4F3PA

Crystal structure of a glutamine-binding periplasmic protein from burkholderia pseudomallei in complex with glutamine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
226
structure length
223
Chain Sequence
KELVVGTDTSFMPFEFKQGDKYVGFDLDLWAEIAKGAGWTYKIQPMDFAGLIPALQTQNIDVALSGMTIKEERRKAIDFSDPYYDSGLAAMVQANNTTIKSIDDLNGKVIAAKTGTATIDWIKAHLKPKEIRQFPNIDQAYLALEAGRVDAAMHDTPNVLFFVNNEGKGRVKVAGAPVSGDKYGIGFPKGSPLVAKVNAELARMKADGRYAKIYKKWFGSEPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine-binding periplasmic protein
publication title Crystal structure of a Glutamine-binding periplasmic protein from Burkholderia pseudomallei in complex with glutamine
rcsb
source organism Burkholderia pseudomallei
molecule tags Transport protein
total genus 78
structure length 223
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4f3pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4f3pA02
4OESA 4G8NA 1MQIA 1R6ZA 3H7MA 2P2AA 2B3BA 3PPOA 1XVYA 5TPAB 1EZOA 3IK6B 3F11A 2V25A 1Y1ZA 3USDA 1LAHE 3O6IA 1CE2A 3TQWA 2ALUA 4TLLB 4XTCQ 2M8CA 4ONYA 4NF5B 1M5EA 3S9EA 1BIYA 4BDMA 2QS1A 4QFOA 5EYFA 3IO6A 3O6GA 1GGGA 3S4UA 2O1LA 2X26A 4G68A 2R71A 4PE5B 5I58A 4OETA 4HTGA 4EQ7A 1JW1A 3K6VA 1MDQA 3OO7A 3IB1A 2O6AA 3CG3A 3W9WA 2AL5A 1JEUA 1B5IA 3MP8A 4GQOA 5ELVA 3PPRA 2ESNA 4YAHX 3E4RA 2G93A 2PYYA 4YMAA 4OMBA 4OFJA 4AB6A 5TP9B 1BTJA 1I6BA 1OQHA 4HS7A 2FNCA 3R26A 3U92A 3TEPA 2BJJX 3PU5A 2Q9TA 4NF4A 3LBSA 1IEJA 2I6EA 1PBQA 5AA2D 3WAEA 3I3VA 1B51A 4OXVA 4JSOA 1N76A 4PFWA 3FGSA 4H67A 1D4NA 1SW5A 4F39A 1MH3A 3RTFB 1PB9A 3WAFA 4ZS9A 4IGRA 5F7VA 2RCBA 1P99A 1FQAA 2GHAA 3I6VA 1JETA 2PT1A 2PX1A 3G3KA 5KCJA 4HCYA 4JWXA 1MRPA 2ZXTA 3MP6A 3VXBA 1B32A 3EHSA 5IAIA 1M5BA 1IXCA 1S9TA 3LC8A 4FECA 5BWJA 3GBAA 3FVOA 1EH3A 4TQUQ 3MW0A 2B3FA 4QSCA 2UXAA 1LB9A 4MLQA 1N0TA 3C36A 4OYVA 4OENA 4OTEA 4QFNA 2XXWA 3A3UA 3TZAA 3S9NC 3V8XB 3K4UA 4X1DA 2PMSA 3SEUA 3V5AA 3PGFA 3ODBA 1UIUA 5L8DA 4G68B 5I58B 1B7HA 2H4IA 2O68A 2H98A 1SW4A 1PC3A 4M4GA 2LAOA 4Z0IA 3W9VA 2AL4A 3TTKA 5H8NA 2ZYNA 2F5XA 2VD2A 3OO6A 2ANJA 4RK9A 2G29A 2ZYOA 4FE8A 4EF2A 1T0KA 