4F2ME

Crystal structure of a tgev coronavirus spike fragment in complex with the tgev neutralizing monoclonal antibody 1af10
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
148
structure length
148
Chain Sequence
b'PSFYTHTIVNITIDLGMKRSGYGQPIASTLSNITLPMQDNNTDVYCIRSDQFSVYVHSTCKSSLWDNIFKRNCTDVLDATAVIKTGTCPFSFDKLNNYLTFNKFCLSLSPVGANCKFDVAARTRTNEQVVRSLYVIYEEGDNIVLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords monoclonal antibody 1AF10, heavy chain
molecule tags Viral protein/immune system
source organism Mus musculus
publication title Structural bases of coronavirus attachment to host aminopeptidase N and its inhibition by neutralizing antibodies.
pubmed doi rcsb
total genus 28
structure length 148
sequence length 148
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3130 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f2mE00
4F5CE 3KBHE 4F2ME
chains in the Genus database with same CATH superfamily
2CUHA 2XIBA 4PHXA 4ZQKB 3IEAA 4N2AA 4XP4L 4G3YH 2F8IA 1G7IB 2B39A 2AZAA 2CKBB 1YSOA 4GBXC 1N7ML 3L4CA 4Y89A 5GIRA 3KPLB 4JVWA 3DUUA 2WXLA 1E9QA 3NFSH 2F53D 1YMMA 5DQDL 1AXTL 1S5IH 3LTVA 2EILB 1XB6A 1N59A 1M53A 5JW5A 3EADA 5CAYB 4U7KA 2ZKMX 1NLDH 4KVPA 4OGYH 3FXIC 1MPAL 3LS4L 4UMGA 5I6OA 3E8UH 4YSAA 2G9KA 1UHVA 3HKZA 3TFKD 3C6LB 2UUDK 2A9AA 2H26A 3FZUD 4DP1X 4WI7A 1WEJH 2CRYA 5EA0H 3AW5A 1FV1A 1Q9OA 2IPTL 4ADIA 3VWJC 2FSDA 3ATFA 3BZ4B 2BSSB 4PJAE 4G82A 1TZ8A 2ZWLT 2EE0A 3VFUA 4H8WC 1G7MB 4TYUA 1XR9A 4JZOA 2OMZB 4UINH 5EU5B 2VH5L 4N0CD 3B6SA 4TOYH 3PV6A 5D2LA 5JHLA 1JDDA 1U58A 4GP4B 2IQAB 4PJDF 1FO0L 1UJ3B 2OJZH 4QHLA 4U1MB 1G9MC 1FNEA 2F61A 3FOLB 4C59B 1YPZB 4Q0XH 1T6BX 3UC0L 1N3NB 4WZ9A 4N0UA 4KQ3H 2K0RA 5EULV 1IRAY 1QW9A 3O3BB 3TYGL 4XVSL 2FO8A 4RBPH 4OV5B 4ZAKD 4IEFB 3WIHA 2YPKB 3CZFA 3H53A 4RQQB 1FNSL 2X05A 1LE5A 4GO9A 2O61B 1P4BH 2HX9A 1XEUA 4M43L 1E9QB 1AAJA 2ZNWA 4N4YB 5E6YA 1FBIH 1IC7H 3D6GA 4MDJA 1F4WH 1FQ9C 4OF5A 4RFEA 5HHOA 4PQXA 2HZHA 1OP5K 3CVBA 3MOAH 4EQ2A 1Z9MA 1HK6A 2K3TA 2AJXH 3LZRA 1L3NA 3B7TA 1A7RL 1JWUA 3GSXB 3FFCD 1IIKA 2YEZA 3W56A 3EYVB 4HIEA 3DO3A 4KJWC 4BZ2A 4FHBD 4PWIA 4PR5A 1FH5L 3KLHC 1P5VA 4RMSA 3QQNA 3APFA 1VFOA 2IWFA 5F9OH 4H1LH 1SN0A 2EDKA 4MXQC 1FVCB 1U8CA 3T8VA 3VI3B 4M62H 4MZRA 1ZT1A 1S7SA 5CIPA 5C2BH 4HHAA 3CCHB 1SVCP 2FSEB 5EUKB 3SDDC 3V9FA 2JKNA 5B22A 1WAAE 2ARJA 3PV6B 5D2LB 1UACH 3TV8A 4DPCX 1C8PA 5ICZB 3REWA 2I9TA 4QGYA 2MPAL 5BV7C 4JUTA 4GAJH 3MSPA 5DC4B 1BXXA 4W4NA 1JCVA 1LJMA 4IRSC 5AW6B 4AYBA 3THMH 3FCSB 1CWVA 4IRJA 1IZJA 4JPVL 2YPLB 4IRZH 2WTRA 2CMRH 1VACA 4LGSB 5E6ID 4JG5A 1X4YA 5J06A 1P4IL 3BPOB 4IHOA 4YDZA 3GJFH 4LDCA 1KGJA 2JQZA 2LLLA 2TSAA 4NZFA 2YPVH 4ZPTB 4F8OA 2GY7B 1AKJA 4EOWH 4U1SB 4N2EA 1PZSA 3UIYA 2P5WD 1CDJA 5DJAB 3UZVB 5KYXB 5I73B 4NPKA 4UUJB 3WS6A 3QUYD 4YHZL 2V8MA 5F7DB 4OGZA 5ICXB 1JPSH 2B59B 5SWSB 4AYID 4YSTA 2VT0A 2PCFB 4MJ5B 5DMGD 3UYPA 1R3JB 3WXWH 3PJSA 4K7PH 3VNZA 3NJFA 1OALA 4D3CH 4OLEA 1TQWA 1CGSL 1NC4A 2OZ4A 3OKDB 1I8UA 5GGSB 3LZNA 4UV7H 4H0LC 1X9UA 3BXNB 4QOKE 1DN0A 3VXSB 3AG3B 5G4OA 3OJ2C 1ZS8B 5C0NC 1M7XA 4C56A 4EKXA 4M4RA 1RZGA 4YQXH 3HJEA 3OC8A 4ZW3A 2AK4E 2B3IA 2WO4A 1NMAH 1UM5H 3LZLA 3F58H 3VGEA 3W0WA 3FT2B 2F6AA 5GRXG 3EOAA 2WQ8A 4MJ6A 1R3IL 2GHWB 4LEXL 2HFFB 2ZWSA 2D9QB 4RGOH 2AAAA 2CGRH 4FQXD 1FFOA 1Q90A 5E6IC 2BSTA 3IJSA 1KTJA 1S5HA 1B2WL 2CWRA 4FP8L 3VO0A 3U46B 1A6ZB 5LB1A 4LCUB 2OKMA 3ARFB 5FA3A 5ESQA 2XQYG 4EI6A 2MHAB 4DUVA 1V27A 2VMCA 1MJJB 2V3FA 1TU2B 4AUYA 4PJDB 4Z9KB 3P0VL 4QEGA 2FIKA 1YAIA 1HT6A 4DGYL 3L2LA 4EI0A 2JELH 2CHNA 2DBJA 4KAQH 3IXTA 3VFTA 1SUHA 1ZTXE 1NJ9A 2DQHL 3LMJH 5AUMA 2NSXA 1A6UH 1Q0YH 4G71B 5DJXA 3FAXA 1FNGB 4KJYB 2VXTH 1B0GA 3QFJE 2FLMA 3D09A 2ZSWB 5IHZA 3QNYA 3U0TB 4FMKA 5MEOB 3ROLA 1IBYA 5IW6A 1XH3B 4PMFA 1MREL 3T8XA 3IYLW 5FYJE 2HLEB 4YDNA 3D39B 2IH9A 1ZRUA 4NI3A 2ITCB 3SQRA 5D71H 3QIBC 4LFHD 1T4KB 2UY7B 2VDKL 3LRGA 5D1XE 3KDMB 2FEEI 3R19A 3BAKA 3VM7A 1YY8A 5IHUL 5B1KA 1IAII 1WS7A 5EN2A 2HT4C 3MO1B 4HZLA 1BEYL 4NQXB 2ORBH 1NDGA 3V10A 3T0WA 1R5WB 5AQ0A 3FU6A 3S36H 3PQYB 3NIFF 1BEXA 3T3MF 4J3OC 2HMID 5AYUH 4K8RH 4YHML 2BZCA 1BIIB 2CRMA 4K71B 1DE4B 2NY2D 1VDGA 5BZZA 4L3CB 2AEQH 3SD5A 1S46A 3T0DA 2QVKA 3OV6A 5DK0A 2XZCH 1DHKA 3H8NA 5HHQA 5TPWL 3N50A 4ALAC 5HDLA 4RDQG 2B8OT 1OAZL 2J21A 1N4XH 3HB3C 4MAUH 4MJID 4XBGA 4PS7A 3TBYB 4B95C 5FECB 5I1GL 3ZTNH 1IAOB 1WISA 1B6DA 1X9LA 3SGEH 5F70A 2YMXL 1EJOL 4YPGA 2IPUG 3KLHD 1UXLA 2EO7A 4H1LA 1SXBA 1A6AB 3FTGB 1KPVB 4NZ8A 4JFUA 1N59B 4KI5E 4B96A 1YMHB 2LTQC 5I75C 3DOIA 4LLYA 1YNTA 3AQXA 2CPCA 2O72A 3LIZH 4NWUH 5EU6B 3LEXB 2XT1B 3K2KA 5DT1H 4DWHA 2KL6A 1MIEH 3TV3L 4ZTEA 2WOYA 2QDWA 1B90A 5I76B 3UAJC 1LMKA 1NMCB 4XVUD 4X6CA 5T1JA 2J73A 2NY6B 3IAPA 2EIEA 3O6KL 4JG1L 3CIAA 4UAOB 3MRCA 4CJ0A 1C8QA 2BSSA 2AJZB 3F7RA 3RX5A 4EUPA 4KX8A 1ACZA 1SJMA 1MH5B 2WJ7A 2KPNA 3M6DA 4RX4A 1I9EA 3QS2A 5EUOE 1DDHA 1UZGA 4Z7QE 1RUAL 5GGRY 4JJHA 5I19L 4LLQB 2LW3A 2DYRB 5D6DA 4GSRA 1T22A 3CN2A 1U8HA 1I9RL 1MFDH 1YEFH 3O11B 2NYYC 1BZEA 1EWHA 3MLUH 3O6FA 2F5AH 5DVMA 1NICA 1ZK5A 5GRUL 3ZKQD 4BXVA 5LJYH 2AQ3A 2F8OA 4LCWB 4HSQA 3BN9C 1BOGB 1J10A 4YGVB 