4F33B

Crystal structure of therapeutic antibody morab-009
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELEKPGASVKISCKASGYSFTGYTMNWVKQSHGKSLEWIGLITPYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVYFCARGGYDGRGFDYWGSGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MORAb-009 FAB light chain
publication title Recognition of mesothelin by the therapeutic antibody MORAb-009: structural and mechanistic insights.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 220
sequence length 220
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f33B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f33B02
4M5YH 3IXTA 3FT3A 1OTUD 1BZ9B 3W5MA 3EO1B 3MV8E 2VISA 4RFNC 4FABL 3IDNB 4OAWB 2P42B 1UGNA 3A67L 2HVKA 4X7TA 2DM7A 5GGVY 3B83A 3NIGF 3DUSB 5FAAA 5AEAA 4PR5A 4FTVA 4Y2DC 1V7MH 2FO4B 3PQYD 4E41A 1QNZL 5IFHL 4NQCE 4Y5YA 2LVCA 4KQ3L 1A0QL 3UDWC 2R1WA 4TSCH 1NC4D 3D0VB 4GG6B 1SYVB 4FOMA 1EGJL 2GITB 1OAUH 1PSKL 4DVRH 3U30B 3GZKA 4XXCA 5FUOH 1B4RA 4MAYB 2OJEA 1QP1A 2VXVH 4WWKB 4OIBA 3H42L 3M1BB 3LRHA 3RVWD 1RK1A 1EIBA 1KB9K 2E7HA 1QFWL 5SWZE 4M48L 2FBOJ 3AB0C 4LQFH 1MHPL 3OAYH 3VRLE 2X4TA 3TZVA 3LQAL 5BCAA 1F00I 1WTLA 3U79A 5I8OL 1FFNB 4XP9H 1RIUL 4R2GD 3RAJH 1A6WL 1KPRA 1OM3L 3L5IA 3BKML 3U9UA 4N8CL 5LQBL 2R0KH 3MV8A 1XGRA 5JHDE 5I0ZA 4QRSA 3QWRD 1T4KB 4YHKH 3LSOB 1CD1A 3P11L 5IV2B 2K1MA 3PDDA 3O4LB 1CBVH 3MUY1 4M9PA 4NQCA 5BXFB 3A6CL 2QHRL 4JHWH 5CZKA 5E1AA 3ROOA 3S5LG 3ULSB 4KRMB 4MQXC 3VW3H 4ODBD 3T0EE 1IVLA 5D7JD 2YPVL 2CLRA 1HHGB 1FVCA 5I1DA 1GIGL 2AK4B 4PP1C 5I71B 3FOLB 1UVQB 3AS1A 3MLZH 5E9DD 1S9WA 2ICES 1KSRA 4K2UL 1F11B 2OQJA 2D4DA 5I8EA 2A83A 4RAHA 4G8GB 3VA6A 2C3HA 3V4UL 3DWTA 3W81A 4MA8L 1NUFA 4PTTB 5JIPA 2JELL 1XIWD 5SWZA 3WFHB 4JFED 2CK0H 2B2XL 3B9AA 2ZCHH 4FA8A 4WI5A 2HTLC 3QEGH 4CN1A 2I60L 1F4WH 3UTSD 3FONB 4U1GC 1S7TB 1V7NH 4OQTA 5IB1A 3STLB 2IFFH 3LZFL 5HHQA 2AXHA 3CMGA 2XWTB 1YY8B 4XBGB 2AKRA 1MAML 2QSCL 4Y88A 4OCXH 5CWSA 5IIEA 3HUJB 4MAUH 1BBDH 3AS0A 3LDBC 4LLQA 2DS4A 4MCZA 1LVEA 1BM3H 5DD3L 2XACC 3G6AA 4WENB 4GUPB 1GC1L 1WBYB 3C5JA 5JHDA 4LQ1A 2PO6B 2HKFH 3MLVH 3HNTH 4FMKA 1I1FB 5EBMB 3DVIA 3U0PB 1F3JA 3B2VL 5I1KH 4HXAH 1S9YA 3MYJB 3UZVB 3CFIC 1A7PH 3TEUA 3BUYB 2LQRA 5IR1A 2RR3A 4Q6IA 1RU9L 3C5ZD 3VXTA 4RIRA 5KAQG 3TA3A 1KN2H 4X98B 1ZVSA 4H5SA 2IH3A 1U95A 4F7MB 1R5VB 1LO4H 2A6DB 5IFAL 3UMTA 4JKKA 3VXRB 5C1MB 4NPYB 1LK3L 3CK0L 3MJ8B 3JXAA 1DDHA 4ZUUA 1FSKB 1KIQA 2BC4B 4YXLH 1HCFX 4YXHL 2IBGA 1HH9B 4G7YL 3QCVL 5EC1A 4KPHL 2DKSA 1X4YA 4N0UE 4PTUA 3GKWL 1G6RA 4HIXL 4XZUA 4O9HH 1OGAB 3VMOA 3RIAF 1XF2A 1KCKA 1W72B 4NKMA 4M6NL 4P5KB 4EVNB 4ORZC 1RIHH 5JXED 3ULUH 1B9ZA 1E4JA 4D0DA 3SE3A 5CJ5A 3D69A 3HMWH 4R4NC 4V1DE 4ZQKA 1J0HA 4RGNB 1ORSA 3HCVA 4MX7A 3NCEB 4OCYL 3EGSA 4H1LB 4ETYA 3LH2L 1VFOA 4HCRH 1CICC 4TVPE 1U3JA 1N8ZB 2IMMA 3O2DL 3CVIL 3AMKA 3MLRH 2YK1L 5GRJH 3ARPA 1N6QL 3GSNL 5T33L 1DBAL 3ROLB 3P0VL 1QD0A 3HE7C 2YZ1A 1BQHG 1O7VA 4HG4K 4MS8D 2XKSA 3LV3B 1PFCA 3MRRA 2YPKA 4TQEL 2P7TB 4FRWA 1A6ZA 3H9HA 1DTUA 2P8PA 3K1KC 2FR4A 1KUMA 2AV1A 5H8DA 4Z77B 5DD0H 1T1ZB 4DZ8A 4WEBL 3IRPX 3DMMD 4JVPA 3BJLA 4U2ZA 2AI0L 1ND0A 4OLWH 2R23B 1FO0L 3TO2A 1CI5A 1IGMH 2C3VA 2OL3L 4JB9L 4N0UA 1CK0H 1G9MH 5B8CA 4RWYH 2QLVB 1AXTL 3V4VH 4POYA 3G08A 2BNRB 5IBUG 3ZE0E 2NLJA 1F45A 1MEXH 5HSFA 3QPQC 3LRSA 3MNVA 4GMTH 3TIEB 3D6GA 2R4RH 4U1NA 4KQ4H 2KPNA 5E2UL 4PJ7B 4P2RD 2FB4H 3F6LA 4V1DA 2L4OA 5I9QC 1UA6L 1RHHA 4PBWD 4TNVF 2W0LA 4XPFL 3IDGB 2APVA 5A2LH 1RIVL 4LHUG 1KC5L 3KS0J 5C0CE 2R1YB 4MNQA 1CF8H 5JPMB 2Z35A 3IGAA 3ES6A 5EB9A 5L8JB 4Q9QL 5FHBL 1G7LB 2WBJB 1X4XA 5KBNC 4F33B 2X4RB 4GKSB 3HE6D 1ZWIB 1KCUL 1K8DB 1RZKC 4TYUA 2R1XA 1IRAY 2O5XL 2FSEA 1ZHBA 4LSVH 4L8CA 2GSGB 1DQMH 4HGWA 5C2BL 3MR9B 4WHTB 2Y1VA 4KZEL 4P2OB 4BA8A 1GGCL 1HQRB 1ZANH 2EIEA 5HGDB 3EHBD 4MCYB 4DKAA 1A22B 1B2WL 5I75C 2YMXH 1KGCE 3ZKXB 5DZLA 1VADB 2PW2B 1MCQA 4NZJA 5CKAA 4ZSOB 1IGTA 3SBWC 1CXKA 1ZOXA 3QJFB 4GAGH 2VUYA 4R7DB 5KSAC 3QEQB 4K8RD 4PGDB 3FQNA 2D7NA 5BVJB 5DJAA 4G9FE 2DQDL 4LCCB 4JPIA 2FX7L 4JPKL 1AY1H 4FN0A 2H6PB 4P9HL 1SYSA 1XMWA 4J3OC 4XAKD 4ZUWB 1U41A 4PRIE 5C0CA 5FA4A 4JHZA 1QSED 4FG6C 5ETUB 5I30H 3HC3L 2VLRE 1NEZA 3QCUL 5EU6E 1UJTA 1T7XA 3BDYH 4YQXL 1BJMA 3CFKB 3LQMA 1CDCA 2A2QT 4OI9A 1UWGH 4CAGA 3QHFL 1YYML 5GSRB 1P4IH 2YBRA 4MHHG 4WW2A 1KENH 4LVOB 1OCWL 1VKXA 4KDTA 3PWPB 4U7MA 3CSPA 3RGHA 5ESAA 2BNQB 1AQKH 1LEIB 2AABL 3MRDB 2QTEA 5DK2A 2F74B 4UBDC 1BMGA 3BEVB 3NMEA 3PP3H 2Z92B 3B2UD 1Y6KR 5DC4B 1YN6B 1NCTA 3LS4L 3MLTB 3GI9H 5IG7A 3R0MA 1EK3A 1C1EH 4KUZH 1EAPA 3CSYA 2HA1A 5DK0A 1YC8A 3GI8L 2X6MA 5HHOA 3MRHB 1G7IA 5DQJA 2Q3AA 1OSZA 4G9FA 1CU4L 5GIRA 1JPFB 2H2PD 5D1XC 1N7MH 4JZJC 5D1ZC 3MO1A 5J3HD 3CFDB 5HI4D 4LSPL 4XCFH 5C0RH 1YQVH 2CUMA 2FIKA 4BK5A 1OTUC 4MA7L 4PRIA 3D85A 1MWAB 3P4MB 5DEFB 2XICA 3VRLF 2VLRA 4NRZB 4XCYB 5EU6A 3BRGC 3H2WA 4ACPA 3R06A 4WFGE 3STBA 2X42A 4Y1AD 1NGXB 3U2SA 4ETQB 1D9KA 4ZFGH 1FZJA 4LMQI 2I9TA 4XWGL 1OTTD 3T0DA 1S9VA 1MCPH 1QFUH 1U92B 1OP3K 4S1QH 1JTPA 1KBGL 1CWVA 1YDPB 2DD8L 4NGHL 1J86A 5TDOA 4Q6YA 2UY6A 1CR9L 3QIUA 1I7TB 4JR9H 