4F3NA

High resolution native crystal structure of an uncharacterized acr, cog1565 superfamily protein from burkholderia thailandensis, solved by iodide ion sad
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
387
structure length
374
Chain Sequence
SLPVPGPDALAQSEALAASLRAEIASAGGWIPFSRYMERVLYAPGMGYYSGDFVTAPELSPLFAQTLARPVAQALDASGTRRVMEFGAGTGKLAAGLLTALAALGVELDEYAIVDLSGELRARQRETLGAQAPGLAARVRWLDALPERFEGVVVGNEVLDAMPVRLVAKQARGWCERGVSIDDAGAFVFADRPFARAEEAARLAGIDADEGYVTETHDAAVAFVRTVCAMLARGAAFFIDYGFPSHEYYHRQRAQGTLMCHYRHRAHGDPFVYPGLQDITAHVEFSAIHEAGVGAGADLLGYTSQARFLLNAGITDVLAEIDPSDAQHFLPAANAVQKLISEAEMGELFKVIAFSRGIDGALDAFARGDRSHTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
molecule keywords Uncharacterized ACR, COG1565 superfamily
source organism Burkholderia thailandensis
molecule tags Unknown function
total genus 122
structure length 374
sequence length 387
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02636 Methyltransf_28 Putative S-adenosyl-L-methionine-dependent methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f3nA00
4G67A 4F3NA
chains in the Genus database with same CATH superfamily
2JIDA 1S3SA 4U7JA 4E07A 1Z2CA 1P4RA 2L82A 3G0DA 3JVDA 1NHGA 5GAJA 3EPLA 1LBQA 5KB3A 2GN9A 1W46A 3AU9A 5B6PA 1JG6A 1UC5B 5ESRA 4FLMA 3P1JA 1GQSA 1WDLA 3E9MA 5AI8A 2GTIA 2I78A 2AK2A 2P2LA 1PBNA 2VS1A 2ZVJA 5AOVA 5K51A 1OI7A 4NU5A 3C1UA 1ML3A 5TQ2B 5BMOA 2DQKA 4H35A 3FR8A 1SHJA 3IHLA 3WIBA 5ENVA 2HNAA 4HWGA 5BUZA 4DSAA 3PX2A 2JGDB 4M7PA 1FPQA 2XYHA 4XX0B 1WNFA 4KJZA 5DTEA 3RHTA 4QLBA 1GTL1 3VDMA 1U90A 4RVSA 2Q99A 1HE1C 3MMXA 4KMMA 5EP4A 4E51A 4HWRA 3SYMA 1TDJA 4QXPA 1XD2B 4G0UA 1OXUA 2XUFA 2ZJ5A 1F9AA 1X7DA 1OVGA 3NANA 1L1EA 2E89A 3PYMA 1A1VA 1SR8A 3UICA 1OZ0A 4TUYF 2CJXA 7YASA 5JS1A 1EQAA 4ZVMA 1Y3CE 2AOTA 2BFDA 2IYYA 5FL7A 1LDEA 3ENKA 1L7NA 4MS4B 4RJLA 3P97A 3TAXA 1XZDA 4NATA 5IK2D 3UAYA 4Z3OA 3DLCA 3IAAA 3JQRA 3LT5A 3TJRA 4CLRB 1YA6A 3FNRA 4JDPA 1P81A 3C5CA 1SXGA 4J9UE 1KRHA 4KXXA 9ATCA 1SXJD 4H6WA 2FLKA 2ZJ6A 5DYTA 5JJLA 3K35A 4M1YA 1E0SA 1Z29A 2PRZA 4M76B 1T9HA 1ZLXA 2B1IA 2HZ7A 4MQ5A 5DCYA 5DHSA 1K8QA 5TQVA 4TZ0A 3AXSA 3MLBA 4ZO7A 3V7WA 3U6BA 4PONA 1Z3IX 1F5SA 4JLDA 4FC7A 1S9DA 2AUNA 3H0KA 4LSGA 3MWEA 2CDAA 2H29A 3EDCA 3PDCA 1KVTA 2Z1DA 1AKYA 3BCSA 1U7UA 5TSDA 4H7EA 5LUAA 4HYEA 2QA5A 2XEDA 1X92A 3GRVA 5IJAA 4BFWA 3PZBA 1OXBB 3PI6A 4D41A 1EVLA 4FZ5A 5SZHB 2OGTA 2EIXA 3QKTA 4JXJA 3M1YA 2O8NA 3OZFA 3BZWA 5IUJC 1U1DA 1QIDA 1ZKMA 2IYOA 1CY4A 1E2LA 1LLUA 4RDCA 4DLYA 3SLRA 1E7YA 4UBMA 2PU7A 1OTYA 5BSMA 1S1CA 3L7KA 2G1JA 4G07A 1K2WA 4IVNA 3PU6A 3CH4B 1NHWA 4C06A 4KXFB 4W1RA 4JWKA 5EKDA 1F8FA 2OAGA 1P4GA 3VFDA 3SD7A 4DIKA 1QMGA 5BN3A 1HZZC 2FK7A 2HKIA 1Q5PA 1LQ2A 3DHWC 2LE0A 4C43A 4EJMA 1VHDA 2A9KA 1M2GA 4L73A 4QU5A 4BUJA 2AFIB 3SEZA 1D03A 5JD3A 1NC1A 3VR3D 2VXBA 2XDQB 5FWYA 4M86A 2FXVA 1G5PA 1WX1A 1YKSA 1XJQA 2V5AA 1BHO1 3A8TA 2FMXA 4QBIA 3EXEB 4YECA 1G2PA 1KDRA 3WLSA 2H2DA 3INTA 4PU0A 3ZWWA 1QAMA 4I4TB 4O8CA 4R8VA 1LRJA 1HYBA 2XNKA 3CF2A 3F5DA 3TBFA 3D81A 3U44B 2V3CC 2JHGA 1YZNA 4Z1MA 3ZGVA 3AR8A 3GVIA 2GJ4A 1S1MA 2Z9BA 4A10A 5KIAA 3AF5A 4NWIA 1WMBA 3HY3A 4YO8A 1JA0A 1JKJB 1XEWY 5FH9A 1G9XA 4DV4B 1AF7A 2FEKA 1PK8A 1EFKA 4HQ0A 2PMBA 5DISB 3T5DA 2HN9A 2ZYTX 4AZVA 1H3FA 2FSUA 4YDRA 1CJMA 1LC0A 3EEFA 2RHMA 2Y99A 2UUOA 2I6SA 2A67A 3ED5A 3GRRA 4DNXA 2ONKA 4TWBA 1OIWA 3TLYA 5GONF 4IGAA 1CEYA 4FW8A 2ZTMA 1A7UA 5ESWA 5TQ2A 5L3RA 4BMYA 5IANA 3TZEA 4DT1B 4RK1A 4RANA 9LDBA 3D2BA 1GLNA 1XMOB 3T5BA 2IQIA 3LBYA 3CVJA 1XEAA 2JGDA 4XX0A 1P0IA 1B26A 1IUPA 1R7RA 3I0NA 4Z7JA 1V7QA 2WQ6A 3D5EA 1M2NA 1NFQA 1NYLA 1QE0A 1QIFA 2UVDA 4G1EB 5DH9A 4FGLA 4I3FA 4ZCLA 1NF3A 1XPJA 2HK8A 3A1FA 4CZ2A 3T3NA 4I9HA 3SHOA 3UK2A 4ZV4A 3W5DA 2HB6A 4LKOA 2XNJA 3DBRB 1ORDA 4JI6B 1BTOA 2O7QA 1J6UA 1YS7A 1FL9A 1NR5A 4HUJA 4HWSA 1AZLA 2DKOA 3AILA 1V6CA 3DCIA 4I3GA 3B6ZA 4MS4A 3TINA 2P5YA 2PQ6A 3NR2A 3ZKAA 4ZCTA 1FMFA 1P7VA 1MHTA 3A9RA 4RFLA 1NRJB 3ZR4B 2CDRA 4ARUA 4CLRA 3DTVD 3TLBA 1YMQA 5LMZA 1AO0A 3DVQX 2IZ7A 3MERA 3ZU6A 1E4EA 1AMNA 3SZLA 4J2TA 1MAWA 3TMKA 2NWQA 2I2FA 3EWIA 2C5AA 2W6IA 5ADWA 2NG1A 2N1MA 8OHMA 4AG3A 1ZOLA 4U2EA 4YAWA 1YS6A 4IDCA 2FN7A 3HXPA 5EUQB 3ENQA 1XDUA 3AVPA 3V7UA 4YXWD 4BRUA 1XMPA 2ADMA 5GVSA 1P0PA 4WESB 5BQXA 3PC3A 1QH8B 3EZFA 4F3NA 1EZ4A 2IITA 3U3XA 4F1JA 2QAJA 3SZRA 2D2VA 4ZA2A 4KSBA 1XZCA 1E2DA 4N3AA 2ZRJA 4XB6B 3VSEA 3ZZUA 1QX4A 4MUNA 5I5GA 3LWDA 4P35A 4U7PB 3IQGX 4ALIA 4RBNA 2P9QA 4YRNA 2YZ2A 2Y76A 1RXVA 3OU2A 1A9SA 3L4EA 4D8VA 4J0HA 4RZHA 1Z15A 5IVDA 2ES4A 5H83A 4L8FA 5REQB 1XRLA 4A92A 4UFNA 2XOEA 2QE6A 1ZN8A 4G85A 1U2ZA 4XZ3A 3U7HB 3FNHA 3KFXA 3HCEA 4E1AA 1DC4A 3OZEA 1KAMA 3JWIA 2IUSA 1ZBDA 5IC5A 4KUHA 2ZJ0A 5F4ZA 1V47A 3RH0A 2QRUA 5B7GA 1ABEA 3AC0A 5C1PA 3G8CA 4L8WB 3U4GA 3R4VA 1E7WA 2AFIA 2HIHA 2RJOA 3RC1A 4CMGA 1EBUA 4BS9A 1K8XB 1C1YA 1KZ4A 3ZY5A 1M76A 4PFQA 2XDQA 2XZDA 3HR4A 1WXHA 3CPSA 4IOMA 3DA8A 3EXEA 3TXXA 1OC2A 4GC5A 4CQMB 2X1HA 4PLTA 4DCOA 4I4TA 1KJYA 1SUFA 3N2IA 4ZTBA 2BSXA 3ZHSA 2VZLA 1MNQA 1DCKA 1HE5A 1M73E 1Z6YA 1BROA 2C92A 1ZVMA 2EJUA 1RKUA 2A0WA 3B53X 3M89A 4IDHA 3OQJA 4IX9A 5TT0A 4LNAA 2OFFA 