5DEFB 3GO1H 1BA9A 4G8GA 4PG9A 5FYKU 3AG4B 5DVOA 5I26A 1WIUA 1XIWD 1ZDQA 1TEYA 2F15A 3KLAB 4FFTA 3Q8FA 1UB6B 3QQ4B 2HAZA 1FH2A 5IV2A 1JCKA 4MNGB 3G6DL 3RLSA 3P4LA 4ZOEA 4OB5L 1IARB 4P23B 3WGVB 4EBQH 4AQOA 3NIDE 3QUZC 4E9TA 4ELMF 5JIMA 2A6JB 1DANT 4K9EC 5F7BA 3WKPA 4BHUA 3RTQA 4BZ2H 5C09B 1HCYA 3PQYD 5DRWA 2CLRA 2VDPB 1S7WA 1A65A 2EH8L 4MA1C 4DP7X 4F33A 5L2KE 3SQOH 4UTAA 1BBDH 1AGEB 4U31A 1CLZH 1RZJL 3D3VA 4DO4A 1OAXL 5HDQH 3EFOA 1CFVH 3IJEA 2OMVB 2WIMA 4M7JH 4N2GA 4NP9A 1QI4A 1W0VA 2X28A 4GKNB 4J39A 5KAQF 3CMOL 1THAA 1V05A 3P11H 3ZSTA 5IVNA 2WINA 4FQXC 5TJWK 5DU7A 4Q9QL 3E1F1 4Z7OB 2PWFA 2JKIS 4JQIH 5IMOB 5K39A 2HA1A 2FWSA 3CFNA 1H3UA 1T0PB 2YBGA 3Q6FB 4MXQD 4CUCA 2VDOH 1FYTA 2R83A 4IK6A 1KN2L 3ETSA 3MV11 5FHAL 1D5MB 3CFCL 3GMQA 5E8EA 3TCLA 1AR1C 5GS1B 1RL1A 1RZ8B 4NOBA 1W2KT 4IHOB 5D70L 4F5CE 4NBYB 2BP8A 5LGHH 2VLLB 4GS7B 2MJWA 1D3CA 1YECH 3T2NL 5LG6A 3WJJA 4ZNEA 3T3MB 1SJXA 3L7FB 3SBWC 5I8OH 5EC1B 4JAMB 1AIFA 3DGGB 4XNUH 5T1KD 3RVWD 1FLRH 1R5IB 3IJ7A 3FO0L 5FM5M 4AV0A 1H9VA 4JCMA 4GQ9L 1CYGA 3N91A 4XHJC 3GHBL 4MYPA 4BUGA 4DTGL 1D5IH 2O5YH 4U4BA 5AZUA 4ZX5A 3ILPB 4RMRA 4M7KL 1UEMA 3UACA 5HY9A 5KS9A 3S88L 4ZMNA 2XX1A 5FDWB 4MQ7A 3GMLB 1GAFH 4U1GB 4F9PA 1GHFL 3QI9B 1M56B 1TLKA 3D69A 3GIZH 4WIQA 7PCYA 3ECBB 3T0VA 2FX8L 4QRPE 2NR6C 4Y4FD 3VGAC 5AZEL 1C5CL 1KPRB 1XGQB 5HYQB 1GCFA 1FI8C 2XI9A 4EN3C 2QQLL 1LO2L 2Z35A 1WCQA 3MRJA 4DO6A 4Q58C 4M7ZC 4DVBB 4DETA 3BH8A 4P2RA 3CFEA 3GK8H 4QXWA 3MNVB 5BS0D 2P7TB 4NSKA 2JI2A 3VUAA 1FLRL 5C09D 1EDQA 5MI0B 4OZ4B 3ULVL 4YHIA 2VUOA 1S5HB 1M6OA 3RGVA 2FJFA 1E6JL 3ARVA 3TPKA 5L8JB 3OHXB 3V0VA 5AG9A 5ESQB 4M61B 4NC1C 5FW8A 4PFEA 2P5EE 2B2XL 2VM9A 5D70H 2R0ZH 4HUNB 3GXMA 4MJ6B 5AOZA 4YDKL 1H5BB 4OZIA 1T66C 4NBZB 1RUML 2V7HB 5F7EL 1V7NL 2F9BT 3FSWA 4Z7WA 2QHLA 5MHSE 1JUFA 4U6VL 5E9AA 1MJUH 4Z7UF 5CUSL 1QLEL 1S8DA 1OTTC 4ODWA 2FUTA 3VACA 2AMUA 5DVNA 3FQ4A 3D07A 2UVFA 1PKQA 4AT6B 2HVKB 4ATTA 3ARPA 2PCPB 1XFPA 2CJTA 5INCA 2OMUA 4HJTA 4KTEL 2R4SH 1ERNA 5BMFH 3EJSA 1IM3B 1IAKB 4KQ4H 4LP8A 2GUOA 3K1KC 3SOBL 4M3KB 4MCZB 2MKLC 3BCDA 1Q9KA 4JKMA 3PNWA 2D73A 4X4XB 2I26N 2XCMC 3MJ9A 4K7PL 3MOBH 2R2EB 1GPOL 3DVNB 3DGCR 1PMYA 2GY5A 2DWTA 4QY8A 3HCVA 4F7PA 4TQ8A 5DRXB 3QHZH 2EH8H 5KSUB 2CDEA 4H26A 3OX8B 4G5ZH 4HJEA 3LQZA 4ONHA 1OAKH 5F7MC 1PG7W 3F85A 3K46A 3T77B 1EJ6A 4A04A 3EJYC 3O8XA 5FYKE 1XAUA 4OZFB 3VFVB 3JTTB 4WNQB 5B3NA 1DQVA 2C3VB 3ATDA 2EYSA 2R27A 4NIYE 4UUJA 5C0RL 1GYWA 4KKCD 2KPWA 3QZWG 3AY4C 4JFHE 4L3EE 4EIGB 4MMZA 1EAPA 1K5NA 3NSDA 1TPXB 3UBXI 1TMQA 2CBTA 2IMMA 2YUZA 2TRHA 2XETA 4RIRB 3LHAA 4I2XB 5ALBH 2ZXCA 4P2OB 1SF3A 2I7SA 4I7ZC 5JIIA 4D0BB 3NH7L 2JI1A 3O3EA 3SZ6A 2EVJA 25C8H 4RMQA 3PWVB 1EEUA 3X14B 4EKJA 1V3KA 1SGKA 1UVQB 3TYFA 3RZCB 2QMJA 4F7EB 4E0RA 2VXQH 4BWWA 1MHHA 1BQHG 4FYSA 1ADQH 2DQ6A 3ARTA 2WBJA 2VLRA 2UZIH 4U6YB 5FEBA 2F5BL 4P57A 3EBGA 1V5JA 3WFEH 2NXZD 1KELH 5MP6H 4OLZH 2BK8A 5ANMB 3U48A 2OMWB 4PP1C 5CLXA 1RU9H 1N6QL 1DBJL 1Z5YD 1DQKA 1RUQL 3P0GB 1J1PL 4G8GE 4HZAA 4E9RA 1F4AA 1DQQA 2V4LA 1U8PB 4KXCA 3L4XA 3W11D 4DQAA 5CCKH 1KTLA 4PS3A 5FA3B 2L7JA 4IMKC 5C0JA 1F4WL 2L04A 2VGLM 5AD0B 2WLYA 3V4UH 2FD6H 5T1MB 1K3IA 2EUVA 2X3CA 1H8LA 4WO4C 4LCWA 5DWUH 1XSJA 3GDBA 1H3WM 1NEZA 2E76C 1FUNA 4JM0A 4FQIH 4NZJA 4WHDA 4C4KT 3S8FB 4X7CC 3T4YB 1UH4A 2XTJB 3ZDYE 4GRLB 3S96A 3BW9B 1Z5LA 2AMGA 5EFIB 4IKNA 5T33H 2WN2A 3EBHA 4KRPB 3RDTA 1DJHA 1WUZA 5FO8B 4YEEA 5FX3A 2CDFB 4F1ZA 1TT6A 2F2HA 1CL7I 4ELDA 3LXUX 4KUZL 4WUUD 1MW2A 1ETZB 5K9KA 3T3PF 3VXMB 3BO8A 1SOKA 2P43B 3SOBH 3H4HA 1FFTB 4UNVA 4N28A 2CK0L 1U3HD 3BAEL 4RMWA 3G04A 4QRPB 1LNUB 2BNQE 3WJMB 2NUPB 2QKIB 3V0GA 1LXMA 1OWWA 2OM5A 5FA4A 3RAJL 3V0AC 2C9UA 1QQDA 4JKPH 4CKVX 4LIQL 3NAAL 2DKMA 4JDZA 1IQWL 4I9WD 3K4ZA 3K1DA 4PRNB 1E4KA 3NJKA 1SDDB 1EEQA 4N22A 1A2YA 4QLWA 3F04A 3S2CA 1T1YA 3MREB 4WO4D 3KHOA 1C9SA 2XBZA 2XZCL 3MGAA 1F6AA 1IT9H 2DD8L 3LEYH 4NZUL 3QARA 1U92A 2APTA 5I18L 3GS4A 1ZKAA 9PCYA 2O6EA 5GS1C 4YAQA 4KZDL 3Q8BA 3ZU8A 5IQMA 2HUHA 4HS3B 4IOSA 4QXVA 1MWAB 2FQEA 1XF3B 4WJG3 2CRZA 3SCMB 2ORBL 1DUYB 4XPBH 5HPMB 2YQ3A 4HUWB 1PTZA 2J88H 1LDPH 1WT5C 3H2WA 3VQ2C 2OX5B 5AAMA 4QTFA 4TLTA 1KGWA 2WO2B 3ML8A 4I5BA 2VZVA 5MEQA 3OPZL 4YDLC 2MQCA 3H2PA 1U8LA 1DBBH 1KJ2B 4PJDE 3HFMH 3DKHA 4JG0L 5E8NA 4MMXC 4ICWA 2WO3B 5GSVA 4HC1A 5JQIB 2YAFA 3KEDA 4Y16B 3AS1A 2CO3A 3FQUB 4ZO8A 3VA2C 4CW1B 3DYPA 1WIPA 1ANUA 3RIFF 1FO0B 3CDCA 3LKOA 3VYOA 2MTAA 1EFXB 1I1AB 3QI9A 3IU3A 5K93A 2G60L 1CXFA 1VCBC 3QDMA 4FABL 5H4YA 1OHQA 5TDNA 1EV2E 1X5MA 3AREC 1CTOA 3QIWD 5FYKD 4I87A 5L2JA 5BO1H 3PWPD 4XC3H 3VFNB 4E9LA 3E3QE 4RA0C 4NM8H 5GZNC 2VLMD 2CDGB 2NPLX 3L4YA 3U4BH 3LPOA 3QUZD 5I8OL 4UMSA 4NHCL 5D7HA 3EJUA 4ZUUB 3LSOA 1SMAA 1XZ0A 1NAMA 1LQSR 4FP8H 2Z8RA 1E6OH 5I1CH 4XBEH 1OGSA 1UZ6F 2P5WB 1QKZH 3EH2A 2BHZA 3RFZC 4Q8BA 4R97B 3LZFL 2ZOWA 3S5YA 4M1DH 2GYSA 2OW7A 1U3HB 5KOVC 4FQPA 3TWYA 2VDOL 4EIZC 5KYNA 1R0AH 3TP4A 3UTTA 3E2HC 4QRRB 3C6LA 4PWGA 5F0LB 4FJZA 4G7VH 4MRCA 1HZLA 1A6TA 4J3OF 2PF6A 2XV2A 1A3LL 1X7TA 2K7QA 3ZL4H 1Y6KR 4G9FE 3K3QA 1GCYA 5AFAA 2FX9H 5FKPB 1NEPA 3EO9H 3KLLA 4JPKL 5DYFA 2AXGB 4NJ9H 4WCYL 4BGLA 3TEZA 1BFVL 3H7BA 