4F7TB 2IQAB 4X5WA 4H0GA 3CLEH 3HR6A 1BZ7B 4PRHB 4DVBA 1QBLL 3MX0A 3RVWC 4P23A 3JTSB 3BGFB 3QNXB 2DB8A 2VO5A 4OF7A 2D7PA 1F97A 5IOPA 1S7UB 4XPHL 4JCLA 3T3ME 4R4BB 1NFKA 2GTZB 5K59E 1N0XH 2B5IC 1X5YA 2NXZD 4R2GC 1P9MA 4TN9A 4ZPVB 1L7IL 2PW1B 3EO0B 3PGCB 4QTHA 4NQDD 3RRQA 4M6ML 3KXFE 3H7LA 1A14L 5B38A 4JFFB 2R2EB 2OTWA 4KUCF 4OT1H 5DJDB 2XFXA 1BFOA 4HIJB 4Y89A 1C5DA 4QLRA 1AQDA 1SBSH 5KSUA 3KLAA 5TH2A 1WEJH 4F9PA 1FVDB 1MFAL 1I9JH 5D7JC 3ARGC 5DMIL 3TM6A 1A7OL 4IRZL 3RWHA 2OR7A 4DN4H 4X6BB 4Z5RA 1UXSA 1KTLA 2M8XA 4JKWA 4LLDB 3RY4A 5HYQA 4GSDH 4X9HA 4NZRH 5I1EL 3K4AA 5LKNA 4NM4L 4NNYB 4XRCB 4JFDE 43CAB 3IFPB 3V0VB 1G9NL 3NH7H 1XIWC 4MAYD 5ISZE 2A6KA 4X80H 4MA3A 4WWKD 2AEPH 4PJAE 4G6MH 2CQVA 5D1QB 1LK2A 1TFHA 1H3XA 2NMSA 3ARQA 4KJYB 3B8SA 3RWFA 3CJJA 1BVLA 2E6QA 4WDIA 1BIIA 3H0TA 5HDBE 5K93A 3S4SG 5I1LA 4M6OH 5I2IA 1FC2D 2YN3A 1AGFA 4U3XA 5TQ0L 2CLVA 1CXEA 1JP5A 2I9LA 2AP2A 3KYNB 1B0RB 2A9NH 1TLKA 4PYGA 2FL5B 3CH1B 3SDXA 1A2YA 2FJFA 1NBZB 5IHUL 4BYHA 4G3YH 3KXFA 3SO5A 2BMKB 1BVKA 2XG4A 1EHXA 5DQDL 5GGUB 4MMZC 2IWGA 4ZNCD 4M7LT 3LS5H 3B9DA 3NA4A 3VFRB 1SM3L 2HT3D 4NJAH 4OD2B 2H1PL 3C5ZC 4LLAA 4XTRD 4HUUB 3R8BB 4KXZH 3WNNA 3V8OA 3O4LD 5GGRA 1FLTX 5GPRA 4GXVL 4PD4J 2DJ4A 4APQC 4PRPE 5DD5L 4L8SC 4OCLC 5C0FB 5F1NB 1IEHA 1KTDB 3C08H 5I1JL 4J23A 5FO8A 5J11C 3UTQB 3G6DL 5J9PA 2AK4D 4QHKJ 4PUBH 2QR0A 3QZWB 3G6JE 2QSVA 4JFDA 4PREB 3QXTA 5ISZA 4JFHE 5ICYB 4ZOBA 4G8GD 3O2WL 4PJAA 3EOAA 1NMBL 5JXEC 5KS9E 1TTUA 2AJUL 5TE7H 1A7RL 4LKXB 4XNUL 3D2UB 4OLXH 5JW4Q 1FNEA 4N5ED 5CSGA 3ZE0F 3BSZL 5EUOF 5F7HA 4KTDH 2YEZA 4EIZC 2X7LB 4YHLL 2IALA 3DGGA 2G60L 4XPAH 3P2TA 4UQ2A 4XPGH 3IDXL 2F15A 5C2UB 1KFAL 1MPAL 5MI0C 5HGBA 4I9WD 4X9BA 3VI4E 4LP5A 5T3XE 3GJFB 1KLGA 1FIEA 4MS8C 3OXRB 1LEKB 3MRMA 2NTFA 1M7XA 2PO6D 2XZCH 2HRPL 3SKJH 1AGDA 5ALCL 3ULVE 5ITBL 5F8RC 15C8H 2FECI 1FNGA 3CXHK 3FB7B 4L3AA 2QQLH 2VABB 5GJSH 3HC0A 1Y6NR 2YZ8A 4PRPA 3IF1B 3MV7A 2E9IA 4I0PA 4I3RH 3L5JA 1IEAB 3GMOB 1PEWA 1U8OA 2J8UE 1JN6A 1PX4A 4M61B 3VXSB 2AJZB 1M6OA 1FPTL 4X5XB 1UYWL 3VXRD 4J4PA 4DQOH 4WW2F 3IFLL 1OWWA 3G6JA 2ADIA 5DJ0B 4L9DA 5FUCC 1MNUL 4OV5A 1DLHB 5T5FL 4ZDHB 4GRMB 3OXSB 5J6HA 3VGDA 1FAIH 5DJ6B 3TN0B 1UFUA 1C16B 5KS9A 3TT1H 1OGAD 4IOFD 1HYSD 1R3KB 5DD1H 1BGXH 5EA0H 5CP7B 3TBTA 4FZ8H 5BW7A 1FJ1B 4LSUH 4TVPL 3C6LA 4LARL 3RWEA 5HPMA 2DM4A 3MJ9A 1OL0A 1M05A 1CZ8L 1JVKA 3H9SB 1FVEA 2YA0A 3SGJC 3UJIL 4JQXC 4OFYD 2FNBA 1MFDH 4RGND 3BWUC 4NQVB 4UDTA 4M7KL 3WFDH 2OX5A 4LAQL 2GCYB 3L5WA 3HE6C 4G43A 3PWVB 3OX8A 4P4KA 1ZA3B 3MRQB 4RA0C 2VQUA 4UB0H 1AD9A 2ICEA 2L7UA 4Y5VA 5JW5B 5ALBL 1YECH 1DQQB 1M71A 4S1RH 3IJSB 5FV2A 1D6VH 2BSRB 4ODHH 2D03L 1MCKA 3QIBB 1LD9A 1EZVY 5AZ2H 1PKOA 4HHAA 3EHBC 3ZZ1A 4G7VH 1MQKL 1M7DA 2JB6B 3WNMA 2J8UA 3UYRH 1QQDA 1YUHA 2ATKA 1NJ9A 2CIIB 5AD0A 5FCUH 3GGWA 5FYKL 5JUEL 5C6TH 3AREB 1X44A 3WD5L 5JPNB 1CFVH 2VDOL 2HJFA 1GZQA 4H88H 2APFA 1FBIL 1ZLUH 2VLKE 1JGUH 12E8H 5I1IH 4PFEA 2IGFH 3TYGH 4K8RC 3PWNA 3LKOA 5FGRA 4F7EB 1GOHA 2BNRD 1EFXA 4OZFG 1Q38A 1K5NA 3GB7A 4XGZA 1HSBA 3TPUA 1E4XH 2AEIT 5I8KH 5HGAA 2EZ0D 3VXMD 3DJ9A 3GIVA 1K6QL 3MACH 4KY1H 5K9OA 4NCC1 4CDGC 4ZAKB 2MQ3A 2G5RA 1AGEA 4F15B 4NO3B 3FQRA 4WEMB 3TFKD 1SY6A 5CSZA 2ZJSL 5LVEA 3RWGB 1JHTA 3D9AH 2MCG1 1LO3H 4KKNA 3WIFA 2WBJD 3DSFH 3MRCA 3PF2A 4L8BA 5DRNB 3M8OL 5KVEL 3H8NA 3KPQA 3FQXB 4CVZA 2X40A 5E8OA 1KB9J 2IPKB 1DN0A 1KEML 5GS2D 4UTAH 4OF6A 1ONQA 1PAMA 4N8VA 3WFBL 3ILQD 3SJVB 1MHHB 4PIRF 4P2OD 4HUXA 4AZ8A 3BH9B 3FO2B 3B2UC 2CSPA 5T1LA 3R8QA 4HC1H 5DLML 1JK8A 3PGDA 2XXCB 3GSRA 4X6FA 2WM0A 4AQOA 3GIZH 4PJGE 1QOKA 2VLKA 4QXGH 5E2VH 2A74A 2DYPA 4F7PB 2NR6D 4PJHB 25C8L 2H2PC 1AR1D 4P0DA 3E8UL 5J3HC 4HV8A 4OM0L 3AAZB 2NZ9D 4HJGB 1S5HB 5HI4C 3QEQD 1I9EA 3FHQA 3WFCH 4JJ5A 1J7VR 2I26N 3HPJB 1IGCL 4ISVA 2Q6WA 2EDHA 4AM0A 4WO4A 4N8PA 1IGIL 1YEEL 3WKNA 4GS7B 2BDNH 4KVNH 1UH2A 3D18B 1U8NB 3T3MF 3VFGL 5ICZA 2YKLH 1YA5A 1CQYA 1I7RA 4L4TE 4XVSH 1NFIA 3BGMB 5K59F 4LDOB 1MCJA 2ZCKH 1KPVB 3BRFA 3JVGA 1CE6B 2DIJA 4JM4L 3TWCH 1Q8MA 2A38A 3T09A 4D94A 3IAGC 3RL2A 4WV1B 1OTTC 3QQ3B 3WUWG 1EJOL 2VR5A 2GSIA 4J12A 3BPCA 1UKTA 2C9AA 4AT6B 2IBBA 5AAWA 3CLFL 1QKZH 1XT5A 1OB1A 1FYHB 4HMDA 3X17A 1DN2A 3HR5A 2XQBL 4J1UA 2XTJE 3PWPD 4QTIH 1JYVA 2BNQD 2FJGB 3QAZB 1MLCA 1NDGB 4LVHC 4TUKH 4QXUH 5TE4L 2OI9C 4HT1L 3E3QE 4A2LA 1IC4H 4PJGA 4PS4L 1DVFB 3IXTB 3IU3A 4IDJH 1C08A 5SWSB 1EEZA 4NHCL 4Y2OA 1UKSA 1OPGH 2VISB 1KOAA 4M9OA 3HC4H 4U6YA 4X7TB 3QRGL 2NXZC 1QFPA 4NUJA 4JHBA 2CRIA 1UKQA 4FTVB 3CUPA 5KW9H 4PJAF 4E41B 4RFOL 3BWAA 1S7WB 3NACL 5HDQH 1DJSA 5TF0A 2R1WB 4OCSL 1UH4A 2J12B 3C60A 3FRPG 4YPJA 4KGLA 5HDBF 4TRPH 5ADPH 3DUUA 4L4TA 4L8DB 4S1SL 3STZA 3ULUE 5F9DC 2GHWB 4AMKL 1JPGA 1YMHA 1CGUA 2GAZA 2OJEB 1VENA 3I3BA 5J89A 2V7HB 5KJRL 3V6OC 3BAEL 3NA9L 2X4NA 1VPOL 2BSSA 1T7WA 4LPTA 4YEFA 3CFJB 5IESL 3GMRA 1OAQH 2E6JA 1I3VA 4ZTOL 3IB4A 3TZVB 4HMEA 1PJ9A 1BP3B 1GOFA 3I50H 2VWEC 1BIHA 4LLMA 1KULA 3U30C 3OF6A 2F8OA 1I75A 4MAYC 1UJ3A 4WWKC 1KPRB 3DURA 4PRHD 1HOCA 2C4FT 2DBLL 3U9UB 2COQA 3MV8B 1XGRB 2CKBH 3G6JF 1QA9A 1CD1B 5B3NA 1A6UL 1H3PH 1JNNL 4Y0GA 