3T9HB 1FTMA 3E13X 3K00A 2FYIA 3MC2A 3N94A 4NF4B 1OMPA 3FVGA 4O3AA 3UN6A 1H76A 4X9TA 3R7XA 4GIZA 2DWHA 1B05A 4IO6A 1A8FA 1JNFA 1H44A 4FEDA 5HPQA 1Y20A 1SW1A 1DTZA 1LFIA 1SI0A 4QRZA 1NNPA 2QS2A 4C0RA 4YKIA 4EUOA 1FW0A 1XC1A 3Q27A 3U72A 1H45A 1US4A 2REJA 2RC9A 2XXHA 3TPAA 2Q8JA 1URGA 3TDJA 4N13A 3EQ1A 5CBRA 5KCJB 3M3LA 2GRVA 2B65A 1I69A 4YKPA 1P1OA 3ZKKA 3KN7A 1EU8A 1S7YA 3SEYA 3OEKA 4DCXA 4RYAA 3U1OA 1MDP1 3N6TA 3JV9A 3IB0A 3KGCA 3LSXA 1Y3QA 2O7IA 3UGWA 3BFUA 4MH5A 5AA4A 4XKRA 3M3FA 4QSDA 1TWYA 3RUMA 4I9DA 3PV0E 1QUIA 3IO4A 3IJXB 2Y7KA 2XXVA 2HEUA 3GXAA 4LQ5A 3DP8A 4M1VA 4KPTA 4EDPA 3MVYA 2IEEA 3GLBA 3B6TA 1P1NA 1B7ZA 2NXOA 1MQHA 1Y4TA 1GR2A 1B4HA 3G3IA 3SDFA 5CMMA 1QUJA 4QFLA 5I56A 4N6PA 3IB2A 3TKDA 1Y4CA 2VGQA 2DP8A 5H8NB 2PT2A 1YCJA 1JEVA 3BFTA 4FORA 2F7CA 2QRYA 3TMGA 1JQFA 5ICQA 1LFHA 1MPBA 4OEVA 4EF1A 3T93B 3DP6A 4EQ9A 1WODA 1SYIA 2D5WA 3OOAA 4G8MA 3K0VA 4G77A 1P1QA 3D4GA 4RXLA 3ONMA 1LLSA 4TOZA 5TU0A 4KYEA 5B70A 1DPEA 1M5CA 2OZZA 2NOOA 3UA8A 1HSLA 2RKMA 3ILTB 2QMXA 1TXFA 4ZDMA 3QUFA 2OBGA 4YB5A 2V3UA 1VFEA 2THIA 2XHDA 5CMCA 5I2KA 1LB8A 3ECRA 3FVKA 3C31A 5DVJA 3SETA 4YMBA 1Z7ME 5JTYA 1UTHA 1XHYA 1O7TA 5AA4B 1MG1A 1LAGE 3UP9A 3OSQA 4IO4A 3TTRA 4F3PA 4U21A 2XXYA 2XX7A 4I62A 1B46A 2GH9A 1R9QA 4ZE8A 4GFRA 2XXQA 3KN3A 2UVHA 1ZTYA 3RQTA 1FCKA 5ITOA 3PPNA 3T66A 2RC8A 3LSWA 3O6HA 2Y7IA 4ZECA 4GXSB 4L17A 2DS9A 3C34A 4BDLA 4P0GA 3CRBA 5I56B 1HSJA 4U1OA 4FEBA 2HAUA 4G68C 1JVXA 2X7QA 3O28A 3B6QA 1B3FA 5LOMA 2V3QA 1MXVA 2XX9A 3C33A 3FD3A 3IOUA 1GV8A 4G4PA 2QMWA 4RK2A 3KFMA 1MPCA 1NH8A 1SDXA 4JXIA 4LP2B 4R9FA 1QW0A 2QL3A 4DZ1A 3CR9A 4YICA 1MH4A 4KCDA 1I6QA 4DXUA 4GD5A 4ZZEA 3SEXA 1BKAA 4IO7A 3C32A 4LQ2A 3EF7A 3CFXA 3LSLA 1B5JA 3KOTA 2HZKA 4LVQA 2GHBA 5FHMA 2F7BA 1HSEA 3BKIB 4QF9A 2XXXA 2A5SA 3PMWA 2RCAA 2OLBA 3TFLA 3QXMA 1M5FA 5CMKA 4POWA 4OWDA 3S2VA 4YU0A 3K02A 5DYHA 1NMUA 5I2KB 3MPLA 3HPIA 1BLFA 4QFPA 2DE4A 4JWOA 2ZNUA 2H9BA 3MVXA 4F31B 5JTYB 1UTHB 1YAEA 5BUUA 4GOTA 1Y9UA 1SQYA 2R9JA 1QJMA 3MVWA 2PBWA 2XD3A 4E0WA 1SW2A 4FIMA 1NKXA 4LZ7A 4H8JA 3KOSA 3H4ZA 1ATGA 3EPEA 1Q1KA 4OZ9A 4NF6A 1OLAA 3S9LC 