2X4SB 2Y6TE 3ARDC 1D6EB 4LNRA 5EOTB 3QXDA 2C3HA 2DQUL 4XOEA 5F72S 3FRUA 2YGNA 5I0YA 1DQJB 4Y1AB 2YPLA 4ZOAA 4DGUA 3JTSA 3FN0H 1R46A 4BFIB 2D0FA 4HUVB 3PWJB 4K94C 3RNQB 3T1FB 1D6VH 4F20A 1JTOA 4JN1L 1A4JA 3RI5K 4O5LH 4XN4A 5LXGL 2GTQA 3A4AA 3BKML 4RNRA 2ESVA 2XG4B 5EB9A 1BW8A 1ZSDA 2AV7B 4N5UA 4PP2A 5F6IC 4CC4C 1VENA 4RWYH 1JYVA 1J8RA 5DK3A 4U1LA 2HRHA 4QY8B 4CC0A 5GJTL 3QDJA 4J3VA 1EXUA 2R1XA 3C6SA 4DNLA 2E7CA 2NX5E 5ISZA 4AQAB 3FQRB 5K9OB 1R3KA 2ZTBA 3VFSB 3BWZA 1VCAA 3OGCB 1NPJA 3U2SB 2CMRL 2X88A 3N44B 3SKMA 4ZDHA 5JDJA 1WWWX 2VO5A 4B9KC 1Z9LA 3LRHA 3BESR 1JNHA 3N40F 1I8IA 2AKRB 4BZYA 1AZNA 2VDNH 3U2JA 5T3ZE 2NXZB 4WTXA 4FFWC 4NZTL 1KBGH 4UT9H 3TZVD 1ZGLM 4LLWA 2FQDA 2XWXA 2XN2A 1B0WA 1XB8A 2FUQA 1M2OA 1OIOA 4OLYL 2YQBA 2W9EH 2D8KA 1A9VA 3QXDB 1LEKB 1WVZA 2BNUB 1I1FA 3W2DH 5T5NG 3S3SA 1J5CA 4QHMB 1MSPA 5AW8B 5B7EA 1F97A 4WEUD 1PS3A 5HGBA 1PFCA 4PRPD 1AS6A 1H6UA 2JQAA 2VXQA 2Y2WA 3UP6A 1NMBH 3CGTA 5D7IA 4BFIA 1M05A 4G42B 5F6HJ 3WEXA 4UINL 1JYWA 5E9DA 1X5ZA 2BSTB 1MNNA 4ZMTA 1X3DA 1YNTF 4NOFA 1UD5A 4X8JA 1H8OA 3UMNA 3QDGA 4V1DE 2E4TA 1E8XA 3LRKA 5GGSY 3BKJL 2UWEA 4BZ1A 4CVUA 1B0RB 3UJJH 3BQUC 5IEHB 1B4RA 4YHYB 3EYOB 2F54A 3FO9A 3G08A 4XWOD 1X7QA 5GZOA 3KLDA 2EDOA 2IBGA 4TNGA 3LKPA 4XMZA 2HFGL 5LNDA 3QJFB 3ZTNL 3L4ZA 5HYSA 1ZLUH 3UZEA 3ZHNA 4AEFA 3DMMD 3C8DA 5E6IA 5HDBE 2NRDA 4GG6E 2JNZA 3RFZB 1IGTA 2YBRA 1NEZB 3BKYL 4LCYA 3X11A 3QXVA 2WD0A 3WN5B 1AG0A 1H8NA 2HJKA 3QWOB 4JJ5A 3MLTB 2QHRL 5D7KD 2QSQA 4LLMA 4FG2A 1TTGA 2OCJA 1U36A 3DIFB 1U3YA 1U6AH 4N9OB 3KPLA 3RTQD 1MZZA 3EYSL 4L3CA 2ZOKA 3MJ9H 3W0WD 2H0PA 1U8IB 3O4OC 3VXRA 4G6JL 2E7LC 4BFEA 4I88A 1ZHLA 4I48B 1KCSH 1NBYB 2FIRT 1PSKL 3CFBB 4RETB 2B1AH 3LKNB 8FABA 4X80H 2D3JA 3KWXA 3EYFB 2F19H 1I7TA 5HJBA 4G6AC 4YHPB 3GSUB 3QDGD 5KN5A 3NCYS 2QQNL 3DRQB 1GTFA 1BZQK 2VJ8A 1WV7T 1QRNA 2KLSA 3IFOA 2V2XA 2AQNA 3D5OF 3PWUA 3DVGB 3GXDA 2DS4A 1FVEA 1MI5E 3QAZB 4N68A 3VMOA 2IDCA 4HJGB 5LLIC 1G7MA 3F65A 3BAJA 3FU0A 1AQDA 4IDLA 4XT1C 3E6HA 2UZYB 2WANA 4AL8L 4CU7A 1DVFC 4URKA 1A64A 5I66B 1J18A 4H2AA 4KKQA 3X2QB 1N6UA 2X2HA 5C0BA 1FG9C 5KSAC 4I9XA 4DK3A 1X5GA 2BZDA 3BDYH 3GMNB 4GRWB 4HZ1A 3VXSE 3RJQB 4OZHB 4UB0L 2YGQA 1FRGL 3AT0A 1BQLH 1QSFB 4KKRA 4F37F 5HVHB 4PH8A 4V1DA 1SMOA 3RI5F 4FFZA 1EUUA 5DR5H 3PF2A 3RURA 1DVSA 3EDJA 4MMZB 3DWTA 3L5XL 4Z7QF 3ZDZF 4PJ7F 4ZSOB 2FVNA 2NNAB 1NQBA 2FYYB 4B7LA 4N2BA 4XVUC 1TETL 4FNLL 3TU6A 2YN3A 4WFGD 4BFBD 1JYNA 3MRMA 4X99A 2JQMA 2AJSL 2F54E 1ZE3C 2EYTA 1TVBB 1UOLA 2XZQL 4XZ4A 3HZVB 1ZVSB 2IAMD 4KKBC 3HC0B 2B7DT 4OCXL 1JZ4A 3QIBD 2VUKA 3LKNA 2W9DL 2KQMA 3AWGA 3VFRB 5L9DH 1TJHH 5MEQB 1KPUA 4ONFH 4KI1A 2FLRT 4GRLC 4ABUA 3TJHC 4N6RB 5AB1A 1Q0XH 3EG9B 5C3LD 1E2WA 1FL5B 1VPOH 4ANKA 1VEPA 1JS4A 4L2LA 5FUCE 1IM9B 3D30A 1RZFH 3L9RA 4EZKA 1A7OH 2J8UA 1P5UA 2MWCA 2C34A 3VGAB 2KKQA 3KHQA 4X6EB 3S37L 2HJFA 4EI5C 4PWJA 1IC1A 2GHZA 1UXSA 2KBGA 4Y7OC 2Z9TA 4HK3N 4Y8AA 3U7WL 4Y88A 5D7LA 4CADB 1YMMD 4AUUA 2C1PA 1OOWA 3ML9A 2BY3A 3JWNC 4S1QL 3WFBH 5E6SB 3UTZA 3RHWK 3BZ4A 1J1XL 1G7PA 4OD3L 3SSGA 4W9GC 3JWNH 4APQA 5ADPH 2GPZA 4ZUUA 4K3EH 4Y9BA 2I5YL 4AE0A 4AMXA 2VMJA 3CBRA 1ZJBA 3DV4A 1PF3A 2MSPA 3P77A 3WFZA 2MCG1 1OSYA 4Q97A 2MNWA 1BJMA 3C75A 3FUJA 5EZLA 1AO7D 4L4TE 3OG4B 3SDAB 3H3BC 5T3ZL 3IGKA 1AR1B 3UTTE 1OOAA 1C1EL 1D9KA 3CXHJ 1WFOA 4Y5XA 1U8NA 3M46A 4HU8A 1DQDH 4ZFOA 2FGWH 5DFVC 2XUWA 3V4PH 1KT2B 3MUJA 4JFQA 1QFUL 2GCYA 2WQVA 5CJXA 2IADA 1NWOA 1YPZF 5JQ6L 1NAMB 4JKNA 2YA0A 3BP6B 1MFCL 2VDQB 4N6RA 2XPYA 1WFJA 1HILB 2NUPA 4UAHA 5E08L 1NCWH 4S2SB 4O02A 4AKPA 4W9IC 2R69A 2TAAA 4XWGL 5EOCH 1JVKA 4RFNB 1RVFL 4H40A 4PRHE 5E8OA 5A7BA 5DJ8B 1W0YT 4ZTPL 3TZVB 4F57H 4RNRB 5CD3A 4HMDA 2IALA 2BP5M 4X98A 3T2OA 3OM3B 5IFHH 1HQRA 4W9LC 2CBQA 3DBXA 5CS7A 4J3WA 2X2YA 3CCHA 4NM4L 5ISZB 5DUBB 1ZLWK 4H5SB 2BDNH 1HAWA 3O2VH 3UPRB 1IBZA 2CLVB 5AW1B 2WOBA 2H3XC 3Q5TA 4FG6C 5IJVB 5IJKA 3P9LB 1ZSDB 2BRQA 2YKKA 3QWQB 4PP2B 1FPTH 4P9HH 3ETBF 2JIXD 2VDMH 4GUPB 3RKDC 1NLBH 3FQYA 1FL3B 4N90D 5F8RC 3MNVA 3ZLQC 1ACYL 4P9HC 5I74C 2P8PB 4KZEH 4ZX6A 2FQGA 1XGRA 5E95B 2EIDA 1F02I 2EE3A 1LP9E 1OEZW 2IBZX 4YZWA 3JUZA 5JNYB 3FTXA 1AD9A 4D8PB 5ECGA 4KI5F 3MAWA 1OGAA 2HLFD 4N1EA 3FH8A 5CWSA 5F3BA 1IQWH 4E36A 4JFFD 4YHLH 3D0LA 4LSUL 4G1MA 2QQNH 1PCSA 2IOIA 4NQCA 2BHFA 2DYPA 1H5BA 2NY3D 3RAJH 1WEJL 4S1DC 3ZE1F 43C9B 2L3BA 1UWFA 1AG6A 3DECA 2GVYA 3AWEA 3PJLA 3D52A 4ENED 5E0FA 4L37A 5EIIA 3WTXA 3FU9A 4IMLB 1TLMA 4BDVA 2WZ0A 3QO0B 5ERWB 5CZXC 1WD8A 3A6BH 5CMAB 3M1OA 5GGUB 3B43A 3SE6A 4GRWE 1Y0LA 4GYBA 3NP4A 1S5IL 2K70A 3QRLA 2DLTA 1EVTC 4OZIB 3BQUB 1E9OA 1N0LB 2EABA 2N59A 4XXDA 1U6AL 4OI9A 4NB7A 4P04A 2Z0BA 3AMKA 3BPLC 5TTRA 2BERA 3GBDA 4R7NB 4ZXBA 3APNA 1QP1A 4ODBD 2PW2B 4WSJA 4HKXA 4X4XA 5T1KB 2VL5B 2EDXA 4JY5L 2FB4H 2P47B 3W2DL 1Q4NX 4G6MH 3UXFA 3DSFH 2CA3A 3QYNA 4ZAKC 1J8HB 2VQ1B 3DJTA 4XAWL 5D7IE 3CLEL 3VXQA 4U3SA 2VDPL 2UWEB 3IDJB 4Z7WF 4AGPA 2QGEA 3BDBA 1OSEA 2R0LL 3TN0C 2BRRH 4DKEH 1A8JH 2LU5A 4F2MA 1IGML 2NZ9C 3B5HA 4P5TA 1PD0A 1OGAB 1ZWIA 2KERA 1QNZL 2OI9C 4X5WB 3TPUB 1CD1B 2BNRD 3U4KA 1A6WH 3D87B 2QV4A 2TRYA 3FFCE 4KTDH 2W5PA 1Z9SB 1SOSA 2EYRB 3HAEB 3KJ6H 5F9JA 