2XRAL 4NJ9H 4LLYA 1IAOA 1ZLWH 4JZOA 4OTXL 3T0BA 3LN5A 2P45B 4NQCB 2PYFA 5E1AB 3BP5B 2YD4A 5IGXH 5H94A 4U05A 4XNQA 3RA7L 4LSRH 1FVCB 5I1DB 4HBQA 3EYQD 2APBA 5DUPL 1IKNC 2F58L 1S9WB 1AHWA 3DI3B 5IP4A 4N90E 4RX4D 2HT3C 2J2ZA 3QP3A 1VGEH 5I1HL 4JFFD 4BUHA 1D7FA 1RFDL 2OQJB 3JV0A 4XTRC 1HKLL 4YHPA 4ZOCA 5I8EB 2MHAA 4OZ4A 1HINL 1J0YA 4MXQD 5E5UB 3HI5H 4EXKA 1Y18B 3C8DA 4PRNB 3VI4F 4FP8H 5SWZB 2E7BA 5B22A 4XNYH 4HCRA 5FF6A 3TP4A 4YDKH 4GO6B 3BHBA 3F12B 1BQLH 3I6KA 2CD0A 5DUMH 3ULVF 5I71C 1KCVH 4ZYKB 4DW2L 5IVZA 3I84A 5HHME 2Z8RA 3GRWA 4D8PB 2EDFA 4K71B 1NFDB 4G6JL 4TPRH 3QG6A 1CIUA 4MCZB 4LCUB 2J8UF 5L2JA 2JLLA 3BFOA 3O3DA 2V5TA 2XV6B 3G6AB 2VC2H 5LBSH 3C5JB 4K9EH 5GRVK 2LV4A 3U9PL 4EOWL 1VFAB 5JHDB 3K46A 1LEGA 3MV9B 4MJIB 5D1QD 1EO5A 3QULA 3UX9B 1K3ZA 4N5EC 4OUUA 1F3JB 4OZFH 1JMZA 2J8OA 1S9YB 5DR5H 5EZOH 3HZVA 1BFVH 3NTCL 4Q6IB 3VXTB 1PLGL 3IAQA 3TA3B 4H5SB 2IH3B 1U95B 3FQWA 2C4FU 2EH8L 5DMKA 1NGPL 3N1GC 4PY8J 1YZZA 1CL7L 2HWZL 1DDHB 4ZUUB 3AXLA 2PO6C 1J9CT 1NLDL 1NGQL 2C1PA 3MUHL 3VA2C 5ID1A 4QXTA 5HGHB 2Q7YA 4KTYA 5EC1B 4RAVA 1G6RB 3P0YL 1OSPH 1KXQE 4XZUB 1YMME 1ACZA 4M62L 2R0LH 5GXBB 1J1OH 1XGTA 3LD8B 3L5XH 1XF2B 2C3WA 4NKMB 4HWNA 4JY6A 3WXWL 2OJZH 4NHUA 4KRLB 2ZG1A 1EHNA 5TFSH 3F7PC 1JGLH 4N9OB 4C56E 1B0GA 3D69B 3O3EA 4XVTL 1FSKC 4ZQKB 1ZT4A 1A1NA 1ORSB 3HCVB 4MX7B 5EZIL 5F1IA 2XA3A 4P59H 5GGSA 3EGSB 4Q9RH 4FQ2L 1B4JH 1IKFH 3C09B 4JQIL 4IOFC 1HYSC 3VRJB 1LE9A 5CGTA 1FIGH 1T3FA 3L1OH 3P77A 3SOBL 1GPOH 4DGVL 5D2NE 3EO9L 3V52H 1ORQA 2VAJA 3P9LA 3KJ4C 5K33A 1YNTA 5T3XL 3D2UD 4XH2A 3A6BH 3IKCA 2YPKB 1W0WA 3MRRB 4RGNC 5DJZB 3DX6A 3H9HB 4PY7B 4W4OC 5TDPB 4CMHB 4X7EC 4BSJA 4FXGA 4QRUA 3VFWA 3ULVL 3OKMA 4QGYA 2IQ9H 3EBAA 3RVVD 4A6YH 2QADB 5CZXC 3JV6A 4KI1A 3S88H 3TO2B 1FE8H 4U0RB 3ARVA 4OCMC 5GGVL 4G42B 2C3VB 4DN3H 1OTSD 4N0UB 1D5IL 4QHMA 3REVB 4FMFA 3A0OA 2ZPKL 1YMMA 3KYOA 3G08B 4F37F 2NLJB 3H7BA 4BSVB 3L3IA 3ALPA 5LXGH 1TETL 3LRSB 3RWIB 3MNVB 1BQHB 1GGUA 2ZWLT 4ZOAA 4QNPE 4U1NB 3ALXA 3LAFA 1C7SA 3SE9H 4C56A 4NC1E 3GK8H 5A16A 3CDGA 5F9OL 1MFNA 3UTPD 4I1NB 2EEDA 3VXSD 1RHHB 1EDQA 1N3NB 4E5XB 4ZXBA 4EUPG 4MNQB 1WZ1L 3KG5A 3ES6B 1AE6L 1K8IB 1UCBH 1ZK9A 4HIEA 2A9MH 4O4YL 1OAYL 3FL7A 3TN0D 3MLPA 4DAGL 2Y6SD 2EIZA 4WFFD 5D2NA 2VDML 5IMKA 2FSEB 2EZ0C 4PJGF 5HYJE 4OLEA 3DSNA 4L8CB 4LLVA 4RBPK 4HGWB 4HKJA 5D7SH 3VFNA 2VDKL 5FUZH 5IBUB 1TJHL 3TFKC 1EXUB 3TV3H 1J0IA 5DEGB 5F3BA 2UYLA 4LFHG 3H9SD 3OZ9L 3QXDA 1AO7E 4WRLA 4O5LL 2WBJC 4M5YL 5E8PA 2WWKO 5AZEH 3MOBH 4LRIA 4TUOA 3PL6A 3GSXA 3QUZB 4J3XA 4HS6A 1EMTH 1T6WA 4AJ0A 2NNAA 2XTLA 1IGTB 3DNKA 3ILQC 4Y16D 1V7ML 3GMQA 4P2OC 1XCTA 4L1DA 1II4E 3EYUH 3FQNB 4PP2A 4NM8H 1A02N 3QIBD 3JBG7 5FYJH 2BHUA 1DEEA 4TSCL 1J8HB 1G7MB 4RZCA 1KYOK 3PV6A 1RSFA 4OCNC 1SYSB 3ZKXC 1OAUL 2Z93A 1HH6A 3QA3A 5C0CB 5FA4B 4FQPA 1MIEH 4DVRL 3BZEA 5FUOL 1UB6A 5EOCJ 3Q0HA 4NRXB 2VXVL 4NKQB 5D7KD 1AR1C 4YE4H 2NZ9C 4NO0A 5D7IE 3SHSA 2YD1A 3BPOB 2ADGA 5SV4A 5C0GB 3VCLB 5B3JE 4OKDA 4LQFL 4LCCC 1R3HA 5HYJA 2CLZA 2OM5A 2YBRB 1EERB 1VKXB 3TVMA 1V8HA 2UV3A 2VZOA 4XP9L 3S96A 4ZAKD 4YBQD 2H26B 3BD5A 1AO7A 2QEJA 5ESAB 3S36H 3ZL4H 3RAJL 4KMTH 2FZ3A 4JO4H 4JPWH 4NQXB 4EDWH 1ACYH 1QSFB 1L9MA 2R0KL 4LGSB 3R1GH 2R69H 1E6JH 3TESA 4YHKL 5IG7B 4YHMH 2B0SH 1I8KA 3ULUF 1EAPB 1HE7A 3CSYB 2PXYB 4LVOC 5DK0B 1CBVL 4S1DD 5HHOB 1G7IB 2X9XA 5DQJB 3PWJB 1Q94A 1OSZB 4JHWL 1FRGH 5GIRB 1J10A 2FLBT 1N6VA 3VW3L 3SJVD 4HPYH 2G2RB 4JFQB 4XP1H 2FIKB 4PRIB 3D85B 1T0NA 2IPUK 2HFFA 3CXDH 2VLRB 1R3IH 5DFVD 4XWOD 4XP4H 4LASH 2HTKD 5D7IA 4PYHA 4U1MA 1REIA 2D7OA 3R06B 3FRUB 4MDIB 1U93B 2CK0L 2ZCHL 3QEGL 1D9KB 4HH9A 1F4WL 3HRPA 2I9TB 2HAZA 1V7NL 1S9VB 2IFFL 1JNLH 3AC0A 5E7BA 4OCXL 3RJQB 1NQBA 4MAUL 1BBDL 1U3HA 5TDOB 4RMSA 3QIUB 1Y6MR 4AIOA 2R2CA 5FO9A 1BM3L 1P7QB 4W68A 4TSBH 3ARFA 2HKFL 3VXNA 3MLVL 4HH8A 3HNTL 3UBXG 4AIZA 3ARUA 1L0YA 5I1KL 4HXAL 5KVGH 1KJ2H 3GHBH 1A7PL 1QHOA 3RGVA 3RDTC 7FABH 1KN2L 4BZ1H 2CPCA 1YEJH 1I9IH 1LO4L 4XBPA 1XEDA 1CFBA 4ODWB 5A1AA 2DMCA 1CD9B 3GHEH 4XMLH 3IETA 1RZKH 5JMRA 4Q2ZB 4QTHB 4YXLL 1NDMB 4I18A 3BGFC 3EZ8A 3RI5K 1DVFD 5DQ9B 3S36X 5B38B 2ZKHH 5SWSD 2OTWB 4MB4A 4JJHA 4O9HL 4C83A 1BFOB 3JTTA 1C5DB 4KH2A 5KSUB 2ZSWB 1RIHL 1CFNA 1QR1A 3ULUL 3KLAB 4FS0A 5TH2B 2J4WH 2HLAA 4FTVD 9CGTA 4HK0A 3HMWL 4HGKC 4E41D 1XGQA 2BRQA 3MZGB 3EYQC 3QQ9D 1UH3A 5DJCA 4Z5RB 4CUCA 1KTLB 1RUMH 1RURH 5AYUH 4HCRL 3EJYD 5E00A 3MLRL 5GRJL 4MXQC 4GLRH 5IM7B 2A6KB 3AS3A 1KELH 1KPUA 5GJTH 5ELIA 4N0FB 1MCOH 2F8VA 3RWFB 1BVLB 1WVZA 4WDIB 1BIIB 3H0TB 1EHLH 4LF3A 1D3CA 5DHVA 1XGUB 4WI9A 5I1LB 1T7ZA 2P47B 5DD0L 3ISWA 1AGFB 3TZVD 2NYYD 2CLVB 1FFQA 2MJWA 4EJ1C 1KIPA 2YN5A 4OLWL 2I9LB 2DDQH 1P5UA 3FFCE 1H5BA 3SDXB 4AQ1B 1A2YB 1FQ9C 2FJFB 1WFNA 1WBXA 2VXSH 4XNZB 1FLRH 1NCUA 2GT9A 1IGML 1QTYT 2JJTA 4EUPH 5D1QC 1CK0L 1G9ML 4RWYL 1BVKB 3V4VL 4WTWA 3RIFF 1A0QH 3MV8D 1I8MA 3QUMH 1MEXL 2DKUA 4GMTL 3E0GA 2R4RL 4G80A 4KQ4L 3VXOA 3WDJA 3MZTA 2FB4L 3LKPA 2OR9H 3HAEG 5GGRB 3B5HA 2V17H 3L7FB 4NQCD 1XCQA 5DJ2A 2DWDA 1AGCA 3LRGA 4IS6B 3S4SB 4PRBA 1ZLVH 3WNPA 5IROC 4J7RA 1CF8L 2F5BH 2VMFA 5J9PB 4U31A 1QR4A 