB 2E56A 1JNLL 3OHXA 4KXCA 3KPRA 3RVWD 4AT6B 1E28B 2N59A 3KLKA 3HNSH 3NZ8B 1EDHA 1YPZE 3D3VA 3ARDB 4LGRB 4JPVH 4MHHI 2XKNB 1KC5L 4OZ4B 4HLEA 1J11A 2IG2H 1XGYL 1IAKB 4NB7A 4ZO8A 3POCA 1QBBA 5K9JH 3FQNA 1NBVH 1JCVA 2X1OA 3FU0A 3U0TA 3GMMA 4RDQF 3L9BA 4X4YB 5HTSA 4AIZB 1B4RA 4LSTH 4GIOA 4IJ3B 4M1DH 1JPST 1RKRA 1Q0EA 1D7BA 4J3OG 5AD0A 2YPLE 3MX0B 4Q6YA 4F2MB 1DBJH 2OMZB 4OQTA 2HT2D 4FTVA 5DURD 3KL3A 4XMVA 2B08A 2J6EA 3CXFA 3WXVL 3MRLB 4NN5C 1BLNA 3R1GH 2Y0SA 4JHAH 3LH2L 4G8GA 5LG6A 1NCHA 3EYVA 3NIFB 4OLWL 5DUPH 1IRAY 3SEPA 3VH8B 3X11B 4K4KA 4ZAKA 4CMMB 4OT1H 2QGEA 3K1KC 1E5ZA 4X4ZA 4J3WA 1PLCA 4XCNA 1Q1JH 4H1LG 3SOTA 1OSPH 1VENA 4PJFE 4ABUA 1TEGA 3C2SA 3AT0A 1GGBL 1OSEA 4F58H 1WWWX 4B9JA 4HSQA 2ZXDA 4JRYA 4XMZA 3LZRA 3PGCA 1ZVYA 4RFEA 4ZTPL 3WGVB 5TE6H 1S9XB 4A04A 3G5ZB 1S7RB 3QUKB 5ITBL 2SEBA 1RUQL 5I30L 4AV0A 5DD3L 5BZXA 4F57H 2FL5B 3M1OA 4G42A 4XP1H 2Y7SA 3L5WB 3D1MC 4IOSD 1UKSA 35C8H 4AUJA 2ADJB 2WMPA 3TURA 1NDMA 4KZCA 3WIFA 1ZSDA 2J71A 3ME0B 4XC1H 3V5DA 3W9DA 5JDSB 4POZD 4R9HA 1VZGA 3C6LD 3HE7D 4G6KL 2FX7H 5I75C 4PG2A 2BCMA 4EI5A 1D5MA 3ZDXF 4AEIH 2VMCA 4U0RC 3UAJD 3QEUB 3IDNB 4CMHC 1H6EA 4YDJB 4YHLH 5DJ6A 5FDWA 1KPUA 1AP2A 3GXUB 2Y2WA 4JFEE 3SGJA 2BNQA 1FBIH 3GT6A 4I18A 5DK2A 1FJ1B 1GIGH 4C56A 4QWWC 4I0CC 5JHMA 3BLBA 1J05B 5HHOD 4KI5C 2CRIA 2ITEA 4XP1L 2W65A 8CGTA 1HAUA 4LCIL 4N2HA 5CLYA 3UYOD 1IC5H 5E70A 3N0AA 4OZFG 3WFBH 5DK2B 4FFTA 3OKNA 1A6TB 4MNGB 4LLDB 3RHWK 3LS4H 1C5CH 5H37G 3NRQA 1UZGA 4ZTPH 1ROWA 1IGIH 4FTDA 3O8XA 3QNFA 4HIHB 4JM0A 2VSKB 2X28A 4NT6B 4JK0D 1FNLA 1T1WB 3SGEH 1IBBA 1N12A 1OSPL 3CD4A 1A7OL 2A6KA 3GRGA 1AGCB 2EIKB 3D12B 3HIZA 2YEZA 4ANKA 3E7JA 2W60B 