4QXTB 4HLEA 3N1QC 4QHNB 2A74C 2BS71 1BVKB 1TKWA 3L1FA 4AJ0A 4NENB 2XC8A 5I76A 5JYLA 2H3NB 2IFFL 2D7QA 4K4KA 3R06B 2LAAA 1TU2A 5GS0D 1XF4A 3BGMA 5K1NA 4XWGH 3ROLB 3SBRA 1DLFH 4IKJA 4K8RC 4NN5B 2ADGB 4CBPA 2J20A 3PWUB 1TVHB 3V55A 1MDAA 1BXAA 2JVUA 2FHCA 5EU3A 1CGXA 3QEUA 1P9MA 2GJRA 3QNFA 4RBPK 3SKMB 2Q7YB 1MVYA 1OGTA 2W0KA 4AVHA 2A9CA 1QABA 4OCSL 5KVDE 3PGCA 1E2ZA 2MCPH 5IROC 1N26A 2ZUVA 3V0WL 1YUKB 3HS9A 1C5DA 1OTSC 4UIKL 5F21B 5FLUA 5J7CC 4XPTL 2ZUXA 3DBSA 4JO2L 3CN1A 1S9VB 2B5IC 1QFPA 5FUOH 1VRSA 4Y5VA 1LK3L 5JHDA 4R2GC 2DI8A 4XTRD 5FFOA 4P0DA 1SYVA 1XH2A 3UG5A 2J5WA 3EHBD 1ZE3H 1QUNA 1JHTA 1I8KA 3OTTA 4D7BA 3REVB 1AGFA 4JR9H 5DQJA 1FL6A 4PJ9B 3AT9A 3ARRA 2OLDA 2ZP0T 3HFFA 3ZR6A 5KW9H 1JZGA 5IOPA 3NPSC 4QRTA 2EDJA 3B5TA 1MFBL 1JJUA 1G7JA 3HB3D 3O6LL 5CSGA 2PR4L 3W9DB 4POYA 5FECA 1DBKL 4XCCL 4G6FD 4YHNB 1S9XB 4FQ1L 4HK3J 4BK5C 5IM7A 2ED9A 3LIZA 2AJUH 1X9RA 4FQ2L 3V4PB 3QORD 1W0WA 3TCTA 4QLRA 4Z23A 3VFOA 2Q3ZA 3VJ6B 1I3RA 3FULA 2IG2H 3N43F 2VC2L 3O3AA 5DHVH 2WYIA 3RA7L 1R75A 5F0MB 1TCRA 1NGYA 3HNSH 4PJEF 5E2UL 3KZ8A 2JTDA 4ODSH 1W0VB 2GSMB 2GAZA 3IDIB 4IS6A 3KBHE 2EUZA 4ZUWA 3VFRA 2OMBA 2R1WB 2JCCE 2PTUA 2Q8AL 2VLJA 5HYIA 4WEBH 5KUMA 4I9WE 4KJPD 4HK0A 2UX6A 4YSCA 3UTZB 4U1KB 1UADC 4RAHA 2VMFA 3QPXH 4U6XA 1OP3H 4YLCA 1R0AL 4JRXB 3VSTA 3JBG7 3QG6B 3CSYA 2JKLA 1DLHB 2NW3B 4NQSA 4ODTL 4OFYD 5B8CB 3MV8D 3MRHA 1QX1A 1OTUD 4HV8A 4ZMOA 3R1GH 5I71B 4PI0A 3E2HB 4JDZB 3UG4A 1IC5H 1IX2A 1EZVY 2BSBA 2Y5EA 3QNXB 3QH3A 4NUJB 5F3FA 5GJSL 1M1XB 3CBJB 1IKNA 5C6TH 3MV7E 2MOQA 4KGLA 2EVHA 1KCBA 1ZD6A 7FABL 2R69L 4LHUG 5BO1L 3O6ML 2OJEA 1E3ZA 1MFAL 4POZD 1TZHA 3O4LB 4OIAA 1N6VA 1JVOA 1G4MA 4O2CB 3MUUA 3ZZLA 1EK3A 1UEYA 2D2OA 1DSYA 2JJSA 3VNYA 1OSPH 3L5WA 1U2CA 4OFQA 1D7BA 5FB8B 1WG3A 3AB0B 2J8UF 3AT8A 4P23A 1K5WA 4JHWH 2W1NA 5HYJA 5HY9B 1SJEB 1T5XA 3RRQA 2O5NA 1QOKA 1RHHB 3M45A 3ZMEA 2X4RB 2JIXB 3FQTB 3D69B 1AO7A 2OYLA 1BWMA 3C2SA 2PPAA 2XPGB 2Q8AH 3UIZA 4YUEL 1DFBL 1M1SA 5FM5O 4G7RB 4OZHA 4WI8A 4P4RB 1PG7H 3MFFB 4PS8A 4EMZA 4FI8A 2MFNA 4K23H 4GO6B 3PAVA 3QT2A 4O02B 4OJYA 5FUZL 1JGUL 4N2CA 3J07A 2RFXA 1DTUA 4BQCA 3BSZH 1H19A 3OKLB 3IMBA 4FNTA 1C08A 4Z18A 4HG4K 3MGOB 3ZRFC 3CPUA 4PG2C 1WO2A 3CZKA 2AK1L 3ARXA 4PJBF 2J1KA 3I6GA 1BYOA 2KH2B 5TQ2H 3P69A 3F83A 1T7XA 3QZLA 5E6UB 5D2NB 4PJCB 3VFWA 2SEBA 1E8ZA 2NY0B 4Z0XB 4QHLB 1MDTA 1ZHNA 5I15L 2BOBA 1B3IA 1P4UA 4NQVB 2PKDA 3GMQB 3AB0C 1HHJB 4PSPA 5IMOA 3GXTA 3G04B 3Q01A 4QRPA 2Y7OA 4W4OA 4XXWA 2XN9B 2P5WA 5C07D 5CNHA 1T2JA 4W68A 4KRNA 1PYWB 1X4ZA 3I3BA 4YC2C 1ND0B 5ID0B 5JNYA 3DUHA 1AKJD 3QZBA 2EE9A 3CD4A 4XNXH 3C09B 2BCMA 2CLVA 2BS8A 4BELD 4YXHL 1FN4B 1XGYH 3HI6H 3GSWB 3V0WH 2K7PA 1RLWA 5HDRA 4TUKH 3V0JA 3MLRL 4WO4B 43C9A 1TJXA 2WXGA 3FUKA 4M1CD 5D2LE 1OAXH 5HDQL 5ADOL 5CP7B 1XSIA 4KXBA 2E75C 3ORJA 3RIAF 4BIKA 2EXTA 4PJAA 1BBDL 3PWNA 3DXAA 3NYKA 2FR4B 4GY4A 3VCLB 5DD6B 3QSKB 1SXAA 3BVXA 3KGRA 1HXKA 2H1XA 5I24A 3O2DH 4PVBA 1ZV2A 4C8XA 2ZONA 4YSSA 1KBVA 1YJDC 3JT0A 4ENEC 2QV2A 3MXWH 3WS3B 1ZT1B 4U0RC 2ESVB 2XG4A 3CU1A 2O5ZH 2ZSVB 3V7AG 1DQLH 8CGTA 3A22A 1XIWA 2AW2A 2BXZA 5MERA 3ESMA 3MROA 4W9EC 1LK2A 3JUYA 3RX9A 4KX9A 5IBLC 5KUKA 1J8KA 4KKLD 1KJ2A 5L0QC 4FN0A 5EPMB 3VD7A 1IGYB 5T1DH 4JY4A 1JPFB 1R33A 2FJGB 4HA1A 4OJEH 1FNGA 2RA1A 1B88A 4KJYA 2HRPH 3Q2LA 2P24A 3UO8B 5MEOA 2YRZA 3SE8H 3L3IA 2AITA 5DEJA 3OHMB 3GXNA 3W81A 3VW3H 1NC2A 2XXCB 3ARED 5TQ2L 5CEZD 2APFA 3V2AR 5C0IB 4ZFZA 1OT4A 3WHXA 3F6JA 5L2KA 3DXAD 5IW3A 3FFDB 4WI9A 5DO2D 4JN1H 3N9GL 3AS2A 1HEZB 4QD2E 5EOCJ 1ZV9A 3PWLB 5IP4A 4K2UL 4ZUVA 2HT4D 1TSHA 2G3ZA 5KYWA 3IJYA 2ZKHL 1LO5A 4WW2A 5E5MB 4OLWL 4JHAL 1MG2C 3TZVC 1RFDL 3QNZA 3T5WA 1JD9A 3GGWA 3RVXD 2D7OA 4J3OG 5CLYA 3IAGC 3RWIA 3V0IA 1EHAA 3U4EB 3V6OE 3HPLB 4G6FB 1RV6X 2UXVA 4KUCF 1QAWA 3MGTB 1U3ZA 4MQSB 3QORB 4KV5F 3VXUA 4KHTH 2APSA 3L45A 1NUGA 1U8QB 1RSYA 2COQA 2WXMA 1OF2A 4Y16C 4HOXA 4PJHA 2WZPD 1T7WA 3KVQA 4H8VA 5IESL 3PE9A 1RURH 4HEMA 5JPMB 3PL6A 3T77A 3LRMA 4Y2DD 2DQDH 3FRUB 2YXMA 2CCVA 1CU4H 1JTPA 2QKIC 4DZBA 2CDEB 4H26B 4RAUA 2GJ6A 3V7MA 5J13B 3TH2T 1JHKL 3VRJA 5LAXB 2YLKA 4XTRC 4F24A 4XPFH 5EO0B 3B1UA 1X7QB 4P23C 1NGWA 4G7YH 1EXGA 1CF8L 2X7LA 3MA9L 4HF5H 2GC7C 5JIKA 2WBJC 1N68A 1RZQA 2BOCA 3IBOA 3U9WA 3BVNB 1IGFH 3WIFA 1JGEA 1KZYA 4KTEH 5DRNB 5J11C 2XVGA 1CFTB 3NSFA 1QWNA 3IFNH 4PJ8B 3IU4H 5KYWB 1F1GA 4HT1H 4B0MM 1IBBA 1OP9A 1UGKA 2QSTA 3ZDZE 3TA3D 1IQDA 4ZMVA 3FYEB 1FHGA 1HIML 1HINH 2NR6D 3EKCA 4Y4FC 5E1AA 3WE1A 1OAQL 4EZLA 3MRDB 3BQVA 5IMLA 4U6YA 3U4EA 2GIYA 1OE2A 3HI1A 1I8IB 2AKRA 4ZZFA 1HHHB 1N0XL 2WIIB 1J5HA 4Y0GA 4M8VA 5ANMA 5DJDA 3QC5X 3BIBX 4F7EA 3RZCA 4YFDB 5E1HB 4IIQA 4YK4C 4GQ9H 5DZVA 1IFGA 3O0RL 2EE6A 3QRGH 2WXHA 2JELL 4NQSB 8FABB 2A77H 4NRZB 2HH0L 4TQEL 4HWBA 1A7BA 3SYCA 4YR6A 4IJ3C 4HIPA 4DGWC 2N7BA 3I9GL 3DTXA 4FQ2H 2HH0H 3DRTB 4FJYA 1ZWIB 4NUJA 4XX1G 5F0PB 3O8XC 4W1TA 5D93C 2AI0L 2FO4B 3C5JA 1ZA6A 5D5ME 2NLJB 3BH9A 1MCIA 2GJ6B 4FZEH 1A25A 5IG7B 2WNXA 3X3GL 2H6UA 4K8RD 4Z8FL 3ZJAA 3RY6C 2X70A 2OL3B 4HIIB 4HJSA 3K6OA 1XBRA 3CFCH 1X4XA 4OV6F 4GAFB 4BH8B 1AO7E 2GJZB 3MBED 4ZK8A 2PYED 4NO2B 2YOCA 4M1CC 2Z31D 1U8JA 1Z5LB 5EFIA 3I2CH 