2F8DA 3ZKLA 3IOWA 1B9JA 3FXUA 3RY3A 4F1UA 4NMYA 2ONSA 2UYEA 1B58A 1LCFA 2I0CA 1Y3NA 3L6HA 4DDDA 3T9XB 4LATA 4H0WA 3TTLA 1B6HA 4C1UA 3MUQA 5M2VA 4NWCA 3RLFE 1Q35A 3LSFB 3RN8A 3GZGA 4G8HA 2OCUA 4GF8A 1NNKA 1LCTA 2QS4A 4R2FA 4BLAA 3FZVA 1OVTA 4GL8A 3U8QA 1MXWA 1J1NA 4KFQA 3Q26A 3MBPA 3GBBA 5ICTA 1MM6A 5K2XA 3T9UA 3H6VA 4POXA 1VR5A 2VOZA 1QUKA 2WKYA 4WKMA 3TTNA 4ELQA 2ONRA 2UVGA 2XD2A 1PB7A 5DEXA 3PUYE 3HCQA 4IGTA 3QYTA 3UK4A 3IOTA 2F35A 5CM6A 1RYOA 1TT1A 3ILUB 4RJZA 4LA9A 3K2DA 2QSXA 3B6WA 3SKPA 1B3GA 1RYXA 1B3HA 1MY2A 5CMBA 3SEWA 1B3LA 4QSEA 5K2YA 4NF6B 2V93A 4BDRA 2AIXA 4F2OA 5I57A 1LAXA 5EHSA 5B7DA 2I48A 4ZEDA 3H6WA 4PQJA 1PBPA 1ZBMA 1RKMA 3JYRA 1B5HA 1LGBC 4H6DA 3IOVA 1M5DA 2REGA 1OLCA 4AB5A 1A99A 3U93A 4ELRA 3TELA 4MLVA 1WDNA 1IQ7A 3PUXE 5DVIA 4BDOA 4IO3A 5HM4B 1H3DA 4IO5A 1B0LA 1B40A 3MZ9A 3FJGA 4C1TA 1QULA 2ZYMA 3DM0A 1B4ZA 4H1XA 1EZPA 1TFAA 2ONKE 3OD7A 4ZE9A 4KI0E 5DVFA 4DLDA 2QPQA 4KR5A 1URDA 1H43A 1UIVA 4BDQA 5J1DA 2Q89A 5DEXB 4F1VA 1IZ1A 1AH5A 1B52A 1URSA 3EHUA 4PFTA 1XOCA 4GL0A 4ESWA 2XXRA 3CG1A 4PP0A 1N7XA 4RPNA 3OMBA 4H5FA 2OJTA 1CB6A 1TFDA 1Y1MA 1PDAA 4F2QA 3PMVA 2I4CA 3TODA 3KSJA 4RA1A 1XT8A 4R9GA 4OHNA 1LAFE 2DE3A 5I57B 2XXTA 2RF1A 1NNFA 1VSOA 2XX8A 1LSTA 1PB8A 2DOJA 1WVJA 5ISUA 1FQDA 3QSLA 3FV2A 3G3HA 2Z23A 2I4BA 1DOTA 3Q28A 4FAJA 1USYH 2R6GE 4DIGA 3THIA 3K6XA 3PPQA 1SI1A 3KN8A 3D4CA 1B7UA 1OQGA 3FXRA 4QHQA 4WXJA 1A54A 1QVSA 1S50A 1B3EA 3EHTA 4U2RA 4UA8A 2KLFA 2IA4A 5HBCA 2VP1A 2NUVA 2V3TA 5AA3A 3OXNA 1QKAA 3PPPA 3CFZA 3RT6B 3MPKA 4BDNA 1LBBA 1YPNA 2Q2CA 4NE4A 4NWDA 2Z8FA 3G3GA 2QJEA 2OWSA 2ZMBA 4X1BA 2XXIA 2X7PA 2F6PA 5KDTA 3ZSFA 3G3JA 3G3FA 3VXCA 2F34A 4XKPA 3VV5A 3LR1A 3RPWA 5JK4A 4ELOA 4MF3A 2V84A 3RTWB 4GVOA 2HAVA 3PD9A 4F3GA 3JZJA 3HV1A 3KG2A 1NFTA 2NWJA 1NNTA 4RNSA 5AA2A 4KYSA 4GLIA 5A5XA 1NL5A 3K01A 4ESXA 1B2HA 4XKQA 2P1SA 3KZGA 4OVJA 3IJOB 4IY6A 3W15C 4IY5A 2Q88A 1XS5A 3PUWE 3LUYA 1VFDA 5L9SA 1N3WA 2XXPA 4EXKA 2YPNA 3IAZA 4MFIA 5F1QA 4NF8A 5FTIA 3B7DA 3HHGA 3IX1A 3IORA 3MZBA 3A3CA 4R6KA 4MBPA 2I3VA 3S9MC 1FQCA 2NVUB 2A5TA 4KCCA 4KQPA 4ND9A 2F78A 3VVEA 4H65A 1IITA 