4F33B

Crystal structure of therapeutic antibody morab-009
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
220
Chain Sequence
EVQLQQSGPELEKPGASVKISCKASGYSFTGYTMNWVKQSHGKSLEWIGLITPYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVYFCARGGYDGRGFDYWGSGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MORAb-009 FAB light chain
publication title Recognition of mesothelin by the therapeutic antibody MORAb-009: structural and mechanistic insights.
pubmed doi rcsb
source organism Mus musculus
total genus 46
structure length 220
sequence length 220
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-05-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f33B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f33B02
4TN9A 3MFFB 1U41A 2AEQH 3MLVL 1FE8L 1HI6B 4M1CC 4QCIA 3IDJB 2QQKH 1UWXH 1QSZA 5CILL 1P84J 1WTGT 2AJXH 4IBLT 4APQC 3JV0A 1EO8L 5DI8B 3QWRD 2PR4L 5IEHA 2PXYC 4PJAA 4UDUA 4ELKA 3MOAL 2ZUUA 3AS2A 3QG7H 4NYLA 1C5DA 2IH1A 1BGXL 4TNVF 2CDEB 4D9RD 1I1YB 4HAFA 2BK8A 4EN3C 2EDRA 4LVOB 5HI4D 3GSWB 4OZFA 1T0NA 1CICD 1SEQH 3K80A 1N59A 4X9GA 5C0BA 3W39A 1WCBB 3X3GL 3BN3B 4JLRB 1EEQA 4HLZG 5TH2A 1D5IL 4H20H 3KPTA 4KAQH 3QHTC 2NXYB 2DLFH 1X6NA 2Z31B 4P46D 2BERA 3ARFA 3OKMB 4FQLH 4HPOH 1ZANL 2F8OA 4KVCH 1SJHB 3RUGA 4HF5H 1QFPA 1NFIA 5DSCA 4LIQH 5GGRY 1JWMA 3FFCB 2R2HB 3P0YL 5FDYA 5GRJH 4EBQH 1WBYA 5TE4H 3B3IA 4GBXA 3HRZA 1CQKA 1Z2KA 5IHLB 2XV6B 4QHNB 3UX9B 3LH2H 1GC1L 4Q6IB 1AH1A 4A6YB 2HFGL 1MRFH 2NTFB 3FB7A 1RJLA 2AP2A 5TDPA 1E4KC 2W0LA 4E42A 1LK3L 4KQ4H 4S1RH 1S7RB 3P9MA 4KTEL 3UZQA 1DBAL 2X89D 3NMEA 3QNYA 4JPKH 2XTJE 1M71B 3SE8H 4LHUA 3REWA 5KSBB 5ISZB 5E99L 1K6QH 5SWQB 1FFNB 3SBWA 2EEAA 3IDIA 5EZLB 2I5YL 5I1IL 1A5FH 3ARDB 1WFNA 5BO1H 5HYEA 3CDYA 3RVWC 1C16A 1PD6A 1NBQA 4MXVF 4OZFG 4Y5XA 1KT2A 3I6GB 1SM3L 4BELD 1G7IB 4JFHE 5JNYA 1LE9A 3GMQA 1NJ9A 5C0RL 1HWHB 4OZGF 2PW1A 5DLML 4XCEA 1FGVH 4XTRC 5D2NA 3MRIB 2C4FU 4L3EA 1OAZL 5T3ZL 3ETBF 4ZAKA 1A7NL 1JUFA 4X4YB 1XGPA 3BUTA 1NFDE 3FO9A 1DUYA 1F3RB 5HJ3A 5TF0A 4FTVD 4PRBB 3CPLA 2VWEE 5GSVA 5C0GB 1PSKL 4QRTA 1BECA 4WWKA 5DURB 2LQRA 3MJ7A 1OSZB 3H3KA 3C6LC 3M8OH 1RSFA 2P5WB 3NABH 4OZ4A 2UZIH 2VZTA 1JZ4A 1CZ8H 4R0LB 1HDMB 2WLYA 1AI1H 4HT1L 2HN7A 2DQEL 5D6CB 4P2RB 5ID1B 3L1OH 5F71A 2ICWI 4NQSA 5FA4A 2B4CC 1X5XA 3MLYL 5I1CL 2DQTL 2KZWA 1QQDA 3H9SA 1B4RA 2WIMA 4XGZB 2ZCHH 1PFCA 5C0NC 4PTTA 5DQ9A 4D3CH 4YNYB 2CDGB 1XF5B 1T1ZA 3SDDC 2YOCA 3S98A 4U1LA 5HPOA 4G3YL 2YPLD 4IOIA 4KK5C 1IAKA 2CLZB 4WDIA 4JQXA 1MCRA 1UKSA 2JCCE 1ERNA 2YBRB 3QEQA 4D0CB 2YZ1A 1MEXH 4GXVL 5JR1H 3VXQA 2HLFC 2ZCLH 3MRBB 4EQ3A 1YC8A 2OI9C 3VXRA 5D93B 3WEXA 5DJ8A 1KENH 5EU5B 1A0QH 2M26A 4OCXL 4RFEB 1ORQB 4WIQA 4OBSA 4J3XA 5FECA 2V9QA 4G6FD 4JFEE 3QCUL 3H9ZA 5DJ2B 1FZOB 4ZUSB 3DI2B 5C2BH 1OP3H 3SCMA 4U0RC 3OZ9L 1SY6H 3OAZK 4N9OB 3MLWL 4F58H 2XZCL 1UVQA 1CGXA 2RBLA 3ROOB 3BUYB 4PJXB 1DN0B 1QSED 2FO4B 3P4MB 2PCPA 1UWGL 4I18A 1ADQH 1CU4L 1RD6A 2PKDA 3EFDL 2QQQA 3MGTB 1KN4L 4PV9B 3KJ4C 4XXCA 2XWJB 4QTHB 4HGMA 3HAEA 4TSCL 1J9CT 4NUGL 2DM2A 3MACH 2Z8WC 3G5VA 2A6IA 5DMGD 4ZYKA 5B38A 3BVNA 4QOKA 3AS3A 1DBKL 1KPUB 1DUZB 5I1JL 4YDJB 3JTTA 3ZYIA 1JZ7A 5FUZH 1G7PB 1EJOL 3RVXC 1X7QB 4NQCB 2RGSA 4IRJB 3CFKB 1ZWIA 2UYLB 1G9NL 4QRRD 4AT6A 2VR9A 4MCZB 3U4EB 4K55A 1LO3L 5T33H 5CJ8A 3VXMD 4POZC 2WSKA 2P1YA 4GSDL 3ARZA 3O4LB 4PJEF 2X4PA 1F42A 5IVXE 4JFFB 5IFAH 3T04D 2LFGA 5C08A 1XIWC 3C5SA 3TBYA 3HE6C 1J1OH 1IGYA 2UUDK 3WFEL 4M7KL 3NA4A 2SEBB 3QXTA 4FZ8H 1B0GA 4OM1H 3BE1L 1LO0L 1J1PL 3QO1A 3M17B 4XNMB 4HKBB 1WAAA 2AVGA 3PWLB 1U8MA 4KUCF 4WHTA 4EN3A 3KYKH 1NGWA 1ND0B 4HUVB 2KDGA 4YDIL 3IDYC 3EYQC 1NSNL 1D6EB 2Y6SD 3TH3T 4Y19B 1CDHA 2X4UA 3PWVB 4HIIB 2DQHL 5DQJB 4OZHB 3MGOB 4UTAL 2NXZC 43CAB 1OB1A 4QRQB 5DWUL 1RURH 3DWTA 3EYFB 8FABB 2XIDA 5ALCL 2JJWA 2O61A 3HNSL 5IESL 5DXWA 5FXCH 2EXYD 5AAMA 5E8OA 1M05B 3G6JA 3S36L 5MEOA 5CHNA 1I7RB 4LKXB 4MA1B 1F58H 3LKOA 4J3VA 4CVXA 4M93B 1VFAA 4J23A 4G6JL 1NCTA 3VDAA 2YHGA 3LV3B 2A73B 4Z7QF 3CFDB 1E4KA 1BQHB 2OXHA 1S3KH 3QUZD 4TTDC 1J0JA 3H7BB 4L4TB 4BFIA 5EN2B 2R69H 1ZLUH 3CSYB 2MSPA 4TSAH 1BZ7B 2BMKA 4N8VA 3DARA 5SX5H 5IF0B 4XVUD 5GGSB 4Y1AD 5JLZA 4ZG1A 1XR9B 4WENB 2XRAH 2A0LC 3QHFL 5DEGA 3NFNA 5C0CE 3GSRB 4JZOA 2QV2A 4OSUH 1BQLL 1DJSA 1IC7L 3WHXB 5MP6L 3S4SA 1MHEB 4QF1B 3D85B 1BJ8A 2GY7B 3WN5B 1KEGL 1OARH 4G6ML 4G8EA 1A6VL 3OTTA 3PQYD 1RIHL 2ADFH 2GSIA 3D3VA 1OL0A 4FQ2L 1VB9A 4P4KD 5DVKA 1QR1B 1FL6A 4GW4B 2DICA 3WKNA 4S2SB 1NCUA 4L8CB 5KW9H 1HNFA 2C4XA 2DLTA 1C5BH 2DMKA 4GRLD 4HIJB 4LSQL 1YNTB 3RZCC 2DDQH 2DWEB 3DYMA 1ZGLB 4BA8A 4OKDA 5DMKA 4HK0B 1I8MA 4PRNB 2BHYA 3WL9B 4GAGH 4HMCA 1J0HA 3FT4B 2C9AA 5C6TL 3N06B 3MCLL 5FUOH 1JNNH 3NFPB 3MLUL 3V6FA 1R5WA 4EUPB 2Y07L 3T1FA 5EU4B 4M8VA 3T0XA 1S9WB 5ICZA 3MMEA 4NRXA 3RDTC 2V2TA 2XKNB 4JKPH 1UZ8A 5DGQA 3RVUC 5F89B 4HWBA 5L6YL 1FC1A 4QT5B 5HHMB 4XPBH 1I1AB 3LHPH 2O5XL 4UOJA 3RAJL 3VRLF 4C54A 4I8DA 4JY6A 4OLWH 1IFHH 1G0XA 3NFSH 4WFFD 7FABL 4RWHA 1EX0A 1LNUB 4GRWE 4BZYA 4ZXBA 2B0SL 4NNYB 3TESA 3LKNB 2XI9A 3B9DA 2R2BB 4L8BA 3QEGH 4QGYA 4HIEA 3T8XB 5D71H 5T3ZE 4ODVH 5JOFA 2VB5A 