5BV1A 5KSZA 1GM5A 2QG4A 3DJFA 4BZQA 1Z2DA 1KYWA 1XGKA 3QXHA 4Q37A 2ZRNA 1JKJA 4IPTA 5L4NA 2YHIB 3SZ3A 4RF5A 1UMDB 3NBMA 4FIZA 5HA5A 3SFVA 4G4SO 1LDGA 4OQFA 5KQMA 3O8RA 5JAZA 2YWRA 1C7ZA 3VKUA 1IPEA 1E2JA 4ZQEA 3RKUA 1C0IA 1ZH2A 3JU3A 3WWOA 1J8VA 1PDOA 2VPYA 3FGPA 3TW6A 2DYKA 3OH8A 5FQOA 5L4LA 2A8YA 3L7YA 1E3WB 4BP3A 1M83A 1O94C 5BO5A 3RUPA 3T8YA 4DT1A 5T4HA 3DM5A 5DYGA 2AIRA 2BFFB 3MOIA 3PR2B 1GNQA 3AY3A 4ZTUB 4CT5A 2AZDA 4BNZA 3H5IA 3BMXA 4A0FA 3IP5A 5JT1A 2QXUA 3CCCA 5KWJA 1T34A 4IFIA 1KS2A 4XD7A 1BN6A 4YC7A 4GS5A 4YV2A 1FJXA 4EYGA 1JR3D 1GGJA 3TMYA 1WM1A 5JR3A 1KS9A 3DBRA 2ADFA 3VH2A 3FA2A 2J6CA 5D3QA 1OXKB 1YR8A 4LOLA 4XEHA 4PX3A 1RJEA 2HA5A 2V97A 1EVYA 3JR7A 3PFFA 1CULC 3DHVA 1ZICA 5JAMA 3QSYA 1F12A 3LCVB 3OX1A 4KQ1A 3MVEA 4FMDF 1W9HA 1NM5A 2GOYA 3GPDG 1B4DA 1OAOC 2QTWB 5GGXA 1D3AA 4KN9S 1WUJS 1YZGA 2BMFA 3RBVA 4JLMA 4GR4A 1I6MA 4NZZA 5BMVF 3NJ4A 1VIYA 3PIRA 3SEAA 2G8NA 4KV9A 2DC1A 4AWXA 4CHGA 1NLUA 3B9QA 1L5RA 4NYIQ 3A04A 1QG2A 4MK4A 4F4JA 5ADUS 3WVNA 4WESA 4EW2A 2IUYA 4FX2A 3QU2A 2OESA 1QH8A 3S5UA 2IHBA 3L0OA 4JGGA 3HB1A 2CBXA 2XGMA 1PLKA 2P2ZA 3MOSA 3NC4A 1KK2A 4D0GA 2DETA 4ZT7A 2DQYA 1Y1RA 4RTJA 3UGTA 1RQRA 3CUKA 2RHRA 4BJ5A 1L7DA 1TMOA 1TX4B 5J47A 4MHTA 3ZWCA 1UPBA 3IGFA 3PNMA 1ITZA 2QY6A 3ROPA 2HF9A 1UF9A 1OV4A 3DQPA 3I32A 5REQA 3O92A 2Q2NA 4B85A 3RQSA 3WL6A 3EA0A 4H7FA 1S2LA 3OQIA 3P8ZA 4O2RA 3FFAA 3N3BC 4Z0HO 4RHEA 5HYVA 2FN4A 2WABA 1T6BY 1CS0B 3C3KA 4K9OA 5D85A 1ONSA 1ZSVA 4B6JA 1PL8A 3RIMA 1RXEA 4CKYA 5M29A 3WMEA 4L72A 3EPHA 5T4BA 3RROA 1ZFNA 1GA4A 2UXCB 2XQIA 3OOJA 3VNAA 1CR4A 1T9ZA 3DW3X 3TGWA 3O2SB 1UFKA 1DJPA 1BGWA 2BVNA 2IH4A 4MCHA 3C3WA 2JI4A 4HGZA 2JD0A 4MPRA 1SRQA 5P21A 3TUJC 4EDFA 2W2XA 3AY7A 1UDXA 2G9ZA 3GYGA 1O6GA 3PKZA 4LBYA 3RHSA 1XWWA 4TTAA 3HS3A 1IK6A 2JGRA 4HRXA 2NTNA 3CJTA 3E5RA 5CVDA 3C5WP 3KZKA 1DEXA 1UBSB 2OQ2A 3R0JA 4EPTA 3GLSA 3QITA 3TYXA 3V1TC 3A3KA 4AY5A 3GUZA 4C3VA 2OCPA 3BWDD 2WICA 2X9QA 2ZIUB 3CMMA 5JRJA 4ZDKA 1EWYA 1CZRA 2QLBA 2QYSA 2H92A 5IDXA 4A7PA 2YHIA 1RI3A 3A3NA 1WXIA 1UMDA 1YMVA 3FSGA 2WWFA 2AF4C 4F3TA 1P1JA 1Y7HA 2GPBA 4XDZA 3TZHA 1V9CA 3D7MA 1KYZA 2QRKA 3CW8X 2ZSAA 4ZZ0A 5EMJA 3KK0A 3ADDA 3WXMA 2PRYA 1V2HE 1WDKA 4UTRA 1E3WA 3ELBA 1XYVA 1ONBA 2WJGA 1L4HA 3ADKA 2BFFA 2WG1A 4D45A 4GMXA 4MA5A 4J2HA 3L07A 4RE6A 4JBLA 2PUEA 1NN3A 1B93A 4OG2A 3CTMA 1PNVA 4BE9A 2C7GA 1MO6A 3E27A 3W8FA 2UUBB 3RK0A 3FKJA 4K7JA 1G8YA 2R751 4JLVA 4KO2S 4UXJA 3A0RB 2L0XA 4UUMA 3NYWA 3ZGZA 2O0JA 2I7XA 2FMUA 2QROA 2WPNA 3SFTA 3WKBA 5GZ3A 2D7DA 3NTQA 4QU8A 2DFLA 1PGJA 3MILA 3IVXA 1II0A 2VKTA 1EFDN 2RGBA 2C9CA 1EXDA 3PNQA 2V1UA 1PE0A 3SMVA 1XZNA 1P4AA 3LUCA 5GOZA 3WSWA 1RI2A 3FAZA 1X8XA 4CMIB 1BXZA 4DIEA 2FWPA 3FPEA 3IELA 2BRUC 1SD5A 3D8NA 2E4YA 1N2JA 2FSVA 5AJZA 1DAOA 1EDDA 2I2BA 3SOPA 6AT1A 5A62A 3CH5A 2VSNA 2X0EA 2ZREA 4WK2B 5KTRA 2J9YB 3A0UA 1NW3A 1JQDA 4JJ4A 4Q02A 1DAHA 1E69A 5JAQA 1L1QA 2XVMA 1BVYF 1BKDR 1X94A 4M0KA 3TQQA 2NSJA 3ULKA 4F46A 2H59A 1D2GA 3UAOA 4RXTA 2R4TA 1U7PA 1G59A 1NKSA 1PV1A 5AWFC 5A3RA 1DG1G 1MP0A 1WW8A 3DEFA 3MMNA 3QH4A 1GYRA 1FUIA 3AJRA 5K03A 4GYWA 5J5CA 1NL3A 4D3ZA 3QXJA 4AY6A 5C32A 4FYJA 3FRJA 4OH7A 1KIAA 3I1FA 4J1NA 2DPLA 4XQEA 4EUEA 3KSAC 5C5DA 3WGKA 1ZXXA 1DMRA 4GI3A 1VZ2A 2PUJA 3MK31 3Q7RA 4URZR 1CS0A 2MSEB 3VU0A 5TGTA 5A06A 3WLPA 3RIHA 4QGHA 4B34A 1Q7CA 2J59A 2HZBA 2KPOA 3EAQA 2ZPAA 2YHBA 4UEKA 2SBTA 3O83A 5CG2A 3BGWA 3DPSA 4QAQA 5DN6D 4WBNF 1C3XA 3G13A 4KN6A 4KPGA 3E8SA 3KKZA 4J7CA 1ODIA 1T91A 4BO7A 3IEVA 4MW0A 2OCYC 4OX9B 2R11A 3EC2A 2IV2X 4J16A 1RYMA 3TPZA 5ES4B 3GLIB 4CCWA 1E9CA 1XZGA 5KVVA 3HA3A 4H27A 1WXEA 3GA7A 1DRVA 4ZVSA 1DQNA 3T3PB 1Z0FA 3X2SA 5L4SA 2QMOA 3GLGE 1TQ4A 2MT9A 2D2XA 2YIVX 1H2HA 3DXFA 4RVGA 4MV7A 4RX1A 4XVHA 3CM0A 2HQBA 3LL4A 4A8JC 3LUJA 5M5BA 1HEYA 1ZMOA 5FL3A 1HL7A 3Q88A 1W5SA 1HC7A 1DZ3A 3G1TA 5KWIA 1U7HA 1R0RE 5JFTA 1TM1E 3R3YA 3CO0S 1YONA 3EARA 3SKVA 4YPOA 1CSEE 1OH6A 1VQ1A 4H1VA 3N1UA 1GO2A 2G1PA 3F6YA 1SVOA 3NBYC 4CQJA 3F97A 3KAQA 3N87A 1QO0A 4K6MA 1E58A 2CLHB 4Q7MB 4BX3A 1EPUA 2V7WA 1YHNA 4X8OA 5JQGB 3IODA 5SYAA 2QLFA 3IAXA 3H7IA 5EC8A 1HDZA 3LUHA 4JC4A 1ZIYA 2Q46A 5IARA 4L6CA 4BP9A 3QXXA 4DNQA 2E4VA 2QNBA 1XLWA 2WKQA 4KR0A 3VHXB 1HTBA 5K6AC 3L8HA 1HYHA 2WNIA 1YE8A 2NQTA 3AHEA 1EG7A 3JYLA 3IEXA 3KEGA 1YJBA 4JYBA 4B40A 4D9EA 3VR4H 2H1IA 2RB4A 3GFQA 1RHQA 5AJHA 1I36A 3OHPA 2PVCA 1Q3HA 2C5LA 2DFNA 2P7IA 4GU5A 3M6UA 3JAMA 2V7UA 3OY2A 1O3YA 3PGMA 5C8VA 2PFKA 1CHDA 3AONB 4DLSA 1T13A 5HKOA 4K86A 3RJMA 4GO1A 3LQ1A 3E2IA 4IIFA 2PGOA 4QAJA 1CUGA 4K5QA 3UBMA 4CMIA 1KZ7B 3A6PC 3VYTB 1OTXA 5KWVA 4CM3A 1QPBA 3WNQA 4B3TB 3EUWA 4FIDA 2AK3A 4P33A 3TLEA 2IX3A 5LP6F 3PGJA 5HM8A 3HJAA 4LTDA 1ECGA 2HWUA 4BNUA 3QW2A 2Q5EA 2YYZA 3VTZA 1XTZA 1E62A 2BKUA 3A31A 3EZ9A 4WE3A 5FBRB 5KYUB 3DLTA 4MVWA 4RM3A 2I7CA 2O57A 2XGGA 3HZHA 1B76A 2Q5IA 1Z36A 4LNHA 4GR5A 1XBTA 2OB1A 2C5GA 4GX5A 2Y92A 5MGBA 3WOVA 1NQTA 4M37A 2JLAA 4EENA 2CD7A 3KTAA 4YV1A 3K70D 4RSRA 1KE2A 1YAHA 2K2QB 5E7MA 1GUYA 3MRSA 1H9CA 1K7YA 1GG9A 3PEYA 1DIBA 1XQXA 2RK3A 1L4GA 4F4IA 1WQ4A 1XDSA 3LVRE 4ZT4A 1NC3A 2GEBA 3NDBB 2ZKIA 2I67A 2ETXA 3BILA 4WCFB 3KYIB 4Y2XA 3WK6A 1WABA 