4PJ8A 3FN3A 2QR0B 3DECA 2L7JA 4M3KB 2XA8H 5ISZB 5IJKA 2OCFD 4KAQH 5DT1H 4LSVL 1F4HA 1QZ1A 3EOAB 2VITA 4ZS6D 4JPVH 2BVPB 1DQML 2VDNH 2HJKB 3J8F7 5GS0C 2VN4A 5SWZD 4HZLA 1WSST 2DBJA 3IDMA 2E9WA 2OYPA 3IYLW 3UTTB 2GW5A 1Z6JT 1ZANL 1FNEB 4UIKH 1NUDA 1S5IH 3EOTH 2YEZB 3L3JB 3DO3A 2IALB 3MOAH 3FFCA 4QRTA 4QNPF 2HN7B 2QKIB 4UQ2B 2YMXL 5HGBB 2JIXA 3Q48A 4OCRH 2EDOA 5SX4I 4QYOB 2APXA 4XP6H 1KLGB 5IW6B 4YHZH 3QDJA 4HD9A 5JHDD 3MRMB 2NTFB 4GAGL 2JJUA 3MV9D 4MJID 4U7KA 4YHNA 1NKRA 1A1MA 4LKCA 3BIAX 3IS1X 2XY1A 1FNGB 1S7VA 2HG5A 4MJ5A 5IBTH 3RVVC 3U82B 1AY1L 1BREA 4JDZA 1WZKA 4PRPB 5MERA 2LVEA 4X83A 3MV7B 3QXUA 4I0PB 3TA3D 1G1YA 2XI9A 3VWKB 1A7BA 1R3LA 8FABA 2PF6A 3D87B 1RUPH 4PJ5B 4OD1H 2ZUWA 5F7FA 5C6WH 4OGXH 5I30L 2EYSB 3WJJA 4DKDC 1MCIA 1OTSC 3AY4A 3OKLA 1I8LA 2ADIB 1GGBH 3BDYL 3G6JB 4ONOA 4HUKB 3W9DB 1G7HA 3CX5K 1IQWH 3VH8G 3IFNH 5J6GB 1UWGL 5KS9B 5IBLD 4UT6H 1P4IL 1X6LA 4YNYA 1KENL 4RMUA 5SX5K 3TBTB 3U4BH 3WNOA 3HKFA 3KPMA 3C6LB 3RWEB 4B53A 4E0RA 1AQKL 3LMJH 3CFEA 1M05B 1PBYA 1FVEB 5CEZE 3PHQA 3U7WH 1KCSH 1DL7H 1E28A 4KUCD 3OAZK 4UDTB 2EYTA 4HF5H 5B4MD 1DQDH 1QEWA 3TN0C 2XN9E 2H45A 2Y6SC 1MFCH 3L5WB 4G43B 3GI9L 4K3HA 1VSCA 4P4KB 5HVHB 1C1EL 1RAMA 4KUZL 5DTFA 2JCCE 1LQSR 3N06B 5KANI 2DI8A 2ICEB 4HC1A 4Y5VB 3TPKA 1MVUB 5EU5A 1M71B 1FL3A 5J1AB 4P4RB 3SDCA 1N7ML 4YFLF 1MREH 5D7IF 3H3PH 1F3DH 1LD9B 4XCFL 5C0RL 4HHAB 5B3JF 4M7ZB 1YQVL 4RDQG 3NCYP 1QQDB 4I3GA 5J57B 1S9XA 1YUHB 2ATKB 2QADD 3GGWB 2FHFA 3B5GA 1TIUA 2HJFB 2VOTA 3C87A 3GJEA 4OI8A 3EDFA 3VGEA 3UPRA 4OIIH 1C5BH 2R29H 2O5YH 3MCG1 5EO0B 3QIBC 3V79C 4OFKA 5ERWB 3LKOB 4ZFGL 1KJMA 3RY6A 1EFXB 4A2MA 1KNOA 1MCPL 1P5VA 1K5NB 1QFUL 3GB7B 4TTGA 1FCCA 4S1QL 1HSBB 3TPUB 4LSSH 3ILPB 1U2CA 5ACZB 5HGAB 1RULH 5EFIA 3AREC 5K9OB 3ZSSA 4JR9L 4QRRB 1KB5H 2BK8A 5E4EB 1H8OA 1T6VN 3CLEL 4RMTA 4W81A 3FQRB 1T89C 1LP9B 5CSZB 1DFBH 4MNQD 2XN9A 3DRTB 3NZ8B 4OI7A 1AR2A 3BP7A 4TVPD 1R5WA 3WIFB 3MRCB 4L8BB 2JCCA 4OZGE 1HILB 4ONFH 3KPQB 4CVZB 4DOHE 5E8OB 5J12B 1KIUA 1DN0B 2VLJE 5J7CC 4ZAKC 4YBQC 1YEIH 1N0XL 5DRWB 1HDMA 4F15C 1ONQB 1R5IA 3KPOA 3MNZA 1AJ7H 1WIUA 4KKAD 5HVWA 3W9EA 4HUXB 1R3JA 3QXAA 2GK2A 5T1LB 1CLYH 3NCYS 1JK8B 3PGDB 3GSRB 1CL7I 1YPZE 3KR3H 4X6FB 3LKNA 1D5MB 5F6HI 5JXAH 1JNHB 4OT1L 2B1HH 5IB2A 1IT9H 2VLKB 4KDWA 4NN5B 3U46A 2DYPB 3QUZD 1SBSL 4S1DC 3O45A 5EIIA 3V0AC 1T5XB 4F7CA 2ADFH 1IM3B 3O3BA 1U42A 1WEJL 3FT2A 4HV8B 1I9JL 1QPPA 4U1IB 4HIHA 5JOFA 2R2HA 4JJ5B 2WV3A 1YNKH 5C0DB 5D2LE 4DN4L 2Q6WB 2Q20A 4AM0B 4WO4B 1G84A 1J8HD 3ZE1E 1EUUA 1URLA 4KU1A 4GSDL 2IPTH 4NZRL 5DFVC 4XWOC 3VFMA 3U6RA 1HIMH 5HYSA 5ICZB 5MEOA 2HTKC 4HKXA 4Q9BA 5C0CD 1NFIB 1MCWM 1T03H 5ABDE 5C8JB 3NH7L 1MY7A 4BH8A 4X80L 2YD5A 4ZFFA 2AEPL 4G6ML 1A3RH 1FYTA 1KTKE 4OZGA 5DMJB 3RL2B 2I5YH 4KMLB 2DTSA 1FL6A 1LILA 3MXWH 2VLJA 2DQIH 2GSIB 4GS7C 4M6OL 3T4AB 4KK5D 4G5ZH 4JO2H 3WJLA 4WVRA 2P49B 3HAEH 4V2CB 4R97B 3LCYA 3MV01 5JIKA 2A9NL 2CKBA 1B6UA 1IGJA 4KMQA 2ZUTA 3T77B 4NBYB 3VMNA 1EO8H 4WUKH 4G3YL 5JW4M 1YPZA 1QSFD 1MLCB 3GUTA 4Z8FH 4WV1C 1V5JA 4ZUSB 3V7AE 4B7IA 4J3UA 1MHCA 3IJHA 3LS5L 1KGCD 3IU3B 3PHSA 5FK9B 3NBNA 1C08B 1EEZB 4NJAL 2V2TA 5HTSA 2X9WA 4PG2C 5D72H 2PXYD 3I02A 5FYJU 4U6YB 4GAYB 4IRSA 5HHOD 4NUJB 4IJ3B 1QSZA 4QOKE 2EICA 5L7XH 2V2WA 5D2LA 3LQZA 3FJTA 3C08L 2BP3A 3QAZC 1HHKB 5DFWH 4HULB 4FQ1H 4KJWD 3C60B 1ZT7A 2EDJA 4YFDB 3GKZA 4JLRA 1DVFC 4OB5H 4PUBL 3DUUB 3BP4A 4L4TB 4PRID 4F8QA 3D85D 3STZB 2VLRD 4KI5C 2CH8A 2BFVH 5FB8A 1JPGB 3ZO0A 1YMHB 4AH2A 5HD8D 1U58A 4X6CE 5TE7L 1D9KD 3QQ9C 2BSSB 4OLXL 3GMRB 1CT8B 1TMCB 3ARBA 2VQ1A 1KV3A 1PEZA 4KTDL 4JM2A 3QDAA 4XPAL 3EJYC 4K8RH 4XPGL 3D1MC 4M1CD 3CH8A 3GBLA 2AXGA 1E0OB 5JOPE 2CO7B 1NGZA 3QIUD 3CFBB 4GBXB 2XZZA 1A4JB 2VLME 1N4XH 1UJ3B 3PDGA 2UWEE 4P2QE 1P7QD 2ZCLH 4Y19E 1GGYA 1RY7B 4JFOA 4Z7NF 3V8CA 1BD2B 2XZCL 3SKJL 4M00A 15C8L 4H8WH 1K4CA 1ADQH 4N1HB 1QA9B 2QQLL 5GJSL 3TZVC 2NYYC 2VDPH 4QOKA 1K9TA 4I3RL 4LLYB 3RVUD 4JZOB 3LN5B 2PYFB 3DXAE 4DQOL 5H94B 2P8MB 2JKXA 5D4QA 2DTMH 2XWJB 5DJXA 1AHWB 1HXMA 1K85A 4WFEE 2BSED 2EDBA 4YHPB 4OF0A 3TT1L 4OZ4B 2NQCA 1HEZA 4X6CA 1BGXL 5DD1L 3SDYH 4FZ8L 1CR9H 4LSUL 2XIDA 3OKEA 3DO7A 5F7YC 2D7QA 4Y2DA 4F3FA 1X7QB 3FKUS 5FF6B 3T0VA 3ECBA 5C0JA 5FKAA 4CL7A 1MFDL 3BHBB 5KVMC 4XNMA 5D93B 2VB5A 5I76A 5C0AB 3EAKA 3PE9A 4JREB 3WFDL 2IJ0C 2C3GA 5F88A 2AV7A 5IVZB 5H2BA 4NFCA 2UWEA 4P2QA 4Y19A 3N1QC 1NMAH 4ZS6C 3OR6A 1CVSC 4UB0L 5L2JB 5BVPH 1NPUA 4H1LG 3O3DB 4BH7A 1YECL 5GSVA 4S1RL 1BOGB 5F7DB 4A6YA 1G0DA 3NVQA 5EUKA 1D6VL 1LEGB 3QULB 1ZA6B 4ODHL 1VEOA 1F42A 1IM9A 5AZ2L 1G7JA 2GY7B 4XC1H 1BBJA 4G7VL 4PY8I 3SKOA 1MFBH 5CEYB 5L6YH 3UYRL 5I17A 3HZVB 4P57A 4K71C 1VDGA 1FORH 3DXAA 3DVNA 3SY0A 5FCUL 2Q76A 1G1CA 5C6TL 4WHCA 4Z18A 3PP4H 1CFVL 5DMKB 5IK3A 2KDGA 4H88L 4BQBA 3PHOA 3L3GA 5FYJE 1SJHB 3AXLB 1JGUL 1U8PA 12E8L 2DLGA 3MBEA 2IGFL 5I1IL 5DJ8A 3TYGL 4PGJA 2C1PB 5ID1B 3MUJA 2OLDA 4FHBD 1DBMH 1MH5A 4ENED 2E7LA 2Q7YB 3RUGE 3V5HA 1A1OA 4LVEA 4JDVB 4HJ0D 3BESR 2PR4H 4LBEA 4RAVB 3RIAK 4CU7A 1WISA 1XGTB 4Q6IC 5DC9B 1E4XL 3GSUB 5I8KL 3TA3C 4NHUB 2JCCF 3MACL 4KY1L 1JZ3A 2A73B 