4HUXA 3WS3B 5T1MA 1EBPA 2VDQL 1S7QA 2E3VA 4KRMB 3NCFB 4NHUB 5HI4C 4WGVB 5F7DB 3PV7A 3U83A 4MXWL 4TULH 1EGJH 3QUKB 4ZFOB 3OKYA 4ZUVB 1TDQA 1RV6X 5JXED 3EO1A 5D1ZD 3EGSA 1ZHKA 4JHZA 4EIGB 5IBTL 2C7UA 2WUBL 1QLFB 5FAAA 4N0FA 2I27N 4P46C 2YUWA 5I17A 4OFYD 4UT7H 1DSFH 3VXTA 4DTGH 4ODHH 4G9DA 4F80A 4XNQB 2BNQD 3MXWL 4DZBA 5JDSA 3KPSA 2DYPD 2ZSWB 4Y4FD 5A1AA 1UEMA 3QZWB 4UV4H 3D39D 3ZKXC 3P0GB 3HHRB 5LGHH 4R7NA 2B4CL 1IT9H 5KS9A 3OPZL 3TBTB 1RZKC 2FNBA 4FQIL 4D8PA 5ID0A 4EVNA 3C6SB 3T1WA 2YUXA 2EYTB 1P4BH 1UB5A 4MB5A 2VN7A 1CXEA 3CFBA 4B5EA 4LSTL 3MRPB 1CVRA 4LLQB 2V17H 3KPOA 3FQUA 3DXAE 4Z7WE 5FUCE 5JPNA 2NY3B 4P9HC 4X98B 3U7WL 4K71B 1KTRL 4BFGA 1A4KA 3Q2CA 1Q0YH 1XGUA 3WFDH 5ERWA 3RX7A 1VPOH 1L9MA 1I7TA 1TVBB 2H2PC 2A83A 3ISWA 4S0SD 4X7TB 3KXFD 5HDBE 5LAXB 2D7OA 1XIWA 4WCYH 3V6OC 5GHWH 1HILB 4JG0L 1JWSB 3HE6A 1Z9OA 4DZ8B 4X80H 3F7YA 3CDGA 4FXGB 4GOSA 1DE4A 1EJ6A 4MYWB 4LLVB 1YUHA 4LMQE 3BSZH 5CS7A 2HTKD 2ZOLA 4NSKB 4WJ5B 1I8LC 1QACA 5EU6E 3WLWD 4L9DA 1U8KB 2NLJB 3OKNB 3FAWA 4HIXL 3FB5B 3U4BH 4CAGA 4LCWE 2NX5E 4GW5A 3QWOA 1IEAB 1ZT1B 4Z7VE 3L3OA 4JGUA 4M5YL 1FNLA 2EDKA 4WW1B 1ULVA 3DO7B 3VFVA 4PGEA 3QDJA 4HC1H 4GAJH 4WW2F 3DSFL 1U8LA 2APWA 3WUWA 5E5UB 2WAHA 4Y4KB 4QHKI 4JFPA 2C1PB 5TDOA 1DQLH 3EDEA 3BWAB 3ZKMD 4HGKC 4ERSH 3LMJH 5IM7A 1T20A 5I9QB 2KQNA 3EJYC 5DJDB 5FKPA 4XWGL 5HYQA 2CKBA 3BAEH 5EU3B 2BOBA 4MJ4A 1G7MA 4FP8H 1NCWL 1IKFH 1YYMH 1KLUA 3O0RL 2H2SD 4GG6F 2H45A 3C8KA 1JPTH 2R4RL 2GAZA 2VLJD 2OL3A 2VDMH 4WTZA 4JFXB 1CXKA 4P2OA 4G80A 2FL5A 5LWYL 4M62L 2EDBA 4BH8A 2CK2A 3T0DA 4OZGB 1L7IL 2R0ZH 4YXHL 5L8JB 4PJ8B 3STBA 4ETYA 3HR5B 3H7LA 5DS8B 3JTSB 4LLMB 1AKJD 4PGBA 1S7VA 4HW6A 3QNZA 1H5BA 1IAII 4W68A 4X6BA 3T4YA 5H2BB 4JEGB 1QYGH 1Q38A 3MBED 4U1MB 1PG7X 1MVUB 3QQ4A 5I1GL 1NUNB 1KB5A 3K4DA 4XC1L 4NRYB 3O9WB 4DEPB 1RY7B 4PTUA 3ZTNH 2YN3A 4IIQC 4BH7A 3PGDA 3WD5H 1P1ZA 4B0MM 1ZVHA 1HSAA 2VXQH 1DQQA 1XH3B 1NKOA 2F8XC 5DMGC 3UTTE 2DQDH 3RZCA 3BH9A 3C2SA 1CD0A 3HUJA 3NIDE 2KKQA 2D3VA 2GJ6B 2PYFA 1YMMB 2AK4E 5SWSE 3SDXE 3SO3B 2WBJB 3DETD 3Q3GA 2MCPL 3WO3B 2CSPA 3LKRB 4H8WC 5GSRA 4G9FB 3UAJD 1A3RH 4PJ7F 3UBXB 4K3GA 5I1DB 3E2HB 4GKZB 3ZHLA 4LNRA 3MA7A 3O8XD 4RIRA 5GGTH 1KJ3L 2XPGB 1A7OL 1ITCA 2VZ1A 3RWJA 2CKBL 4JJHA 5I1EH 2V9TA 5CWSB 3RDTA 2AI0H 1XGTA 5E70A 4XNUL 3BHBB 5EPMA 5TPWL 3CFEB 1RFDL 4PRHB 3X12A 2W07A 2OL3L 4HK3J 1D5XA 4O2FA 4WV1B 1OGAB 3WMSA 5EO0A 3OF6A 2RIKA 5EDXA 1RK1B 2HLAB 2RQ8A 3NN8B 3TYGH 4HXBL 3L95A 3LY6A 4XWOD 5K9KA 3RA7H 3PGCA 4OD2B 2F54B 4WFEE 3GUTA 4JM4H 2GKIA 3BDBA 4QRUB 3IKCB 3TZVA 1ZKAA 4U6HB 3G08A 2YPKB 3O6LH 3FQXA 3PDOB 3HZMA 3LIZH 4X7SH 4YO0A 3MLSL 1JL8A 1BWMA 2Y6SC 3W9EA 2E7LC 3PV6B 3MLXL 1SEBA 2R29L 2VNCA 3PGFL 1S9YB 4E41B 2WQRA 3MLTA 4NKMB 4YBLC 5IJKC 2HJFB 3MV9D 4NM4H 2E6QA 2RHEA 2VYRE 3E6FA 5EO9A 3MUGB 1QSVA 5MERB 2Z31D 2RB8A 5GISH 1DANU 1UZ6E 2J5LB 5IB2A 2EXYC 3TBWB 5EBMA 1HKLH 1U3ZA 5L88L 3MRHB 4KKBD 3BPCA 5FYJD 3GKWH 1HWGB 4JRYB 2UV3A 3ROLA 4C58B 1F6AA 3FFCD 3OWEA 1U6AH 1LGVA 3EOTL 4G8GE 1A6TB 2IPKB 1NC2B 2R1XB 5DZNA 3RWEA 1EHLH 2NZIA 1BLNB 3CC5A 3MV7A 5IJVB 5J57B 2X70B 4PJEB 1A6ZB 4XP5L 5C07A 4HH8A 5E2TL 2XZAL 1ZTXH 3N9GL 4NKDB 2VXUH 4OQ1A 3PJSA 4HAGA 5J13C 4G8FA 5LQBL 2Z4QA 4XVUC 5BRZE 1ITBB 1I7ZA 4P5TB 4K9EH 3QDHA 5E8NA 5ISZD 1MAJA 5J12C 4PJAF 4XCYB 3FRPG 3O6FB 4NN5C 2BVQB 2DOCA 2MTPA 1H3PL 5SWZA 2J88L 4RAHA 4M7ZC 4HPYH 5BQ7B 3ARDD 5CJXA 1QFUL 3LQZA 3L3GB 1UJ3B 2FGZA 3FT3B 1RI8A 3EYSH 1ZA6A 1DR9A 3V6OA 3E8UL 5FHBH 1XF4B 2HJLB 5DJCB 3VXOA 3L3JB 3VGAC 1MREL 4XPAH 2DM4A 2AJ3A 2APXA 4R96B 2JELH 4K7PX 5F3BB 3QPQD 5B4MC 5HHNA 4OCNC 5KSVA 4LGSB 5CAYB 3DRTB 3D0LA 5MENE 4OGXH 4P4KC 1I8LA 5A2JH 1F2XK 2IALB 1B2WL 4KY1L 5IOPB 3TPUA 3QUXC 3EFFA 5TGBA 3T2NL 3RUGF 2WNGA 4Z8FL 4M7JL 2IWGA 3MLZH 2V2WA 5DURD 3ZKNC 4PB0L 2HFEA 1NBYB 2YKLL 3IRZA 4L4VE 1KCUH 2P5WD 1QNZL 5K33A 3CVHB 3QCTH 2AJVH 5D1QB 3SGJC 3ULVC 4OF3A 1FSKB 4KMTH 4HV8A 2EDOA 4RGNE 1YEFL 4P2RD 3LN4B 3QB7C 3BZ4A 2Q8BH 5JOPD 4LOUD 2NY7H 3OXRB 2QHRH 1JF6A 3BKCL 4M43H 2EH7H 3A67H 4JPWH 2P47B 1E4XH 1AD9B 2WMPA 3O11A 5IFJB 4LPUA 1FFOB 4YHKL 1RZKL 4BKLA 4MZ2A 5DRZB 3V4VL 3OAZH 3GHBL 1CL7H 4OD1H 3FKUS 1TZIA 4XMLL 1I3RB 1AHWA 4PD4K 3BDYH 5JW3L 5K9JH 4I1NB 1X5AA 3P11L 5CGTA 5E08L 4ZUWA 5ITBH 4PRIB 5I19H 4P9HL 1CT8B 3LD8C 2ATPB 3FONA 2A77H 1FL3B 4XNZB 5FGBC 4HQQH 4RQQB 2PTUA 3GRWL 2FB4L 1MFDH 3QXAB 1KXQE 3KPQB 2XFXB 4WO4B 3FQTB 3IVKA 2QSQA 1OP9A 4XAWL 5DC0A 1F6LL 1U8QA 4FFZL 5HYIA 3BZFB 2IADB 2ERJC 2P24A 1JHLH 5F1IA 5CINH 3QR2A 1LILA 5JXEC 5EZJA 2LU4A 4ETQB 4WU5A 4MX7A 5E94B 1AR2A 4AM0B 4IIQA 2E6JA 3E0GA 1DBBL 3VD5A 4MNGA 3B9AA 2EDQA 4I2XB 4NN6C 3ECBA 3JWOH 2CK0L 2F53B 5TE7L 4TYUA 3R8BB 1OPGL 3OX8B 4QEGA 2VH5L 1FORH 3KLSA 2AJUH 4Y4FC 3RJDA 3AB0B 1T80A 5FYJU 3U1SL 1L0QA 4TOYL 1JI2A 2EZ0D 2G60H 4DW2L 4PJBB 2BVYA 3SE4A 4XX1E 1AQDB 5T1DH 2E7CA 5IQ7H 5DD6B 4U1SB 4HMEA 1PVHA 1OM3H 3QNXB 4P5MA 1A7RH 1G9EA 32C2B 4D0BA 1CXLA 1H15B 3VG0L 3N50A 1NGXB 3LB6D 1NQBA 4NQCD 4WI4A 4IRJD 2VKWA 4I3RH 3BO8A 4OUUB 3SGEH 4M8QA 1MIMH 1U93A 1FNSH 1GGCL 1UYWL 2ESVB 3G6DH 2A9MH 2AKRA 3T09A 2OSLA 4X6DB 4M7LL 2F15A 