1FQEA 1FTJA 4JWYA 3CI8A 3C4MA 1NH7A 4R6YA 1USYE 3V83A 4F1YA 3PUZE 3QAXA 4ZEIA 1QKBA 3SESA 1SBPA 1EZ9A 3KBRA 3T22A 1ELJA 1JVYA 4KYDA 3Q25A 3OO9A 5H8FA 4F3SA 2P0SA 3O9PA 2H25A 2Y84A 1L5TA 3VE1B 2Z8DA 2VHAA 5KDTB 4EQBA 4R72A 2Z8EA 3H06B 3TTMA 4DCYA 1FTLA 1F9BA 3OO8A 1SYHA 2I0BA 2RINA 2DWJA 1II5A 1MXYA 1MQGA 3FASA 5AA2B 5I2NA 1GTKA 1LFGA 5DT6A 5A5XB 3FXQA 2ZYKA 4K3FA 1MQDA 5FTHA 4ZZAA 1P1UA 1DMBA 3PUVE 4OFOA 5KZTA 2ZNTA 3P7IA 3QUJA 3E9XA 1MQJA 4HCWA 1R1NA 4RPOA 3FJMA 2HFBA 2YJPA 4XXUA 2AYSA 4NF8B 2DVCA 1FTOA 2OWTA 4F19A 3VFJA 3RGYA 3FIRA 3TCFA 4FATA 3MQ9A 2DXYA 2A5TB 1KWHA 1SVXB 4ISUA 3IR1A 3A09A 1MXUA 2F6GA 3G7WA 4P11A 2GFEA 5EHMA 3OEMA 1ZKBA 3T9VA 3CSGA 1OVBA 3CVGA 1Y3PA 4NTLA 3OELA 5CRYA 1DPPA 5FHOA 3MWBA 4AQ4A 3TAJA 3FJ7A 4H8IA 2I49A 3O29A 4E0XA 2DXRA 1BP5A 1A7LA 3K6UA 5H8FB 4O3CA 3IL1B 1UTBA 3CIJA 3MZ1A 3TCHA 3KJTA 1IUDA 4ZEKA 4R2BA 2E0SA 3RNNA 4OFLA 3VLWA 2YLNA 1D9YA 3HHFA 3E3KA 1O64A 3C9HA 4OQOA 4F3BA 1AOVA 3VDFA 3TUSA 4JDFA 5ITPA 1A55A 5H8QA 2QS3A 2UVIA 5I2NB 1D3KA 1FQFA 4P0IA 2HCAA 2HXWA 1D9VA 3U94A 2PVUA 1R9LA 4LZ5A 2Z22A 4EXLA 3M8UA 1MY1A 4Q8RA 2DQVA 3VVFA 2UVJA 4I8CA 1YTVA 2DWAA 4R73A 3AXFA 3UIFA 3EN3A 4F22A 2W7YA 3H6TA 3RT8A 4R74A 3ZS6A 5I59A 4GRKA 5CC2A 1IXGA 4JB7A 2O7UA 2FA7A 1MXXA 5L9OA 3VVDA 5CI5A 3I5OA 3QIMA 2CMOA 4NEDA 4THIA 2Y7RA 4LZ8A 3K6WA 2Q2AA 4WEDA 4PETA 3O66A 1MXZA 1IXHA 2D3IA 2E1SA 2ABHA 1B1HA 4IO2A 2DYXA 2H5YA 4YZZA 1OIBA 3DLNA 4IB2A 4WEPA 3PD8A 1POY1 1IIWA 2DE2A 2F7AA 4GWOA 1N04A 5DTBA 4YB7A 1ZU0A 3TQLA 4U23A 1UTBB 3L6GA 2I58A 4KHZE 3FVNA 1MS7A 2ZNSA 1ZLQA 3K1MA 4U1ZA 4LUBA 5FHNA 3T96B 3H6UA 3Q29A 4G2ZA 3MVZA 3FUZA 2XXUA 1ZMGA 1A40A 4Q30B 5JEIA 4HW8A 4XIGQ 3K1PA 1MPDA 4YB6A 5H8QB 3DP4A 1N3XA 3FATA 1AIVA 4H5GA 1N84A 3O97A 3UORA 3MAMA 3QK6A 3MJNA 3OSRA 4U4XA 1VE4A 4OERA 3HN0A 4PFUA 3FV1A 2VD3A 3HO7A 1MY0A 1FTKA 1DSNA 3MP1A 5H8HA 5AA1A 4O3BA 1IXIA 1O63A 3H3GA 1XVXA 5L9MA 1UQWA 4F29A 2UYFA 3N26A 3H03A 5AE4A 5CBSA 4RY1A 3TYHA 1ANFA 1POTA 3OENA 4R6HA 3R6UA 5I59B 4GXAA 3KSXA 5TPAA 1SD3A 3V89B 2F97A 4OEUA 2DSFA 2DWIA 1AMFA 2DVZA 3KEIA 4XKNA 4I1DA 4DXCA 4Z7EA 4NF5A 