4XVJH 2BRRH 3OJ2C 4I3SH 1T1XA 1KYOJ 3O3EB 3UC0H 5HHMB 3D9AL 1J1XH 5F1IB 1WC7A 1Y0LA 1LO3L 5GGSB 2QQQA 3SQOH 4X4XA 2DWEB 3DSFL 3WXVH 5IBLC 1GHFH 3LD8C 2CO6B 1RJYB 5ISZD 1TQBB 1V05A 2PCPA 1JTTA 1T3FB 2M2DA 3QO0A 2R56H 4DUVA 3FRPA 3O6LH 3P77B 2ZUSA 4UTAL 4MWFB 5D6DA 5DVMA 1ORQB 3SE3C 1MRCH 2H32H 3P9LB 4OD3L 4XH2B 3UTTD 1W0WB 3DX6B 5B4MC 4M1DH 3MV11 4HC1L 4NQEE 4HAGA 4YEEA 5EULV 1Q9WB 3LB6D 4FXGB 3C09C 4QRUB 1OAKH 3MCKA 4J3TA 1BX2A 4GW1B 3GIZL 4QXGL 5E2VL 1DQJA 2ZG2A 1QVOA 1WZLA 1FZMB 4GG8B 3RUGA 4CJ1A 3CGTA 4QHMB 1YEFH 5E7FA 1YMMB 1IAKA 3F8UB 3WFCL 3H7BB 4CMHC 1MAKA 4EN3A 5BMFH 3L3IB 4OZGF 2BDNL 1DBKH 1BLNB 4PRPD 1RJLA 2QADC 1HSAA 4WUUB 5A16B 3MV7D 4I0PD 2YKLL 4C56B 4U6XA 4TNVK 3VWKD 3EFFA 4XVSL 2ZCKL 4PJ5D 4U0RC 5CIPA 5FECA 3RX8A 3SKMA 4J4PD 3TWCL 4ZXBB 3LKSB 5C0IA 2VAAA 4HIEB 3BX7C 3HZYA 1NL0H 1YPZF 4HEPG 5KSBE 4FXKA 5D2NB 4B50A 1QKZL 1YEHH 4QHUA 4I48A 5IMKB 2D0GA 2DIBA 1CFSA 4LLVB 1BEYH 4HKJB 2EC8A 3C6LD 4QTIL 4JKPH 4X4YA 4NQEA 4AK1A 5F3BB 2UYLB 2M26A 4EI5A 3KPNB 5C09E 3QXDB 5T1MB 3K7UA 4BUGA 4TUKL 4QXUL 1BJ1H 5CMAA 2VSDA 3T4YB 1IC4L 5D2LF 1ZGLA 1CIDA 4IDJL 3L7EB 5E8PB 1GYAA 3F5WB 5IHZA 4P4KD 5T3XD 1OPGL 1J87A 2DLIA 1NANI 4TUOB 3GSXB 3HC4L 3RTQA 3GSWA 4JY4A 3PUCA 5KW9L 1Z0MA 4KKAC 1XCTB 4DZBA 3TBVA 3L3DA 4U4BA 5HDQL 3VDAA 1DEEB 3WHXB 2RCSH 4F8TA 1T5WA 4TRPL 1SMAA 3NFPA 5ADPL 4N68A 1FN4A 1N5AA 3OG6B 1JJUA 1UEMA 2Z93B 1HH6B 2WQRA 3QA3B 3QUZC 1B88A 4I0KA 3B9KB 4JM2F 5IVXE 1UB6B 5JW4N 4HMCA 4WW1A 4DTGH 4NO0B 2FRGP 2HRLA 1Z3GH 2ADGB 1ZE3C 5E8EA 5KSBA 5DA4A 5F7NC 1EFXD 1R3HB 1OAQL 2CLZB 1QHPA 4KDVA 3ARDA 3I50L 4FQIH 2J1KA 3K2UH 5FM5O 1JTOA 5AG9A 5C09A 4QRRD 2VERN 4XBEH 1AO7B 1KJ2A 4ODUA 2NY0B 4D9LH 2FZ3B 2DAVA 3DX7B 5C08A 3TBYA 4JFXA 2WK2A 3BPOC 4BK4A 2A6JB 4JN2B 1P69B 4LVNB 5F9JA 1WF5A 1QFOA 4Z7VE 5KZCB 1GH7A 5L0QB 2EDLA 2CKBL 1ERNA 1H3PL 3RU8H 2QV2A 4NJ9L 1I1YA 4KDTC 3TIDA 5JO5A 1F6FB 1IJ9A 1I3RA 3LKRA 5JUEH 1Q94B 4UILH 1MJ7H 5T5NF 5IGXL 2E7MA 4X6CF 2OXHA 1W72H 3KDMA 3KLDA 4LSRL 3CX2A 1SVCP 3LKQA 2AJSH 5T1LD 4Y5XA 4DFHA 3BRDA 1G0XA 2VXUH 2RFXB 4HIIA 1VGEL 5IVXA 1I7UA 5JQ6H 2PXYC 2VLKD 2DLTA 2ZNXA 2DYPD 2EDXA 4H1LH 3HI5L 5E8NA 4OLUH 2UWEF 3OL2A 4FP8L 2X09A 4UINH 4XNYL 35C8H 1OP5H 5KSAA 1HWGB 1I3UA 2A77H 3LPGA 4HH9B 4KJWC 2YD7A 4YDKL 2VR9A 1CS6A 1BQLL 5DUML 1KCVL 4NKOA 4UQ3A 4WO4D 5LAXA 5CJBA 3DRQA 2O61A 1DUZB 1YNLH 4S2SA 3FB5B 5D9SA 1U3HB 4TPRL 2QQNH 1NH6A 3EYFA 2YSSA 3JV4B 4Y4HA 5FO9B 5HD8C 4YGVA 1J12A 2VC2L 1IAII 5LBSL 4K9EL 4Z7VA 1ITCA 3QFDA 1W8NA 1XZ0A 3VXNB 1D9KC 5FGBC 4AIZB 4YC2B 5TDNA 5E5RB 1W2KT 4MXVF 5DR5L 4HX1A 3W39A 3QDGB 5EZOL 4EUPA 1BFVL 3RGVB 4M1CC 5L2KB 4YAQA 3Q6FA 5IB4A 1MHEB 1K2DB 5KVFH 4HUVA 4OSUH 3QIUC 4XBPB 3W0WE 3U7AA 3QUMA 1KIRA 2YA2A 1BFSA 4JO3H 2DQFA 2GUOA 3IETB 4ZFZA 2X1XR 4L3EE 1NSNH 1ZMYA 3BO8A 1EGJA 4PJFB 4I18B 1MRDH 1JRHI 1OQXA 1RZFH 3WN5A 4QY8A 1OSPL 2R0LL 1J1OL 3L5XL 1S7SA 5AYQA 3BDXA 1ZHKB 4WI4A 1N2RA 2OJZL 2X4OA 4DGIH 4GRLA 1CFNB 5LG1A 2HLFD 1QR1B 4OZHE 4O2EA 3INUH 4P2CG 5TFSL 1JGLL 2HLAB 4HK0B 3T2NH 5KSVA 4U1LA 5DWUH 4NRYA 1KLUB 3C60D 4P59L 1A9EB 2VH5H 5GS2H 3GBNH 4Q9RL 3CSBA 1B4JL 1IKFL 4L4TD 1CGSH 4YZFE 3MRBA 4YDJB 5D5MF 5E00B 3VMPA 4D9RE 1FIGL 3V4PH 1RMFH 3L1OL 4DEPB 3A6OA 1GPOL 3CX5J 3KJ6H 2UVFA 4MQSB 3V52L 4WGWB 4YHOH 4C54A 3QO1A 4F9PC 2X1OA 1N59A 4P9MH 5CCKH 1KPUB 3KVQA 2Q8AH 1DQTA 3A6BL 4R90H 4WWID 5DJYB 3RUGF 3U4EA 5DHVB 3SGEI 1JWMB 1MELA 4GQPH 3W0WA 2IQ9L 4A6YL 5E9DE 4LU5H 3M07A 3VXUA 1KIPB 5JW4R 4L3EA 3WCYA 2RBLA 3S88L 4GBXD 1H5BB 4OLZH 1FE8L 1WBXB 1PYWA 4LCIH 4DN3L 5AWNH 1BD2D 1J0JA 4WI7A 3FFDA 3DV4A 3QUXA 5KVDH 1DANU 5IJVA 2DI9A 5LXGL 4OZHA 3O0RH 1KXTB 3SE9L 2ARWA 4JZNB 3LKPB 3GK8L 3VXQA 4YFLI 3M17A 3KPSE 4H20H 5HVFB 2WWKT 1XCQB 5DJ2B 2DWDB 2ZUXA 4XNZC 1AGCB 4U1HA 2NX5E 2WUCH 3BH8A 4ENEC 5A3ID 2WIIA 3GMPA 2Y23A 1UCBL 1TVHA 1X5IA 4HJ0C 2A9ML 2DJUA 3SEPA 5DC0A 3ARSA 5K9JH 5E99H 1NLBH 2DRUA 1FNHA 2EXWD 3W11D 2CXGA 5D7SL 5FUZL 4HZLB 1I1CA 3TV3L 3ARGA 4GW4A 3IDMB 1P4LB 1FFPA 2PN5A 3CVHH 2AAVA 5E9DA 3VFSA 1U8HA 5C0AD 3QRFM 2YD8A 3ZDYE 3WS6A 2DQCH 2C1OA 3QWOA 4QRTB 1UM6H 4RMVA 5AZEL 1F58H 3MOBL 1FG2B 5EG6C 2JIXB 4X9IA 1OAZH 3ZDXF 4NDMA 3QDJB 3FO9B 2FEEL 1MWAH 2ATPA 2P8LA 1JFQH 3EYUL 4NM8L 2VZVA 4YHNB 5FYJL 2BOBB 4L9LB 3LB6C 4KVCH 3MRGB 1S7VB 4MJ5B 1FFRA 1IL1A 2YC1A 2ZNWA 3DBXA 3KPSA 4BZYA 5KSBF 4JDZB 1OP5K 5J56B 4L5FH 4WTZG 4LK4A 3UBXA 1R3LB 2NX5A 5KG9A 4J3SA 1JYXA 1MIEL 2ITDA 2Q86A 5E94A 1NGYA 4LCYA 1FZOB 4F2MA 2EEBA 4UDUA 4YE4L 3F7QA 3OKLB 1M1SA 1FG9C 4N90D 2D9CA 1P2CA 3O2DA 3BZDA 3N1MC 1DE4B 1G7HB 1KB5A 2VIRA 3I75B 4ZOEA 3O3UN 4GFTB 1TVBA 3QIWA 4FQXA 4U49A 4U7SA 4I0PC 4YNYB 3D25A 4BKLA 3VWKC 2VL5A 1F2QA 4APQA 1A6VH 1N64H 3KPMB 3MQIA 5DD6A 4L8SA 3S36L 2DF3A 2D4FA 3ZL4L 4J4PC 4E0RB 3CFEB 4ONHA 4KMTL 1NEUA 4JO4L 3W2DH 4JPWL 5TJWK 3PHQB 4EDWL 4JGMA 3RBGA 1ACYL 2BOCB 1L0XA 5HHMD 3T0AA 1VEPA 2N1KA 3AROA 1U8KB 2EYTB 1FO0A 5IB5B 3R1GL 2R69L 1QEWB 3R4DA 5I66A 4X5LA 1E6JL 5FUCE 2Q87A 4YHML 3WIHH 2B0SL 4PJCF 3E1F1 5JXEA 5BW7C 1EVTC 1TCRA 2R4SH 3ARXA 1FL3B 3C6LC 5IVXF 3RWDA 2R2BA 1FRGL 4R7NB 1M7IB 3VD9A 2CRYA 