4PCSA 4LIQH 2F7PA 2R1YB 3MLYL 2H9GA 2JB5L 5I74B 3BZEB 2QZ5A 2Y1YA 5FOBA 1TYEB 2J7LA 1W72L 4L8DA 1MCNA 4ICXA 3FCGA 3GHEH 4QHUB 3SIKA 1NGPH 2DJSA 4ZNCD 1MCOL 2BWQA 1FVDB 1ETZA 1QLEB 2QPSA 5D2LF 4YNYA 2R2HA 4I18C 1BLNB 4XCFL 3ZT5A 4MVBD 4GINA 4JM2B 3VWJD 3G6JB 3FB6A 1XO8A 2CO2A 4LHUA 4CSPA 1NDMB 2AGJL 3BVDB 5JPNC 1H6TA 2ZAIA 1PLCA 4B7IA 2I25N 4POUB 4TV3A 3DIFA 3X12A 1DYZA 2O61A 5BVPL 3QIWA 2VR8A 3MBWA 3UJTH 4JFEA 3IPBA 2OTUB 3CFKA 2CO1A 4NZRL 4GSUA 3VFMB 1HCFX 1A02N 2Y06L 4HSCX 2VKWA 5I28A 4HH9A 1OT1A 3DX6B 4P5SA 3VXTA 2C9AA 5BZDA 4Q9QH 1G6VK 3V79C 4YAQB 4J23A 3GUFA 5CCKL 3DV6B 3MNDA 4K3JH 1DJGA 1RZJC 1IFHL 3SE4A 5KBLA 3QIUC 1UG9A 1A7NH 4Z78B 4E9XA 4LO9A 5BQDA 5HI4D 2FSEA 3VE0B 3TEXA 2QBWA 3DX8A 1JGVH 3VGGA 5C0BB 4M5YL 1MRCH 4PGJA 3F5WB 3RIKA 3GSOA 2YD9A 4X6CE 1NBCA 4WHTB 2A2QT 1FIGH 5F3HA 3TIDA 1ZLSH 4BZ2L 4NKIH 3EJQA 2PCXA 1TUPA 1BQHA 2CJUH 1C12A 2OQJB 1IKFH 1MCEA 1XF5A 3STBA 1K8DA 2UZXB 3G6DH 1BVZA 2FWUA 2ADJB 4FULA 3QK0A 1MHEB 3U0PA 1YJDH 4HLZH 4S0TD 3EGXA 2FT7A 4OGAD 1U4FA 5D1QD 3F00A 1CN4A 3RGBA 3V95A 1UD6A 3QIBB 4ABVA 1NOLA 1IL1B 1FSKC 2PPDA 1QFOA 1JPTL 1TIUA 1EJ8A 5AB9A 4PS4H 3VCLA 5HHNB 3W0WE 3KPRB 5CCJA 5I1GH 3EYSH 4H0IA 3T6QC 2XYBA 4FQLH 2VLLA 2B59A 4WDIA 4FRWA 3STZA 2CA4A 4B3VA 3UBFA 4PW4A 3M17B 3O2DL 2L4OA 3PJSB 5T3XE 1HYRC 3JT2A 3BP7B 4FKKA 1F13A 1TQCC 1WWCA 1RXLA 3QHZL 5CXPA 2Q7AA 4PJ8C 5IHBA 3QDME 1ASQA 4AZ8A 1WT5A 3D9AH 2KYIA 4W70A 5HVGB 4LDOB 3DLQR 3VD3A 4P59H 1GIGH 1MJ7L 2ID5A 4AJVA 2OSLA 5KSBF 1ASOA 4FTVB 3HG1D 1DEEA 4LL1A 3DPBB 2NW2B 4JMXA 4MD5A 2V0AA 1O9ZA 1UB5B 1KN4L 3UO1L 1EVUA 2W0LA 3G5ZB 5EA0L 3R8QA 4Y2DB 3H3KA 4PIRF 1T1WB 3MRKB 1FL3A 1U41A 1WF5A 3SDAD 4RZCA 2IQ9L 2MTPA 2VLKE 2ZYSA 3WV0A 4OR1A 5D7JA 1KCWA 2WQSA 1KEML 2YMXH 1M7UA 4AVKA 2PYEE 4UIMA 2R56H 4WEMB 1HHIB 3BVVA 3P9MA 1A3QA 1U93B 2A4CA 4ZMXA 1OAZH 5D1XA 3TF4A 2FL5A 3FT0A 4NKOB 2OTPA 2I9LB 4XRCB 4UZSA 1I3UA 4DVBA 5K9QG 3ECBA 2BP0B 1ZIAA 2E8YA 2VSDA 4QOKD 5GGUA 4HWZA 4U2ZA 5CGMA 3A67L 3KPRA 4WI0B 5BRQA 1M2VA 3WN5A 1P84K 1KEGH 2X9YA 3MA7B 3WNJA 3CFDB 3OMIB 4Q9CA 2JI3A 7FABH 5JW4Q 1VAHA 2FX7L 4LCCC 4XMXA 3VI3A 1NZRA 4NQDA 4TSAH 3HAEG 3QNYB 1NIEA 1M57B 2A6IB 2Q2LA 4JFDB 4NNXB 2NNXA 5TH2A 3JQOB 3TO2A 1I1RA 5GJSH 5F7YC 2VDNL 1I7UA 2P5WE 3GS7A 5E8OB 3D39A 2BS9A 2XQYA 3LNFA 1LO2H 4B9ZA 2WXKA 4X2UA 5CLZA 4K73A 3U25A 2OI9B 1CICD 3CK0H 2G9HA 4ODTH 4ABWA 1MW1A 2VDKH 3QJTB 4QHKI 4MS8D 1TF4A 2NY4C 5T5FA 2PW2A 1GRWA 4Z77A 3VDCA 2C4FT 3NTCH 3RWHB 2G75A 3P3UA 2CO6A 1FHNA 2LR4A 4L8BA 3IE4A 4NBXB 3LB6D 3ARZA 4QRSB 1QRNB 1NFKA 2ZKYA 4JZJA 1OW0A 1Q9LA 2NX5B 1GMEA 4XBMA 3NZUA 3X1NA 1P1VA 4BZ1L 4TULH 4B97A 3VI4B 3NIDB 4I3GA 4BQ8A 3LQAH 1IO4C 2HVKA 1KYAA 2XWEA 4JFOA 3HMXL 4X9BA 4A37A 2WYZA 3L3KB 3TPUA 4DFIA 4LPVA 4NFBA 3MRIB 1CFTA 2X53A 4QOKA 1TJIL 1ITCA 1LHZA 4GW5B 2ENQA 1OM3H 3RFRA 1KG0B 4MJ2A 2PWDA 3SYAA 2E27L 2UXGA 4HIXL 2FX9L 2GUYA 2WLLB 4F8NA 4KVNH 3RWJB 1A5FL 3O8XB 5IB1A 3I6LE 3ETBJ 3AM8A 5FCUH 3TBWA 1HZKA 4XNBA 3QJOA 3OF6D 3WFDL 1CCZA 3DJRA 4ES9A 5AB0A 5DQ9B 4ANXA 4Y1AE 3H9SE 5E6RB 3C08H 3B37A 2CO7B 4GT0A 2YQ2A 5ADPL 2HMIC 1F3JA 3NZHL 1QR4A 3S35X 3CFJB 2DLGA 4HIXH 4XPTH 1OF0A 5GGQL 1JHLH 3CHOA 3DI3B 4PW9A 3RA7H 2SODB 3D0VA 3KPSD 4G7SB 3H54A 1HL9A 1YN7A 2HRLA 1BZDA 1YRKA 6PAZA 5IOPB 5EEXA 4O02H 3UAJD 2WSPA 4N2MA 2X9WA 3BDYL 3LEVL 5LUMA 1KXVC 2J43A 1UJTA 1I8KB 1W6LA 1M9SA 5HHME 4JZNB 2OR9H 4CNIA 2LLGA 2Z93B 1YYLL 1QVOB 5C86A 1JI2A 4ONFL 5GZNA 3QXAB 3NESA 5EBLA 1U92B 5LQBH 5FF6A 4AENB 1IGCL 4XMVA 2V7NB 4YL4A 3SJVA 2RB8A 3D05A 3KNBA 3O4LD 4AY0A 1EEYA 3H4FA 4UQ2B 5C7XH 4ZD3L 4QCIB 4HJ0D 4MA7L 4GQZA 1N9PA 3UBXA 2FT6A 3HBZA 4D2NA 1YAZA 3C6LC 4R7VA 5JHDE 1SF5A 2W81C 2WJ5A 1JGLL 3L5XH 3LJ3A 4QHNA 4UBDC 4AEEA 1KV3A 5JDSB 1A6VH 1FZMA 5DMGC 3FZUC 2VDPH 1FZKA 3D48R 3W9EB 2VXVH 2DI7A 1O5PA 1RK1A 4UU9B 1JF5A 4FCHA 4GW4B 4XVSH 2ATKB 5DTFA 2WVSA 4XZUA 4HKBA 3DETD 4CDGC 1WRFA 3T2PA 2OTUA 1XF2B 2EDYA 3BAYA 2ZCLL 4QO1A 4ZTOH 5AVSB 1IBHA 3VRLE 1TYJA 2BVOB 3JYBA 3PWPE 1IJ9A 3HRZB 1GZHA 4IQHA 4TF4A 3T0EB 4URTB 5DA0B 3T08A 3QIUD 3N0PB 2XN0A 2Y1VA 5HHPB 3DUSB 3SO3B 4JEGB 1NPNA 1HHGA 2J6WA 4WK2B 2IPTH 1UWGL 3CXFA 4YHKL 1AFVL 1MUJA 1BDYA 1M6UA 3JV5A 2WYHA 2YPKA 3IJHA 3ARFC 1MCLA 1WFMA 4HD9A 3WFCH 3V8CA 3D18A 1CE1H 1U8MA 1PU0A 3SYOA 1U4EA 4PJ9D 5HI3C 3LKQB 1CR9H 2V9TA 2I24N 1NLDL 4OGYL 3C5SA 2LHAA 4R6UA 1OANA 1RZ7H 5D7LB 1VGKA 4EUPB 5EIQA 1MCKA 1CXLA 5FB8A 3UYOD 4GKSA 1S7VA 1U3HC 4QXUL 4FTVD 5DHVB 4LPWA 1FYHB 1AIFB 1HOCB 4RMUA 4UTAH 5K59E 1ZLUK 4WV1A 4WFHE 2FK9A 4X0NA 3SKOB 4Q0XL 3NJXA 4O9HL 2FEDC 2EEDA 5D7EA 5EZLB 3LX9A 4M9OA 1CTNA 2P8PA 4O51A 2RTTA 2V2WB 3HVNA 4NERA 5ICYB 3FTYA 3R18A 1FPTL 2DYSB 4I3RH 4O2FA 4X9YA 5F2FA 2X4PB 1Y7VA 1GA2A 4BFJA 1AD9B 3S34L 1TSRA 3HNVH 2DRUA 3DGDA 3D0LB 4MAYC 4LLQA 3WFCL 3UJJL 3MRRA 5EDXA 2Y22A 3AZUA 2WXIA 3MC0A 1TNNA 3BP6A 2EDQA 3U2IA 3T65B 4E41E 4IGBA 3RY4A 3MUZ1 5TE6H 4G8GD 5TE7H 5IR1A 3ECVA 4KKPA 12E8L 1GGYA 1FNHA 4PJXA 3CZLA 3H42H 5E2WL 2J12B 2NXYD 1S7SB 5CIPB 3B8SA 3K6SA 4KO6A 4KPHH 5E2TH 2PO6B 2AABL 1VZGA 1ZLSL 2R23A 2ZCLH 1BG1A 3H0TA 3APMA 3QUGA 4A39A 2X09A 3VFMA 2ZD0A 3L1OL 3MJWA 5D72H 3U2SA 4WFHD 4RLDA 