2O84X 1US5A 2HQ0A 4ZEFA 1B1XA 1N7WA 2I3WA 3VLUA 4Q5TA 1AL3A 1Z7NE 2CZLA 4U4SA 4JBZA 3SEVA 3VLVA 4DE8A 3CSBA 2Y7PA 4R75A 1P1WA 4KD5A 1LBCA 1JW5A 4UACA 4U22A 2OK2A 1MY4A 5TP9A 2O69A 3TCGA 3M3KA 4TLMB 2RC7A 1JW4A 3K1NA 2O1MA 4FJPA 4QFKA 5IKBA 3KJ7A 1A8EA 2O51A 3N6UA 2H99A 4DXBA 2Y7WA 4YKKA 1MM7A 1MY3A 2F36A 4Q0CA 4YKJA 5H8SA 3CFLA 4X48A 3N5LA 2HZLA 3BBRA 1ZJLA 4F18A 5I84A 4ZEBA 1DTGA 4N07A 3O2AA 1GVCA 1I6AA 3C35A 5H8HB 3DELB 1B0HA 3HSTA 1PEBA 4ECFA 3PMXA 3SERA 4ELPA 4JSDA 1FQBA 4PFYA 4LONB 2D21A 1ZIUA
chains in the Genus database with same CATH superfamily
4OESA 4G8NA 2P3NA 1MQIA 1R6ZA 3H7MA 2P2AA 5IM2A 2B3BA 3PPOA 1XVYA 5TPAB 1EZOA 2CZHA 3IK6B 3F11A 2V25A 4PBQA 5IZ3A 1Y1ZA 3USDA 1LAHE 3O6IA 1CE2A 3TQWA 2ALUA 4TLLB 4XTCQ 2M8CA 4X8RA 4ONYA 4NF5B 1M5EA 3S9EA 1BIYA 4BDMA 2QS1A 4QFOA 5EQ9A 3IO6A 3O6GA 1GGGA 5EYFA 3S4UA 2O1LA 2X26A 4G68A 2JJKA 4PDHA 5EYGA 2R71A 4PE5B 5I58A 4OETA 4HTGA 4EQ7A 1JW1A 3K6VA 1YXIA 1MDQA 3OO7A 3IB1A 5I5PA 2O6AA 3CG3A 3W9WA 2AL5A 1JEUA 1B5IA 2F3DA 3MP8A 4GQOA 5ELVA 3PPRA 4H46A 5FBPA 2ESNA 4P9KA 4YAHX 3E4RA 2G93A 3MSTA 2PYYA 4YMAA 4OMBA 4OFJA 4AB6A 2ZZXA 5TP9B 1BTJA 1I6BA 1OQHA 4HS7A 2FNCA 3R26A 3U92A 3TEPA 2BJJX 3PU5A 2Q9TA 4NF4A 3LBSA 4DI3D 1IEJA 2I6EA 4N8GA 3CHGA 4PFIA 1PBQA 5AA2D 3WAEA 3I3VA 1B51A 4I40A 4QBAA 4OXVA 4JSOA 1N76A 4PFWA 3FGSA 4H67A 1D4NA 1SW5A 4F39A 1MH3A 3RTFB 4O7MA 1PB9A 3WAFA 4ZS9A 4IGRA 5F7VA 2RCBA 3EKIA 1P99A 4PAIA 1FQAA 2GHAA 3I6VA 1JETA 2PT1A 2PX1A 3G3KA 5KCJA 4I3YA 4HCYA 4OVPA 4JWXA 1MRPA 1RDXA 2ZXTA 3MP6A 3VXBA 1B32A 3EHSA 5IAIA 1M5BA 1IXCA 1S9TA 4DI4B 4H45A 3LC8A 4FECA 5BWJA 3GBAA 3FVOA 1EH3A 4TQUQ 3MW0A 2B3FA 1LBWA 4QSCA 2UXAA 1LB9A 4NG7A 4MLQA 1N0TA 1NI9A 3A29A 3C36A 5IZ3B 1SPIA 4OYVA 2WBBA 4OENA 4OTEA 4QFNA 1NV4A 2PFZA 2XXWA 3SZPA 3A3UA 3TZAA 3S9NC 3V8XB 3K4UA 4X1DA 2PMSA 3SEUA 3V5AA 3PGFA 3ODBA 1UIUA 5L8DA 4G68B 2FIEA 5I58B 3RPLA 3E79A 1B7HA 2H4IA 2O68A 2H98A 1SW4A 1PC3A 4OVRA 4M4GA 2LAOA 4Z0IA 3W9VA 2AL4A 4AS4A 2CEXA 3TTKA 5H8NA 2ZYNA 2F5XA 2VD2A 2QFLA 3OO6A 1YZ0A 2ANJA 4RK9A 2G29A 1FJ6A 2ZYOA 4FE8A 4EF2A 1T0KA 3T9HB 1FTMA 3E13X 3K00A 2FYIA 