2UVFA 2V7NB 3O4LD 3PHOB 4N0UB 1UA6H 1N6QL 4JHBA 4JZNB 1I1FA 4ZS6C 3QG6A 3O2DA 3BEWA 4OAWB 4YDLB 4WEBL 4F2MA 4JFFD 3VXSA 5KSUA 1XZ0B 3P3YA 2HTKC 5DR5L 1XF2B 5DDHA 1H0DA 1R3KB 2COQA 5D4QA 1RZFH 4JFQB 4LEOA 1BD2E 3T0EB 1DLHB 5I66B 3WLWC 4TSBL 5I1HL 4ODXB 1S5IH 5FCUL 2FEEI 1KV3A 4RMVA 3MRMB 1QSFB 4WUUB 3A6BL 3EJZD 5GGVL 2E7LA 2GFBB 4P2CG 2R0LH 4XBEL 4FXKB 5DD0H 4NZTL 4ZSOA 3X3FL 1FO0H 3PWJA 3D0VA 3T08A 2EECA 4MXQC 3MV01 4M1DH 2BFVL 2MQ3A 1Q9WA 4Y19D 5IJKA 2E9IA 5HGHB 4HSQA 3LCYA 3TA3B 2OYPA 2ORBH 2Z91B 5CMAB 3ZKMC 1KTKE 2XNAB 4GUPB 3BIKA 4RMRA 5FB8A 3EO0B 3OKOA 4KJYA 4N0RA 4H8WL 3TO4B 4C55A 5F8RC 4Y0GA 3BKMH 2EIDA 5FO7A 1T6WA 1E6OL 2D2OA 2H2SC 5B39G 1FVDA 2ITCB 2W65B 1R3JB 1N64H 3D25A 3ALWA 1BX2B 2X4RA 4KI5C 2R1WB 2HMIC 3PABA 4PV8B 3GJFH 2HKFL 4KHXL 4HUNB 3B6SB 1KJ2A 1JWUB 4L4TD 4H0GA 2NW3B 5DZLA 1MQ8A 1AO7B 3WNKA 4GQ9L 4LVHB 4PP2A 1QA9B 5CBAB 1UM6L 4ENEC 5F70A 1P7KA 1I9RL 2VQTA 2DIBA 3VRJA 4HS6B 5T5NG 5ICYB 1MJJB 1UKTA 4KV5F 3MBEC 5F7WC 4UT6L 1NEZB 3H42L 5D7IE 3TBVA 3O4OB 1NLDH 3VGDA 4BM7A 1N2RB 4L4JA 1WAAF 1AR1D 5KTEL 1OF2B 2FX7L 4JPIB 9CGTA 2E27H 1WVZA 2DMBA 4X5WA 2D7TH 4FNLL 5HGAB 2OZ4H 3PHQB 2NY1B 3PQYA 3W5NA 3D85D 4ODSL 1J7VR 4WW2B 5L2KE 5DK0A 3SY0A 1KIUA 1QFWL 3QUXA 2C3VA 1NAMH 2GJZB 4XVTH 1WUNT 3ZTJG 1BAFH 4ZPVA 4OKVB 3HI6H 2IANB 2UWEA 1QOKA 5MI0B 1KCKA 2YD5A 5BS0E 1X5KA 3UAJC 3G6JF 3D9AH 3SGJA 1D5ZA 2ZUTA 3O8XC 3OKKB 2H26A 4GG6B 1KLGA 5GZNC 1RU9H 1AGCA 1CLYL 5E2VH 2QBWA 3QUMA 2WM0A 3HA0A 4KUZL 1MRCL 2ED8A 1I4FB 4PJCA 5CJOH 1Q72L 4YHZH 4OF5A 3T77B 2F5AH 4J7RA 1J8HB 1B6DA 5IMMB 3OKDB 1A2YB 2VE6A 1I1CA 1MCPH 1UEYA 1F3JA 3RWHA 2ZCKL 1G6RA 4ZUTA 5GZOC 3OKLA 5HHMD 1I1AD 4XVSH 1N0XL 1HSBA 1R3HA 5BW7C 1OQOA 2B39A 1Q9KA 1GAFL 5LJYH 2BVOA 3BN9D 4G6KL 3GMPB 4RZCB 4XWOC 2DQFA 5KVFL 2ENYA 3K4AA 3GB7B 4YHMH 2K7QA 5FGBA 3F58H 3U9PH 2H6PA 3DUSA 5JTWA 3BEVA 1B0RB 5EFIA 4AEEA 2HKHL 1DLFH 4KJWD 4D9RE 4HWZA 3KS0J 3BP5B 5JMRA 4S1DD 3TGXA 1U2HA 1A8JH 2Y9RT 4U1NA 4FQXC 3HPLB 3VXUB 5EO1B 2GITA 4LSSL 2A6JA 3WSQL 4JY4A 1DDHB 4LVOC 5ILTL 3L3DA 3WJLC 3STZA 5DMJB 1JFQL 5GS2H 1HQ4B 2BXYA 1DFBL 4LQFL 2YWZA 1AXTL 1DBML 1RZ8A 2LV4A 2NXYC 4NQXA 2Z31C 4PJ7B 1M7DA 5LCVH 4BQCA 2EE6A 5C0DA 4WI6A 4Y4FA 1WIUA 4MAYB 3GSNH 2FLRT 2VLKE 1TJHH 5EUOA 1DP0A 2ICWB 5A2LH 2KZ1B 3HZYA 2I9LB 4PJHA 2WLZA 4MNHB 1HHIB 4XNYL 4HKZB 2QEJA 1NCBL 1ZS8A 2Y1VA 4QXUH 4YHNA 2AEPH 1OHQA 4HWNA 1H8NA 1Z6JT 4URTB 2Z35A 3I6KB 3H3PL 1WBZA 4R26L 4Y16C 4UTBH 2DB8A 5HYJB 2NY3D 5I6XB 3C2AL 1HQRA 1RK0B 3ARDC 4YE4L 1SJVA 3RWCA 2C1OA 3QI9B 4UV7H 4LARH 4XBGA 3P9WB 2RFXB 3LEVH 4H0HB 4DKEL 1JPSH 3KLAB 3F7QA 1TETL 1WEJH 5AWNH 1MVFA 1MY7A 3QPQC 5FEBA 4OGYL 1LEGB 1QRNA 5CD3A 1GL4B 2J6EH 1UC6A 5EIIB 2XN9A 1I7UB 1G7JB 4LASL 1FPTH 4FTVE 3GFUA 2XICA 2CR3A 2G75B 1KF9B 2JK5B 1GZPB 4X7DC 3QUYB 4PRDA 1DL7L 1YEHH 3G5ZB 3TCLA 1EAPA 4O2EA 5F6HI 4FFYH 4U1JA 4P3DB 4NNPL 3G04B 1D9KA 3QQ9D 3ARTA 2FR4B 5I1LA 3K1KC 2ZSVA 3BWUC 3I50L 4NHCH 4R0LC 3TP4A 1ZHLA 3DRQB 4XP6L 2VABA 3MROA 1MHHA 2NR6D 4MSWB 5FF6B 4NKOA 5KS9F 1YDPA 2AK1H 4WNQB 5CIPB 5ADPH 1WIPA 1FJ1A 1AGDA 15C8H 3LPFA 4Y4KD 3UTSE 1BQUA 3IFLH 4GG8A 3DV4B 1U3HA 1PZ5A 3IF1A 4CDGC 4OQTL 2YPLE 1A4JB 5IHBA 1HHHA 2VLJA 4B7IA 4BSWA 5IEHB 3G5YA 4ELKB 2DL9A 3ZT7A 4N90D 4NYLB 1C5DB 4XAKD 2IH1B 1P5VA 1Z9SA 4LSRL 2J4WL 4OCYH 5ALBL 3PWUA 1YPZA 1K3IA 5IV2B 1AKJA 2V5MA 4NO0A 3M1BA 2FWOA 1LDPH 1OAKH 4NWTL 5D93C 4OZFB 5E2WH 4PJ8D 3TH2T 1N59B 4UT9L 5C0BB 3W39B 2HYMA 1C1EH 3MBEA 3MRQA 3QCVH 2HA1A 5F7YC 3WIFA 2JTDA 1V3JA 4HHAA 5TH2B 3SKMA 1J88A 1KCVL 3ARFB 2I07A 3S96A 1QSEE 2EDDA 4X6CA 1K8DA 3BRDA 5JIKA 5JXAH 3O9WD 4KK6C 1NFIB 5DSCB 3CJJA 1JWMB 2R2CA 2HTLD 4DN3H 5JDJA 4HDIA 1T89C 3NPSB 4GBXB 3WCYA 3HRZB 4J6RH 4H0IA 3DX7A 4O5LL 4NCC2 4LIQL 5EU7E 3RU8L 4N8PA 4Z0XB 1OT1A 3RY6C 1T5XA 2EZ0C 4CW1B 4NQDA 4Z0BH 1UCBL 1IJ9A 3FB7B 5TDPB 1J0ZA 5ACZA 1IQWL 5E00B 3QXDB 2GJ6D 3QFDA 4MLSA 1MCQA 1YMMD 5HYFA 1MRFL 3REWB 4WU7A 4U4BA 2WBJD 1I85C 4G9FD 4QRRE 1CG9B 2P44B 4LCUA 3FO0H 1IVLA 3IDIB 5IEKA 2DTSA 4WI7A 3VXME 4Z7NF 2XWBA 4YHPA 1K6QL 4UNTA 5ESQA 1IZKA 3WKMH 1QPPA 1QRKA 1W72H 3VU2A 3VD7A 4E0RB 1KT2B 5T3XE 3MLVH 1FE8H 4NM8L 3AU1A 5JNYB 1OAQL 1NJ9B 2PW1B 3FQRA 4ODWB 5D2NB 5CILH 3MFFA 4L3EB 1EO8H 4ZAKB 4GAYB 3WLBA 2PR4H 1XGPB 1FAIL 2W91A 3IDJA 4HXAL 3HZVB 3FO1A 3MOAH 1OGAD 3NA9L 5HJ3B 4KC3B 4ONHA 5DI8A 3CPLB 4OV6F 1ZT7A 4WWKB 1BGXH 4QLRA 1A3LL 4OGZA 3MXVL 4ONFL 3SGDH 1VFMA 2BVPB 1CGTA 4OCWL 4CADA 2F54D 3SEPA 4FQXA 3EJZC 1IILE 3X3GH 1A14L 4U31A 1KJVB 5AZEL 5FA4B 3QDGE 1D5IH 5IB3A 3HUJF 3WJLA 2L4OA 1WCBA 4P23A 1MJ7L 4N1EA 1ZANH 3OMZA 2X1PA 2P43B 1MWAA 2IBZY 1S78C 2DJ4A 4JFYA 4PTTB 5DQ9B 1D6VL 4KQ3L 4E41D 3P0YH 3OKMA 5EOCL 1F11A 4NT6A 5E56A 3DECA 3MSPA 1FZJA 1GC1H 5CUSL 1IAKB 2BSED 4U2YA 1FLRL 2R2HA 4WDIB 4L8SC 5FGRA 2HFGH 3QEQB 3EO9L 4X5XB 4JRYD 4MA1C 1LK3H 4HUMB 4I77L 4LK4A 4NQEB 5ETUB 4MHHI 4M93C 3VXQB 4KTEH 1DBAH 4A6YA 3BP4A 3EYOB 3VXRB 3WEXB 4U0QB 1NC2D 5DC9B 2EE2A 5DJ8B 5E99H 5HHQA 1REIA 2NY5C 5FECB 1RMFL 3T3MF 5IKCA 2I5YH 5I1IH 5KSBA 4Y1AE 2BSSA 1QLRB 3SCMB 5SWQA 5HSFA 4OI8A 4Y16A 4GRWH 4LGPB 4NJ9L 4P5TD 1SM3H 3UJJL 