3DBXB 2R69H 4M93B 5BOJA 4I8DA 1IUZA 2HWZH 1F41A 2R29A 5ALCL 5DZPA 4OLUL 1NDTA 4ANUA 3MN8A 5FK9B 1HH9B 3ZTJH 2JCCB 4Y7MA 1ZPUA 1B2WH 2AERT 3GJFK 1BFVH 3IDJA 1X5YA 3ARBC 3U9UA 2VN3A 4OJAA 3U79A 1XD1A 3R1GL 4JFHD 2CO4A 2XKNB 4APXA 3DXAB 5E03A 3BUDA 1A3LH 2NTFA 3GHPA 3MTRA 2YKLH 2ZX6A 4A7TA 3OKDA 5GGSA 3KWUA 3NCJL 4PJ5B 2WXNA 4F7TB 4K5PA 4AV5A 2Z7UA 4KKAC 4YE4L 4LGRB 3F12A 4ALAH 3WFDH 3G3LA 3FU5A 5IMKA 3N6YA 4Q52A 4NZRH 2M8XA 1NCCH 4N24A 3DX9A 4PGDB 3T65A 5ICXA 3W1ZA 2Y24A 1E3FA 3BZFA 3IGUA 1M42A 4NCDA 3WNOA 3LS5H 3FU7A 2Y69B 4PU2A 4YHOH 5AKSA 1SEBB 4ZI8A 3OQ3B 2ZCHL 4E68A 4G5ZL 5CWSB 3RGHA 1ORQB 4O5LL 3MYJA 3NPZB 4HUKB 3OC5A 4NHCH 3T9WA 4EI5D 5FGBA 2IFGA 4KKLC 3A4DA 2IDTA 4L8SA 2ICWI 4P46B 2DYPB 2XIIA 5FYJU 1BFTA 3K74B 5KSBB 3KPPA 2X4SA 4LNRB 4MASA 5DJ2B 2VRKA 5IIEB 1A7OL 3GJEB 2YAPA 3KL0A 5KJRH 4ZAKB 4CN1A 3ATBA 4JANB 1ITBB 1E5ZA 4YSRA 3MJGX 5A2BA 4C54A 1UASA 1VLXA 4RMBA 5T3XH 3QA3B 1UM4H 5I75B 4KO7A 5C0FB 4BFOA 4LAJH 1U8CB 3K2UH 4M00A 1V7NH 2Z1KA 3BEWB 3PWLA 4KHXL 4APXB 2AV1B 5EUOB 5IJKC 3ASWA 5IUCA 2V5RA 2EJ1A 2ZUSA 1PY4A 3H9SA 1W16A 1C7SA 2MHAA 4ODXA 4F7TA 3LZPA 2XWZA 4QRUA 2B2XH 2WVUA 3BT2H 4GIAA 5A1AA 4I48A 1AOHA 1CGWA 2W95A 4B9GA 5EN3A 4R7DA 1L0XA 5CR8A 3DX9B 1VADA 4PGDA 3W9DA 4M8QB 1F6LL 3DNKA 1CXKA 4GQQA 1BQLL 3HPLA 3DO7B 2NZIA 2F7QA 3BD4A 2NZ9D 5CEYA 5I1EH 2YGOA 4G8IA 4TQEH 1P4LA 3NJMA 2H2PD 5INDB 2WSDA 4OZGA 2D3LA 4J5VA 4ESKA 4OLVL 2KMWA 3L5HA 2IOMA 5I16B 3U4AA 4OZIE 1UOKA 3OKKB 4PCKA 4ILDA 5D5MA 3UBXG 1AZZC 1MFVA 1RCYA 3FUMA 4KPHL 4CMMA 1P9MC 3RVUD 4JCWA 4GIPD 2FX8H 4NI6A 3WJLC 5LVEA 3L95B 3H42L 1E50A 1EMTL 5IROA 1IC4L 3ZYJA 1HOEA 4PJIF 1QNIA 2GBVA 3FBQA 4JHUA 3GMNA 1I53A 2AHIA 3BWAB 2IV9A 2P9RA 4X4YA 3TONA 1QBAA 1M2VB 2V7HA 3I3EA 2XZQH 1KBKA 1TTUA 1PVHA 3AU1A 4N87A 3CX2A 4LSVL 2B15A 1CGTA 1U91B 3CNKA 3B2MA 5CILH 3CVCA 4X50A 4DW2H 5AW7B 2A4ZA 1E4KC 2APWA 3OVUB 3IRCA 1F2XK 3HZ3A 3KPQA 5ELIA 1HHHA 4Q4EA 4X7EC 5I5IA 4PJBA 3G7TA 4PGEA 4Z5RB 2G30A 1UCBL 2V17L 3CZNA 3FYIB 3C8KB 1Q1PA 3PL6C 4MBRA 3DSFL 3U7AA 2Q8BL 5F9DC 4OCWL 3T4AB 3WTVA 2FB4L 3U9PL 5DDHA 1XWVA 4JUSA 5FXCH 4LBEA 3IVKA 1S7RB 2UY6A 3IPFA 4BK5A 3JTTA 2V7NA 3QUYA 3EOAB 3TS8A 3ARGD 1EAQA 4DUWA 2WBXA 2YBRB 3NIGE 4LCYB 5BXFB 5DRXA 3OKMA 2R8SL 1S78D 5I2IA 4OU3A 3QPKA 4OZHF 5BRZB 1BZ9B 4KBPA 4Y5VB 5DK2B 4TRPH 1NBYA 2QJDA 4A6YL 3NCYP 1Q94A 4FTDA 1QHPA 3L3DA 2X2JA 2DIAA 1UQSB 4UQBA 3G6AB 1I85A 1YA5A 3L7EB 2BW5A 3EUDA 2GJZA 3I84A 1BX2A 1PSKH 3VFOB 2AEWA 3UCQA 1EDHA 5GRVK 2OSXA 1OCOB 2BWDA 3Q3GA 4G80A 5DWPA 5EU4B 2CUMA 1QWHA 2ADFL 4PG9B 3QRBA 2XA3A 4YHNA 4WWKD 5DQDH 1OSZB 3NFSL 2WLKA 3RWJA 2K1MA 1VKXA 4LPUA 1FFNA 3S98A 2ZG2A 4G6AD 2F74A 3KBFA 4XP4H 3GTTA 4XP6L 3TN0B 1JXJA 2DWEB 3QZPA 4PY8J 5K1JA 1J0JA 4AC4A 2YK1L 4N0UE 1ASPA 5DEFA 3OKOA 4PJCA 5KS9E 2WLHA 1JZ5A 3P9WB 4I1PA 1KJVA 4JPWL 2AXHA 4XH2A 3NABH 4JPQA 3UC2A 2NY6D 2EDRA 1GZPB 1NFDA 1NL0H 3KGUA 4RISH 5ALBL 2F1BA 1ZTXH 1SJHB 2CIIA 4HWEL 3AXLB 5C71A 1DLHA 4NM4H 4Y9CA 4PJGB 5C0RH 3PCYA 1T20B 1CGUA 2AXJA 4HV8B 3SYPA 2EEXA 2OJEB 4WUKH 2E7DA 1T0MB 3MBXH 4NRYB 5IB3A 1DL7H 4GAGH 4XVOA 1QASA 3VGDA 2Y4SA 2PTVA 2X4NB 5DHEA 2CIKB 1QFWL 2VITB 3ZDXF 1JZHA 1KOAA 4FLHA 5CD3B 3HVDA 4OIIL 3F6IA 1AGEA 3HG3A 3PPEA 1ODAA 2GK0B 2XVBA 5CCGE 2VR4A 4GT7A 1MRDH 3FAWA 2IAMC 4XB7A 5E2VH 4Y9EA 1T03H 1NCWL 1T5XB 3WENA 4G8FB 5DD6A 2PO6C 4UQ3B 5DUPL 2K6WA 5F96H 4O02L 4KKNA 4LMQI 2ALWA 4HIQA 2JK5A 1QYGH 2X2UA 1SN5A 1ILUA 4B5ZA 2ZXDA 3KPTA 2J8UB 4PRIA 4ZRGA 5EC2B 1INEL 1NANI 2NXYC 1O6SB 4KK5D 4HGWB 2VDOB 5EC1A 4ONGH 1GSKA 1Q72L 1BD2B 2ITFA 1WCBB 4X0KA 1WAPA 4OF3A 4M1GL 4W9JC 1QWUA 3ULAB 5E5UB 2QKSA 4FMFA 1PW3A 5I6KA 3FQNA 1XCWA 1X6NA 3I74A 3IGLA 4O58H 2VNCA 4FHKA 2V9RA 1K4CA 4LPCA 1W9XA 4WW1B 2EEAA 3V7AE 3TIDB 2JJWA 4MGXA 4KX7A 2Y1AA 3AMLA 3MFFA 2APXA 2K3HA 3II2A 5D93B 3KPMB 1NBZB 4OV5A 1QQDB 1BXVA 4YDKH 3VXSD 2H6OA 1UXMA 5C0EB 4HAGA 3X3GH 3FU3A 5DGRA 1MLCA 3GXUB 2AXFA 2DQTL 5I6MA 2VSMB 3EFDL 4ODUA 3SKJH 3V0HA 3R4RA 1XF3A 3GD1C 4U6HB 3SCMA 4YK4B 3WUWB 1MCBA 1RJCA 2R39A 2XN9A 5L2KB 2BSRA 2WQUA 4U3CA 5EIIB 4AYGA 2JH2A 2NNCA 5FUCC 4Z0XA 3S36L 1P7BA 4E9YA 4ZOCA 3EBIA 3VD4A 1KJ2L 2OYPA 3SDYL 3WNMA 4TSCH 2CJSA 4EVNA 3MJ8A 4J8QA 1MCWM 4J12A 4ELKA 2GEQA 2FH6A 4U0RB 2IALB 4X98B 1FVCA 2QADC 3SPIA 3V0VB 1CI5A 1JBJA 4U1HA 4EF3A 4TPRH 1CBVL 1FO0A 2XACC 4FJ6A 2EIMB 2EKSB 1JNHB 2WGNB 5JOEA 5J1AB 2FHBA 5IVZB 1GAFL 4J3XA 2F1EA 1FFPB 3WKMH 1S7WB 4JHWL 5CSBA 3OKEA 3NJNA 3JWDL 1WAAF 4HT1L 4TLSA 4LVHB 5HI5D 3AFLA 4JPIA 5EEUA 2BINA 5ID1A 5GGTL 2XY2A 2RIKA 3O4LE 3DJSA 2YUWA 2P48B 1U95A 3LMJL 4AIZA 3IJ8A 2M83A 2YA1A 4DSYA 3WSQH 5B1AB 3P9LA 5DC0A 4KXZH 1PLGH 4Z3FA 1I3VA 2Q76A 1QG3A 4K94H 3UROR 3V5KA 3QUYC 4FDWA 3IU3B 3ELQA 3F7PC 1MCDA 3BUQA 4ANWA 1ZGLP 1GTNA 3BPOC 2JCCF 2GJPA 4PV1C 1T0NB 2VW7A 4Y4FB 1Q9KB 4M02A 4K07A 2GSIB 3ULUD 5CEYB 3NFNB 5HVWA 3D25A 2OZ4L 3BEWA 2UZXA 3H6AA 4FG6D 4ES8A 3W39A 3BCFA 3VFPA 3CN4A 1NMCC 3U30C 3QHTC 4J28A 3BXNA 1IU1A 4J4PD 3WKML 5KANI 1BMGA 4HHGA 1TVHA 2PMZA 2RBLA 2F54B 3FO9B 5IMMB 2VCOA 3F58L 3MLWL 2AK4D 1RIUH 2IANA 1YLBB 2BMKB 5D8JH 4U1HB 1DQJA 3IFNL 4Y1AA 1IBDA 4HCIA 2HYMA 4L37B 4GP5B 1GJWA 