4TV8F 1RHKA 5KYGA 2A5DA 4CLDA 4R8MA 2DPHA 3ZDFA 3MTBA 1O77A 3O74A 1UAGA 1YZHA 1IEQA 4TM8A 5EGNA 4JVLA 5BRNA 1EFUA 1P45A 2WLTA 2F64A 3O21A 2GJ9A 4UQPA 5CBKA 3DZCA 1ESEA 1QR2A 3FYSA 4KL8S 4OUKX 3TTVA 3U31A 6Q21A 1N57A 5AHXA 3HCRA 1U0BB 4OI1A 1CUSA 1VZ3A 2ONJA 2NU7B 3GLIA 1XPRA 4IS3A 3AVTA 1Z17A 2ZB4A 3TIXB 5C5CA 4AKGA 1T6NA 4KITB 1BWSA 1ZPDA 2RHJA 2C5BA 3O82A 4GPIB 3WYNA 1W30A 2ZIVB 2ZJ4A 3IIKA 4I08A 4LYJA 5FIUA 5SZIA 1Y6GA 4G0YA 3QX9A 4BXOA 3D6AA 1G7TA 1NIPA 3NG1A 2C83A 4PM4A 2FZWA 2Z6QA 1CP2A 2D54A 1GAWA 4DE5A 5BV8A 2HMAA 2DU8A 2W48A 4BX8A 2CNWD 1IJKA 5A71A 1E2PA 2VI5A 3BS4A 3GRKA 1UIRA 2ZTUA 2CXHA 3E03A 5IYZF 4FZRA 5ALKA 1DL5A 2XRFA 3KOWA 2UYQA 4C0WA 2AZTA 1J21A 1WV1A 3GEPA 1T9GR 1OBHA 1XHFA 3ILXA 1ORRA 4QXRA 4AIIA 1JH9A 3GD5A 2QUHA 2Y2UA 3H2ZA 3N2EA 4NECA 3ZLJA 4KWCA 3DFMA 5AUPB 2HU5A 4DKJA 3FJ1A 1CWUA 1USUA 4ZZIA 4DBVO 5JQGA 3HJCA 3MTJA 3AIOA 4G5XA 5A5EA 3AJ8A 3EOAI 2C7PA 4B43A 4YT5A 1TTQB 1FYFA 1NJ2A 2R47A 1KOJA 3SEQA 1P2BA 1E2MA 4ZK2A 5KYWB 3ZIUA 1WB5A 2C1ZA 4PQRA 2FW7A 1RLUA 2QL6A 3H04A 4KH1A 2WM3A 3SIRA 4J0JA 5F2EA 3VHXA 1GKYA 1Q7EA 3N6RA 2V5VA 3UUWA 1Z8NA 2XMDA 3IAFA 5M7EA 3B2QA 5JFOA 3I34X 4BMVA 3AIIA 1VDZA 3OE1A 2X7HA 1P7CA 1KI3A 3KEQA 2A9QA 1KRWA 3HU2A 3K6KA 2CSUA 5D5QA 4EJ2A 2HGSA 1PJ4A 3S2IA 1SBQA 3KSMA 3NEJA 1RLMA 4CLXA 3HLTA 1NVXQ 2KM1A 1E3SA 3B38A 3F49S 1OJ7A 5BT8A 1IQUA 4HB3A 4OLBA 2M98A 3G0BA 4OQEA 1JEOA 2R97A 1JN0A 4JOBA 2ZLBA 1KSJA 5C52B 2JEZA 1CB7A 3RK1A 1HNZB 4MVJI 3F90A 3HEMA 1JMVA 4LMAA 2HFJA 3AGPA 5CNIA 3W4IA 1OAAA 2GX6A 2ZPUA 3WLJA 4DMKA 3SVTA 1EK5A 1EX9A 1IEWA 2GVDC 4US1R 4GQIA 2WJYA 5KYUA 2JKVA 3A1NA 2HXSA 1RP1A 1AC5A 2FEMA 2ZI4A 5TLSA 4P0PB 4AFNA 3DFKA 1CJKC 1O94D 5FOWA 5GMOA 3N9IA 3VR6H 4WY2A 2R6CA 5DV9A 3FMFA 3DLAA 4B6RA 3RAFC 2YFQA 3ISTA 2FR8C 1TF7A 1W52X 3FHJA 3OFJA 4J2OA 2AVNA 3TDKA 2NO6A 1W4LA 3WV4A 1N2SA 3JYQA 4BLPA 3SZGA 3FWNA 4LGCA 1SWVA 3CONA 4Z9YA 5ALWA 5EIBC 1H6DA 3F1KA 5IT9A 2WWIA 4FZVA 2XCRB 2IEYA 2WU3A 4GIBA 1KMQA 1P9WA 4WCFA 1CR6A 1GCUA 1P1CA 4IDBA 1HT0A 1SHUX 1NG1A 3FRHA 1X1AA 2UUPA 2I87A 1T1IA 1J5PA 4EG0A 4OAQA 4P7JA 1ZGAA 3HUTA 4KX3A 4QWWA 4ZQCB 3B60A 1T29A 3N0XA 1F4LA 5CFQA 5JNRA 3GPBA 3ODGA 3ABRB 4ZWNA 3NUGA 1GN9A 3ZVKA 1H5NA 1K7FB 2QMZA 2XOKD 2NU7A 5FFMA 4XUCA 3RYHB 5A4IS 9GPBA 2CZQA 4EGAA 4JQCA 3VNUA 1HG0A 3AFOA 2IF0A 5ICFA 3P0FA 2FQ1A 4M7RA 4BLOA 3NM4A 4IJVA 1MORA 4RHTA 1QHHB 4AIRA 1GLGA 2NXCA 3I92A 2C2YA 3E61A 2XUGA 3JWHA 2HDNB 1Y3BE 2R8EA 5JY1A 3BKXA 2JFWA 2GD1O 3HYCA 4LY6A 3Q9LA 1JA9A 3P26A 2COKA 2PH1A 2QVYX 3IUNA 1P31A 4FEEA 2GN6A 4EB3A 1FXWF 5FOXA 3C8HA 1AMUA 3FOBA 4AT1A 3AVXA 3OM9A 4FS8A 2II6A 2VH2A 3IAM1 3QVOA 4RDHA 4IHKA 4L5IA 1K7XB 1BMFD 3U9TA 3CUUA 1RYEA 2ZETA 3IHKA 3NHKA 2I3GA 4MA4A 4R9NA 5JXHA 1FDUA 4I5IA 3OURA 2E4WA 1SQ0A 5SY6A 2RONA 2J6BA 4NE9A 4B71A 3O31A 2A1TR 4B6EA 4CKBB 2BSQA 2HJSA 1AM4D 1G3MA 3W5SA 2JS7A 4AJOA 1J49A 5KYWA 2BGWA 1NY6A 4JJ8A 3D6TB 3P96A 4M0CA 5CDFE 3H2KA 2MMGA 1YTUA 1BJTA 1GKKA 1WXGA 2WUEA 1EP3B 1SQFA 3H5AA 2AE1A 2NUAB 4B6FA 5EYPB 4QODA 4HGNA 4FXOA 4QNMA 3GOHA 4OQPA 1I5EA 5E95A 1ONNA 4DLAA 1XTKA 2J9RA 1J9GA 3U3RA 1EA7A 4NF2A 1FJ2A 4L8YA 2RH9B 3HYNA 4LN1A 1WE2A 1OBOA 4JVNA 1NQWA 4ZO4A 3TAHA 4DABA 3NHAA 4U2GA 3SLGA 4PWYA 1SHTX 2VJPA 3BL8A 3JQBA 1VI2A 5FTWA 5H1YA 3TRJA 3IUMA 4G26A 4YRGA 4U2DA 1KI7A 1FDWA 4NJMB 3TIGA 3LXRA 1ONOA 1PR4A 4WOPA 4FILA 2CXOA 3A27A 4PG4A 2GEKA 4P58A 4ESOA 1JI3A 1A9PA 4RQAA 2WV9A 4TL6A 2YFKA 2IELA 2EFEB 1IWBB 2FSFA 2RSLA 1KJ9A 2XRMA 3LPNA 3K9BA 4URWR 3IALA 5L3SB 2OO7A 3ZUGA 3LCRA 4E5DA 3W2FA 3ETHA 1KK3A 1XA0A 2FX5A 4ROSA 3UA3A 4FFVA 3MTEA 4QARA 4CU5A 5B7NA 3FHLA 3IXLA 4NCHA 2YWBA 5AKZA 4N3GA 3PDHA 3HY4A 3ZPXA 1WQ1R 3H0EA 4UAVA 2JBHA 2ID7A 3LX6A 1Q0PA 5KVAA 4NZPA 2EJWA 1LX6A 1TK3A 4ZC1A 4CT4B 4ENRA 1RQPA 1Z13A 3NEYA 3UW1A 5BURA 4IV0A 3OZVA 1HEIA 2NPIA 1QM5A 2PGNA 4MP3A 4YAFA 3DUWA 4OFZA 4DGSA 4URFA 4DEVA 3SIXA 5EJGA 5KJCA 4V2UA 4R2HA 2IXTA 4OFXA 3ORQA 4BVJA 4MRRA 16PKA 4GMGA 3IEPA 1OGIA 3OQNA 1THTA 3C4VA 2QM3A 3PNKA 4RVOA 3B48A 4EECA 4FSDA 4DHWA 4Q48A 4HQ6A 1AURA 4KRGA 3RYHA 1XQWA 4TL7A 3H3XA 3WICA 1V1MB 3VC2A 2RGRA 3ACBA 4GKJB 2V6MA 1QHHA 4RTNA 1FUUA 3TQFA 3R7BA 1LV7A 2OO5C 4P3YA 1XZPA 2HMYB 3W9SA 1NULA 1U0JA 1VLVA 3DVLA 3AERB 4RD6A 4U7FA 4JR0A 3M83A 4CTKA 3P2EA 3U9LA 1YC5A 2B20A 1QLJA 3OZUA 8MHTA 3PHIA 1A8QA 1K5DA 2Z2YA 5F52A 1B3BA 4D99A 5CITA 5A5FA 3K72B 4ZJPA 2HIGA 4WPGA 1QVZA 4RCZA 3O94A 3E22B 5CYOA 1QZ3A 4HKTA 4GBMA 2H4ZA 2X1VA 1X86B 1YE3A 3H5RA 2XNHA 4KGXA 1K89A 1MAAA 3T9CA 1MKYA 2W2VA 1JDBB 5C5EA 3UBTA 3KDPA 4IUYA 4PRYA 2XDAA 5ED0A 4PC6A 4CKBA 3BHMA 1FP2A 1GOTA 2QNRA 5DHAA 2X8LA 2NTEA 4JYPA 4LGYA 4KQIA 4C4AA 2WJHA 2JI9A 2OHHA 3BBLA 4B9EA 3K2EA 4I4LA 4DR2B 3S2UA 1RAFA 3EVEA 3EIXA 4RGBA 1BD3A 2QD4A 3GVCA 1UOOA 2J3EA 3ZLUA 1Y42X 1Q17A 2GMWA 3KAPA 4NS1A 5AI5A 4EHLA 1LY1A 4B47A 1OZHA 2NUAA 2I7TA 4MUXA 2IPOA 2OZVA 3GLKA 4OQZA 4Q82A 5EYPA 3R9IA 4ESHA 3OQOA 1XN1A 4J1SA 4IICA 1M0WA 1XVLA 1UEIA 3KJZA 1D07A 3QOWA 4I2VA 2H2IA 2WPDA 4K1XA 3UGQA 2DFKB 1GG5A 3ETDA 1NYQA 1W5EA 2ZJ2A 3NAGA 1NMSA 4FXPA 2AWOA 4LYHA 4ROTA 5F5NA 2AVDA 1DKLA 1R15A 3IQXA 2OXRA 4MGYR 4TUYB 4WBXC 4E7PA 5KNBD 2Z6AA 2W2TA 