1UVQB 3ZDYF 5EZLA 5C2BL 2XY1A 2BC4B 5C0RH 2D7NA 4D9QE 5DLMH 3FZUD 2Y06L 3O6FD 1PX4A 4I18B 3EW3B 1AR1C 1JNHA 1OAZH 5T3ZH 3HAEB 1A7NH 1FIGL 5BV7B 5IWLC 4KUCD 5F7MC 1ADQL 2A6IB 3MRLB 2XYCA 4ZYKB 1GGTA 3BVNB 4UIMA 3SOBL 3WN5C 4X4YA 1PSKH 2MPAL 1VSCA 1WWCA 2X42A 3ZDXF 3TBSA 4ERSL 3JTTB 4N0CD 3S97C 4ZTOL 2R4SL 4P99A 2OBGA 4PRBA 5DC4B 1CFSA 1VFUA 3KS0H 5EOQL 4HT1H 2WK2A 4LRNL 2DQEH 1ZWIB 4WTXA 3ZE1F 4R0LA 1CIUA 3DVIA 3MLYH 5I1CH 2DQTH 4WEMB 5D6CA 5ID1A 5D1QD 4N1CA 5FYJL 3S3PA 5BJTB 1IKNC 5JORA 3GI9L 3NH7H 1FYTD 3B9KA 1K4DA 1IGCL 1O0VA 3IJYA 1ZE3C 2X4PB 4XGZA 2VDOL 4G3YH 2DWDB 4A6YL 5C08B 5L9DL 3C5SB 3TBYB 4JJ5B 3WXWL 4DK3A 5JOEA 4WFFE 3P77A 1I1AC 1X5YA 3O3BA 1PKQB 4GXVH 1NLBL 1B0GB 1JK8A 3BN9C 1WTLA 3OB0H 3E1F1 3ARPA 1AGBA 4NOFA 3S3JA 1WIOA 2YBRA 3CMOL 5HBBA 4D0CA 2CIKB 4OCXH 4PRID 1U8MB 4WHTB 1YEEH 4EN3B 1NGWB 4KJWC 2BVUA 4DN4L 5HVWA 3OZ9H 3AY4C 4WI2A 3MLWH 5DJ2A 2XZCH 5A40E 3RWDA 4NJAL 4WO4D 5L2JA 2YSSA 4JKMA 5IR1A 5INDA 1UWGH 3RKDD 1CU4H 5C0AE 3EFDH 1KN4H 3QBTB 3KHQA 4RAUA 4TVPE 2O61B 4TSCH 3BUYA 4PJXA 5HDLA 2QHLA 4NUGH 5D2LE 1DN0A 4AIZA 2FO4A 5E4IA 2EXWD 5DVMA 4EIZC 3N1QC 1T89A 4PV9A 3MGTA 5MEOB 2BNQE 1CTOA 4QTHA 4WI5A 5F7HA 2QTEA 1AGFA 1DBKH 4AENB 3LKOB 2F53D 3UPCA 1VFAB 4Y8AA 2JB6B 3RY6A 4XX1G 5I1JH 3D39E 4QNPF 3UO1L 1EJOH 3MJGX 1INQA 4YHYB 3HG1A 4BFIB 3G5XA 1DUZA 1MCIA 4OFKA 2BMKB 4N8VB 2GY5A 4P2QD 5GRZA 1TZHB 5J06A 1LO3H 1N3NB 1C12A 3QDMA 5D7LB 2ENSA 1ED3A 2VLLB 2UYLA 5JLZB 1UT9A 4MCZA 3SDYL 4GSDH 4I0PA 3IFNL 4C4KT 1NGQL 4AEFA 4JZOB 1TJIH 5K59E 5F72S 3VMOA 1CFTB 5DZOA 2NY3C 1MI5D 4GH7B 1F3DJ 1T7WA 4K71C 1PW3A 3U0TA 2ESVD 5ESAA 4OV5B 3KXFE 3QEHB 2AJZA 1LO5A 4G8EB 4K8RD 3WFEH 4M7KH 3IS0X 5JZ7D 2GSIB 3AUVA 4Z5RB 4JFFA 1EK3A 1FL6B 3BE1H 3WDIA 1LO0H 4LLAA 1J1PH 4NZRL 1QPXA 3GSVB 5ANMA 3KAAA 5CKAA 2E9WA 2O5ZL 2EC8A 2AEWA 4ZQKA 3J7HA 4IS6B 4XNMA 4YDIH 3T0ED 1NSNH 3FCTB 5KSAA 1BBJB 1GJIA 1CD9B 4LIQE 2DN7A 2DQHH 3QQ9C 1QSFD 1ND0A 1JYVA 4UTAH 4WUUD 5JIPA 4HUVA 1MFAL 3FB8B 4PJGE 1D6EA 5DWUH 1R5WB 3V6FB 1VFOA 3T1FB 1D7FA 3WE6A 2ZNXA 3PWVA 2BRQA 4YFLI 5ALCH 3V0AC 2NR6C 3HNSH 3MGOA 43CAA 3UJIL 5IESH 1KLFA 1UZ8B 5CGMA 2D0FA 4MQTB 3VFTB 3JBG7 1R6VA 4Y4KC 2NZ9C 3EYFA 3S36H 1TXKA 3TA3D 1JPFB 1RHFA 1FFPA 3RNQA 3Q6GL 4JY6B 4G6JH 5T5FL 4L8SA 3IAQA 2LU7A 4DKDC 3IGAA 3TO4D 2CUIA 2G5RA 3NTCL 3RL1A 4ZXBB 5J4MA 4OLWL 1P4LA 5F6IB 3S35X 3BXNA 4L8BB 4X4ZA 2A73A 3CFDA 1BEYL 5CLWA 5JOFB 4HUXB 3H7BA 3HI1A 3MRNA 5LBSL 1VACA 1S7QB 3CSYA 3QXUA 4HZAA 1J0KA 2FATL 4PJ5B 1YY9C 1AO7D 4NBXB 2C3HA 4PJ8C 3QHFH 1W0YT 3EO1B 3GIZL 3HMXL 3EGSB 1BQLH 1IC7H 1PG7W 3MRDA 5MP6H 1YA5A 2C7UB 4MJIA 1A6PA 4N0FB 5J9PA 2K1MA 3GSRA 1KEGH 4N5UA 3VXTB 4G6MH 1A6VH 2KL6A 4G9DB 5F21B 3WHXA 3O9WC 4DEPC 5IWLA 1MHEA 1RIHH 4FQ2H 1I8IB 2DQUL 3KPSB 3VGBA 2HTLC 3WN5A 5HGBA 2ID5A 4LSQH 4ODHL 4PRPA 2NY1D 1MCLA 4FFVC 4NCDA 4J8RB 4Z7UA 4R7NB 2R56L 5FO9B 2QSCL 4KHTL 5KS9B 4L8CA 5E6YA 3L5XL 5ID0B 1L7TL 1XF3A 4HJ0D 5I16A 4YBQD 3ZDZF 5C6TH 5LXGL 1ZGLA 3KPNB 4F7TB 4PRNA 1F2QA 2IAND 3MCLH 1HOCB 3GSQA 3SO3C 3WL9A 2WBJC 4MVBD 4RX4A 5CEZD 3MLUH 1OAYL 2Y07H 4DOHE 4RAVA 2YZ8A 3E2HC 1P69B 1JGUL 5KZCB 1A4KB 2PTTB 3NFPA 1CR9L 4LSDA 5EU4A 5L6YH 5D70L 1XGUB 1S9WA 5DO2D 5ERWB 5D7JB 1FZKB 1I7TB 2O5XH 4EI6B 4HFUL 1J8HD 1XIWB 3DX6B 3HE6B 3FHAA 4QT5A 3F7YB 3CDGB 2NY5L 1YUHB 4ELME 1O7VA 1XAUA 2ZOLB 4WV1C 4QTIH 1LNUA 4MA3A 1N6UA 1G6VK 4OCRL 3QQNA 2VR4A 2BRRL 2IG2L 3LKNA 2CQVA 1L6XA 2VDQH 3JWDC 1I8KB 1JHKL 4N5ED 1VERA 2R2BA 2ARJQ 2FECL 3T8XA 3VXNA 3AY4A 4MXWH 4FS0A 3MCKA 4Y5VA 4YBHA 3VFVB 4MD4A 2QSTA 1EVUA 4PGEB 3QDJB 3I75B 1A02N 1YEIL 1U8LB 3BMWA 2VLRA 5IBTH 3I6LD 4MMXC 3TEUA 2WUBH 1BOYA 1DCLA 3MRKA 3QUKA 4ZFOA 3ES6A 4ZUVA 5TDOB 4K23L 2DAVA 3MV9E 5IM7B 2VKXA 1T20B 3QPXL 3SQOL 5GS1B 2UWEF 5HPMA 5ACLA 3MQIA 3MXWH 1PJ9A 1QLFA 5FKPB 5D6DC 5HYQB 3O3UN 4JPVL 2MCG1 3ULVF 1G7MB 4PRAB 4YDKL 5FYJE 4YLQT 1INEL 4XNQA 3UYOD 1A64A 1KLUB 1CLCA 5EC2A 4LBEB 3ALPA 2J5LC 2B4CH 3FFCE 3OPZH 4MAYD 4FQIH 3IFPB 1QBML 1MCEA 1WZKA 4PJCF 3ARWA 4P2OB 5ACMA 4G80B 1KC5L 1LEIA 4OLXL 4XH2B 1GRWA 4HUWB 3IDNA 4LSTH 4CJ1A 3C6SA 3GMLA 4M5ZL 3F62A 4HWBH 4PGBB 1NMAL 4XCFL 1S7VB 4OCSL 4UAOB 3U7WH 4HCRL 3DVGB 1H5BB 4X6BB 3T4YB 4LLQA 5ISZE 3WIHA 3SJVA 1ONQA 5GIRB 2PW2B 1FV1A 2AAVA 1EH9A 3I3DA 4P5TC 4X98A 3QQ4B 1KB5B 4OZIF 1JZ6A 4FFWD 1MUJA 3S8WA 3O6FC 5JHDA 4NZJA 5HYJD 4BH7B 3PGDB 4JG0H 1LE5B 2IFGA 1HSAB 4P0DA 3MNVA 4X7TA 5LAXA 4IEFB 5EA0L 3QI9D 1DQQB 1S7TB 1UJ3C 3C09C 5I15L 4TQEL 3Q5TA 1FNFA 4PY8I 3NCEB 1WBXA 4DZ8A 3BH9B 3HUJB 3DPBA 4WI9A 3WNOA 1G1YA 4HIXH 1PGRB 3QQ3A 1I9IL 1R24B 5GSRB 1PEZA 3EYVA 4M5YH 3GBLA 3QUYD 2Y5EA 1MCHA 3OJMB 4LNRB 1IEAA 4LPCA 3MA7B 2P5WE 4RIRB 3DSFH 4GMSL 3PE9A 5EUOF 5F8QC 3RWJB 3DO7A 3JUYA 1FL5A 4P2RE 5JOPE 5E2UL 5CZXD 5EPMB 1JMZA 2FD6L 1FSKC 4PJHF 4Y4KA 2X9WA 4XWGH 5IB4B 4O00A 1ROWA 3BWAA 1D5XB 4O2FB 4LPVA 4HBCL 1DN2A 1NCWH 3LS5L 1A7QL 3O0RH 1WICA 4HKJA 5EO0B 2R4RH 3L95B 2ZUXA 3CH8A 5K9KB 1NGPL 5LWYH 4NRZA 4M62H 5HDQL 5TE6L 3PGCB 3L7FA 1L7IH 3L5WB 4PJIE 1MCJA 3ZE2E 1UCTA 4YXHH 2M2DA 5HHOA 4GLRH 3TZVB 5J8OA 5SX4I 3FQXB 2X4TA 3HZMB 4QHUA 1FNGB 4KDVA 4YO0B 