3MC2A 3N94A 4NF4B 1OMPA 3FVGA 4O3AA 3UN6A 4NN3A 1H76A 4X9TA 3R7XA 4GIZA 4MIJA 2DWHA 4XFEA 1B05A 4IO6A 4OVTA 1A8FA 2QVVA 1JNFA 1H44A 4FEDA 5HPQA 1Y20A 1SW1A 1DTZA 1LFIA 4GWZA 1SI0A 2ZZWA 4QRZA 1NNPA 2QS2A 4C0RA 1FBPA 4YKIA 4EUOA 1FW0A 1XC1A 2OX3A 3Q27A 1FPDA 3U72A 1H45A 1US4A 2REJA 2RC9A 2XXHA 4MAGA 3TPAA 2Q8JA 2XWKA 1URGA 3TDJA 4N13A 3EQ1A 5CBRA 5KCJB 3M3LA 2GRVA 2B65A 1I69A 4YKPA 1P1OA 3ZKKA 3KN7A 1EU8A 1S7YA 3SEYA 3OEKA 4DCXA 4RYAA 3U1OA 1MDP1 3N6TA 1NUZA 3JV9A 3IB0A 3KGCA 4GWYA 3LSXA 1FBHA 1Y3QA 2O7IA 3UGWA 3BFUA 4MH5A 5AA4A 4XKRA 3M3FA 4QSDA 1TWYA 4N17A 3RUMA 4I9DA 4MHFA 3PV0E 1QUIA 3IO4A 3IJXB 2Y7KA 2XXVA 2QVRA 2HEUA 3GXAA 4LQ5A 3DP8A 4M1VA 4KPTA 4EDPA 5J16A 3MVYA 2IEEA 3FBPA 3GLBA 3B6TA 4N6KA 1P1NA 1B7ZA 2NXOA 3MYUA 1MQHA 1Y4TA 1GR2A 1B4HA 3G3IA 3SDFA 3RPLB 5CMMA 1QUJA 4PAFA 4QFLA 5I56A 4N6PA 3IB2A 3TKDA 1Y4CA 1NV5A 2VGQA 2DP8A 5H8NB 2PT2A 1YCJA 1JEVA 3BFTA 4FORA 2F7CA 2QRYA 1EYKA 3TMGA 1JQFA 4HE1A 5ICQA 4N6DA 1LFHA 1MPBA 4OEVA 1FPFA 4EF1A 3T93B 3DP6A 4EQ9A 1WODA 1SYIA 2D5WA 3OOAA 4G8MA 3K0VA 4G77A 1P1QA 3D4GA 4RXLA 3ONMA 1LLSA 4TOZA 5TU0A 4KYEA 5B70A 1DPEA 1M5CA 2OZZA 2NOOA 5EQ8A 1NV6A 3UA8A 1HSLA 2RKMA 3ILTB 2QMXA 5T3JA 1TXFA 4ZDMA 1IMDA 3QUFA 2OBGA 4YB5A 2V3UA 1VFEA 2THIA 2XHDA 5CMCA 1FPLA 5I2KA 2MKZA 1LB8A 3ECRA 3FVKA 3C31A 5DVJA 3SETA 4YMBA 1Z7ME 1G0HA 5JTYA 1UTHA 1XHYA 1O7TA 2XWIA 5ET5A 5AA4B 2BJIA 1MG1A 1LAGE 3UP9A 3OSQA 1EYIA 2P3VA 1LEVA 4IO4A 3TTRA 4F3PA 4U21A 2XXYA 2XX7A 4I62A 1B46A 2GH9A 1R9QA 5F24A 4ZE8A 4GFRA 2XXQA 3KN3A 2UVHA 1ZTYA 3RQTA 1FCKA 5ITOA 3PPNA 3T66A 2RC8A 3LSWA 3O6HA 4NGUA 2Y7IA 4ZECA 4GXSB 4L17A 2DS9A 3C34A 4BDLA 4P0GA 3CRBA 4KXPA 1DCUA 5I56B 1HSJA 4PGNA 4U1OA 4FEBA 2B4MA 2HAUA 4G68C 1JVXA 2X7QA 1FSAA 3O28A 3B6QA 2FIXA 1B3FA 5LOMA 2V3QA 1MXVA 2XX9A 3C33A 3FD3A 3IOUA 1GV8A 4G4PA 2QMWA 4RK2A 3KFMA 1MPCA 1NH8A 1FRPA 1SDXA 4JXIA 4LP2B 4R9FA 1QW0A 2QL3A 4DZ1A 3CR9A 4YICA 1MH4A 4KCDA 1I6QA 4DXUA 4GD5A 4JVDA 4ZZEA 3SEXA 1BKAA 4IO7A 3C32A 2XA5A 4LQ2A 3EF7A 1IMBA 3CFXA 3LSLA 1B5JA 3KOTA 4PAKA 2HZKA 4N91A 4LVQA 2GHBA 5FHMA 2F7BA 1HSEA 3BKIB 4QF9A 2XXXA 3D1RA 1LBVA 