1Q1BA 2JAXA 5LBIA 5B1YA 4AKTA 2QP3A 1R0SA 1MQ8B 1UP6A 3LPLA 4NJMA 4EF4A 3Q8LA 2C2BA 4QUKA 3WA6A 3WLKX 2GGSA 5H16A 3L9WA 2IX9A 1KIMA 2QQ5A 2ECOA 4KXNA 4Y9TA 4ZO8A 4W9NA 2ZXFA 2PGIA 1PS8A 1RBMA 2CMKA 1W8IA 2OV4A 3FGNA 4QTUB 1RZRD 3I5YA 1EGMB 3OTOB 1GUZA 1JKXA 1PT8A 2XMGA 3JZDA 4LG1A 5L3SA 1G17A 4EGFA 1L8XA 5JXJA 2BGRA 121PA 1G20A 2B82A 1UFOA 3A6GA 4HNHA 4YP9A 1O95C 4ZEOA 4U8HA 3BXFA 5CXXA 1FBTA 4R6XA 3K6RA 1AOXA 5DDIP 2IKSA 1JF8A 5IZCA 3LWZA 4WW0A 2IZ5A 1LPNA 1G21E 3PXXA 3ZWMA 3RSZA 4WJLA 3EH2A 3WQBA 1G42A 4EATA 2IYWA 3UY4A 1VTKA 4P38A 3SM3A 4P3NA 4KHZA 3ZDDA 2PS0A 3G5LA 3GMDA 2POCA 5LA6F 4D57A 5J1SB 2WZDA 1Q22A 3M3DA 4RL6A 4GEKA 4E5SA 5CFMA 3HVJA 4XX1A 4YAUA 3PSAA 1P7ZA 4NYJR 1YJ5A 3UWMA 1KU0A 2BBSA 3HUUA 4MHOA 3WMFA 2WLSA 1KBZA 1KP9A 4Q9IA 3W1WA 2OD2A 4D4HA 4JR2A 4Q3AA 2A14A 2ZRQA 1GTZA 1J1IA 1Y48E 2G82A 2QV0A 5CK5A 4HDKA 1E6CA 1Y7TA 3I72A 1E79A 1LZKA 1MU0A 3H1AA 3Q72A 1S4QA 1JL3A 1V1MA 2PR7A 5DX8A 3R8FA 3CKMA 1CX9B 2O4UX 4JT9A 1NKVA 2VWHA 3BWMA 1KO8A 1MTZA 2PZBA 1ULAA 3AERA 2FZEA 3T3EA 1FDRA 4C76A 4CG3A 1O6BA 2OD9A 1JJVA 3W04A 3LXMA 2V5UA 3V1KA 1EFTA 3WNVA 1DCMA 2LV8A 4CMBA 2NZUG 1JECA 4D92A 2I6XA 3UTDA 2D00A 2JFPA 3VKFA 1EDZA 3E22A 4II7A 3TM4A 1PDVA 3GFOA 1JHXA 1YL5A 1YA8A 2OXIA 1N32B 1ECLA 2X5JO 3KJGA 2O05A 1Q2UA 3RU3A 3NRCA 4MV6A 1YTLA 3F6CA 3LQ2A 1IAQA 2EZ8A 1UBCA 4NR0A 1NBEA 2CFIA 1F2DA 2PM8A 3DDNA 3KKMA 3UJHA 4D6PA 1EFHA 4ENPA 4B4WA 3ORRA 3RSSA 1Z38A 1GFZA 2HPZA 3WA7A 3OCWA 1DS6A 1L3CA 3LMKA 2FPMA 3PUJA 4F12A 3DP9A 3FVTA 1RPAA 4EKYA 4UHEA 1FJHA 2W6JA 3F7MA 3ZWPA 5G41A 1ST3A 1CY2A 1LLCA 1TM4E 2QG6A 3NH9A 5DMHA 1L8AA 5KUTA 1JT9A 4RUKA 2CLMB 1G63A 2JHFA 2IXBA 3HKDB 2JA1A 4OLHA 4TUYA 5DCLA 4LMPA 5CLJA 1F6BA 5I7UA 1E89A 1F06A 1CVRA 3U40A 3MHTA 2KSQA 3THXB 3ZW9A 3KQLA 1DUVG 1ZMXA 4P7GA 4XQ9A 3A37A 1OI2A 3IJEB 4J75A 2QTVB 1KPIA 4D0SA 1ISIA 5AJWA 1CIVA 2GARA 1JP7A 4IUBS 2W93A 3B1XA 3BFJA 3ET4A 2XUDA 1QO7A 3KDAA 1E1KA 5JJCA 3OP1A 1HOXA 1W88B 1CCWA 2PSFA 1UXGA 4IWXA 3VHRA 4UHHA 3ZLVA 4MXDA 4IJWA 2YV1A 2HC9A 3Q6MA 3TEJA 5UKDA 2CHEA 3E7PA 2G1UA 4H6PA 5CHEA 2GWRA 1L8QA 3CA8A 3K8OE 3RHFA 4HB0A 1USIA 2VYNA 3EOBI 5JANA 1C9DB 4G8BA 1QK3A 3GLRA 1V7CA 4FDMA 4KODA 2EGUA 3O9MA 1XNQB 1UINA 1DC7A 2PWPA 4B7ZA 5JDCA 4JJAA 5DM1A 4HAVA 2XYVA 1N7IA 1CDOA 2WMDA 4H15A 3NHPA 4NIMA 1UT6A 2C31A 1FU8A 3CLKA 2Z5VA 4MJ7A 4B6OA 4DADA 1C29B 3AZOA 2OFPA 1E6LA 1DRKA 3QIVA 1SZPA 2JANA 2IIPA 4HT3B 2QPOA 4ZAYA 4DHEA 1KQPA 5JFGA 1EFVB 2GAJA 3TRFA 1HG1A 3ZCUA 1Z4QA 3MSCA 4HQFA 1XP8A 4KQEA 1Q19A 4KXLA 1N8SA 1SU7A 4D9HA 2Q1XA 3BE6A 1JLHA 1MJ5A 1URPA 4Z53A 1G60A 1T8UA 3ZIDA 4F8YA 2ZSIA 1F4PA 4FGZA 2O7RA 4TGLA 1Z0JA 3BD8A 1MNAA 2OV8A 2QXYA 3I09A 5ALQA 3DOJA 4HNAB 3IJ5A 4Z9FA 2ERXA 3RF7A 2NAPA 2ZBEA 2XTNA 1L7XA 2ATCA 1XAJA 3D3EA 3FR7A 3H8JA 3IP9A 2R1TB 4PNEA 3I6ZA 3W9UA 1M2FA 1LD3A 1U28A 1UJBA 2YZ7A 2ZJ1A 3LRPA 2Q0SA 2D5IA 3MCVA 1A77A 4MQLA 1WBDA 4WERA 1PJQA 1W1UA 2VJNA 1VKOA 2XKJE 3UC5A 4YMTA 2WJWA 1HXHA 3PRKE 5DSZA 3O93A 1D1TA 4EF6A 1Y6QA 2P40A 2Q8NA 3O2JA 4WXEA 5DT2A 2G5PA 2QAGB 1AS3A 4LJYA 1V7ZA 4S0XA 1R74A 2A0YA 2YS6A 4QE3A 5E7QA 3PLAE 3GZJA 3N0VA 2A92A 4IDQA 1OXXK 2WEKA 2PD3A 3D4PA 4JBWA 4JX8A 3RWBA 5GINE 4UCFA 5EIBD 5BOVA 1JJFA 2IVZA 3TOVA 1STOA 3BRSA 3II6X 3KEOA 2YOGA 3KR9A 4UC0A 1S96A 3CU5A 1RXSA 2HRZA 3NCHA 2OV2A 1G2OA 3IIMA 4HLUC 2COEA 4QUJA 2I7VA 3G7SA 5M3BA 3U62A 1K92A 3LW7A 3AL3A 5F78A 3C85A 4LZWA 3K2QA 2IRWA 4DMRA 3H6GA 4U7TB 2Z83A 4UZEA 1CZKA 1IQPA 3I42A 5C37A 2GRUA 3AYZB 1JHQA 3WL7A 3OHSX 4PRZA 1DG3A 4OMUA 2Q6LA 4NEHB 3EASA 3GK3A 5I7SA 4ERNA 1KY4A 4HNUA 1LH0A 1ZGCA 1RJGA 3LC7O 5CR9A 5EJEA 1ZOIA 2ET6A 1JX6A 1KIFA 2V03A 1PTKA 2WM8A 2XSZA 1GY8A 3FWYA 3HKDA 4LDNA 2F3PA 4KYTA 4G36A 1JLRA 1JEEA 3NC1C 1PJBA 2GO7A 2PL5A 4C14A 4WN3A 2YKGA 1PK7A 3THXA 3Q1LA 2C9DA 4FMDB 2W6NA 2BY4A 3RYIB 3E2PA 2VHWA 4JEMA 5CDFA 4C3OB 1H9AA 4ZYTA 2QJWA 3OX3A 1MPTA 3TW8B 3RB8A 4DW8A 3KJEA 2GK7A 1O97C 2ODNA 2R96A 4WKGA 4YROA 3CX8A 2SKEA 2PT5A 4FLEA 4FB4A 2OP1A 4PYMA 3STVA 1NW8A 3KJFA 1FNSA 1W88A 4YT4A 5I9MA 2VTEA 1UXIA 3N6XA 1MH9A 2QI9C 4DB2A 5EHIA 4RY8A 3WO1A 4CI9A 2Y1GA 4MIEA 1RYHA 5CA0B 4B3JA 2H4WA 1PWZA 2R3SA 4DIDA 1E2EA 2V45A 1BEEA 3DE5X 4QEDA 4S1TA 5EY5B 5FI1B 3ZGOA 3FVVA 4RZIA 4PO8A 4W4TA 3F7NA 4YI3A 2YWJA 4HATA 1GV1A 3G2MA 4ZTZB 1VB3A 2I66A 2VP3A 3DMGA 3DXZA 4DJAA 1P5HA 4XASA 2NXEA 2WC1A 5G4LA 4HB4A 1SC1A 3O0TA 1D0IA 3GC6A 2F9LA 2SHKA 3ETGA 3OEYA 4KGZA 4P9NA 4QG3A 4XJTA 5LZ8A 4AO8A 1WA5A 4D7AA 1U3GA 2C8LA 1R0LA 3ESRA 2JLXA 2H0RA 3AG6A 4LJSA 2V6BA 1QRTA 5DTMA 3DNFA 1EFVA 3ZDBA 3HP7A 2JBAB 3KOYA 1UDRA 5FBKA 4F2WA 1ZNXA 4I9NA 4WBSA 3OPYI 3T95A 1V1RB 4FCWA 1IY2A 1RKXA 3CH7A 3WMGA 4DZZA 1V8FA 3NT2A 4IWNA 2GLXA 4TL8A 4YJ3F 1P1HA 3ZXXA 4OBBA 5G02A 1J24A 3MQ2A 1PFKA 3KZOA 4NCKA 4A5SA 3NJ8A 4HNAA 4TTVA 4DCTA 2FWMX 3PPXA 4P0TA 4Q4LA 4N82A 3U13A 4CM1A 2NLOA 2R1TA 3DL2A 3QJ5A 4TRNA 2PPVA 4FNAA 4LEIA 2POQX 4OGKA 3EUAA 1TJ4A 4EW6A 3SS8A 5JXGA 4O4HB 1NDHA 2Z2ZA 4JX9A 3OIDA 2AEEA 3RG8A 2PT9A 2VDKB 5L8VA 4UE2A 2GFQA 4KWIA 1U3TA 2QAGA 4GOXA 4QHSA 4QDUA 3TNJA 3AWDA 2PYZA 3DO6A 5CB4B 4XDGA 3CVXA 3IPCA 1I30A 4HAZA 4OMDA 4UXIA 4P81A 1X7HA 3V4VB 1FFSA 1QORA 3JQAA 