4NGHL 4PJ8A 4UQ2A 3CXDL 3VFSA 4X6EB 1SEBB 5D72L 3NCJL 5I1GH 4OF0A 4WO4C 4XC1H 4PG2C 2BX5A 5CJQL 5H2BA 5C0BD 2YD4A 3MLTB 2EDFA 4RGOL 5DQDL 5KOVC 2XZQL 3RIFF 1MVUA 4EXKA 1S8DA 2HJKB 5J1SC 3RGHA 3B4NA 4NRYA 3O9WA 3MODL 3MLRL 3ARFD 4MA8L 4YXKL 2CO6B 5EBMB 5E6ZA 1SHMA 4JO4L 4XB7A 3ROLB 3LEXB 4N68A 1GZQB 4GBXD 2BVEA 4EJ1C 1UB6A 2D7QA 2MCPH 2OR9L 3RWEB 2R1YA 3AB0C 3CC5B 3MV7B 3WS6C 3BKYL 4WVRA 2GJ6A 4F7MA 1R5IA 1S7XA 3K4ZA 4DCQB 4PY7B 1BVZA 1LEKA 2LVEA 1KJ3H 3IU4L 4UU9B 4G8FB 4YIQA 1F4YL 2Z4QB 3QISA 1XF1A 4GAFB 1A7OH 5C92A 2CKBH 4NQCE 4LHUD 1CDYA 4XNUH 4NO5A 3DX9A 2V2XA 4NC2B 5TPWH 1RFDH 1WLHA 4KI5F 2DLIA 2XPGA 4K9EL 5SWZB 2OL3H 1BPVA 3LQZB 2VJXA 1C5CL 1YPZF 4PRHA 2D4DA 3VXOB 3O4LE 1EDQA 1EEYA 1TCRA 2AJ3B 1LD9B 4HPYL 2X05A 5HHNB 4HXBH 5KSVB 4K8RC 1XFPA 4L3ED 3D0LB 4LU5L 4ZAKD 3U6RB 4JFEB 4E9LA 4K7PL 3VWKB 3NN8A 4YDLC 2YRZA 5IW3A 3TPUB 1T5WA 2H41A 4DQOL 2UZXB 5TGBB 1CDJA 1OTUC 5GJTL 3QIUA 4X6CF 4ZODA 2F54A 4WWKD 2Q86A 2P45B 2V2WB 4RFNB 1TQCC 3AS0A 3L6FA 3MLSH 2HFEB 3T0EC 4QRUA 3IKCA 1VADA 2Y5TA 1Y6MR 3MLXH 4U6HA 2YPKA 2R29H 2B20A 4XB8A 4R2GC 3O3AA 5J7CC 1JPST 4HV8B 3PGFH 25C8H 1EMTL 1AIFA 3BZ4B 4JAMB 1MCKA 1IZJA 4Y19E 2H32H 1CVSC 3N1GC 1LP9A 4OZHE 2IPTL 3BFOA 1AY1L 3CSPA 5D6DA 4NKMA 2HJFA 5L88H 4BKLB 2X10A 3TA3C 3MUGA 4P4RB 5ECJE 4CL7A 3RTQC 1UH3A 3TBWA 1TZIB 3EOTH 4KRPB 2CLVB 3MRHA 3V0VB 1AHWB 1SVCP 3TO4C 3H3BC 3AFLA 1WFUA 4ZUWB 2XQYG 3Q5YA 4XP5H 3CIQA 2WW8A 1BJ1H 4YHOL 3QEQD 1U8NA 2XZAH 4KJQD 1NC2A 3W81A 1UXWB 5I76B 5D7SL 4NQED 3TJEL 5LQBH 1KB9K 1A6ZA 4L4TE 3X17A 4U7MA 3VXRD 1YJDL 2J3SA 3IVKB 1JZ3A 1V3MA 5F88A 1U8QB 4M1GL 1H3PH 3C60A 3HFML 3O2WL 2XG5A 4P5TA 4LVHC 2J88H 1OCWH 3DIFA 4XNXL 3SCMD 1TZGL 1QFUH 4WU5B 3MRCB 3O6FA 1FZMA 3E8UH 1MREH 4KH2A 4XRCB 3UZVB 4PGDA 1DQTA 3ECBB 3JWDL 1QG3A 4PREA 1WV7T 2VL4A 4TNWF 5JPMB 5IMLB 2HJLA 3L3JA 3NVQA 1A22B 4CGTA 4R96A 3LRHA 1B2WH 4KY1H 5E5RB 5F3BA 4J3OC 2OM5A 3DRTA 3T2NH 4Z8FH 4M7JH 2IALA 5I8CA 3V0WL 4U05A 5HHXL 4HJ0C 4EI5C 4PB0H 5A16A 4RMTA 5IHZB 2YKLH 1FRGL 1K9TA 1QNZH 1U91B 5DMIL 3DTXA 5GRVL 2VL5A 5MI0C 1NBYA 4YH6A 1YEFH 4MVBC 5DD5L 3TM6A 3BGAA 2AGJL 1FG9C 4I3SL 2OTPA 3BKCH 4XC3L 1U93B 4HJJL 3H9HB 4PJDE 4YHKH 1RZKH 4TNWK 2AKRB 3GHEL 3HN3A 3V4VH 3OXRA 3U79A 3GHBH 4YZFF 3SKOB 5B39B 1AD9A 2VO5A 3C8DA 5IFJA 4XMLH 1FDLL 2YA0A 3QG6B 4C59B 1H9VA 3BEWB 5JW3H 4ZPTA 1KJMA 3P11H 3L3KA 5HHME 1QHOA 5GXBB 1GPOL 5E08H 3VXSB 5KSUB 5C08D 1PY9A 4I3GA 4P9HH 3Q1SL 5DDHB 1A1OA 1X3DA 1KEML 2FBOJ 4LEOB 4DGIH 5EIVA 5GRWA 3NIFF 3GRWH 2FB4H 4PJFA 5DT1L 5INCA 3P30H 3U46B 4XAWH 4FFZH 4RQQA 4XPTL 4EN3D 1M6OA 1QFWI 4LAQL 4ZSOB 1MFCL 2XFXA 3PWJB 4RMWA 3MFGB 4Y88A 1IARB 2CO7B 4YBLB 3MV8A 2BVTA 5FM5M 1DBBH 1ODAA 4Y2DA 4IRSB 1H8SA 2CK0H 1CFQA 1JF5A 4AJ0A 3C5JA 5TE7H 5E94A 3BIKB 5FB8B 1OPGH 1F4AA 5KVDL 3OKOB 4KJYB 2VH5H 3GIVB 1DQML 3U1SH 4TOYH 4JY5L 4BYHA 4DW2H 4I13B 4ODBD 3L5JA 1FVDB 2CDFA 1WSST 2G2RA 4MAYC 5I30L 2CMRL 4ALAL 2X4RB 3CVHL 3PABB 3WO4C 5CEXA 4PJBA 3VG0H 1AQDA 1EO5A 1KJ2B 1UH2A 3LOWA 1Z9MA 1SQ2N 5DD6A 3OAUL 4U1SA 3P4NB 4PP2B 2QSVA 2IGFL 1P7KB 1JGEB 3OL2A 2EE9A 2VDPL 3GK8L 3WNPA 1UADC 3VRJB 1GGCH 4V2CB 1UYWH 5D7LD 1MOEA 2DL2A 3TBVB 4Z6AT 1ZMYA 4JR9L 1BZ9A 3WV0A 4P2YA 4M7LH 4QRSB 3RVWD 4FFWC 1NGYA 4J12A 1N6QH 3BQUB 1P9MC 3VGAB 1NUDA 2ICEA 2M8XA 4X5WB 4X6DA 2FIRT 4WEBH 5I6XC 4H26A 4D94A 2P8LA 3QI9C 4G7VL 5DR5H 1HHJA 1QZ1A 2EDTA 3SKUD 1WZ1L 3QUXB 5MEQA 2C3VB 3D3VD 4TSBH 5I1HH 4IDLA 1XZ0A 3QXVA 2VQUA 4U3CA 5FCUH 3CX5K 4ZPVB 4P9ML 4PJXF 4JFQA 5GGVH 3PNWB 3RY5A 3T0EA 1EVTC 1SJXA 4ODXA 4XVTL 1Q1JL 2W9DL 5HD8D 4XVJL 5C8JA 3QUYC 2NPLX 4NZTH 3X3FH 1D5ZB 4AK1A 3MRMA 1II4E 1TNNA 4W81A 4M6AA 5GRXG 2H26B 2BFVH 4PIRF 5EULV 3OJDA 1ETZA 3S7GA 3UTPD 1G0DA 3W9DA 2W60A 1MCSA 3BRGC 4NDMA 4PJCB 5DA4A 1U8PB 2EDYA 5AUMA 4ZNEA 4K3DL 4ZOBA 5KN5A 2VOTA 4H8WH 2Z91A 1F3JB 5H94A 1U8HB 3RTQA 3RWHB 1G6RB 3TJHC 4ZUTB 4GUPA 1E6OH 4O4YL 3V7MA 3OKLB 1EZVY 2NNAB 4KK5D 4O9HL 5F9JA 1HSBB 1R3HB 4LSUL 1PEWA 2BVOB 1NGZA 2YEZA 1Y0LB 1HHGA 2DQFB 4F7EA 2HKFH 2GUOB 2KPNA 1DVFA 4QXGL 5C71A 3T4AA 4KHXH 2W65A 4OZIB 4YDVB 4N90E 4ZXBD 1R3JA 4FRWA 5DUBA 4XAKE 4N9GA 3DUSB 5DD3L 1BX2A 5EFIB 4GQ9H 3KPRA 4HWZB 2Q7YB 4MXVE 4AZ8A 1JZ5A 1UM6H 4JB9L 5F9OL 5D8JL 1I9RH 3ARVA 2I24N 4U1NB 4M48L 2GK2A 2ERJB 2VR5A 4OZGE 2MQCA 2GITB 5IHUL 3TYFA 4UT6H 3H42H 4JY4B 4QO1A 3B2UD 4K8RL 2YD7A 5FDWB 1EV2E 3L3DB 4GKSA 4HS6A 5KTEH 2FX7H 3STZB 1NEZA 1VGKB 3QXWA 4ZNCD 1B90A 1SY6A 2OR7A 1UH4A 4FNLH 5EU6B 1DZBA 1MSPA 4NQXB 5EOCJ 1M7DB 4ODSH 1RUAL 3O6ML 5C0DB 1QLEL 4LCWB 3H0TA 2NX5B 1Z0NA 2FX8L 5HGAA 1QFWH 5EUOB 3H9YA 3KPSD 5GRYA 3VGHA 1KPRA 3NPSC 4I5BA 3ESUF 4EI5A 2EIEA 4PJHB 2LAAA 2GJZA 5HGGS 3QO0A 1EUUA 3RVXD 4U6VL 4YUEL 1YMME 2QJDA 2MHAB 1K5NB 2NTSP 1RZ7L 4HEPG 4HUKB 4PGZA 1CLYH 1ZS8B 4G9FE 2JJUA 2ZNWA 4KUZH 1JRHL 1NDMB 1MRCH 2FH6A 2J8HA 2Z35B 1Q72H 2LE9A 3OKKA 1VENA 4POZD 3K81A 2AJYL 4MS8D 5F9AC 3SBWC 4NKQB 5KZCD 2EC9T 4NFDA 1HQRB 1MJUL 1I4FA 3CZFA 3IU3A 3RWCB 1PQZB 2C1OB 4KFZC 4UINL 1K2DA 3H8NA 5DHVB 5IMMA 3OKDA 5D7JD 2LTQB 1N0XH 3F8UB 1A6AB 4HS8L 5AG8A 2D03L 2VLMD 5DJXA 1GAFH 4NFCA 4G6KH 1XIWD 5D2NC 2I9TA 