2FD6H 4HPYL 4XP1L 3ZKND 2BJMH 4L3CA 4X6EA 3QXVA 4Z7WE 1HQ4A 3KWWB 3MLUH 3OV6A 5E1HB 4P4KC 3DLQR 3CXDL 1S9XB 3ZHDA 5HVHC 1T2JA 1R3IL 6CGTA 4XP4L 3G5YA 5FGCE 4LASL 4P46A 4PV9B 4MDJA 3OAUH 4Y5VC 3GJEB 2XZQH 3UPRB 4RMRA 3K8LA 3MRIB 3NFNB 5CBEA 2HFEB 3GBMH 4NYLA 4PJXE 3F58H 4ESKA 4K7PH 1YMMD 1KJMB 2D0FA 4K3JH 3QH3A 3RWCA 4M7ZC 3GO1H 2BVTA 1KNOB 4Z7VF 5IMMB 1JNLL 4UAOB 1QLEH 4IOIB 4WUUD 2F54E 4C56D 5EFIB 3P3YA 1G7QA 3GFUA 2VJXA 1JIBA 4TSBL 2MCPH 4ZXBD 2XN9B 3BPNB 1ZKAA 1QLRA 3WNKA 5E2JA 1D5BA 1VGKA 3BP7B 2W0FB 1R5WB 3BN9D 5KVGL 2QSQA 1KJ2L 3GHBL 4K3GA 3X11A 7FABL 5C9JA 4ZFOB 2JJVA 4BZ1L 4K94C 1YEJL 5JLZB 1I9IL 2ID5A 1GJIA 1HDMB 5E4EC 4M8QA 4WHYG 1R5IB 4YBHA 3GHEL 4Z7WA 4XMLL 2IMNA 1RZKL 2EE9A 2X1PA 2WIMA 1R3JB 3QXAB 1Q9LA 4JRYE 4PB9H 4XVUD 3ZYOA 3TLRA 4HDIA 1EA9C 3UJJH 5GS0H 3VRIB 3LPWA 3HE6A 2ZKHL 4UT9H 1Z9LA 1X3DA 5MEQA 1TXKA 3IVKA 5J12C 3U46B 4LLWA 5CBAA 3O45B 5EIIB 4PJXA 5T3ZD 4F7CB 4IMKA 3O3BB 2J4WL 5GRZA 2UZIH 3FT2B 4HIHB 5BV7B 5HHNA 4HFWA 5LGJA 2OMBA 4W6WB 5TF1H 1OARH 2F54A 4PRDA 2BVQB 1RUML 5HJ3B 5E6YA 1EO7A 1U8MA 1RURL 5DFTA 5E6ZA 5AYUL 5CHNA 3VFMB 5HYSB 3U6RB 2VDMH 4NN5C 4HKXB 4WHDA 4I4WA 4PJIE 2CUHA 3B9KD 4WFHE 3UPCA 1OLZA 2XPGA 4X7SH 4KK9D 5FYLH 1KELL 5FCSH 2FEDD 4ZFFB 4M6AA 3RHWK 1FYTB 4NO0D 4OZGB 3BXNB 5GJTL 1MCOL 4DOHB 3EYOA 1FL6B 3L95A 1EHLL 2VLJB 4WO4C 3GJFH 3RNQA 5F9WB 2VRAA 1FFOA 5DZOA 3B4NA 3P73A 2AXJA 3JWDC 2C7UB 1FZKA 5I8CA 4K7PX 1JHKH 3VG9B 3H9YA 2DDQL 4OZHF 1AO7D 4JRYA 1IGJB 2VXSL 3F7YA 2NY0D 1FLRL 4NT6A 4OUOA 1H0DA 1GOGA 1WGOA 2YD6A 3WKMH 4HAFA 3DYOA 1WTGT 3GUTB 2VZ1A 1MHCB 4Y1AE 3IJHB 3KLHC 4P5TB 3QUML 5KZCD 3GSQA 4OLYH 4YZFF 3B6SA 5FKPA 3I02B 4NQSA 2OR9L 3MC0A 3OKDA 4R97C 2V17L 4IRSB 4MJ6A 4RAUA 2PTUA 4ZS7H 4RGMB 5D2LB 2DM2A 3HPLA 3LQZB 1T7VA 3MA9H 1JPSH 5F72S 2F5BL 1MCFA 1UZ8B 1ZT7B 2FGWH 4MXWH 4JLRB 3BP4B 3NAAH 4PJIA 4CJ0A 2XA8L 1NCCH 5FB8B 4KAQL 5DT1L 5I1GH 2BVUA 5F7MC 1XR9A 2B1AH 4B5EA 2HLFC 1AXSB 4JPVL 5FOBA 4Z7UF 2VDNL 4G6AD 4IJ3C 5MHSD 4EIGB 5HXMA 2YHGA 4F57H 2M1KA 1OD7A 2FCBA 1PZ5B 4WI6A 1P1ZA 3C60C 4UIKL 1S5IL 3ARBB 4Z95H 2VQ1B 4Z76A 3EOTL 3G5ZA 2DMKA 4KJQD 4NQDE 1DBJH 3MOAL 3L3HA 1FC1A 4ZO9A 1U3HD 2AXGB 5CGMA 4MLIA 4JG0H 3UYOD 3V6FA 3QUYA 4OCRL 5JW3H 4JANA 3H9ZA 4XP6L 4YHZL 4JQVA 4Y1AA 4OCWH 2OTPA 3BVNB 4B0MM 1P7KA 1C5CH 1I1AB 1UB5A 5FYKU 4XXDA 4ELKB 2Q8BH 3V6OE 2O93L 5IBTL 4AENB 3QDGD 4PLKD 3RGVD 3O6MH 4QOKB 5L2KD 1RQ5A 5BO1H 3C8KA 4PG9A 3PNWA 1RJZB 3S3PA 4LNVA 4GG6E 4GBXC 1RUPL 1UJ3C 4OD1L 4OGXL 1NCAH 2YS4A 3BQUA 3EOYG 4FFZH 1U91B 1WIOA 3V9FA 4ZNEE 4FFYH 1NBYA 1GGBL 2XXMB 1U8LA 2LTQB 1IGYA 5DJXB 4PV8A 1IQWL 1HXMB 3IFNL 3ZDYF 2YXMA 4BQ9A 1IFHH 4UT6L 4JO1H 1HEZB 4X6CB 1DZBA 2W9DH 3MJGX 3U4BL 3OKEB 2DOCA 3DO7B 3D39E 2CK2A 1NCBH 5EZJA 4Y2DB 4F3FB 3LMJL 4RFEA 4YHIA 2P5EE 3LVEA 3ECBB 5C0JB 3TNNB 1KCSL 4NQDA 3U7WL 1NCDH 5A3IC 1DL7L 4NWTH 4LP4A 4XNMB 4IRJB 4HF5L 4POZC 1DQDL 1AHWC 2AV7B 4FQCH 3BPLB 1BZ9A 5H2BB 1MFCL 1JNJA 2H32A 3K4ZA 1JZ2A 4U1KB 4P2QB 2BVOA 4OAWA 1S7XB 3UYPA 2EXWC 3OR6B 1FV1B 4BH7B 3W11C 5B39A 3T0EA 2EKJA 3O4LE 3VFOB 2FO4A 2YA1A 3V6OA 2IEPA 5IMOB 1MREL 4KROB 3H3PL 1IM9B 5D93C 5L9DH 5BZWA 5AAMA 3SKOB 1RV6X 3D0VA 2ERJB 2VUOA 1SYVA 5I17B 4GG6A 4P57B 2GITA 3DXAB 1FNLA 4Q7DA 5HHVH 3P9MA 3DVNB 3SY0B 2Q76B 4BM7A 4YGAB 3Q1SH 4MAYA 4ZNEA 4WWKA 5HI3D 3FQTA 4OIIL 1C5BL 1MI5B 3L3GB 2R29L 3I85A 1U8PB 3CPLA 3MBEB 2O5YL 5HY9A 1MH5B 3RBSA 3V5HB 4PJEE 3GMMA 4Y4KA 3HRZB 4N5UA 1QO3A 3D39A 4ZPTB 4LSSL 2P44B 1FFNA 1KJVA 5IFJA 1RULL 2P5EA 1X5GA 1PKQB 2VE6B 5TGBA 1KB5L 2H9GA 3BIKA 1T1XB 5I1CH 5JMOC 3OTTA 3UTZB 1DFBL 2NY5C 2V5YA 1UQSB 3ALWA 1WC7B 2MFNA 3DYPA 4UU9A 4Z7WF 4X4XB 4OKVA 1T4KA 3KYAA 3C5SA 4GW5B 4ONFL 3U36A 4O58H 1X5AA 2PCPB 3O4LA 3F65A 5CEXB 2HYMA 3MGOA 2NY3B 3LN4B 1YEIL 2EH7H 1AJ7L 1INDH 2OR8A 5CLWA 4PJXF 3VXRE 3DIFA 3OB0H 1CLYL 2WNGA 5DRZA 4GJTB 2X4SA 4HWBH 5EUOE 3KR3L 3E6FA 2IF7A 4TTDD 5JXAL 1BX2B 5FYKE 5E08H 1SJEB 2B1HL 1TQBC 1IT9L 3MODH 5D7LE 1DQJB 3VXMB 2JIXD 1JGDA 4NCC2 5CJ8A 2ADFL 3TO4A 3RUGB 1W8OA 3QDJD 4PJEA 2E9BA 1JGEB 2V6HA 4X9GA 3OAYK 4CDHA 3ZKNC 4F37K 1JE6A 1IAKB 3ZKQD 5EU4B 3STLA 1UZ6F 1YNKL 1BZQK 5C3TA 2EE2A 5TPWH 4EN3B 1KJ3H 1ZTXH 4RMWA 4RGNE 5EU3A 1ZS8A 2IPTL 3MREB 1DUYB 1HSAB 1HIML 3C9NA 1A3LH 5F71A 4U6XB 2XOTA 1EEYA 3G5VA 1T03L 5CIPB 5ENWA 5ITFA 1WBYA 3SKMB 4P5MA 4YO0B 32C2A 2VAAB 1NBVH 1A3RL 3F7VA 5GGTH 5D6CB 4NNXB 4JGJA 2I5YL 2X89A 5CJOH 5JA9A 3ET9F 3MXWL 3HZYB 3MYJA 1NEZG 2DQIL 3BUYA 4MMXC 1JZ4A 1HN1A 4IIQA 4QHUB 4G5ZL 3T8XA 4X98A 2Y07H 4JO2L 5DUBB 1R5VA 1JZ7A 1ETZA 4HS8H 1U0QA 3VWJA 2DLFH 3VXRA 3TNMB 1NAKH 4FFVD 4X4YB 3X3GH 3ZT7A 3BYTA 4ZXBC 1ZV5A 1EO8L 4EI5B 4WUKL 1FCGA 5EUOA 4Z8FL 2IAMA 2VKWA 3QG7H 3BN9C 5D7LA 1ZGLB 5CUSH 4KWUA 3M45A 3WL9B 3EFDH 5D2NC 5IHZB 1O7SA 1W72A 3O3AA 5D72L 2OTUB 4EVNA 2DL2A 3RTQB 3GSWB 3L5HA 3MROB 4PJIF 3HNSH 2WANA 4JY4B 3DX8B 1KXVC 2UUDH 5L7XL 3KS0H 2IANE 4DZBB 1LNUA 1LO5A 4FQ1L 4GXUM 4XVUC 2PTTA 4M1GH 4OB5L 1T5WB 3NFPB 4LMQE 5LJYH 4HUNB 1T66C 2W9EH 1CQKA 1NCNA 2BFVL 2VL4A 3NIFF 4OQTH 2G75B 3QHZH 2CRZA 3BZFB 3LHPH 4GRWB 1FHGA 2Z8WC 4NZTH 2BERA 3LV3A 2HKHH 