2A5SA 3PMWA 2RCAA 2OLBA 1FTAA 3TFLA 5IZ1A 3QXMA 1M5FA 5CMKA 4POWA 3IFAA 2Y5KA 4OWDA 3S2VA 4YU0A 3K02A 5DYHA 1NMUA 5I2KB 3MPLA 1BK4A 3HPIA 1BLFA 4QFPA 2DE4A 4JWOA 2ZNUA 2H9BA 2KR0A 3MVXA 4F31B 4GWUA 5JTYB 1UTHB 1YAEA 5BUUA 4GOTA 1Y9UA 1SQYA 2R9JA 1QJMA 3MVWA 2PBWA 1EYJA 2XD3A 4E0WA 1SW2A 4FIMA 2ZZVA 1NKXA 4LZ7A 4H8JA 3KOSA 3H4ZA 1ATGA 3EPEA 1Q1KA 4OZ9A 4NF6A 4XEQA 1OLAA 3S9LC 2F8DA 3ZKLA 3IOWA 1B9JA 3FXUA 3RY3A 4F1UA 4O8MA 4NMYA 2ONSA 2UYEA 1B58A 1LCFA 1NUXA 2I0CA 1Y3NA 3L6HA 1FPIA 3T9XB 4DDDA 4LATA 4H0WA 3TTLA 1B6HA 4C1UA 2VPNA 1QGXA 3MUQA 5M2VA 5DW8A 4NWCA 4AS5A 3RLFE 1Q35A 3LSFB 5IZZA 3RN8A 3GZGA 4G8HA 2OCUA 4GF8A 1NNKA 1LCTA 2QS4A 4R2FA 4BLAA 3KC1A 3FZVA 2FHYA 2L5VA 1OVTA 4GL8A 3U8QA 1MXWA 1J1NA 4KFQA 3Q26A 3LV0A 3MBPA 3GBBA 5ICTA 1MM6A 5K2XA 3T9UA 3H6VA 4POXA 4UABA 1VR5A 2VOZA 1QUKA 2WKYA 4WKMA 3TTNA 4ELQA 2ONRA 2UVGA 2XD2A 1PB7A 4HE0A 5DEXA 3PUYE 3HCQA 4IGTA 3QYTA 3UK4A 3IOTA 2F35A 5CM6A 5ET7A 1RYOA 1TT1A 3ILUB 4RJZA 4LA9A 3K2DA 4GX3A 2QSXA 4MEVA 3B6WA 3SKPA 2CZKA 2R8TA 3B50A 1B3GA 1RYXA 3KBZA 1B3HA 1MY2A 5CMBA 4MNIA 2WYPA 3SEWA 1VDWA 1B3LA 1KZ8A 4QSEA 5K2YA 4NF6B 2V93A 4BDRA 2AIXA 4F2OA 5I57A 1LAXA 5EHSA 5B7DA 2I48A 4ZEDA 3H6WA 2GQ1A 4PQJA 1PBPA 1ZBMA 1RKMA 3JYRA 1B5HA 2Q74A 1LGBC 4H6DA 3IOVA 1M5DA 2REGA 1OLCA 4AB5A 1A99A 3U93A 4ELRA 3TELA 4MLVA 1WDNA 1IQ7A 3PUXE 5DVIA 4BDOA 4IO3A 4HE2A 1NV1A 5HM4B 1H3DA 4IO5A 1B0LA 1B40A 3MZ9A 4HXVA 3FJGA 4C1TA 3U65A 1QULA 2ZYMA 3DM0A 1B4ZA 4H1XA 1EZPA 1RDZA 1TFAA 4N81A 2ONKE 3OD7A 1KA1A 4PC9A 4ZE9A 4KI0E 5DVFA 4DLDA 2QPQA 4KR5A 1URDA 1H43A 1UIVA 4BDQA 5J1DA 2Q89A 5DEXB 4PE3A 2HHMA 4F1VA 1NV3A 1IZ1A 1AH5A 1B52A 1URSA 3EHUA 4PFTA 4FBPA 1FBFA 1XOCA 4GL0A 4ESWA 2XXRA 3CG1A 4GWWA 4PP0A 1N7XA 4RPNA 3OMBA 4H5FA 2OJTA 4PGPA 1CB6A 1TFDA 1Y1MA 1PDAA 4F2QA 3PMVA 2I4CA 3TODA 3KSJA 4RA1A 1XT8A 4R9GA 2FBPA 4OHNA 1LAFE 2DE3A 2FVZA 5I57B 2XXTA 2RF1A 1NNFA 1VSOA 2XX8A 2CEYA 1LSTA 1PB8A 2DOJA 1WVJA 5ISUA 4GX4A 3T0JA 1K9ZA 3FXBA 1FQDA 3QSLA 4PCDA 4GWXA 3FV2A 2DDKA 3G3HA 2Z23A 3GYYA 2I4BA 1DOTA 1FPBA 3Q28A 4FAJA 1USYH 2R6GE 2XWOA 4DIGA 3THIA 3K6XA 3PPQA 1SI1A 3KN8A 