3RIEA 5ECYA 2GCIA 3WK4A 4WOCA 2IXAA 4MLZA 4FEAA 3NONA 1W5AA 2OBLA 2JDIA 4QQ8A 3W5IA 5EFZA 3J80A 1YKGA 2IYTA 3AUYA 3GBPA 1BEUB 3EDQA 3G7NA 4C07A 3HO1A 3MJFA 2PMEA 4HS9A 5K0BA 4WWHA 4WSOA 2RHCA 3VOAA 1IN6A 2ZU6A 5F33A 4S1VA 2XMPA 1I3CA 3B2EA 5IJZA 1EKXA 3L0PA 4P8RA 2P3LA 5DW0A 4LK2A 3I2FA 3GJQA 3MC1A 1EXWA 3ZY4A 4HRAA 1JLLB 1OWPA 4AO7A 4C1BA 1VOTA 4F3YA 1YMUA 3S8YA 4JOQA 1UDCA 4Q24A 1GPDG 3P4XA 5CLLA 5THQA 1QF6A 1P9NA 1X7XB 1PJ8A 1XU4A 5LQUA 3MZ0A 2Q49A 4GT1A 4BATA 3GO4A 1KP2A 1NFRA 1ZK1A 2VZEA 4QOIA 4WCDA 2GYYA 1ZOSA 1RKQA 3NVAA 5CG1A 1X1RA 1KJQA 1OZGA 1HQCA 2E6UX 4M9ZA 5FBHA 3UW3A 4BN0A 5AW8A 4OHMA 1CQJB 2OFXA 3RREA 3RYIA 3VPXA 4JI7B 2VPWA 3B1KA 1J7JA 4C30A 1H8ED 2YW2A 4EMUA 5I7OA 4KTTE 1RYYA 4M7WA 5IT4A 2VWGA 3DDHA 1CERA 3L7MA 2Q4BA 4J6FA 5KJ6A 1J2JA 3UYKA 2QSJA 5C1DA 1WSBA 1R0KA 2BFPA 3L82B 4P86A 4PS0A 4CIVA 3T9EA 3IL2A 3JZAA 3E2MA 1GPNA 3W06A 3MGGA 1RE1A 2PK3A 2VKQA 3BPSA 3WYCA 4A6XA 4BVEA 2OG1A 4Q3BA 4RHFA 2CB0A 2FPOA 2FSHA 3JQEA 2GR9A 2NSDA 2VDJA 3NNDA 5KAMA 3OCYA 4DG9A 1PSWA 4ER7A 3E0XA 1MEJA 1SH7A 4E30A 4N03A 4Z1OA 3CNOA 3PPIA 3TS1A 2H6EA 4CDMA 4J9VA 4UBNA 3VYVA 1P1RA 1OYOA 3VR5H 1VPEA 1KEZA 2BP7B 2J87A 2OYCA 2QK4A 1T5SA 1DAEA 1DOZA 1NXXA 3EY9A 4BKOA 3ILVA 3P9RA 4E2ZA 5ITSA 2REQB 5TS2A 4B46A 3RKSA 2HQRA 4K0KB 3ZY3A 2EQAA 2F6RA 3A10A 2QRNA 1GGMA 1TU4A 2PQ2A 3IKJA 3P0RA 4OXIA 5CT9A 3UHJA 4URXR 1QHFA 1UJ2A 2JBAA 1LDBA 4DLUA 4UZFA 5AJXA 1BE6A 1V1RA 1AS2A 2G36A 3A2NA 3DHNA 3F2VA 4JB3A 5PGMA 4DLXA 4HBZA 4MITA 5D00A 3OY7A 1JXOA 3GNTA 1XVVA 1E2IA 3FWHA 3KPWA 4U9UA 3RKRA 3FYUB 1AUPA 1Y1KE 4ZI5A 1RYZA 4DIOA 3CGWA 1VPVA 2J5RA 1GCAA 1FTWA 2VP4A 1E0KA 3NKFA 4GOLD 4HZGA 1OJLA 1KMCA 1P0FA 2YWCA 4N41A 3FTEA 4UNNA 1WHTA 4FKZA 2CXQA 1EFRA 4U02A 5DKFA 3N3AC 3L7NA 5K0ZA 2QVXX 4DN6A 4PTYA 2Z0MA 1DJQA 2BSAA 3UPUA 1VSUA 1KWKA 3GEMA 1NR7A 2WJVA 2QTFA 3DL7A 3EBOA 1E4YA 4RKWA 1O95D 3TZCA 1RR6A 3UCEA 3OA0A 2UVPB 5AK3A 3AYXB 4N01A 5AW1A 4PIPA 5EUCA 1YUBA 5J2TF 5GOTA 3WLLA 2CY0A 4Q6WA 2ID9A 3B1JA 5F2KA 4H59A 1DXQA 4LDJA 5LZ9A 2UXDB 3DOCA 3OZAA 1TW2A 2XMZA 4MWZA 4CM8A 2VJQA 4NI5A 1WB6A 5KOHA 4IH9A 2D59A 3OOWA 1ICIA 2I1WA 1VGRA 3NOXA 1C7QA 1S8OA 3AOEC 3SDZA 2IP2A 4EH1A 2RHBA 4ZI3A 2J3JA 1DIOB 5KSPA 3DLHA 2ZIZA 2W2LA 3OJOA 1DT3A 1ZM4A 5JC8A 1ZD3A 2AX4A 3I0MA 1GAQA 3IAS1 4OIFA 3W1VA 2OHGA 2FDRA 5JAPA 1T2AA 3RS9A 4K2AA 1ZJ6A 2HHHB 3FNQA 3SXPA 1JLLA 4F6LA 1FX1A 1PV4A 4X60A 4LHSA 2V3VA 4R71A 4KVAA 1EHYA 4OB7A 4DLRA 4JLKA 3VJKA 2G06A 3FCEA 1RHUA 2I6QA 1X7XA 3CW9A 4JAVC 4E31A 5K0EA 4JV5B 1E1QD 2J08A 3H5WA 1FP4B 1UAAA 1X1TA 3V8BA 4NV3A 3R3HA 4Q7KA 4ASUD 4ESEA 3ANNA 2BR5A 1YOVB 3L4SO 3CVVA 4BVGA 1G9TA 5AVYA 1C50A 3UJ3X 2TYSB 1SQGA 3ZCVA 3ZDCA 4LK3A 3U4HA 4H08A 1V8DA 3IURA 3OFND 3HRIA 3KG2A 1E0DA 3D1JA 4L4ZA 3NUQA 2ZAIA 1J22A 3AUUA 4W8OA 3NB0A 3PWTA 5DTQA 3STTA 5SYNA 1MAVA 2G7ZA 5LP6B 1JSLA 4TLMB 1TYBE 3L0IB 3VU8A 2E48A 1PD1A 4B3HA 5JMTA 3JQ9A 1AGPA 2QR5A 5ICEA 1HT2E 1DFHA 1XEXB 3BMOB 3M1IA 2GILA 2O2EA 1MB9A 3C6BA 1Q1NA 5L45A 1RBQA 5B4TA 5MHTA 3CE6A 4BKPA 2PEYA 2HLHA 3TLMA 1RADA 4JVMA 1XJWA 5K8LA 1DDGA 1DTSA 5EXTA 2VUIB 2DP4E 1WBJB 2PMFA 3A3PA 1UFQA 3LCJA 4LWZA 4XR9A 4YJ2F 3SJAA 2R0QC 2BP7A 1TK2A 3E1GA 3PR3A 3P9QA 3MCWA 1VYHA 1Y8CA 3NHSA 5F73A 4N7RA 3T7CA 4KFCA 5C31A 2REQA 3PD1A 1KKUA 4YMGA 1PK9A 2XA9A 1GL6A 1IHUA 1CR1A 2Y1FA 3WK8A 3OTWA 3ILSA 421PA 5JPCA 4C4PA 5KOJA 1C4WA 2UAGA 1GPYA 2PR2A 4JR1A 5AKEA 2JFVA 3QMVA 4TV8B 4DA0A 3T7KA 1ANKA 3SC2B 1CZHA 2PGJA 3LPAA 4ZGWA 1A9ZA 3ZXUB 1W6UA 1HKUA 4GM4A 4R9RA 3ER8A 5JSYA 1LPSA 4S12A 1S7CA 3DDZX 3FYUA 5CNMA 5CBPB 5CFOA 2H85A 2ZWPA 1QV9A 4DLPA 3T3MB 2ZRIA 5DSTA 1B6GA 1YR6A 5LU8A 5DLYA 3SZMA 2PLWA 3AR2A 3GBVA 5JLAA 4ETWA 4PX5A 1TU0A 2P9GA 1T4CB 1TGYA 1VPDA 4L4XA 1FQKA 1UK7A 3AP3A 2HA7A 3PFBA 4MWSA 5CH8A 1A4RA 1CKEA 5TVGA 4L57A 4FMCF 4O33A 3TVTA 3H87A 2FMKA 2VXOA 3CBGA 2DJIA 3KCQA 2B4AA 4MYDA 4TVBA 3A4VA 3G85A 1WVMA 2GB4A 2UVPA 3M4XA 3R41A 2D3TA 4PHTA 4YAEA 5A0TA 3GBSA 3K9HA 4I2NA 2CNLA 3T9AA 3TFQA 3GDWA 4C21A 4B3CA 5IYZB 5BSVA 1C4OA 1Z5GA 3DBLA 2CHQA 3D0RA 4N0MA 2HL6A 3AJEA 1DKOA 1PJZA 4TWRA 1F3LA 4EKNB 2ZXUA 1E9EA 4CGZA 3IO3A 1OF1A 3CF6R 4EY5A 4C20A 4LJKA 3LRTA 5CK4A 1KQNA 5CM8B 4AJEA 3FPCA 4JU9A 4R2KA 3ZZ0A 2FF5A 5JI3E 4X6LA 3IOYA 5IWCA 4HDQB 3N8HA 4F9FA 3TTYA 1SKYB 1ZN7A 3GPIA 3ZK9A 4JXKA 3W77A 3ZS9A 2HR1A 1VB5A 2X76A 4OLFA 4DTCA 4F38A 1P60A 2ZT6A 2JLZA 1NNLA 1Z18A 2IYPA 2P2CA 3FCXA 4KC0A 5FUBA 1M54A 2Q3FA 3AL0C 5JBNA 4NCXA 1FP4A 1KJWA 1QR6A 2A84A 2V9CA 2YICA 1E7QA 1YOVA 2CDBA 1R5BA 2IYEA 2M6SA 2W4QA 4NBKA 4Q21A 3TN7A 3PICA 3OWOA 1ZVKA 5E4TA 5AHWA 5JNVA 2R7KA 1CY6A 6YASA 1Y81A 1SD1A 3ZH9B 2DCMA 1JIXA 4TS1A 3SJCA 4G4IA 1EXNA 4MS3B 5AIBA 1VGQA 3MB8A 1U9ZA 1RWQA 1YOBA 4GRDA 3LPMA 5LP6A 3IV7A 4LHVA 4D0LB 2FWRA 1AKEA 3H8VA 1R0CA 4K03A 1XEXA 3ANXA 1TFRA 3BMOA 4UE6A 4NDAA 4KIWA 1XCGB 4YVFA 4INZA 5F7ZA 5BYAA 1Z5ZA 5GM1A 1G7RA 2DLNA 3MG9A 1P4SA 3OPMA 3VOTA 3WRYC 1QYXA 3PDWA 3OLYA 3O7WA 1LBSA 4EJFA 1Q0SA 1MX1A 2P6PA 4M89A 1TVCA 1VLHA 1JPUA 2GPTA 5ALYA 4MYSA 4YMVA 1I1NA 2Q6TA 1AHIA 3C3AA 1WXXA 4DA8A 1Y3AA 3E58A 4PFJA 4WL0A 2ZUTA 2WF7A 3IBSA 3BDAA 2FUG6 2A5YB 3EVNA 1ZEJA 2O3JA 4Z2AA 4XQGA 1X77A 