5H37G 1WLHA 4LIQH 5E8EB 5KSBB 2P7TA 3EDDA 4XX1G 3VD3A 3SCMA 4K8RL 4N1CA 3ARDB 3AGVA 3L3KA 4JFZH 3N1FC 1XGPA 3B8YA 5I9QB 3RL1A 5C09B 3B9KC 4E42B 3UEZA 5CEZD 2UY7A 1XF5A 1P53A 5C71A 1MAJA 1N4XL 4KK9C 4ODUB 1MCCA 2ZCLL 2FEDC 5C08B 2XQYG 4IM8A 4JFXB 3BZ4B 1WWCA 2XN9D 3O8XB 3G5XA 4ZSOE 1VFMA 3UP1A 5F9JB 2VSCA 4ORGA 4H8WL 4YBLB 2FEEI 1ADQL 4OIAA 1ZSDB 1T21A 4IHOB 2VDPL 2ZUYA 1I1YB 3TIDB 5JO5B 2IANA 3LKRB 4L1HA 1Q1JL 5F3HB 1QG3A 2NY0C 1G6RH 3I6LE 2IH1B 1U8QB 1X6NA 4MNGE 3KDMB 5JPMA 2DTML 4J8RA 3LKQB 3UJTH 4LVNC 3FN0H 5EN2A 1SJVA 1OLLA 4Y5XB 2X4RA 5L0QC 4GKSA 4HIIB 1DR9A 5IVXB 1I7UB 3RKDD 2ICWA 1J8KA 3TYFB 1F6AA 3MLSH 4JRXE 4Z0XA 3KHQA 3SDYL 5E8NB 1A4KB 3K4DA 1NAMB 2R0WH 3QQNA 3ZTNH 5B38G 3VFTA 3WO4B 5KOVC 4JVWA 3PWPE 1ZT1B 2BNQE 2B20A 3EYSH 4XCNA 4HQQH 4WCYH 3D48R 1NUGA 4NKOB 4UQ3B 5LAXB 5LGHH 4J2XA 2E9JA 3DRQB 2O61B 3MRFA 4S2SB 2Z4QB 1EV2E 1HZHH 2W65A 3QYCA 3OSKA 4DUXA 3EYFB 1MRFH 1NMAL 2YSSB 4Y4HB 4XMKH 4GG6F 2F5AH 5BVPL 4G6AC 4ZSOA 4JVUA 2VZSA 4Z7VB 3QJFA 4R7DA 3QFDB 4UNVA 2FJHA 1XZ0B 4LCWE 1FYTD 5BVJA 5EOQH 5HBBA 4CNIA 1S3KH 4XC1L 2APWA 2VLJD 4X99A 4HX1B 3W39B 1MFBL 4KJQC 5L6YL 2F8XC 1MFEH 1CTOA 2H41A 1FORL 4YAQB 5IB4B 1U3HC 5DMGD 3BP6A 4MNGA 3PP4L 4X4ME 3FMGH 2AJYH 2DQFB 2GUOB 4ZFZB 3CAFA 3BO8B 5LCVH 1Z9MA 4HSQA 5IQ9A 1DBML 5KANG 1WFUA 2OMNA 4YC2C 3ZHLA 1CXFA 4JRXA 2PR4L 3WN5B 4P5TD 3QNYB 4QY8B 3WEXB 4PLKC 1ZHLB 5GSRA 3RGVC 4MZ2A 1N2RB 2X4OB 3V95A 4K7FA 4WTXA 4GRLB 2DMBA 4XVJL 3T65A 4IRSD 4O2EB 2YPLE 2BRRL 4I3SL 5J1TC 3MRDA 2OP4H 1GGTA 2KBGA 5F96H 3UC0L 4G9DA 3BEVA 2Z92A 5IQ7H 5KSVB 1J1XL 4I18C 4NUGH 2X2YA 4PRHE 5A40E 2ITCA 3SQOL 3I2CH 3FB6A 3MRBB 3NGBB 3THML 3WXVL 1GHFL 3CVHA 4TOYH 5FO7B 3NZHH 3IU4H 4QRQA 1XR8A 4LCWA 2R56L 2EDYA 3O6LL 4XT1C 4NO5B 5DGRA 1JPFA 5EWIH 1N59B 1MRCL 3CFDA 2LU4A 5I16B 4ELMB 3N50A 4M1DL 3U4EB 4PJEF 2EDEA 3ARBD 4K23H 1F8TH 5BQ7B 5FDWA 1OAKL 1RZJH 2AJ3A 4X4MA 3W0WB 1KT2A 3S37H 3HLAA 3VXUB 2AQ2A 4OZIB 4L3EB 4JFFE 3WSQH 4DEPC 3E2HB 1AI1H 5IMLA 3PV7A 4TULH 3O9WB 1ODAA 1PYWB 1IE5A 4CBPA 4F9LC 5MEPA 4MZ3A 3RIFK 1YEFL 2C4XA 5GZOD 4O51A 1I1AD 2OK0H 3FFDB 3QUXB 2Z91A 5BMFL 3NCBB 5IJVB 2WW8A 1DBKL 3RDTA 2YPLA 3O2VH 3BOVA 4QOKD 4XI5D 5DO2D 3VXQB 5D96B 3M17B 4JEGB 4F7TA 3PP3K 1H5BC 4PB0H 5HI3C 2MNUA 1BZ7A 4PRHA 4RCAA 1TZHA 4U1HB 2JJTC 3BH8B 2ICWJ 1K4DA 2ZUUA 1AC6A 1OF2A 1TDQA 2WIIB 3QNXA 3GMPB 2ESVE 3VGFA 1TVHB 4QHNB 4WNQA 1NL0L 3OGCB 1YEHL 5E0QA 1WIPA 2EKSA 4RMQA 3S35H 1GCFA 1BEYL 3HG1B 4BZ2H 3I9GH 2X70B 4Y2DD 4ZPVA 3WIHA 4JKPL 2PW1A 2GEEA 3EO0A 2NXYB 2QL1A 3BW9A 3U7YH 3FQUA 1F13A 2YUXA 3VFSB 1U8HB 5EOTB 4IRJD 2NY7H 3T2PA 4YK4B 3QWOB 4WY7H 2VLMD 1XF3A 5HDLA 5FXCH 1TPXB 5IJKC 4P2QD 1FP5A 3DMMC 2R0ZH 2WLYA 4NDMB 4RQQB 2XY2A 2Y25A 2ATPB 2P8LB 5H37H 3QDHA 43C9A 4KROD 1IM9D 2RCSL 4AEFA 3KPSB 2YC1B 3QJHB 4TTDC 4RWHA 3DXAD 1RHFA 1LE5A 4XRCA 3SKNB 2NX5B 5K9QI 1QFWI 3LIZH 5IHBA 5E94B 2Q86B 2ESVA 4UDUB 1MI5D 5D1QA 4DTGL 3MBED 3HZKB 3OKNB 2CMRH 1M4KA 1Z3GL 3S37X 3LEYH 1F02I 5GHWH 2AEQH 4L9LC 3GSNB 1OWRM 3P4OA 4G8EA 2NY2B 2EEAA 2JJWA 5EZLA 1H15A 3QIWB 5FA3A 4ZG1A 4FQXB 3D25B 3ZT6A 5FYLE 4FQIL 4YDLB 3K2UL 3TH4T 3KYNA 4APQB 1B0RA 2FL5A 4JFPB 5DD6B 4XBEL 1VHPA 4LPUA 4PJ7F 5E5MA 4ONHB 1DLFH 4GXUN 1B90A 3KPLB 4D9LL 3AY4C 4O2FB 4ODSH 4Y16B 3RX5A 1I8LC 3VGAB 3ZKMD 4HK3J 1FO0B 4XPBH 2D31A 5I66B 4ERSH 3WLWD 4M03A 1CXHA 1IBGH 4HUUA 4I5BA 2OL3B 3RU8L 3O11A 4UOW1 3SDAB 1MY5A 1TCRB 1X5JA 2NY3D 4FFVC 4D3CH 3RWDB 2R2BB 4UILL 1MJ7L 2Y7QA 3UTPE 3OJMB 1W72L 4L3CB 4BFEA 4X6EB 2ZG3A 5ANMB 3DHMA 1HQ4B 2AJSL 3S35X 3QZWA 4GQ9H 5DEZA 1CXLA 3I6GA 5DDHB 5C0EB 2VXUL 2Y72A 2QBWA 1RJCA 5JQ6L 3G5YB 4P46B 1HHHA 4MDJB 1N0LA 4DCQA 4OLUL 2E27H 2YOCA 2RHEA 1DP0A 4LKXA 2X4PA 3NFSH 5CBEB 1EZVX 4UINL 5E6IB 35C8L 4NYLB 2A77L 4TVSa 4WU5A 1HHIA 3RWCB 4FQLH 1T20B 3H9SE 2X7LA 1LDSA 4K55A 3CFCH 4P3CH 4PBVC 4EN3D 1YNLL 2QQNL 3HTLX 1WAAF 1TZIB 3GJFA 4CMMA 3FB8A 4NCDA 1LEKA 2P1YA 3OHXA 1LO2H 5GS3A 1W0VA 1QLRB 1D5BB 4OD3H 3VI3E 1DSFH 1V3MA 3RY6C 1CVRA 5DRXB 5ICXA 4UAOC 4QGTA 3IF1A 3X11B 5KVFL 1YEDA 1IEAA 1I9RH 4CVXA 4OSUL 4GAJH 1FL5A 3SDDB 2VDLH 4X5XA 4I2XB 2V7NB 4M8QB 1J05A 4LLUB 4JO3L 4Z7WB 2X4QA 1NSNL 5HHPA 4EI5D 3BPNC 5F6HJ 1X5LA 4FFWD 3BEWB 4QCIA 1Q9LB 5DJ0A 4Z78A 3BMWA 1N5YH 5SWQA 1IEBA 2FATH 3ZMRA 1MRDL 4GRMA 2HFGH 2JK5A 1RZFL 4MJ2A 2X44D 3ESVF 3FO1A 4CGTA 3DV6A 1R3KA 2ZSVA 4OM1H 5IF0A 4LLWB 4HWEH 5CBAB 4DGIL 3RTQD 5IEHA 3INUL 4U1JA 2YR3A 3H9SA 2AQ3A 5HHNB 4HFWB 3CIQA 3T2NL 2Z8SA 4YDVA 5DWUL 3MLXH 3MLYH 5E2TH 3RHWF 1JF1A 2GCYA 2VH5L 3GBNL 4PRDB 3GNMH 3PWVA 1CGSL 1ZA3A 3FZUD 3RKDC 1NUNB 5CHNB 4Z9KB 1LO0H 2VTFA 5JW5A 3V4PL 4QEGA 1RMFL 1MJUH 3SPVA 3E6HB 3KJ6L 4M93B 4YHOL 4N0CD 2BSRA 4P9ML 5CCKL 3W82A 3QIBA 2Q8AL 5BV7C 4MNHA 1OOAA 1JZ5A 3L6FA 4R90L 3L95B 3V5KA 3T8XB 2JB6A 2W59A 1FFOB 2A0LD 2OSLA 3QPQD 3FT3B 3P73B 1MQ8A 4KJPD 2CIIA 4BELD 3ARDD 4JHAH 3AREA 4LU5L 1FZKB 5JPNA 5I8CB 4HUMB 5C09D 3V6ZA 1A7NH 4OLZL 1AD0A 2HVKB 1T89A 3F7YB 1A7QH 1ITBB 5C08D 4PR5B 4LCIL 5GGRY 1OW0A 3VGGA 2V5MA 5AWNL 1MF2H 1NKOA 2JJSA 3JUZA 3O8XD 4RRPA 4PJHE 4F7EA 5KOMC 4Y5YB 5C7XH 4HK3N 5KVDL 5FFLA 5F9WC 