3GSXA 4N2NA 2BY0A 4BDVB 2OA9A 1YG9A 4TN9A 2RGSA 1D5IL 1G7HA 2J88L 1FG2B 1SFHA 2O5YL 4RZKA 1T89A 4LSDA 1R5IA 2WXRA 3E7JA 4LPXA 1CGSH 2EDTA 1F58H 2OMYB 3GI8H 3ZDXB 3WIHH 2IPUK 5A2CA 4D94A 4A2DA 2ZXQA 2HG5B 5E1GA 3KW8A 3QO0A 1J5OH 2DM4A 3C87A 2OK0H 5B8CC 4Y2NA 2A0LD 1OWRM 4TSBL 1RZIB 3ABGA 4UTBH 4WW2B 3PDOA 1TQSA 3RPBA 1Z9PA 2R7EB 1XDTT 4OAWA 3VU2A 4Z1PA 5EU6D 4A7VA 3F12B 5DUML 3CFMA 3OG6B 2WWOA 4TQPA 3LHPL 1XV8A 3V6OC 2Z3FA 4MXWH 4OKVA 1D5XB 2JB6B 4YSDA 1YNKL 1G9ML 3EJPA 2WBJB 4FQQA 4FKEA 3B2VL 3KDPB 4PM1A 5B38A 4G1EA 2WQWA 3Q6GH 5EUOF 3UDWA 4BUHA 5AVWB 3AS0A 1U91A 2ODHA 3GRWH 3QQDB 5T1DL 5TFSL 4U7MA 2E47A 1VFBA 4NO0D 1JNNL 4JQIL 3SDAC 1G9NC 2WCGA 4R90H 1BZ9A 5KVFL 5EZOL 3LXCA 3BYTA 4P2RE 4MDRA 4E42A 5FOBB 1WAEA 2NY1C 5C8JA 5K9OA 3TN0D 3L3DB 3BPLB 4R4BB 3WG7B 5E1IA 1SXZA 4G6KH 3EBAA 4YSPA 3RUGF 3FT3A 1MQKL 4L4VE 1QEWA 4XRCA 1KWKA 2UUDH 3FRPG 5LG1A 3T71A 3WFEL 3SYQA 5LBSL 3K0YA 1PGRB 4NO0B 4WI0A 4LEBA 2XVKA 1TTFA 3ARDA 4HU2A 1RULL 2KLTA 1QSEB 1S2EA 3PQYA 4HX1A 1IGJA 1XL4A 1O7SA 1TMCB 2WZ5A 2WUCL 5SWZA 5DK2A 3D33A 2OL3L 5TK2A 3ECQA 5AVVB 4JX0A 1Y1UA 3TVMD 1CIUA 3RBSA 4TNVK 4Z7WE 1OGTB 3MLSL 2AV1A 5EUOA 2A1WH 5CM1A 2X1WL 4Q6KA 4YXKH 1C5DB 5KZCD 5HGBB 4X7TA 3ARSA 4K3JL 4XN8A 4J27A 5A2JH 2WTOA 1HDMA 1HWWA 3LDBC 5IVXE 3MOAL 1F42A 2EACA 3SO5A 3DX6A 1G94A 1KJVB 4XH2B 2P80D 5DSCB 1TR7A 1A9EB 4NN7B 4XNZC 1P4BL 2V6HA 3IFPB 3KNBB 3QZWA 3K72B 2BVUA 2DM2A 2QKIA 2AQTA 2J2ZB 1J8SA 1YMHA 3HE7D 4JJ5B 4R2GD 4XPAL 4Z78A 2NZ1A 3ARBB 1EHLL 4MMZC 3P4NB 1RUAH 2WZAA 3LEXA 3LV3A 3NPSB 4AENA 4AH2A 4BXSV 1JRHL 2D0HA 4K5MA 3AQZA 2YXFA 5F9WB 3VVWA 4DFHA 3NZ8A 5E7BA 1NFIA 3QRFM 3DX2A 3ULUE 1KUMA 1ZK9A 3GXFA 1SDDA 3ZRSA 4OVUA 3L16A 2C3VA 3JVGC 5DEGB 5JYMA 1OP5H 3VI3E 4YHMH 4LSRH 2QMKA 3JXAA 2Q1EA 4R0LA 1G7JB 4Y4KB 1I7ZA 5JPNA 1KXVA 3EYFA 5EEVA 4NPYA 1G5AA 1LP9F 4KJWD 5EV7A 5I17A 2XDHA 3HI6L 3WNLA 3ES6A 2FHFA 3B4NA 3P4OA 4JDTH 4NQEA 3OKLA 4YNYB 3C60C 3QUXA 3ASNB 4JFFB 2G0LA 2H9GB 4YSQA 1U8IA 1YYCA 4N8CH 2J6EH 4FA8A 1INDH 1MXDA 1QLEH 4WLCA 4HGWA 4GJTB 4Q14A 1CGYA 2Y9RT 3FPXA 1W72A 1RPUA 4CILA 1KT2A 2PYEA 4JFQB 4NQTA 3N44F 4PD4K 4WFEE 4Y4KD 3ZBMA 3U6XS 4M03A 3VWKD 3VX1A 3IVKB 4WK4B 2CGYA 4BM7A 4HAFA 1AY1H 4K3DL 1KIQA 5GIRB 2XPZA 3F7VB 3LZFH 4F5CA 3ABZA 2XA8L 3DUSA 5A16B 4FNQA 5F44A 3QEQB 5CZRA 1RUKH 4TSBH 2XIDA 4NNPL 1EJFA 4DN4L 1UH3A 3M7FB 4F80A 1Q94B 4G8GB 2A6JA 2FAUA 1SY6A 3I9GH 2A7BA 3MRNA 4WTZA 1JV5A 2V17H 2X89A 2GBTA 3ZL2A 3NMEA 2CBMA 3US0A 1PD1A 2QL1A 2VLKB 4U6HA 1KCLA 4F33B 5DEZA 4UNIA 1RMFH 3BE1H 2BDNL 1E4HA 1INQA 1AE6L 2WXJA 4HQQH 5I6LA 4XBGB 2V5SA 5KZCB 3EFOB 1AGCB 4FERA 5FF6B 1HZHH 2DMHA 2WB1A 2DEXX 4KI5C 5E00B 6FABL 3ILQC 1WS8A 3QCUH 3LN9A 2ZP8A 4XP9H 1DBBL 5CFHA 4J1UA 1N67A 4Q6IC 1HZHL 3L3GB 4F2FA 2VIRB 2ZYRA 3T8MA 1I31A 4KY1L 4TSCL 4MD4A 4R4FL 4WSKA 2DQHH 2FNBA 1PDKA 2FBRA 3GHBH 1XGUB 2YAOA 3DOSB 1UURA 2GTWB 1YEKH 1KIQB 3G6JE 3HR6A 3P0VH 4DGYH 5I1EL 2JF1A 3DETC 4LDEB 4UTBA 5F6HI 3VRIA 1C12B 3L4TA 4UI2A 4IDJH 1DVFA 5C6TL 1N12A 4ZXBC 2XWCA 1C16B 4PVLA 2F53B 3BMVA 4F58H 3GTNA 3T2NH 2ERJC 1J1OL 3MRNB 1OPGH 3TO2B 2X10A 4E41D 1ADWA 3STLA 3MLVL 3B2PA 1T22B 3QDJE 2VLRE 2R0KH 2YD8A 4H13C 4QRAA 4UF7C 5AZEH 2JKRM 3KYOB 4XPHL 3N41F 5CLTA 4JO1L 2JKJA 5E8DH 4F3FA 4L0YA 1UKTA 4IGBD 3SOTA 4U1LB 3ZYZA 5DMYA 1D6EA 1Z3GH 4GLRH 2ETWA 4XNYL 2KZKA 3FMGH 1L7TL 1COBA 2GFBB 4OFKA 5F1IB 1BV8A 2DH2A 2E3VA 1SQ2N 4XOAA 5GS3A 4JO4L 3ULUH 4EQ3A 1WAAA 1KFGA 4LB8A 2MCPL 3GC3A 4M7JL 3GSQB 3RJOA 1R17A 5I1JL 2XZAH 2V5MA 3BP7A 3DPBA 4J3TA 4MD5B 3P73B 3CXDH 3OGOE 3CHXA 1JZ2A 2BJML 2ESVE 3R7QA 2AC0A 1PCXA 5JA9A 4YFEA 4U6TA 3LPGA 3ZTEA 1RPQA 4FTVA 3Q8EA 4OZ4A 3VXMD 1ECYA 1HKFA 2BH0A 1YEGH 1PFOA 1IC0A 3CVHH 4U1IA 5GSVB 3DX1A 3FU7B 4DP5X 5DZOA 1I8AA 4FFYH 4NRXB 4ZFZB 4M61A 4YH6A 1QLFB 4XGZA 1KLFB 4IRZA 5DUBA 1BF2A 2N7SA 1CD1A 4WUKL 1T04A 3NSJA 1BQRA 4FFVD 4PLKD 1X44A 4FA6A 5T5FH 1CB4A 1ZLWH 4HJJL 3UTSE 1N5AB 2WXOA 5FUOL 5FHBL 1E5AA 32C2A 2OSWA 2C4FU 5IOKA 2FJGA 1FNAA 4F7KA 3U0WH 4PB0H 2AANA 3TBTA 5AOIA 5K1VA 3NOIA 2BOCB 4R96B 3JZYA 1XL6A 1DBAH 2VYRE 4UOZA 1DANU 3MROB 3K6SB 4R97C 1F4HA 4V33A 4A2GA 4PJ8A 1HX0A 1QYGL 2X1XR 3JVGA 5FO9B 1DP0A 4XO9A 2C3WA 3H0TB 5C0AD 5AL8A 4GW1B 1IQDB 2Z64C 5DD0L 3LQAC 1CG9B 2BSDA 5D72L 1EBAA 1WA1X 1DLFL 1HU8A 4NQDB 3NCCB 2DQJH 3OXSA 3C60B 3FB8B 4AQEA 2LVCA 3H9SB 2Q0ZX 4EPSA 1WH0A 4OM1H 2Z7ZA 3GINA 4HIEB 5E2TL 2HFFA 4Q6IB 2ED7A 4ZO9A 3ARDB 4XE5B 5CJQL 5GRVL 3UAFA 4JPIB 4MCZA 5ID1B 1JZJA 2X44D 2OMTB 1VZIA 3BLKA 4R26H 3KL3A 5J3HD 3ERXA 2W8CA 4BGDA 2QGCA 2FE0A 1BPVA 3DYMA 1JERA 5AWNH 4S1RH 2Z91B 2GITA 2YWZA 1S4IA 1EEYB 1IGMH 1AIZA 4G1MB 2BIOA 3FJTA 4LU5H 5DHXB 1P84J 1A9BA 3EFFB 3TVMC 2WKOA 3UBXB 3LKSA 4WUUB 3CU7A 5CLWA 3LN5A 1EBPA 2IO5A 4L3FA 2QDVA 3GSUA 4DT2A 1JYXA 3LH2L 5TQ0H 5ESAA 2JLPA 2Z31C 3FKUS 3PWPB 4P46D 2EYSB 1ZY9A 3CDGA 3L5IA 4JGNA 2VW4A 2X2IA 3U9PH 3BKYH 2OK0L 1UENA 3WNNA 4Z5RA 1NGWB 2Q5BA 2UXTA 1CDBA 3CFBA 4P2OC 2PTTB 1WA0X 4FXKB 4M48H 2BVOA 3IGAB 5C1MB 4H2CA 1OB1B 3TASA 4DZBB 1T6WA 5DT1L 2WNKA 4KQ4L 1MAKA 4DQOH 3TT3L 1AQKL 1JMXA 4P2QA 1AD0B 4Q6IA 3WXVL 4U3SB 4KVCL 4LHUB 3HE7A 1I9JH 5F88A 5D71L 1T83C 2PCFA 