2A74B 3HE6D 1JN6A 5CD3B 43C9B 4U49A 1FFQA 3RWFA 5KVFH 1OGAE 2FZ3B 2XN9B 5GGSY 4CDHA 1KSRA 1JYWA 1BVKB 1ACYL 4RZCA 3IJSB 4PRDB 2HKHH 3LRSA 3TCLB 3ALXA 1T7XA 4O2EB 3E6HB 1CCZA 2A9NL 3IFOB 4WI3A 4G8IA 1B0RA 2I26N 1D9KB 4LSSH 1PZUB 1GCFA 3WSQH 4U7SA 3IXAA 5I1LB 3BP5A 3EYQD 4KMQA 2OTUA 3HPLA 3VXUA 5ILTH 1ZHLB 5EO1A 2VABB 1CD8A 4Z7UF 1MHHB 1OWWA 5KVGL 3QDJD 2OQJA 4FXLA 4HIHA 1JFQH 2L7UA 4NKOB 3GO1H 1DDHA 1DFBH 1FJ1B 4LQFH 1AGDB 1AXTH 1DBMH 1U8JB 1TNMA 4GG8B 4E41E 3C87A 4OUOA 1HQ4A 5SWSB 3SDXB 1U3HB 2FJGB 4AMKL 3C9NB 3S34L 2IAMC 4BSWB 3X13A 4PUBL 5CEZL 1FNEA 4NPYA 5J6HB 4JRYE 4Q9CA 1QBAA 4JQXC 8CGTA 4TTDD 3DV6B 3QJFB 2VAJA 4FQCL 4P2OD 4BSVA 4XNYH 3UYRL 3PWUB 1EIBA 3BP7A 3FL7A 1NCBH 5I8KL 4NO0B 3M1BB 3KGRA 4P5KB 4PJEE 4MNHA 2AV1A 5I8OL 1JNLL 3JUZA 3H3PH 2BNRA 2JKXA 3N1MC 2DBJA 4R26H 5FM5O 5FV2A 1LDPL 5GRUH 2CGRL 2Y23A 2APVA 2LVCA 3C2AH 4V1DA 3SKMB 5HYSG 2NY4B 3SCMC 4YE4H 3QSKB 1P9MA 2I07B 5JW5A 1VCAA 4X6CB 3ULUF 4DKEH 3RGVA 5ICXB 1TETH 1E6JL 3E3QC 4OGYH 3D2UA 3HE7B 2KBGA 4I18C 4HDIB 3V2AR 5CCKL 5DRWA 4XXCC 2BSTA 3DX7B 3KLAA 4LASH 4F7CA 3KPLB 4KKLC 5BV7C 2X4SA 1LEGA 5E03A 1T5XB 3THML 1DL7H 4NQDB 3WJJC 5EIIA 2YD9A 4NNPH 1GZPA 1W0VA 4MGXA 2D0GA 3K2UL 1A7PL 3G5ZA 3WFHA 1A1NB 2L7JA 1KTLA 3I50H 2HT2D 4FMFA 2FJFA 4LCUB 4XP6H 1LK2B 4KWUA 2FR4A 2FDBP 1T22B 4YHPB 4WFHD 2AS5M 4J3WA 3U4AA 4PLOB 3IDMA 1FYTE 3RDTD 1MFBL 3AU1B 4JGMA 1GHFL 3RI5F 4G8GB 4WNQA 5CIPA 4Z7QE 3FQRB 3RVUD 1W72L 5DRXA 4OQTH 2EKSA 2KH2B 3WLBB 1B4JL 4S0TD 1OD9A 3DV4A 1NAKL 4Z76B 3M45A 4TUJB 3FO1B 5FGCB 1GH7A 1A4JA 5TJWK 3OF6D 2DQJH 4HWUA 4ONHB 2VUOA 3IB4A 1ZT7B 1OTSD 3NCBB 1N0LA 4GO6B 4LSRH 2J4WH 2OP4H 5ALBH 4IMLA 4MZ3A 4QRPA 4PRIE 1ZLVK 4CADB 4NWTH 4FQXB 1IBGL 1ZK9A 3KDMA 3DUHA 1GGBL 4UT9H 3BPLC 2D7MA 3TZVD 1FQ9C 5IV2A 4Z7OF 3T2PA 5IB3B 2PYEA 4NO3A 5AEAA 1NMBL 3RI5K 4EOWL 3K8MA 3ZSTA 1KCVH 5JIHA 4P23B 1ZGLP 3FQWA 5F1NA 4JCLA 4RMUA 1MWAB 1Q0XL 1KPVB 2EIZB 2HWZL 4JFYB 4JDVA 1EGJA 1G84A 1WFOA 3DYPA 3BOVA 1U36A 1F11B 4NT6B 4O5LH 1FZJB 4ZO9A 1BFVL 3RU8H 4I2XE 2F53E 2DI7A 1BMGA 1UCBH 3FTGB 1J18A 2HAZA 2J8UA 1IQWH 4PS4L 4TNVK 4Z0XA 4O58L 4RGNB 5DD1L 4CW1A 3BP4B 4MD5B 4YHYC 1HH6A 5HHQB 2XQBL 4BQBA 3MV7D 2WBKA 5E00A 4P2QE 4LVNB 3QXDA 5C07D 2QQNL 5IKCB 2GYSA 2BOCB 4HZLB 4OBRA 2BSSB 3X11B 2AABL 3QHZL 5F7NC 3S36X 1CG9A 3IYLW 2VDLL 3VRLE 4Y16B 2GI7A 4U6YB 4NM8H 3LQAC 1OAQH 2YD8A 4WY7L 2OK0L 3BH8A 3TF7C 3I9GL 3V8OA 5J6GB 2B2XH 1MI5E 1JNHB 3KNBA 4E0RA 4LPYA 5SWZD 4D9LH 2H2PD 2ESVE 1FAIH 4HXAH 3ZHDA 2GTZB 3QIWA 4ODWA 3GI8L 1RUKL 2XWTB 4K7PY 5EZOL 1TCMA 3NA9H 4N0UE 4UIMB 4GAYA 1RJZA 1Y6NR 1NANH 3MNZA 4JHAL 2IPUG 1X6LA 1A3LH 3HZVA 3MXVH 4ONFH 3TBSB 1OD7A 4JFED 4OCWH 1CFSB 4X0KB 5EIQA 5E6IA 3CX2A 1C08A 1HXMA 4KPHL 4ORZC 1A14H 2P49B 4DKFL 4UMGA 5AZEH 2BVPA 4TPRL 5HD8C 1PDKA 4M4RA 4JGJA 2XOTA 1KTDA 4CKVX 1EHXA 1QSFE 3GSOB 4OB5L 4WUUE 3L3HB 1MJ7H 1KJVA 4I4WA 4H1LG 5JORB 4XHJD 1T21B 3B9KB 1D6VH 1K4DB 2QQLL 4KQ3H 3IJYB 4KVNL 4HC1A 2D9CA 1WK0A 5EOCH 1R0AL 5C6WH 4PJ9B 5GQBA 2B8OT 3NH7L 5CUSH 1BREA 1X5LA 1NKRA 3EJYD 1FLRH 5D5ME 1WITA 3QYCA 2IAMA 2VZSA 4S11A 1F6FB 3EO9H 1XT5A 3P77B 5C09A 3O3BB 1AJ7L 4I77H 5ELIA 4L3CA 1JK8B 5F7LB 3ILPA 4XCNA 4KRPD 4RRPG 1AGBB 1OLLA 1BQHG 4X4ME 3BGMA 3RVVD 4W4NA 4X5XA 2CRZA 3MLPA 2O26U 5FK9A 4LFHG 2JJTC 3QFJA 4NQEA 3ZMRA 5ETUA 4ZXBC 3RBGA 5DJ0B 1RMFH 1A9BA 3TIDB 5F6IC 5EBWA 3EYOA 4OLYL 4I48A 1AGEB 3GBNL 1UENA 1YEEL 2ZOKB 3BJ91 4NJ9H 1YY8A 3UJJH 1AO7E 3RWDB 4R7DB 3HCVB 5L2JB 2YSSB 3QRFM 5IR1B 4H5SA 1QLRA 3B2UC 4HH9A 5INDB 2Y06H 1F5WA 1MCOL 5H37G 4JFZL 3FOMB 1AFVL 3FT2A 5LGJA 4RAUB 2BC4A 2IF7A 4WUKL 4AIZB 1FIGH 5K93A 5JW4N 1MRDL 2OJEA 3I85A 5BOZG 1BD2B 1WJ3A 2E9BA 3EDKA 1ZEAL 1F4XL 1AGFB 1R3LB 3SOBH 1D5BA 1OSPL 1HE7A 4AIXA 2MPAH 3ARQA 4CUCA 5B22A 2HVKB 4OF8A 1X4YA 2CLRA 3MRLA 1B88A 1U3YA 4ZTOH 1UACL 3EZ8A 3WJJA 3LEYL 2R4SH 1INQB 4LLUA 2CD0A 1HHKA 4JQIH 1LP9F 3HG1B 5EOQH 3G5XB 1NFKA 4LRNH 5GGQL 4ZDHA 4RBPH 1OLZA 3MA9L 5C0JB 4PGJA 5JHLL 1ZHBA 3LVEA 2IANE 4RMSA 2PNDA 1C12B 3QDMB 3P2TA 4JO2L 4JFDE 1ED3B 5CEZE 4QKXB 5FYJH 5C3LD 2RJMA 3GI9H 4I0PB 3L5HA 5IP4A 1IGCH 3L7EB 1S7SB 5L7XL 4GG6E 5GGTA 2J8OA 4DGYL 4MS8C 5BJTA 4R97B 2VDOH 3VGFA 5M94B 3U0TB 4A6YH 5ESAB 5L9DH 1TJIL 2AJZB 4U2ZA 1J8HE 1LO5B 3WXWH 3I3EA 3MZGB 5D7JC 5F93C 3U48A 1V7NL 2DWDA 1NLBH 1E4WL 5C70A 4TRPL 3OG4B 4R8WL 5GRVK 4JJ5A 4J3UA 3CMOH 1HIML 1CXIA 3S9DB 3PWPA 4IOFD 4G7YL 1PKQA 5ANMB 3VXSD 3QIBA 2YPVL 4LDLB 3RRQA 1GIGL 1U95B 3DGGA 4ZQKB 3RPIB 3OAYK 4XP9L 4DN4H 2CIKA 2AJSL 4ISVA 5KSAB 1EERB 5MEPA 1J0YA 4EDXA 4NJAH 3GMOA 2GW5A 2H9GB 2QR0A 3CFJA 4S1QL 3T2OA 3WE6B 1MJ8L 3I6LE 5BV7L 2VIRA 1U42A 3BESR 5HI5C 1G9MC 5DGRA 2WINA 1FFPB 2X09A 2GQHA 3RNQB 4IRSD 2R8SL 4L8SB 5GS1C 3EOAB 5BS0B 1PKOA 3UO1H 3IGAB 4PJ7E 3S5LG 3QZWG 4AENA 1KFAL 3RL1B 1CFVL 2JB6A 1P4LB 5GGRA 2P5EA 4NO2B 1UG9A 3BXNB 3HI1B 5C7XL 4MNQA 3MRNB 3ARBB 1VACB 4P2OC 3S35L 4J1UA 3D5OF 5HHVL 3T0WA 4M3KB 5C86A 1TZHA 2M1KA 3SDYH 3IFNH 4H88L 2HG5A 1N3NA 2YD2A 5D7LA 1T7VA 1NGQH 2VLLA 4UAOC 1H3WM 3MRDB 1H5BC 2JLLA 3PL6C 3N85L 4MJIB 2YN5A 1MCWW 2FX9H 5J9PB 4PJFF 1CFTA 3TNMA 5HYJE 3UEZA 2DI8A 1XR8A 