1JZ6A 2NY4B 3D3VE 3B6SB 5JDSA 3WJLC 3O0RL 1PGRB 1WV7T 5DMGC 3S8WA 3OKDB 3RKPA 1CTNA 3VG9C 3TCLA 3OG4B 1I3GH 4H20L 4MJ6B 1Q0XH 2BNUA 3WHE1 3OJDA 2B4CC 3HPLB 1LDPH 2WUCL 1O5DT 3OPZH 1RK1B 3L9RA 1F5WA 4OLVH 4P5TC 3MJ9H 5I1AA 5I18H 5K9JL 5E99L 1Q9KA 2X4TB 1NLBL 3CU7A 2AK1H 4HLZG 1GZPA 5FOBB 4IRSC 5CD5D 5C86A 4XP5H 4RGMC 1MHHA 3TF7C 2XWBA 2Y06H 3WLBA 3BH9A 2DICA 3CVHL 1UWXH 1P1ZB 1WT5C 1NGWA 4Z76B 3MRJA 4QRSB 4HG4J 2DQCL 3L3HB 1ZLUK 1UM6L 1U36A 1F58L 3CNKA 2GK0A 5SWSE 1PQZA 4Y4HD 1VESA 3QUYB 3V6FB 5IEKA 1OAZL 3OJVC 4KI5E 4JANB 4PJHA 3QT2A 3RY5A 5DHXB 1MWAL 3ROOB 2Q7NA 2YUZA 5DS8A 1JFQL 2ILLA 3CZFA 3D3VA 2CLRB 4XXDB 1L9NA 3ARBC 5JHLH 4KVCL 3RZWA 1P6AB 4Z7OE 1FNAA 3D18A 1U8NA 4EEEA 4KK8D 4WEUD 4XAWH 3C8KB 4L5FL 3PNWB 5L8LB 1UM4H 2A83B 2YXFA 3BGMA 1KPVA 4EI6A 3MNWA 4OGAD 3WO3B 3BQUB 2ORBH 1NBYB 3OBAA 2OI9B 4XHJD 1BF2A 4K94H 1I1AC 1YYLH 3QQ3A 1IGYB 2LU7A 4PV8B 2J3SA 5IB1B 4AT6A 2RGSA 4CKVX 5HHQB 1F6LL 1SY6H 2R15A 2AKRB 1Z5LA 4HKBA 4XI5C 5CWSB 5DO2C 5IIEB 3PXJA 4LLQB 1DEDA 4GRLD 1A6VL 1N64L 1QLFA 1BWMA 2BXZA 2NCMA 4LRNH 1EHAA 5EZJB 5M94B 4RFEB 2FJGA 1QPXA 3W2DL 1Q9OA 1NDGA 2LTQC 1DVFA 3S34H 1A64A 5E2WH 2XKUA 5SWSA 3KPTA 1MCDA 2H32B 3WIHL 5DVNA 2BVOB 5IR1B 1CCZA 2F53E 4RIRB 5HYFA 1ZVSB 2FECL 5B39B 2R4SL 3T0EB 4HWBA 3RPKA 1S7WA 2FD6L 1VERA 3HI1A 2BJML 4TUJA 1KIQB 3O4OB 4IRJC 5BZWB 3BPLC 4NNPH 4NFBA 4L8DA 4PTUB 6FABH 3MLUL 5C3LD 3W0WD 3P9MB 3VXUD 4L3ED 5J4MA 4R4FH 3OAUL 4YLQT 4KZDL 2XZQL 3FQTB 2EYRA 2V7HA 5CILH 3O9WD 3CPLB 4D0DB 3JWDH 3GBML 3X14A 4KROC 3F58L 4MB3A 5HY9B 2A1WH 4K7PL 3CFJA 4K3JL 3GMMB 3GO1L 4Y4KB 3QUXD 4U6HA 2ERJC 1QO3B 3D39B 2X41A 1U8JA 4NOFA 5GGTA 5I19H 1Z0NA 1KJVB 4PGCA 5IFJB 1QLEL 4PRAA 2P5EB 3KAAA 2ED8A 3UZEA 2Z31A 4LSDA 1NFDE 5TGBB 4CN6A 4BFIA 2H9GB 3BIKB 4LIQE 1D5XA 1MOEA 2MCPL 3MBEC 3Q2CA 2E7LC 2R9HD 3PWUA 5IT2H 4HS3A 3F6IA 4UU9B 3NN8A 4OKVB 3BISA 3C5SB 1A6ZB 3MV9E 4MJIE 4LPYA 2F53A 4D9RD 2P8PB 5J1SC 4U3CA 2FR4B 3U36B 2AV1B 3S6CA 2YWZA 4DZ8B 3IS0X 3MGOB 3O6FA 1INEH 2WQ8A 3LEVH 2EIBA 5F89A 1ND0B 3BP5A 3HG1D 4YXKH 4RNRA 1TQCB 1WFOA 4FXLA 2AJXH 1BQUA 3ARGD 2NXYD 3C8HA 1A6TA 5B8CB 3DIFB 3ZKMC 4PB9L 3BKYH 3WLWC 3DYMA 3UJJL 5DRZB 5GS0L 2X4SB 2YD3A 4M7LH 5B21A 3E6FB 1UM5H 4UT9L 2ENSA 3IXAA 4RSVA 4D0CA 2EIDA 1FH5H 5L88H 1JGDB 1Y18A 2NY3C 3O6KH 4PRNA 3K3QA 4V1DB 5D6DC 3TO4B 4PJEB 4Q97A 2UZIL 5T1DH 3MUGA 3F12A 3NABH 2DN7A 3VI3F 2Z35B 3IGAB 5TF1L 2X4UA 1OARL 3C2AH 4ZYKA 3QXWA 5EU3B 3KPSD 4D8PA 2E7CA 1NFDA 3S5LA 1ZS8B 4UI2A 1BAFH 5GRWA 3C9NB 4MB5A 5ILTH 1UWXK 4LPVA 2ADJA 2R1XB 4LCUA 2NX5D 1ZHBB 1HKFA 1EEYB 4OFVA 3G5VB 1IAIM 5CGYD 5ENWB 5ITFB 3TJHD 4X7SL 5FYLL 4P5MB 3ZHKA 1VFAA 4AG4H 5A2JH 32C2B 2J88H 3MV9A 1E6OH 4MJIA 3F7VB 3F7RA 3HMXH 1BOYA 4I13B 5JORA 1ZLWK 2CIKA 4EN3C 4F58H 5CZVH 2NY2D 3QIWD 4IIQB 4HBCH 4FQXD 4XC3H 1ETZB 3GSVA 4H0HB 2AXFA 3VWJB 1JHKL 4APQD 4LDEB 2ARJA 3FOMA 3X12A 5EU7C 1PZUB 5IW1A 4NZDA 5EUOB 3WKML 5HGHA 2IAMB 1MCEA 4UMGA 5DJAB 1R6VA 2DQTH 5D7LB 1ES0A 1GGIH 5MENE 1WWBX 4Z0BH 3H3KA 3SGDH 4OLYL 1XF4A 3T0WA 4G8IA 5ESVA 3P4LA 4JPIB 3O3AB 3OKKA 4G6KH 3AU1A 3SDAD 4HLZH 2E8YA 3QWQB 2NR6C 4HKZA 4ZS7L 3KJ4B 1NEZB 3JWNC 4EI5C 4FFWC 3MA9L 1HWHB 3WFEH 1JPSL 1LNUB 1LO5B 5BJTA 1IC5H 2PTTB 3ARYA 3QBTB 2FGWL 4MXWL 3IJYA 4MNQE 1EAJA 3NAAL 5F93C 3VRJA 5KTEH 2DJSA 1NCCL 3ZT5A 5I1GL 4FQHA 3RTQC 4P46D 4R8WH 4WW2B 2B1AL 3DHJA 1OP3H 3TBSA 1UWEH 3GRWH 3H6JA 4F57L 2NZIA 5E6ID 3VXPA 5DJZA 5DK2B 1AIFA 2CDFA 3Q5OA 1BECA 3MXVH 4PJHF 4PY7A 3FT4A 5TDPA 4Z95L 4HFUH 1VB9A 3WYRA 3EYVA 3ZE2E 3FZUC 3SCMB 1DBJL 1IAMA 5L8KB 3L3KB 1XGPB 3RL1B 2EDQA 4JG0L 3Q6GH 1XF5B 5JW3L 4JDTH 2YRLA 4N0CC 2DI7A 1J5OH 4G42A 2R8SH 3TT3H 5IHLB 4G9FB 3REVA 2V9QA 4OCWL 5MENA 1NANH 2NY1B 3G5XB 3OQ3B 3MO1B 1C5CL 4BSVA 4ORGB 2Q8BL 2A0LC 3RWIA 1BQHA 1T21B 1WICA 4EDXA 4KJPC 1YJDC 1OAXH 2WINA 2NY5H 3O6ML 1J8HE 3ARDC 5BO1L 2I07A 2IANB 1MCWW 3BT2H 2VZTA 5EU6B 5EOCH 3SDDD 1NCAL 4FFZL 1N3NA 3IFOA 4E5XA 1JZ8A 1S8DA 1ROWA 2FX8H 3O8XC 4J8RB 4PLJD 4FFYL 1ULVA 1K8IA 3U2SB 1FZJB 5EN2B 2YD9A 3S3JA 4LPWA 1TJIH 4YBLC 3N1PC 5DHYA 5CD3A 2ICWB 1F6AB 1IFHL 4JE4B 4C4KO 4JO1L 1MJ8H 4Z0XB 4GMSH 2W9DL 3SQBA 4KI5F 1EXUA 1OGTA 1NCBL 4X5WB 5DEGA 3DPBA 3VFTB 1GAFH 4RA3A 1YY9D 4DVBB 4EZMA 1NCDL 4NWTL 1IILE 3QEUA 4XCNB 4P23B 3IKKA 2ICCA 4Y5XC 1QSFE 1YN7A 1RUAH 2F54D 4BQCA 4FQCL 4Z7OF 3MRFB 4PGZA 1F4XH 4XPTH 5IOPB 1CLZH 1T2QH 2W65B 4LHUA 1KN4H 3QUZA 4HW6A 4BFGA 5CD5C 4R26H 3VDBA 4CADA 1JWUA 3SO3B 3WO4C 2FJHB 5HHOE 4G6FB 1ZAGA 3I3EA 3G04A 3OB8A 5ADOH 4CNIB 1J8HA 5L9DL 1G7MA 4X99B 1RZ8A 1ZLSH 5FM4A 3EUUA 4B7LA 5HHVL 5I74B 3K74B 4KHTH 3BP6B 2XFXB 4ONGH 3JWOC 4Y4HC 4MNGB 1B3JA 3Q1SL 2K9UA 1AQDB 4NRXA 4RISH 4JRYD 1S7RA 3CXHJ 3PABA 2WUBH 1PDKA 1N6UA 5C0GA 2CDGA 3MMEA 5CJXC 5IQ9B 3VCLA 1I7ZA 4XX1E 4QXWA 1ZGLP 4CU6A 3RWHB 4JRXB 2PNDA 1UXSB 4R3SA 4KK8C 2NY4D 2DQJH 1PG7H 4KRPB 5GGSY 5HYQB 3X13A 2AGJH 4CW1A 2SEBA 4K7FB 3U1SH 2H26A 3T65B 3VG0H 4OGAC 4K3EH 5I1CL 2MOVA 4NQXA 4G9DB 1QSFA 4MA3B 3GDBA 4XHJC 1LK2B 2GJ6E 5FEBA 2ITCB 3IRZA 3AM8A 3WN5C 1IAIH 3FB6B 4WFHD 5DYOA 5I2IB 3CVHB 4O58L 4I77H 4EKXA 2PXYA 5A2KH 2KL6A 3QUKA