3GMMB 4MJ5A 5KBNC 3MNWA 3E8UL 2YRLA 3B7YA 1Q38A 1MPAH 3LS4H 1HTYA 3BZ5A 4MNQE 5MHSD 3GSNA 3KH3A 1QSZA 4I18A 5F7EH 2Y7QA 4GKOA 4AYMC 2OMUB 1R5WA 4DVRH 4KNTA 5DEGA 4NC1E 2N4IA 3VD9A 3QEUB 3CFUA 2P5ED 5AW2B 3K7UA 2Y3NA 4MAYB 1L6XA 5EO9A 5EMYA 4YN3A 5AZ2L 5KG9B 1U8PA 3D7PA 3UTPD 4F2EA 5DURD 3ZKXB 3FB7B 3RZCD 2VDML 3QDGB 2XFGB 4RRPA 4O2CA 4P9HL 1MVUB 4PV8B 3DOHA 5IFAL 4M8UA 3DV6A 2QQKH 2Z34A 1F18A 2M2DA 3C60D 4YBQD 1QW8A 1KB9J 1O7VA 3QXAA 3J27A 4QCIA 4RGNC 1QR1A 2CR3A 1UT1A 1YC8A 3O2VL 4OQTH 3C9NB 3TBSA 4HALA 4NUQA 4ONOA 1E3XA 1A6ZA 1H3TA 4LLVA 1NCIA 3D85B 3FO1A 4YBLB 2IPKA 1UWXH 1YEIH 2AVFA 4Q7DA 1E27B 1P6AB 3GBNH 2WZ6A 1CVSC 1RK1B 5J0BA 1L3WA 4MZIA 2XTSA 2UYLB 4HC1H 4H7VA 4JKLA 4LL4A 1K2DA 5ACZB 4GLRI 1K9TA 5FM4A 3HOGA 5KBMA 1OP3K 4LKXA 3TN0A 1SJHA 4JFFE 3WE6A 1S9KC 2DAVA 2HPOA 3T6XA 3LNEA 3OZ9H 3PHQB 4PV9A 4R4ND 4YQXL 5AW3B 3O81A 2E6PA 3GIVA 2X89D 3MBEC 4PB9L 3RWEA 4X7SL 3BZDA 3VQMA 4I18B 1I3RB 3VXPB 3NACH 3G6JA 4OZIF 4N90E 4HW6A 4X7TB 4KRLB 3CH1B 3WOVA 1FAIH 1ZHLB 3PL6D 3PYCA 4QHKJ 1WZAA 3DSNB 4PRPB 1FAIL 4EXKA 3RWFB 3AGWA 2ADIB 1ZIBA 1MRFH 1LEIA 2Q86A 3DTDA 3FTWA 2NUTB 4BV1A 4E2OA 3W5NA 1LO0H 3EO1B 4OGXL 3VXUD 4X7SH 2D31B 3C5SB 3STZB 1BJ1J 4X9FA 5IVXA 5PCYA 5FHAH 1SYSB 5BUGA 1C1EH 2YRBA 3MCYA 4AVJA 4IOIB 5GISH 4HHAB 3D18B 1DE4A 1V8HA 1XIWC 5DRWB 3PUUA 3G6AA 5A2AA 4NXSA 3OWEA 1YMMB 5LNGA 1E42A 1G7LB 4JRYB 3ZW3A 3BGFC 2IAND 5HGAB 4UM9D 2FYVA 4FNLH 1O6SA 4KZCA 2I32A 3ESPA 2RHEA 4HMEA 5KS9F 4PJAF 3O4LA 3MZTA 1GGCH 3D3VE 4JM4H 3AADB 5A2IH 1PX8A 2Y5TB 5F1IA 2CCLA 2DLFL 5EBWB 1IBGL 1KC5H 3VAEA 2N0KA 4XC3L 5CKGA 1BF8A 3FCTB 1I8LC 4P46A 2XQ0A 3QJSB 1N3NA 1MZYA 2P5PA 5B3JF 4JGJA 4FABH 4ODVH 1T6VN 4DGIL 4FF9A 1FGNL 1Q0XL 1XGPA 4AL8H 2WLMA 4C83B 2X9XA 1WLHA 3T1WA 3CUPA 2Y7MA 3BVUA 3RKDD 4FTVE 1NTDA 2Q3AA 4EBQL 1RZPA 5D9SA 1TJHL 1QO3A 1Q1JL 3MV7D 2W9DH 2J71A 4L4TD 5A40E 4LKCA 3GQFA 3MR9B 2C1OA 3B2XA 2A9ML 4LMQE 5A16A 2IH1A 3AUVA 4NQEE 4UQEA 3NCJH 5TE7L 3AXLA 2XG5B 3HI5H 3HBQA 3CK0L 4P5MA 4XMPL 1CO1A 3BGFB 1SVBA 1TETH 2NYKA 1SHXA 4DPAX 5I23A 5SWZD 2X4RA 2XQBL 4JJOA 4JG9A 1HSAA 1P5VB 1RUPH 2VAJA 3ARDD 4KROB 4Z95L 3TWCH 2HWZL 3GF8A 3MOQA 1RHFA 4HBCL 3VTTA 3VYNA 1IL1A 3CLEH 5DFTA 3PXJA 1NKRA 4FXKC 5AVTB 3VVVA 2J8HA 4NKMB 5K5YA 3TLRA 1SLXA 4CGUB 3ZZ1A 1OTSD 4LPYA 3OKEB 4GXUM 3KVPA 3ZQ9A 4LRIC 1UB6A 1FO0H 1PZ5B 1N70A 1TZIB 2V9UA 3II1A 1M9WA 2ZT9C 3SDCA 4G11A 3S37X 5DO2C 1RIVL 2EO1A 3ZL1A 1WBXB 4JRLA 1H6EA 3MX0A 1A4JB 4KNQA 1ZLDA 4L1DA 1KXHA 1WBYA 5C3IA 2K6YA 4HUWA 4FLOA 4MSWA 1EA9C 4R96A 3KCPA 3KPNA 4CMHB 5H4ZA 1XEDA 1BAFH 3CIQA 4F15C 4HBQA 5CMAA 5CJOL 1BFSA 4XMUA 4N0RA 5IHHA 5L8LB 4MS6A 5BCAA 1A1NA 3A4EA 4Z7VA 4YDIL 3Q9PA 1M71B 3RZCC 2XU9A 4FXGB 2IANB 4M48L 4X4KA 1P5UC 2IXQA 1HXMB 1YZZA 2RMNA 3KPSA 3MYJB 1EERB 1LWHA 3V6FA 2GEEA 4Q9BA 2R9HD 4OM1L 4RSYA 3UZVA 3QISA 1IEBB 4YS4A 2HT3D 4HUUA 2HLAB 4TUJB 1D2OA 5H8DA 2CALA 4LPTA 3PDGA 3QUKA 1Z1WA 3FSOA 3KPPB 1PD6A 3IDGA 4R84A 4LHUD 3WUWA 5HPOA 3WAJA 2HUEA 1Z2KA 4BUQA 5L2JB 1MW3A 4LLDB 4L29A 3AS3A 4IU3A 1NLBL 3ZQWA 1UA6H 2B16A 1WBZB 2ICEA 2H3NA 3TT1L 2CQVA 4KOBA 2X42A 1G7HB 1CS6A 1QBMH 4KXDA 3TGXA 3I75B 1S7QA 2CM6A 4P05A 4Z95H 3MJ7A 2HFGH 5EPMA 4HCRL 1CR9L 2E7HA 5CILL 4JB9H 3SDCB 4JO5A 1GYVA 3QDGE 4G42A 3EOTH 5EEYA 2QFRA 1N10A 3E6FB 1NWPA 2EDWA 4NAJA 5DYOA 5IK3A 4PBWD 1SHMA 3ZE0E 2P24B 4PD4J 4QXTA 1A3ZA 3MRDA 3P1VA 4MMYA 4X5QA 2HCZX 2Q3XA 3EJCA 4TXVB 3NSYA 4U1NB 3V5HB 1JZ7A 4I0PC 4B9JA 3L3OB 3ZTJG 1O9VA 5J56B 1T1XA 4WHYG 1IAKA 1NKGA 2IJ0C 2Y07L 3WY4A 4LFHG 4WJKB 4KRPC 1FFOB 5ANHA 3ZYIA 3KYMA 4IYKA 2O6FA 5C0CE 1KELL 2F8XC 1S7TA 1AZRA 3DMMC 5I0XA 7CGTA 1XSOA 3L2NA 5KS9B 3Q9QA 4KY2A 5FDWA 3V5KB 2NDGA 3OKNB 4F8QA 4JHBA 4PWFA 5IEHA 3EXLA 1IBGH 1YUHA 4Z76A 3X3FH 4ONHB 4JMNA 1SNRA 2GSIA 1R47A 2JKTM 5JQ6H 5I1JH 5DLLA 1FZMB 2XQBH 4I85A 1WJ3A 3MNWB 4EI6B 2A6DA 4YXLH 1N64H 1MN4A 1HQ4B 2YC1B 1BM3L 4L05A 1GZPA 1NFDB 2VDQH 3U0WL 2N0MA 3GNMH 1ESOA 4KXAA 1L7TH 1S7QB 2G5RA 4J4PC 1AGFB 2JMRA 4TM9A 2CIIB 3NSXA 3L4UA 2B1HL 2DLEA 4U3XA 2DQEL 3K2UL 4OSUL 2VZTA 2KDGA 4G59C 5DJXB 2E6QA 4NP4L 3WLBB 5IK3B 5LQBL 1UM4L 1R19A 5LCVL 1I85C 3HRZC 3NCMA 3T0EC 1RI8A 4DKFL 4KNSA 3UJTL 1A1MB 1YYLH 2VC2B 3KPQB 3PWVA 3OAUL 4P2CG 3SGDH 3FS9A 5J5EA 5GRJH 3IGFA 3D0VB 4I77H 2DF3A 4Y19A 4F58L 1MRFL 1UT2A 2E8ZA 3T04D 2AJVL 3WY1A 2K45A 3DVFA 1JXKA 2ZQKA 4M7LL 1JZFA 1NGYB 1D7FA 1O5DT 4YHPA 4BD4A 1GJIA 4WJ5B 2ITDA 1AP2B 2NXZC 5E8PB 3IFPA 1HI6B 3ARWA 1NANH 3QZWB 2JK5B 4D9RD 5JW4M 2L8AA 3NRFA 3ZY7A 5GS0C 4G5AA 2EDBA 1JZ6A 1SDAB 3WUZA 1I1YB 2BHUA 4GKSB 4HXBH 2OXGB 5ECJE 4EOWL 2H6PA 1ID5I 2PPEA 4Y4KA 1K8IA 4UM8A 1FNLA 2A9DA 2VXUL 4KMQA 5HDWA 4L9LA 1GSMA 3DYOA 4X5XA 1OSZA 4M93C 1FC1A 2OPCA 3OZ9L 4ALAL 5CBAA 1PX4A 1MELA 5AD0A 5ITBH 3BHBA 3V8OA 3FO2B 5HHQB 1T4WA 4HC1L 1KXTB 3V4VB 1J05B 1TVBA 2VLKD 3FT4A 3OLEA 4ODHH 4U2YA 5DJ0B 5A6IA 1TFHA 4PGBA 3AROA 3H9ZA 5JPNB 2EICA 3QDHA 4OD1L 3Q8CA 2COVD 3RTLA 4Z8FH 4GMTL 4ZSOA 4V2BA 2ZIDA 4XBEL 4XPBL 4WGVB 1RZKL 2HVJB 5CN1A 2Q87A 4MB4A 3WLBA 3WDJA 1JK8A 5DD5H 1KJMB 4B53A 5CEZE 4S1SL 1ZA6B 2EAEA 1E4JA 4LCWE 1WZ1L 3EJJX 4LDLB 2X41A 1ZLVK 1F5WA 1EUTA 4ZS6D 3TNNB 4HPOL 4GRMA