1P2CB 3HLAA 1DO6A 4YDIL 1UQSB 5DUPL 3UJIL 4BRVA 4NO2A 4K71C 3QQNA 2YFNA 3R1GL 5B7EA 3VXMD 5F7UA 3BO8A 2GFBA 1KB5B 5FW6A 5FV2A 4E42B 1XCTB 1T1ZB 2AV7A 1DBJL 4HK3N 2JXMA 3V4UH 3PJSA 4LSTL 1D6VL 1YEHL 1SOSA 3NCJL 4RFEB 5JIDA 4WI8A 1OWWA 2R1XB 4G8EB 5K9JL 3WUWA 3DO7A 2QPDB 1LTXA 2CDEA 1E7UA 2P26A 2KDYA 4XOCA 5AG9A 4NUPA 2I24N 2WLIB 3KPPB 5TE7L 2XJLA 1QD0A 1FZKB 1XFPA 4JPVL 4QO1B 4ALAC 1TJMA 1HH9A 1HE8A 5DRZB 2QKIA 3EYVB 4UANA 1HL9A 1R33A 1BJ1H 2OZNA 4Z7UA 1RZJH 1QAWA 2IOIA 4R90L 4RNRA 1NGZB 2OA9A 3HCVA 4NXKA 2NX5D 2V7NB 4KJYA 1QSVA 1A3QA 4AGQA 4PY7A 3BH8A 3P0YL 4LSPL 4OLVH 2YD5A 4FEIA 2QZQA 3VW3L 4MNQA 2YXMA 1NGXA 1T83C 1S3RA 3U6XA 5IIEA 1YEJL 3EADA 1FYTD 2MTPA 1QTSA 2NY1B 2H8PA 2P80A 1U3JA 3ARYA 4GBXA 2ESVA 4KY1H 1IFHL 5EOCH 1DEEA 2DTSA 3WL9A 5KS9F 4XMXA 2QADD 4ALAL 2G4GA 2X4OB 2NDFA 3K2KA 5D2LE 1UM4L 4M6AA 5JOFB 3CJJA 2VZSA 3NJGA 4NN6B 1FL5B 1KNOB 4PJFF 2HUEA 3SBQA 5I15L 1PKQE 1PZ3A 1R24B 2RGSA 4ZTOH 4BZ2L 2FO1A 5EEZA 4NUGL 1AY1H 1XF5B 1UXWB 3UC0L 2QLVB 3FMGH 5E6RB 5C0AB 3NDYE 1Q9LA 1OANA 4I0PD 3IJHB 3MDJA 3MV8B 2ERJC 3UJTL 2JH2A 3QISA 2R2EA 3G08B 5DT1L 1DQLL 1OGTB 1OPGL 4K7PY 3S88H 3UPAA 4JVUA 1Q9WB 1YPZA 2KYIA 4UZSA 3T4YB 3RY5A 3BGMA 2HLAB 5IHLB 3TVMD 2J25A 3Q3GA 1IAIH 1KIUA 4JO2H 3VI4E 3HFML 2VN7A 1PLGH 3DMMD 1DE4A 1JS4A 2LE9A 4NUJA 2FX8H 3SPVB 1FFNA 3W57A 3K2MC 3MRQA 2ZYIA 3IB4A 3IU4L 4G7YL 4UYQA 4XXWC 5F7EL 3WD5H 1N6QH 3K5RA 1UA3A 1T7YA 3QZMA 4X4XB 4CW1B 4Y4FA 4XO3A 2I7OA 4ZFOB 4YC2B 2BP8A 2YD1A 1F4WL 4XC3H 2FWSA 5DHVH 5D5MB 1KCSH 5HJGA 2CGRL 4F7CA 1DDHA 4L8SA 4J7RA 3MUHL 4HG4J 1F4AA 5FUZL 2D7TH 1QRNB 2IOOA 3TZVB 4APXA 2ZWNA 4YO0A 3BWUF 1E9PB 3MRFB 4B3VA 1G4MA 2Q3ZA