3BQUD 3B83A 4OV5A 4OF7A 3QEHA 4NZRH 5B4MD 5HGBB 4PRPB 4YHIA 4Z5RA 2X9XA 3MRFA 2O5ZH 2IBBA 4Z7UB 2D31A 5BZDB 5F9DC 1XF3B 2MKWA 5I16B 4NN7C 3QUXD 3GSVA 4M03A 2OXGA 4UBDD 5GJSL 3EDDA 4IS6A 3ZKND 5DVNA 3BPOB 3GSQB 1MFAH 1T1YB 3FCTA 2HT2C 1T04A 1BBJA 4RAVB 3MYJA 3ULVD 4OLEA 2F58L 3UJIH 3FB8A 2VLKB 2BSRB 3MTRA 1SYVA 4PJBF 4PPTA 3DBXA 3Q6GH 1NL0L 3VRIB 5T5FH 3VFTA 5E1AB 1NCAL 2R23A 1JPFA 3F7VB 1MF2L 1IEBB 3NTCH 5C0IA 5E7FA 3V95A 1QP1A 4MA3B 1OW0A 4LAJH 1BEYH 3TC9A 2JJTA 2A2QT 1KULA 3MZTA 1OTSC 5LBSH 4PJAE 3LQAL 2HFTA 4QTIL 5IBUG 1IE5A 4X6DF 1OQXA 1GVIA 3VXNB 2FATH 5F3HA 3MCKB 4Y5VB 3OGCB 4MD4B 3IS1X 3TZVC 4BQ9A 3W0WA 4M61B 4E5XB 1J5OL 3GIZH 1MPAL 3HMXH 1N5YL 4NWUL 2VLRB 4PJ5A 3AREB 2ARJA 3MRKB 3ES6B 1ZLWH 5C0BE 1RUQL 5DFTA 2F5BL 1JGDB 1S9KC 4FQ1L 5HPMB 4NNXA 1JBJA 3SN6N 3DX8B 2DQUH 2XACC 4PFEA 5IUSA 3TT1L 1I3UA 2OS7A 2ZG3A 1N4XL 1T1XB 3RUGE 1RUPL 1KELL 1IAIL 5LG1A 5EU6D 2AQ1A 2AXGA 5EC2B 1I8IA 4X8XA 3ME0A 2R56H 3T3PF 2QSCH 1BOGB 2RR3A 2NX5D 4KHTH 4MJ2A 3L5XH 3GBML 1L7TH 4NOBA 1FIEA 2VDNL 5LXGH 4J8RA 1WZMA 1LEIB 4H1LH 5FO9A 3IDNB 3K7UA 3GMLB 2X1OA 1GOFA 1OAYH 2HVJA 3VA6A 3UTSB 3KPNA 2E7HA 4F33B 4F7TA 1JGUH 1HOCA 1MH5A 2IBZX 4JRXA 1CR9H 3SJVB 1ONQB 4HWBL 4K94C 2B1HL 1FV1B 4R4ND 2YPLB 3FAXA 5D70H 2JE8A 4P3CL 5TQ0L 1F4WL 3NZHL 4JO1L 1MUJB 2PTTA 2OR8A 4HFUH 5JHDB 5KBNC 3VFGL 5D7JA 1T0MB 1FZKA 2NY5H 3MNVB 5CJXC 4EI6A 1F4HA 5E8DL 4ODUA 4ZS6D 1NBVL 1RIUL 3DX6A 5D2NE 3EDJA 1WBXB 4ZFGL 4L3EE 4CMHB 1IL1B 4OCRH 3V5HA 3MGAA 4B7LA 2BRRH 1MHPH 2IG2H 2BY2A 12E8H 1QRND 4ELMF 2BNUA 1JHKH 3QQ3B 4JDTL 2XN9D 3EBAA 2GIYA 4AL8L 2CRYA 5H8DA 1QTYT 3EYVB 3VWKC 1BZQK 4M7LT 5H37H 4ZFFA 2NYYC 1I8KA 4HFWB 2FRGP 1YEIH 4RGMB 3VI4E 5E9DA 3VH8A 4RFNC 3PP3H 1D9KD 4K23H 3TIEA 1M4KA 3I75A 1FL5B 2F9BT 5F1OB 3U82B 4C56A 4M6OL 4MXQD 5CBEA 3QPXH 3VI3F 1E28A 3SQOH 5ESVB 5CP3H 4XHJC 5KG9B 2HT4D 2X4OA 2E7BA 3DYOA 4KZDL 3H9SE 4JPVH 5TQ2L 4RISL 4JZJA 1P5UA 4YDKH 2DQGL 5IVZA 2BP3A 5GS1A 1INEH 1MFNA 2DRUA 4HKJB 3SO5A 5DFVD 5SWSD 1U3HD 1FFRA 2YS4A 1U9KA 1QBMH 4PRAA 1OP3K 2MFNA 5F9WB 4QRRB 3SDCC 1KC5H 4LBEA 4NRZB 1YEGL 4KRPC 4OLXH 3L7FB 1AHWC 3IFPA 3RVVC 4XMPH 4Z78B 3NIGF 3MBXL 3QEQE 4EUPH 4KI5D 5HHOB 2PETA 4L5FL 4M5ZH 4AG4L 2HMID 2ADGB 4XCFH 1NMAH 1HYRC 2CH8A 4OCSH 4R3SA 2W9EL 4XH2A 1JYNA 4HCRH 4QHUB 2X4TB 4HUWA 3RX8A 4KMLB 2DI9A 2FHCA 3VXRE 4DGVL 4UQ2B 3HC4L 2CUMA 3GJFA 3REVA 3VFSB 4XHQA 1TLKA 3JV6B 4NO0D 4ENED 4KK8C 5ITFB 3DVGA 3PL6A 4OLVL 3BD5A 4FQHA 5GIRA 2DLEA 1BBDL 2PW2A 3GDBA 4BUGA 2WBWB 3VH8G 1S8DB 1K3ZA 4EKXA 5EA0H 1TMCB 5I15H 1H3UA 3KYAA 4PLJD 4TQEH 2PUQT 1LE5A 1EXUA 3GSXB 1KIQA 1S7TA 3HE7D 2FCBA 1UB6B 1I9IH 4QOKE 3QDGB 4YK4C 1PX3A 2R1YB 3R06B 4JDZA 5D1XA 3H6JA 1WWBX 1IGFL 4F7MB 4NQDD 1R5IB 1E4XI 1S7XB 3VG9B 3C8HA 3SE4C 5K9OB 1R24A 4GXUM 1LEKB 2YC1A 4GMSH 4YIQB 1G9ML 2QL1A 3A6CL 1CL7I 4KGJA 5E2UH 4NO5B 4JN2A 3DX9B 5GZND 2V2XB 2FD6H 1ZGLM 3HLAB 1I3VA 5IGXL 2VQ1B 3U2SA 3MRGB 4HBCH 3LS5H 1A7QH 2H8PA 5IB4A 1EEYB 1NH6A 1TCRB 5BOPA 3FOLA 5GZOD 2FO1A 1NGPH 5DRNA 2J1KA 5HDQH 5TE6H 2N4IA 3FN3A 3HS0B 5C08E 1JJUA 4JN1L 4Y1AB 1T5WB 3QEUB 4IOFC 2YXFA 1EEUA 3QIUB 5E24E 4KV5E 1AP2B 1GGIH 4AIOA 3L5WA 2Q86B 1T1WB 4NGHH 3L6FB 4CU7A 1AXSA 1WAAE 3CXDH 1VADB 2Y5TB 1KB5L 3FRPA 5D72H 1FNAA 3NCJH 3V5KB 1FNGA 4FQXD 3O3AB 5CJQH 3AM8C 2VZOA 4RA0C 4Z9KB 4JO3L 1AIFB 4RGOH 5DQDH 5CLTA 2XZQH 4X6EA 4LCIH 4CN4A 4OJFL 1WF5A 1LP9B 1CD1A 4OFIA 1HN1A 3EJJX 3MODH 4OGAD 3MLRH 1ZLUK 4P23D 1NFDA 25C8L 4MA8H 4YXKH 1CXFA 1OOAA 2YRLA 4JO4H 4JVPA 3O6KL 5SX5K 2HJKA 4DFIA 2NXYD 4IRSC 1OVZA 5SV3A 1RIVL 2ZUVA 1BM3L 4BJLA 2VUYA 3OXSA 2JJSA 3G6JE 2OR9H 3LEXA 3BKYH 1P7QA 3VFWA 3SGEI 2B5IC 1GZQA 3GSNA 1U8NB 1GC1C 3IU4H 1FLTX 1OAUL 1MCCA 2B7DT 4RGND 1F4YH 4UNVA 1J10A 3EOBB 1P84K 4DCQA 4PY7A 5B8CC 3NAAL 2VTFA 5F88B 4UU9A 1U8OB 4GQPH 4X9BA 3C60B 5C3TA 2GEEA 3DIFB 5D7LE 3T0BA 3UPRA 1C7SA 1C5CH 1FZMB 4Y16D 1MCBA 2EYRB 1OCWL 3BPNB 2JCCA 4PGDB 5DJYB 4G42A 2F74A 5B3JF 3KR3L 4PREB 3C09B 4R4FL 3R1GL 3CLEL 4LU5H 3BQUC 1G7LA 4K7PH 1LD9A 3BZEA 1NUFA 3VJ6A 1ZT4B 4DQOH 2Q87A 3K8LA 5GJTH 1YMHA 3NCYP 3D3VE 4KJPD 3U6RA 4JFEA 5I8CB 3VWKA 5A16B 4DVBA 3L3IA 2HT3C 1VEMA 5C0AB 3DTXB 4UBDC 2VL5B 4P48A 1XGQA 1EMTH 5E4EC 4B53A 2Q76B 1S7WB 3UTPE 2J8UF 2DYPB 3KYNB 3TLRA 2IPTH 1AY1H 4JAMA 2FEEL 5HY9A 3TH4T 3B9KD 1H3VA 3QP3A 3WYRA 1YQVL 3Q5OA 2EICA 4PJ9D 3TWCL 3FRUB 4ZPTB 1KJMB 3L3KB 4P4RA 5BXFB 2N7BA 3SDCA 5IROA 1VEOA 4XP1L 4WHCA 2CLVA 1A1OB 1CI5A 2V7HA 4YHOH 3V0VA 5JA8B 4UI2A 3SKJL 3MOBL 5D7SH 5DMYA 4K94L 3TJEH 1WQVT 2YD6A 3SKNB 4WHYH 4TUOB 5FM4A 4PJFB 5INCB 4R90L 1YJDH 4DGIL 1UXWA 4IOSD 5I76A 2R39A 3TT3L 4M1GH 4UQ3A 3SDAA 2E9JA 5AYQA 3O2WH 3HFMH 1M6OB 3P30L 5IFHL 5FA3A 2QADB 4XNXH 1DQJA 1TZGH 4CU6A 1N7ML 3MV8B 1JPGA 3TVMB 5IVXA 2X5PA 1T83C 4U3HA 4KTYA 4Y2DB 3QJHB 3JWDH 1CFQB 3MRCA 3C5JB 2R0KL 1JZ8A 4KK6D 4XRCA 4DUXA 3OR7A 1K85A 1NMCB 1SJEA 1MLCA 1G7QA 4Z95L 5JPMA 5IMLA 1I9JL 5DYOB 3UC0L 3ULSA 3KPSE 4LPTA 2CDFB 3V0WH 2G2RB 5HHXH 4L29B 1BFSA 2ED9A 4PJGB 5A2FA 1FRGH 3ARGA 5CEXB 1JYXA 5DMIH 4KXZH 4A2MA 1N5AB 2PO6A 3HG1D 5KS9E 1LO2L 5KVEL 3KLHC 4GRMA 3V6ZB 5IHZA 3RFZC 5DD5H 