3HVHA 3P27A 4NZ9A 3NAMA 3R0VA 4P4SB 4OXQA 3QBDA 4YRQA 2A78A 2DWCA 1FMLA 1YCDA 1ZDMA 2VTVA 3BMQB 3DEZA 5TPZA 1YQXA 3GRYA 4RSHA 3T35A 2WYWA 3D8UA 1CDZA 4TV8A 2ABWA 2BUAA 3CG4A 1IFXA 4MDHA 2I4LA 5CVCA 1YVDA 5JE8A 1C9KA 3JYOA 5BT9A 1AKQA 4MHSA 3ZQ4A 1QU3A 3SC2A 1RWWA 1UBRS 4D4IA 3CVWA 4RABA 4CN9A 1SNYA 4RSGA 5CBPA 1ARZA 1J1UA 4EG4A 3ZU5A 4C0LA 1B42A 2KE5A 1U0NA 3LDHA 4B3RB 3HJFA 1OWMA 1O97D 1YT5A 1U2RA 3HCWA 4DUZB 4P98A 2YV3A 3L6EA 4PPNA 1T4CA 5CVUA 2R6GA 3H4TA 1VI6A 2WKRA 3ITDA 5BWOA 2GDJA 4Q3NA 2A9VA 3LY5A 3CO5A 4PANA 4PBRA 4CT0A 1WPRA 2HRBA 3WLNA 1FZQA 3T9DA 3C3JA 4B1FA 2ZRBA 4S0ZA 1E3LA 5FTLA 4ND2A 4X9XA 3OAAA 1E3QA 2V4MA 1ZYUA 1G3IA 2AUTA 1QZZA 2TS1A 2XADA 4OVKA 3PA6A 1V3UA 5D1HA 1PFGA 4IR7A 1Z75A 4YUYA 4PWZA 4XVCA 4E5UA 4CE6A 2BMEA 3TM5A 2JBWA 3HKCB 5IYZA 4G9GA 1GA1A 2BJHA 2Z6VA 4N4AA 4PY2A 4JBXA 4JI8B 3H1FA 2UUAB 3VO8A 3RJTA 3F67A 4G56A 3K5WA 3ZE9A 4MAAA 3TJZA 2PT7A 1DQRA 5J4VA 2XBMA 4JNKA 2ZZMA 1R64A 3FHOA 3EIEA 3GJZA 1XSEA 2FRDC 4OO3A 5ADHA 2BAGA 2D7CA 3EAFA 3SX4A 3V32A 2ASEA 3D4BA 2AZXA 2I91A 3GVXA 1TADA 3PJGA 2HFKA 2XAUA 4DCVA 2PNFA 5GJVC 5LQKA 1I0LA 4AK9A 2XWSA 3A1TA 3TSAA 1Q0LA 4V3BA 2BHTA 4UU8A 1AUXA 5EQFA 1YKFA 3CUSA 2JKZA 4HVAA 3U7QB 5I9NA 1EVIA 1U5BA 4RY9A 4WFKA 3D3NA 3AB7A 3ZKWB 1W36C 3DHEA 1KDVA 2YZMA 3KOXA 4Y3UA 1KY3A 3DDSA 3CB2A 2X8BA 3OQHA 3S70A 1BSVA 1ID1A 1DKQA 1UODA 4FGKA 4Q00A 4CM4B 3CKYA 4ENSA 2Z4SA 2G0NA 1PR6A 2V0NA 3LC2O 4GP6A 4NONA 1G5FA 4R7GA 1NM5C 3ZGLA 3FGZA 4INJA 4BKRA 5CEEA 1TYEB 1NE7A 2X86A 2YXLA 1VSTA 3MIIA 5LFAA 4MS3A 1E1RD 5SYMA 3SBXA 1HQKA 3OLXA 1L6RA 1UCFA 1GARA 2QDKA 9MHTA 3ENWA 3C87A 1INLA 1RFLA 1F8YA 1EZZA 1R0ZA 4OU4A 4I50F 3ROKA 4PYNA 1NJ6A 5HDQA 3VR4A 5JS8A 1H1LB 2VDOB 4ZV9A 4CIAA 5CGQB 2HNBA 4P4LA 3S99A 4LFCB 3L6RA 1KEWA 4O3FA 5L3ZA 5BYJA 3VGPA 2XCLA 4P4GA 1TIBA 3ZXSA 3CX4A 2HV9A 3IDFA 1LA2A 1BX1A 1U94A 4FNOA 4DLLA 1EU1A 1NSTA 3GJYA 3KAJA 5JSKA 5IPFA 1EYZA 5AKHA 3TD6A 2E2WA 4HR7A 4FFRA 5THXA 4AUEA 4F91B 4N3CA 3F9CA 5L95A 4RTKA 5EESA 1OD6A 3HR7A 4L8LA 4JB2A 4CV3A 1NXQA 1NUHA 2P5SA 3Q40A 3Q3IA 4N5DA 1DIAA 1E1NA 4AZWA 2C78A 1NQOA 1Y3IA 3BMQA 2X0DA 2QN8A 3TO5A 1M9NA 1QYRA 2P2SA 5A3QA 3V5NA 1WF3A 5T57A 4O63O 2WYUA 4MV5A 3U1TA 3HU1A 3F5MA 2GEUA 1JJ7A 3R7AA 4G8DA 5DVZA 4M1WA 1FY2A 5DM70 2YR0A 4LE2A 1TFUA 1RRFA 1L3BA 1F14A 2V7PA 3EDOA 1AK2A 2F3UA 2GM9A 4LXQA 3RLFA 4G23A 1Z6AA 2AC4A 3LO8A 3WJ2A 5GJBA 3R5HA 4X71A 1M7BA 2D0PB 3ADBA 1RC8A 2VFAA 4UEQA 3UG7A 4PR0A 4ZVLA 3SYRA 4L0MA 4NZOA 5JO9A 1S01A 1FVFA 1MJGM 2R6HA 3G17A 4TSKA 3L8CA 1KK1A 5EZ5A 5B7PA 2J48A 3IJRA 5CD9A 4UHCA 5GADl 2QTBA 4LMBA 1V5GA 1DAIA 3OC6A 3PNPA 1JQKA 3QIAA 3RAGA 3B3JA 4F04A 2FZGA 3AQIA 4QQFA 5E2AA 5IXYA 1XOIA 3S2GA 1NAHA 1WU8A 3KUKA 5AHOA 1H42A 4IVRA 4NBNA 3LTNC 1FXWA 1UQTA 2YQ4A 1R6DA 3VYRB 3HKCA 4URVR 1Z4OA 1M6VB 4FGUA 1IUNA 2SCUB 4BY9E 3PNLA 2AEJA 3GCWA 4Q19A 4H60A 3ICPA 3RE1A 3LIIA 4IIJB 2CXUA 1MZPA 4HXEB 3HDQA 5I4KA 3Q10A 5EFOA 4LDPA 1IN4A 5HBRA 5T3UA 5JW6A 1NVDA 4DR1B 5DP2A 2BGKA 1Y33E 2RGUA 1A69A 2YIJA 5EZQA 2YYAA 1BKYA 221PA 5JAIA 1U2EA 1M8KA 3DXYA 5ESDA 3W8EA 4PAWA 3PQ2A 1EVZA 3DB2A 3W5VA 3K0FB 3U7QA 1RHMA 4QTXA 2Y1WA 1HORA 4Q1VA 4TV9F 4D5GA 2F62A 4TMZA 3WGJA 4ZOQI 3WV5A 1H69A 4TRJA 5DHFA 3ZKWA 3T7AA 3LOUA 3T7IA 1TJ5A 5IHXA 1RXUA 1XTTA 4CNQA 3FDFA 4CM4A 3R7NA 1A76A 3CS3A 4IJQA 1JQ5A 2FPGB 2F3QA 2H2GA 5AOAA 5CDTA 4G65A 4ZOLF 5LC1A 3LGAA 1GVNB 3EC1A 2M6LA 1AKWA 13PKA 3LJKA 2ZSEA 2FOXA 2X4GA 2LR0A 1EVEA 2P3SA 5EJ5A 4DV6B 4QUIA 2FLVA 1ADGA 1CQXA 3DJYA 3OLCX 1QP4A 1ADCA 2QAIA 1JHMA 4F5WA 3ESAA 4Q9LA 1RXYA 2GQ0A 1THGA 1QDEA 2O7VA 3ME5A 1M5UA 2ROQA 3FOWA 2XE6A 4GBGA 1E2UA 2DTEA 2CFRA 3EYWA 1M1XB 3V9AA 1NVBA 1H1LA 3PQ5A 2OZKA 2PE5A 2PXCA 3BHJA 4IDPA 2H2FA 1JKIA 4X92A 2BHRA 3GT0A 5K8TA 2W8BB 1W4AA 2E49A 5AI0A 4MWTA 4P2BA 4TRRA 4CM9D 1I7PA 4XSGA 4BNTA 2L42A 2V7VA 1C30B 3AUTA 2FYTA 3F5SA 1JDSA 1PW5A 2OCAA 5F23A 1U2DC 2N46A 2XDWA 4MGIR 3ELYA 3RC7A 2YZGA 5DTJA 2C4VA 2OGSA 4BQNA 3KSRA 2BPOA 1CF9A 2ZI9A 2NO4A 3D7RA 4KFRA 5LA6B 2PKQO 2ZB8A 1F4VA 4R3NA 3SR3A 2EC5A 2ZM5A 3GRZA 4QD3A 1X1DA 5FL7D 3W9YA 5E3IA 3I61A 2B8EA 3PPYA 4HQRA 5HKAA 4L85A 4TN5A 3K15A 4G09A 3VR6A 2ZU0C 3CX3A 2N75A 3DR3A 1QK5A 4OMCA 4IDNA 4Z4GA 2ZWAA 3HDGA 2HJWA 4HBGA 4JL6A 1OA0A 4YRDA 4MPTA 1GCOA 1W1IA 3I05A 1ENOA 2H2HA 1LSJA 4JL8A 4LOKA 4TMKA 1EWKA 1A8UA 3TSCA 2RKBA 3JQDA 3M5PA 4L95C 4GZ3A 5C3UA 2R1UA 4YCSA 4FP9A 5ARDA 3NJRA 1P5JA 2OXCA 3SXJA 3FFBA 1N5RA 1K98A 4HH1A 4MUYA 3VV2A 5ERYA 3QRWA 4R9UC 5KTMA 3ZQ6A 3R3XA 4LRSB 1FUKA 3LHSA 2C03A 2O1WA 4MJ3A 4TWIA 3UNXA 1ZNQO 2YNMC 3QE3A 3W05A 2JASA 2VYVA 3WFZA 1UT8A 1G2IA 3VISA 1WD5A 1M6VA 2XDYA 3TI9A 2SCUA 4H3VA 3DMYA 1QQAA 2CK3D 3E53A 1VIDA 4OQQA 1CUIA 3DTNA 4YRFA 3ETJA 1OH8A 4IIJA 3V97A 3VNQA 3IUPA 5DTIA 4XGIA 1C9JA 1HNWB 1QE5A 1Z4KA 1CY1A 3DZFA 2V7EA 4N7JA 1PR3A 3FCYA 3QVGB 4DJDC 5D2CA 1GZVA 3KTFA 1HE8B 5T8KA 3CB4A 1G4AE 2ZRAA 3M81A 1XE3A 3DCJA 2G9VA 5JDIC 2B4YA 1L7EA 1K5HA 2QTCA 1Z83A 2VAMA 2XBUA 3G8YA 3M4NA 1HYQA 3K0FA 4CETA 3AM4A 3LT1A 5J4KA 1P6UA 1LNZA 1ODKA 4S1NA 3BGOS 3WAJA 3E3NA 3E23A 1SB8A 1X1BA 1VBNA 3KT6A 4EPVA 1N33B 2ZJAA 1N7HA 3GWGA 1Y4DE 2EW1A 2O3SA 2H1SA 3MTQA 3OUZA 3MUNA 3TTXA 2JPDA 4EA6A 2FQYA 2FPGA 4G0MA 1D7OA 3UAGA 3C8UA 3I4CA 3OPXA 1OH5A 3LLSA 2I2XB 3PNOA 4YACA 2FFQA 4ZOEA 4Z1MD 1QFYA 2FDXA 2G80A 2XECA 1ID8A 2OAQ1 1US8B 1Q6ZA 1X39A 3PYXA 4M8SA 2IEAA 2NOAA 4PG6A 4RWEA 2FZ5A 3R3WA 3U16A 4RV9A 2WYIA 1FXSA 3B1WA 2G1AA 3Q3GE 4Y6OA 3WGHA 3CRRA 4GRAA 4MROA 5TEVA 3KLBA 1XWIA 3AI1A 1YI0A 3ECAA 1HE2A 2GHTA 4AMUA 3KZXA 1KMHB 1R8YA 1CRZA 3LDUA 2PCJA 3WBJA 1SN7A 2IHKA 2VK2A 3BICA 4ND1A 5B2FA 3MTIA 5C9ZA 1M0TA 1KH1A 3EGVA 1JPJA 4KPUB 1R18A 3U3DA 1IATA 4K6OA 1CUCA 1J2UA 4ISBA 2W8BA 5F1YA 4Y30A 2IIVA 4MVJM 1RMQA 3BD9A 3NOVA 3EZGA 5LU9A 1HA3A 3L40A 3HACA 4BVAA 3I30X 1C30A 1AU9A 2EBUA 3TECE 2C8KA 2J9FB 3E1SA 4OQYA 4Z9AA 2RBKA 4LY3A 3C7TA 3GA5A 3KETA 2OXTA 1DKNA 2CV0A 1KI2A 2PX5A 1WB4A 2P62A 4NS4A 3WHIA 2ZBGA 5BUCA 1L8OA 5FCDA 3GT7A 1JHPA 4LRTB 5F21A 1DINA 4WJKB 2Q29A 2QRGA 4JQOA 5LA6A 1PT9A 2PCLA 4N0DA 3UJBA 3W2EA 1XAGA 1QPZA 3TUZC 5L7TA 2V8OA 3U61B 5JNUA 5EJMA 4ZT3A 1T8SA 1RBYA 1GCGA 5JJBA 5ALGA 1U7XA 2D2EA 4KPFC 2HQSA 4UBOA 3P0JA 4MVXA 4WXMA 5CTAA 4IGIA 3OTHA 5EMKA 3RT1A 3SS9X 4DCGA 2P35A 5JO0A 5LYJF 1T5LA 2GI4A 2JLRA 2W6ID 3F4LA 3O3CA 3WISA 1MVNA 1SCKA 1JMYA 5DYWA 4KU4A 5I7AA 3BF7A 3RLIA 3CUEF 3KUDA 2ORWA 4B76A 4B6GA 1R6AA 3GB9A 1TPZA 4GWKA 1C4XA 3NIDB 3PTAA 4DSNA 3PPWA 3EZYA 1CRWG 3ZUPA 4EFKA 5CT8A 4EO4A 4RK7A 4JEHA 5LP1A 4HEA1 4ZCRA 1NBAA 2OV3A 2ZCJA 2RHLA 1DRWA 3K0KA 1QGUB 1PEYA 4I1RA 1UC4B 2QSUA 1AQIA 4RHXA 4YJGB 5AIAA 4KZPA 4KPYA 1FU4A 2GD0A 4MR9B 5IAAA 2JJQA 3A6LA 4J0QA 4AS3A 2O8DB 1ORVA 5KVQA 1VBMA 3SS7X 1VMEA 1B6TA 1PWEA 2ZE5A 2HMUA 4XLTA 2C3PA 4UBJA 3QVGA 3BTSA 5KNCH 5DM60 1Q1EA 1SQSA 3AEQB 4OSEA 5KPJA 2DB3A 1REQB 5JAHA 2JB9A 4J0KA 1ZLYA 1GPWB 4O02B 1RHJA 4E1BA 2EF0A 3ZVLA 3GNSA 4KR3A 3EPPA 3L04A 1ZCAA 3CLRD 1W8DA 1RIFA 3IEIA 5C4GB 3WFJA 3RTBA 1Y7LA 4ES6A 3I1IA 2P8SA 4Z4CA 2O2GA 2F8TA 1FSZA 1YB6A 2H4FA 4IZOA 4L5CA 4BV3A 3OVMA 3PR1A 3OCUA 4RHYA 3RWOA 5CCBA 2P2GA 2P7HA 3O7MA 5ECWA 4ND3A 1FC0A 2DFDA 3THOA 3I04M 4L7QA 4RK6A 3JQQA 4L07A 5EJAA 4D97A 4YJDA 4XIIA 3K9CA 3WO0A 4IF4A 3G6KA 3FCUB 1US8A 5BSRA 3ZBQA 4EEKA 3MAGA 5KOYA 4XWKA 1RTTA 1WD7A 1GYQA 4LJ7A 2F9FA 2XZPA 3ZHQA 3VYUB 3OIUA 6REQB 1ISHA 2VP0A 1BC5A 2OL4A 3BSSA 3FZYA 4UAJA 1KMHA 4QOEA 4U9IS 4NFLA 2NN3C 2HA0A 3A2KA 2FW1A 2P9FA 1GR1A 1SGWA 2VG8A 1UOEA 5KJEA 1N5LA 3RSLA 2HK7A 5BV2P 4KPUA 3N2KB 2EP5A 4U6NA 5LQSA 1RPJA 5DWQA 2WD8A 3U3KA 2QRPA 3K32A 3MTGA 3E7DA 5K3AA 5DWVA 1LZLA 3LKVA 5IT0A 2XQVA 4DIUA 4RVFA 1E5DA 4X61A 3IP6A 3E3AA 3SJUA 3BIJA 3ZWAA 2XHZA 2CXXA 2J9FA 5LIRA 3FROA 4RPJA 5DCWA 5GV8A 1JZQA 3NWBA 1M1YE 1Y1TA 4IX1A 3CISA 4N0PA 4F97A 3SC3A 2HRQA 2BFNA 1FTGA 2Q9CA 3EVCA 2IV7A 1GR0A 1ICEA 1U1FA 2GO1A 4Q47A 1W36D 2RIRA 4BLQA 3PXGA 3GP8A 4IW3B 4FSXA 3LQ4A 4LUCA 4EJSB 4OI4A 3UAZA 4D3SA 5F3WB 4GKBA 2ZBVA 5KTOA 3V46A 3ZCSA 1WXWA 4LYYA 2WVGA 1OROA 1QQ6A 3QWAA 3K71B 1NR1A 1HQYE 4IVQA 1M2WA 4NJEB 5DZSA 4K88A 2IIQA 2XQGA 1GU0A 1L7MA 1MABB 1NUQA 3EE6A 1YSCA 3DO8A 3PVZA 1NVVQ 1FP7A 5CIWA 3SOZA 4E03A 7ABPA 3IBTA 1L5KA 3N2ZB 1PNOA 3K1TA 1V39A 5I4IA 2C96A 8ABPA 2BR4A 3LBNA 4M0FA 4KUGA 3WGLA 2BF4A 5DLEA 4WACA 3WXBA 4BBPA 4IIVA 4D56A 4NY1A 4KFUA 1CUFA 1CQIA 1W2WB 3KP1A 4IQ0A 5FTJA 2ZROA 5LSAA 4ACAA 2OKGA 3ZBPA 3I9LA 1YL7A 3VSAA 1R66A 2OSVA 3AR3A 4PPQA 1BW9B 1GPJA 5E6RB 1AVTA 1QGUA 4JLOA 2XUQA 3K0AB 2RC5A 2IXEA 3K73O 3O1IC 3R1IA 2QMUA 4BFZA 4F06A 3L41A 3TGLA 2IHTA 4R2LA 2WAYA 3N7AA 4YJGA 3PC7A 4MR9A 3VJRA 3A9WA 4JOSA 5ICGA 2VPQA 4BNJA 4Q05A 1YS4A 4Y1FA 2O8DA 3RM3A 2GPSA 2OPHA 2BOVA 2HHLA 5D5HA 3HGTA 2W4IA 5K8CA 2CLIB 4OQDA 3AEQA 2CF6A 2WT4A 2NUPA 4H0FA 2BZSA 4D4JA 1REQA 4HAYA 3RADC 1AB5A 1TKAA 2OCXA 3B1VA 4X5OA 4TTQA 5FTMA 4PNHA 5DGHA 1G38A 5TGDA 4PFSA 1KSGA 3T7DA 1RQ7A 1WVIA 2NT4A 4L0CA 3IAEA 5IKOA 1P7PA 5J4YA 1Q83A 5I7FA 1GUFA 4NNOA 3IQZA 1U8CB 1SMKA 2VZ9A 1ODFA 3MLEA 4GBJA 4MAFA 4DV1B 1KQOA 4EYSA 4L02A 4CQMD 1PT5A 1U7DA 4MO9A 3OU6A 4AUMA 4BFSA 1DOAA 5EEGA 4DJTA 3M5WA 2ORYA 2A7QA 2FPUA 2YRFA 3GZNB 3O9ZA 1OHHA 4XGQA 3MQFA 2ACVA 5I47A 1V6SA 3BJZA 3WL8A 4NARA 3PXBA 4V0MA 2NZYA 3U4QB 1U8EA 1Y8ZA 4G1BA 3FSGD 6REQA 3STWA 2J0UB 2VRNA 3HUDA 1W1WA 3RS3A 5EIEA 3D7LA 4FOOA 2Q0XA 2PA0A 1FQJA 1C9MA 1SK8A 5AW4A 2XX3A 2HSJA 4XVRA 5F1PA 3HBMA 3LD9A 4KQ9A 3FNBA 2I9PA 3N2KA 1Y4UA 3NGMA 3N8GA 4R01A 3LWNA 2FPWA 1Z5UA 1C2TA 3NYRA 5IKPA 1P0QA 3OZBA 4EJ0A 4D8XA 2WIGA 4DNPA 1G6Q1 3C5HA 5HF6A 3DV2A 4FW9A 3UMCA 2GCNA 2ORED 3A4IA 3EGOA 2ODBA 2NNLD 4MTCA 3SF0A 4A36A 2V4UA 4RM2A 3UAXA 4EZEA 1A4IA 4KGDA 2Q4EA 2O5RA 1GZUA 3GLFB 3IVAA 2IU0A 1OZFA 1QQ5A 1C7FA 2QJFA 3MWLA 3U49A 1BFDA 1AO3A 3AR7A 5BV7A 3ILHA 5JNTA 1JIVA 3DPUA 3HDYA 4LOHA 3VNRA 4EJSA 1AG9A 3MOGA 3TSZA 3ZWNA 3ZHCA 4OJQA 4M9UA 4UFPA 10MHA 5A05A 4PN7A 1OYWA 3EXAA 4NJEA 4UM9B 4Z51A 1B8VA 1MABA 3JAKB 3LZ6A 1TYCA 3NHRA 4NEGA 1JIJA 4M1MA 2CWWA 4R2IA 4OYHA 5CEJA 1K86A 5GZ6A 1EHIA 2XJ4A 1WCYA 3QUBA 4E4YA 4PR3A 4MKGA 4D4LA 4BB6A 3VSBA 4B81A 2DAPA 5DM4A 1N9GB 2QUIA 1NE2A 3NP7A 4AZSA 3IQEA 3E9NA 2HBRA 3D3WB 4CM6A 2TMDA 4Q7QA 5HP4A 4ZVPA 4B3GA 1VSVA 3LU1A 1YV9A 4I4NA 3MBIA 4ENTA 2WSMA 1GZSA 2O2XA 1KMIY 5E6RA 1BW9A 3WBBA 4AU1A 1GEEA 7REQA 2FETA 5I7RA 3K0AA 3SU8A 4Q9DA 2JLYA 4EG6A 3NPMA 1G64A 4HAXA 