2UUDH 1U91A 2AGJH 2YUVA 2Q7NA 4LRIC 5F96L 4I3SH 4XC3H 4UILL 4HJJH 4LLWB 3QDMD 2V9RA 1G9NC 3BD3A 1UQSB 4HG4K 4R4NC 3RJQB 1A6UL 1BZ9B 4MQ7A 3GHEH 1VKXB 4I0PD 3H9HA 1Z3GL 1NGYB 3RWIA 5C0FB 3DURB 1FDLH 5BMFL 1RPQA 2ICEB 3P9LA 4H26B 1DANT 1PAMA 4JRWA 3SKOA 1GPOH 5B39A 2P8LB 2VLME 3KG5A 2VMFA 3Q1SH 5E8PB 1HHJB 3QT2A 4LSPL 1RULL 1KEMH 4U1KA 2LTQC 5HDOA 5MEQB 3BP6A 5DT1H 3RNKA 1X5FA 2YD3A 1TQCB 4J3TA 2X6MA 3ARYA 5CD5C 3NBNA 4XPTH 5C8JB 3U46A 4LAQH 5C0CA 1MFCH 2IQAB 4R2GB 4LNVA 4IMKC 2IFFL 2NY6B 3AM8A 5KSAD 3NCMA 5FYKD 2PF6A 2Z8RA 3OJDB 1ETZB 2XG4A 3O41A 4X7FC 1D9KC 3ZKQD 3W9DB 2W60B 2FBJL 4NDMB 3OR6A 4UNUA 5DJ6A 3QDJE 1MCFA 5AUMB 4F3FB 4X83A 5KN5B 4AEIL 4YC2B 1T2QL 3V4PL 2HT4C 5KVDH 1JF1A 1NCDL 1S78D 3ESVF 1DQMH 4IRSA 5H94B 1QO3B 3RTQB 3HPJA 4JY5H 2ICWJ 3PWNA 5F9JB 4K3JH 1CFBA 3GIVA 3DHMA 5DFVC 3OBAA 4KZEL 1U3HC 2DLHA 2CMRH 5I30H 4ALAH 4X7CC 3UPAA 5BS0D 1NGZB 2YEZB 3CVHH 1HHGB 4F7EB 5DHYA 1DVFB 5JA9A 3T4AB 1BIIA 2Y36L 2P8PA 5DUBB 1IC4L 2ZUSA 3OAUH 4N9GB 4Z7NE 3KPRB 4UUJB 4F7PA 5B8CA 2IGFH 2Q1EA 5F7KC 2W1NA 2VDPH 1Q8MA 3GK8H 3RY4A 5BCAA 3ARBD 3P4NA 3TYFB 4CN6A 3S37L 3EYUL 4JR9H 2Q3AA 1JGEA 5IMOA 4PP1C 4GKSB 1MHCA 4ELMB 5C2UB 2C3GA 3O2DL 2X1WL 3MR9A 5I1AA 2EYSB 4YHLL 1Q94B 4QRSA 4MJID 1BF8A 2NY4C 1YZZA 3BQUA 4G7VH 3H0TB 4PLJC 1A47A 1M1SA 1WZ1H 3VFMB 1A6WL 1YN6A 3HE7C 1KPRB 4I5BB 4P9MH 5BVJB 4PRPD 4Y4HA 4EI5B 2DQIL 4X9IA 1CGSL 3CFCL 3HUJE 3QO0B 1Q1JH 2W9DH 4XVJH 5FOBB 3B5GA 3F65A 2UY6A 3QH3A 3PNWA 2WZPD 2APFA 3MV9B 4B50A 1VA9A 4IJ3B 2XA8L 4RX4D 4MDJA 4NP4L 3CVIH 4K3DH 4BFBD 4WFHE 3WNNA 4Z18A 4ZOAA 3CZFB 1U8PA 3IU3B 2VLKD 1K2DB 4NQUA 4WEUD 4JM2C 4O4YH 4O9HH 3FMGL 1NBZA 2VDKL 5DJXB 1BF2A 4LSUH 3CK0L 1U8HA 4LQ1A 3IXTB 1BFOA 3GSUA 2I9TB 1JN6B 3RWFB 2NNAA 1KJ2L 4MQXC 4QXGH 3T3ME 5IBLD 3S88L 2YWYA 2F19L 4F15C 5DD3H 3HMWL 1SMOA 1MELA 1HXYA 4Q9QL 1QBBA 1Y0LA 3LRSB 3VFPB 3A6OA 3DXAA 4Z7WA 2GUOA 4OZIA 4JB9H 2DIAA 3C08L 4R4BB 4YDVA 5D8JH 5F9OH 4JG1L 3ZDYE 3FQNB 4G8IB 4M48H 2P48B 3HNVL 3IKKA 5IHUH 4C83A 2Q7YA 3IXAB 3TN0B 5HYSB 3ULUD 4K8RH 3C5ZA 4PD4J 2ED7A 2OTUB 3CH1A 1T83A 3IDUA 5FYKU 4UB0L 2OQJB 4HIHB 5CSBA 5FDWA 2VLRD 3ARED 4XP4L 3K2MC 3AAZA 3SE9L 4OGAC 4C4KO 4IDJL 5A3ID 2GK0A 4P23C 1RUAH 3O6MH 1NC4A 3ZDXE 5IT2L 1VGKA 1QLEH 3RL2A 1INDL 4MAUL 4OF6A 4XMKL 3GO1L 1AD0A 2FX8H 5EU6A 3D69A 5EBLB 4LCWA 2NX5A 3VDCA 4FABH 4Z7VA 3X13B 3ZE1E 1FNEB 4NPYB 3DMMC 3VWJA 1A9EA 4Y5YB 3WO4B 4K2UL 2CUHA 1DTUA 1RVFL 3ULVL 1P4IL 4U6VH 4YUEH 1IGML 3MREA 4BSVB 1T3FA 1V7ML 1RZ7H 5CJ5A 3MRRA 2P42B 3BP7B 3STLA 4R6UA 3QUML 3MV7E 4RGNC 4LRIA 4NZDA 4LHUG 5C07E 1JRHH 2MHAA 1K5NA 2AV1B 2JIXA 2BNRB 5BZWA 3UTSD 4LCYA 4LVNC 3IDXL 2AJYH 4XPGL 4V1DB 1NDMA 1MJUH 1G6RL 4YWGL 3SJVD 4UINH 5JW5B 5EWIH 2X1QA 4G43A 3SGDI 4GJTB 5GRUL 4HS8H 5SWZE 3RGVB 2D03H 4PJIB 3W11D 4GKNB 1PQZA 4ZFZB 5JHDD 1NPUA 3D2UB 3HI5L 5DHVA 5JQ6L 5DRWB 3V6OE 4HX1A 3SGKA 4HG4J 2BSTB 5DUML 1A6AA 3B5TA 3PDDA 4F7CB 3OKEA 1F97A 1MLBA 2X4SB 2X9YA 1ACYH 5T1LA 2A74A 2VITB 43C9A 2FZ3A 4KJPC 4M6ML 3ILQD 2VZVA 3W5MA 2A9NH 1BVKA 1W0VB 5FO8B 3IJSA 3WFHB 4IMKA 1WWWX 1KTLB 3E6HA 3U36B 3JWNC 3IFOA 2FJFB 1UM4L 5KVGH 1M7IB 3U7AA 2X4QB 1TIUA 2VSCA 5E8EB 2YRPA 3IDMB 3VA2C 4QNPE 1BQSA 3UTTA 4MCYA 1KNOA 5DRXB 3B9KC 2NZ9D 3LAFA 4AMKH 1U8JA 3S34H 2EKSB 3NZ8A 4MDIB 2AK4A 3D18B 3ZE0F 5SWSA 3SDXA 4PJ9C 4PUBH 5CEZH 2FJGA 1ZLSL 3C9NA 1A1MA 5I0DA 3DROB 3IDGB 3UP1A 4FQCH 2CJUL 2X41A 3UYRH 4KK9D 5J6HA 4IMLB 5I8KH 2DQJL 4QRPB 4U1HB 3DI3B 3DV6A 3QJFA 5AZ2L 1XCQB 5HHOD 4DK6A 2OP4L 3KDMB 5I8OH 1A3QA 1JNLH 1X5HA 1U58B 1MCNA 2N1KA 5T3XD 4CBPA 4JKKA 4P5KA 2FEDC 2CGRH 1KXTB 1YY9D 3PP4L 2PYEB 4NO3B 4HMDA 5EOTB 5T1KB 3FQWB 1Z9LA 5F1NB 3VFOB 5AYUL 3LS4L 4JDVB 4APQA 3NACL 3SQBA 4TTGA 1E6JH 2PXYA 1PBYA 2FH8A 2H3NB 2G9HA 3WFCL 5CCKH 5HVHB 1FH5L 3HAEG 4X6FB 4MNGE 1NCCL 5ICXA 2XKSA 1CK0L 2CPCA 3HE7A 3THMH 5B38G 1JZ2A 1R3IL 2R9HC 4HUUA 2VXSL 2J8UB 4FFVD 3KPLA 5I2IA 3AVEA 1B9ZA 3K2UH 1A7PH 1CN4A 1HH6B 3V79C 3QDGD 2BXZA 4WWID 1WCQA 5ADOL 4H1LB 5E1HB 1J12A 1YNKL 1A1NA 1LDSA 4EXPX 2BZDA 1SBSL 3KYMA 4K3EL 3RX5A 1LK2A 4HGWA 1MFBH 3MRJA 1GHFH 3BH8B 2FYYA 1T22A 1V3KA 4I0PC 4JM2A 3KNBB 4F8TA 4PB9L 3CXHK 1B4JH 1WC7B 4G8GA 5LKNA 1NAKH 2AXHA 2B2XL 3QIWB 4R97C 1OT2A 4PRHD 4D9LL 2D0HA 3SPVB 3VFRB 3ZKSD 1RJZB 1I3GL 3MNZB 4IHOA 4Z76A 4LMQI 1YNLL 4TUJA 4Y7MA 3LZFL 2CIIA 3WXVL 5BRZA 3VXSE 3W2DL 2OTWA 1MAKA 3G6AA 2GCYA 3K3QA 5E6IB 1IBGH 1C08B 1GGBH 1HXMB 3HNTL 4M02A 3F12A 3QIUD 3GKZA 1RHHA 1AC6A 3X14B 1KTDB 4EOWH 4LLDA 1NMBH 4D9QD 3QRGL 4NQVA 1QKZL 5KSAC 4LSVL 4I4WB 5GGUB 1MQKL 2W0PA 1Q0XH 4HS3B 2HWZH 4ZSOE 2IMMA 1Q9OB 1RZJC 2AERT 3UXFA 3HR6A 3N0PB 3GJFK 4RNRA 5MENA 4GW1B 1KPVA 3DVNA 2EIZA 4OIAA 4GT7A 5CGYD 1BFVH 3ZDZE 2IAMB 3C6LA 5C09B 4QHKJ 3DMMA 3R4DA 4L3CB 4HLZH 4PS4H 4O58H 3ILPB 4XCNB 5DD1H 4L4VA 3BGMB 3FTGA 5FK9B 3U9UB 3QFJB 2XQBH 4BZ2H 4PJDB 5GS0D 3HRPA 2QQNH 1A9BB 4N8VG 2APBA 4MD5A 5EBWB 4I48B 5CIPH 2IQ9L 4OT1L 4KROB 2AABH 3QHZH 4MA7L 2VDLH 3ARBC 3T0AA 3ZO0A 6FABL 3KYOA 1YY8B 1OY3B 1ZA3B 4O51B 1M7XA 2BOCA 4HZLA 2XTLA 4WY7H 3X11A 3SDDA 4H5SB 5KVMC 4HH9B 1IM9A 2OK0H 3I9GH 3R0NA 1LQSR 5F1SA 1FG2A