2BT4A 2W58A 1WMSA 3A6DA 3P2MA 1JJAA 2WYOA 1XJ5A 3BDVA 4KDFA 2KWIA 3OMWA 2C1XA 4WNIA 4BGEA 4EYKA 2EAUA 3WKEA 1DLIA 2NP6A 3FTQA 3EFOB 4DBLE 4WNAB 3TLXA 4RPHA 3BB3A 3QVTA 4W1QA 3HCBA 3ZE0B 5CB0A 2B99A 2O8EB 3V33A 4UUBA 4CDNA 2AXPA 2H2AA 4QYWA 4BL5A 2Y0BA 5FA6A 4UFOA 1JQEA 1DIHA 2AZMA 3MT9A 3V2GA 3B3QA 3L1VA 4R2WA 5H81A 2D0OB 1YBHA 2WU1A 3ND8A 3PNYA 1A5ZA 1II9A 5T67A 3RVJA 2PYIA 2DM6A 3KVOA 1EDOA 3RTEA 3KTDA 3LLMA 3HE3A 3O1HB 3R40A 5G2OA 1TM5E 4MMXB 4MVJP 2PLNA 3LT4A 1D2RA 1TCVA 4A26A 2OOKA 3GZNA 1OB2A 4Y9UA 1JR4A 2CL7X 2E55A 1D2AA 2I4MA 5FEMA 3U4QA 2NVOA 3AY6A 2X8AA 3D8RA 2ZB2A 5TQ0B 5F76A 2FTKE 2J0UA 1Q77A 4W9NC 2O19A 3HLKA 4LRXA 1YFJA 1AMOA 5IBQA 2ZRGA 4MJLA 4QRIA 4G63A 1MW9X 2GPYA 2DBRA 1R0WA 2PX4A 3KS9A 1ZONA 1BHQ1 2AG0A 3CX7A 1UBLS 4BPRA 4J0DA 5DIZA 1Q7BA 4L9AA 5LCXA 1QQTA 3DOEA 2E4XA 1Y3HA 3KHKA 1E60A 3C16C 4FQ8A 4UW9A 4KLZA 1GG8A 1GAJA 1CUAA 3BRWA 2JLWA 4YJ2B 5EE0A 3ZU2A 1OGJA 2C7QA 3OEHA 4TYQA 3USCS 2UU9B 1DJMA 3IB3A 5DRYA 1SCBA 3K0EA 2NP7A 4ZQFA 2WJ6A 3OE5A 4DMCA 5K45A 3CBQA 2YN0A 2XZOA 1R5OA 1NWHA 2IYUA 2LKCA 2ZWOA 2IP1A 3ZIAA 4DARA 2DERA 1Z37A 4UUQA 1Z9BA 1D2MA 2J0VA 2PS9A 5FEUA 4Q7LA 2XGJA 5YASA 1RRCA 2CVFA 1HYEA 4MV3A 4BJHB 621PA 5LDHA 4IGFA 5CIQA 5BRJA 2C7OA 4IMIB 4LJLA 1OXMA 1L5ZA 1UQRA 2B8JA 2V3WA 3A06A 2O2HA 2ZUVA 3OCXA 1RAHA 2WILA 1BU8A 1I4EB 3BXGA 4ZCSA 3JAKA 1KBOA 4L75A 1Z62A 3IHTA 3PITA 4GC9A 2BLNA 3KUXA 4Q01A 2VT6A 4JI0B 4HOYA 1EH5A 3O47A 4MULA 3K5PA 5B37A 1N9GA 1K6EA 3D3WA 1K7EB 3HYSA 3IBFA 3HN2A 4QO8A 1T2UA 2IK8A 4XE5A 3WKAA 3D7NA 2SICE 4BQEA 4Z54A 3ELUA 4EZBA 3OF2A 3FFWA 4FMCB 3KRTA 5A02A 2CFTA 3JD0A 4I1YA 1VL0A 1KF0A 2R7MA 4ZVUA 4J1TA 1BVHA 1YASA 3ZV5A 2DWOA 1VJ1A 5IVIA 4HQNA 3H1PA 1ULBA 2NZ8A 4BNHA 5JV5A 2VH1A 4FDAA 3NBZC 3H75A 4JI4B 3H9JA 1CUHA 2WAOA 3OIGA 4JODA 1LFDB 1JBEA 3EFOA 3HB5X 3NW9A 4WNAA 4PAQA 1QLWA 4UCQA 3ZWQA 4OQMA 5BR7A 4F72A 1V35A 2A9PA 2PVPA 3FBTA 5BP7A 3IXMA 4GM1A 1HDEA 1NV8A 5A6SB 4LF6B 5IM5A 3CF4A 3ZE7A 4Y2SA 2H1VA 3WDKA 2DFVA 1BDJA 2PX3A 4JH0A 4OFWA 4ALJA 1E2QA 3BZUA 1QJCA 2JGFA 5AHRA 3REQB 3HJNA 2EFHB 3NTLA 5HW0A 2PUVA 4FEYA 5ALJA 4K9RA 3HCOA 2R5NA 1FA9A 1BHJA 1ZIXA 3WLIA 3TW0A 4EW3A 2EJBA 2ZS9A 5FNZA 1XDBA 2XY4A 3L9XA 3OX4A 4ARCA 3P5SA 1EWQA 2QYTA 2OORA 1RRVA 4KVGA 2J3QA 2P0EA 4MCAA 1G9SA 4IDEA 4LQDA 1UK8A 4WTOA 3IDOA 3EPRA 4HTAA 4KO8A 3GELA 3OF5A 3T1YB 1SELA 3GEEA 5C8XA 1DWPA 1PHPA 1VA5A 4PAMA 1H2BA 4LYGA 5TQ0A 4EYOA 5HIIA 2PKXA 1V3TA 3A7EA 5KQPA 2GNOA 5HJEA 1PBTA 5HCIA 1GRNA 5EMMA 4FHFA 4FT4A 1HDYA 1Y6FA 1NMZA 2P5UA 4FWIB 3L1UA 4FU0A 4JOCA 1J25A 1X0XA 1SC9A 3AGQA 3QHAA 5I51A 2EIHA 2X41A 3NTOA 1C3EA 1V9LA 3MRXA 3LF1A 1H4VB 5DF1A 4CI0B 4JU8A 4HZIA 4XIYA 2DPYA 2BDUA 1FIUA 2YJTD 5C2JB 1VE7A 2OT3B 3UQYS 2GJSA 2Q3BA 4RD3A 3CINA 3GX1A 4LPKA 4ND5A 3G2HA 2QRQA 4QDOA 5GZ1A 2GJAA 3WLAA 4V1CI 2HU7A 4YJ2A 2C57A 5T64A 1GZ6A 3USZA 1TAUA 3NEAA 1ULHA 2IPLA 1VL8A 3BXHA 1P2DA 4HFJA 4TVKA 3L8FA 3Q5GA 2HIMA 3RRJA 5AP9A 1SBHA 1FFDA 1M2JA 1R0XA 2YVKA 3D54D 3RD5A 4QHTA 4F2GA 2R4UA 5CDHA 2XMSA 3LC0A 3W79A 2GEVA 4CNBA 1X6VA 3JQFA 1VJ0A 3OTIA 5TVKA 3PNVA 4F85A 1WIWA 4ZZ2A 2NZVG 4HX5A 4GSKA 2J46A 4HH4A 4MKZA 2GK6A 3FPLA 4Q34A 4US2R 1R12A 3G79A 4A16A 3DDCA 1Y89A 1YR1A 2NPOA 1ESZA 4NMWA 4YP7A 3VC3A 3ID6C 1OX5A 3UJ9A 5JCJA 1SXJE 4C78A 3JARB 4R8RA 4RV4A 4O1MA 1DQSA 1E9BA 2PUAA 5JCZA 2JHPA 2VLBA 1YVRA 1DPFA 2FG5A 3JCZA 3JVEA 4KGVA 4DR4B 4L4UA 1I1QB 2C0PA 2PIAA 1KSHA 1SOMA 3HL4A 3KKLA 1RMYA 1FB5A 3B36A 4KDEA 4P93A 3TKLA 3EXHC 5KHLB 2AKEA 5F5XA 4OHZA 2AQKA 2EQ5A 1MRSA 3QFTA 2B34A 3HXQA 2R8YA 2BGJA 4F4DA 1IN1A 2V6FA 5AOBA 4ZAGA 3H13A 5EWMB 4M22A 1DWUA 2EKBA 3U4AA 1DC8A 3CWQA 3DNMA 1U9CA 1N5OX 1H66A 4PQFA 4L76A 4FLFA 3AM3A 5ALDA 3IBCA 2GBGA 3ZW8A 4BO3A 3EX7C 4BNNA 4KHPB 1R5NA 1VL6A 3GAMA 3UK0A 1Z73A 1Q50A 4GNRA 1TJ3A 2ZSHA 3DT6A 5IFLA 3KSZO 4BO8A 4B4VA 1NG9A 2BI8A 1YJAA 2XOXA 5A6SA 2F1KA 2I0FA 2D1YA 1FLAA 1NWCA 2OCGA 3QI2A 4XYMA 4CL8A 2O8BB 1GILA 4LVNA 1HR0B 1YJ8A 4NCNA 4MYHA 1P8AA 1NJ1A 1XVUA 3BFPA 4M8NE 3QLVC 4CDRA 1QCDA 2VAXA 5HK8A 3REQA 4ZDWA 3LM8A 1UOQA 1CNFA 1N7JA 1T2VA 5JHGB 1VCMA 3GJ5A 1SHKA 5FPPA 2JK0A 4G0VA 1ZNWA 3M34A 1BZYA 1WULS 1QKKA 4LJ8A 3OFSA 2A30A 4E5NA 4FNMA 1GDDA 3K31A 3QX3A 5J3JA 2H18A 2ZSKA 2HLPA 4MDEA 2HUPA 1RKBA 4UUAA 1CUYA 2P75A 4BMNA 3BXZA 3TL3A 2FK8A 1USWA 4E2WA 4RD2A 3UXMA 3ZWKA 3HA5A 4D9JA 1QU2A 2C59A 1JI0A 1WAMA 3OO1A 2XNDD 4D9CA 3U6KA 4Y2HA 1JZTA 2BBTA 1NBMA 1A0OA 4PCUA 1IBSA 2FVXA 4C5AA 3RUFA 1U1CA 1IWOA 1M1ZA 1C3VA 3Q15C 4A9AA 4BLTA 4ZHQB 1UKZA 3F3YA 4I50B 4YRKA 4CR6A 4LCJA 3WZ2A 4OA5A 2Y0DA 1C1XB 4BBAA 2GN4A 3WIEA 4ALMA 4QJ5A 1FNDA 1ZMBA 2PSEA 4BO5A 5BWBA 4FCCA 4JI1B 5JD4A 5EXEA 2LVBA 5K0FA 1E2KA 5JVDF 3TK1A 1USVA 2DFTA 3BGDA 2XYPA 1FVOA 4M9QA 4PAGA 3SJ7A 2GBCA 1QGYA 5BN1A 2G09A 2WZCA 4HEQA 2HDOA 4O4IB 4FD2A 5EPOA 5HFJA 1UMBB 3TIFA 1IMJA 1E0JA 2PD6A 3K1YA 2PU5A 5DBEX 4RK0A 3X44A 1SVMA 5BUQA 3B8EA 1L7RA 1N8KA 3K20A 4F9EA 3UMYA 1JW9B 1BMTA 4KZKA 1R16A 1A5BB 3V42A 1JFLA 4GPTA 5LBUA 2J3DA 4F6CA 2P6UA 4AN0A 1QIHA 1TEVA 1Y5LA 1O5IA 4FZ3A 2QL7A 2YWGA 4ME6A 4NH0A 3UUGA 5KNBH 1QIKA 3SVLA 1C3LA 5K0SA 5CDUA 4BYGA 4B6SA 3S28A 5A04A 4WGFA 2QPLA 3UMGA 3DYVA 3EQZA