3RYDA 3D4CA 1B7UA 1OQGA 3FXRA 4QHQA 5ET8A 4WXJA 1A54A 1QVSA 5A5LA 1S50A 1B3EA 3EHTA 4U2RA 4UA8A 2KLFA 2IA4A 5HBCA 2VP1A 2NUVA 2V3TA 5AA3A 3OXNA 1QKAA 4N15A 3PPPA 3CFZA 2Y5LA 3RT6B 3MPKA 4BDNA 4PBHA 1LBBA 4NQ8A 1YPNA 2Q2CA 4NE4A 4NWDA 4LN5A 2Z8FA 3G3GA 2QJEA 2OWSA 2ZMBA 4X1BA 2XXIA 2X7PA 4QXDA 3QMFA 2F6PA 5KDTA 1Q9DA 1FJ9A 3ZSFA 3G3JA 4PFBA 3G3FA 4GBVA 3VXCA 2F34A 4XKPA 3VV5A 3LR1A 3RPWA 4MNPA 5JK4A 4MJOA 4ELOA 4MF3A 2V84A 3RTWB 4GVOA 2HAVA 3PD9A 4F3GA 3JZJA 3HV1A 3KG2A 1NFTA 2NWJA 1NNTA 4RNSA 5AA2A 4KYSA 4GLIA 3LUZA 5A5XA 1NL5A 3K01A 4ESXA 1B2HA 4XKQA 2P1SA 3KZGA 4OVJA 4P1LA 3IJOB 1RDYA 4IY6A 3W15C 4IY5A 2Q88A 1XS5A 3PUWE 2HXRA 3LUYA 1VFDA 5L9SA 1N3WA 2XXPA 4EXKA 2YPNA 3IAZA 4MFIA 1KA0A 5F1QA 4NF8A 5FTIA 3B7DA 4O94A 3HHGA 2WX9A 3IX1A 4NF0A 3IORA 3MZBA 3A3CA 4R6KA 4MBPA 2I3VA 3S9MC 1FQCA 5LTCA 2NVUB 2A5TA 4KCCA 1FPGA 4KQPA 1D9QA 4ND9A 2F78A 3VVEA 4H65A 1IITA 1FQEA 1FTJA 4JWYA 1FPJA 3CI8A 4GWSA 3C4MA 1LBXA 1NH7A 4R6YA 1USYE 3V83A 4F1YA 4PDDA 3PUZE 3QAXA 4ZEIA 1IMCA 1QKBA 3SESA 2PFYA 1SBPA 1EZ9A 3KBRA 3T22A 1ELJA 1JVYA 4KYDA 3Q25A 4O7IA 3OO9A 1FPKA 5H8FA 2F3BA 4F3SA 2P0SA 4MNCA 3O9PA 2H25A 2Y84A 1L5TA 3VE1B 2Z8DA 2VHAA 5KDTB 4EQBA 4R72A 2Z8EA 3H06B 3TTMA 4DCYA 4P8BA 1FTLA 1F9BA 3OO8A 4P47A 1SYHA 2I0BA 2RINA 4GX6A 2DWJA 1II5A 4PTKA 1MXYA 1MQGA 3FASA 5AA2B 5I2NA 1GTKA 5EQAA 1LFGA 1NV7A 5DT6A 2WYKA 5A5XB 3FXQA 2ZYKA 4K3FA 2QVUA 1IMFA 5LDZA 2WBDA 1MQDA 2VPOA 5FTHA 1K9YA 5ET6A 4ZZAA 1P1UA 1DMBA 3PUVE 4OFOA 5KZTA 2ZNTA 3P7IA 3QUJA 3E9XA 1MQJA 4HCWA 1R1NA 4RPOA 3FJMA 2HFBA 2YJPA 4XXUA 2AYSA 4NF8B 2DVCA 1FTOA 2OWTA 4F19A 3VFJA 3RGYA 4JVCA 3FIRA 3TCFA 1YYZA 3B8BA 4FATA 3MQ9A 2DXYA 2A5TB 2WEFA 1KWHA 1SVXB 4MMPA 4ISUA 3IR1A 3A09A 1MXUA 2F6GA 3G7WA 4P11A 2GFEA 5EHMA 3OEMA 1ZKBA 4NHBA 3T9VA 3CSGA 1OVBA 3CVGA 1Y3PA 4X04A 4N8YA 4NTLA 3OELA 5CRYA 1DPPA 5FHOA 2PCRA 3MWBA 4OANA 4AQ4A 3TAJA 3FJ7A 4H8IA 2I49A 3O29A 1INPA 1FBEA 4PFRA 4E0XA 2DXRA 1BP5A 1A7LA 3K6UA 5H8FB 4O3CA 3IL1B 1UTBA 3CIJA 3MZ1A 3ROJA 3TCHA 1FBGA 3KJTA 4I3EA 1IUDA 5EYHA 4ZEKA 2XWVA 4R2BA 2E0SA 3RNNA 4OFLA 3VLWA 2YLNA 1D9YA 3HHFA 3E3KA 1O64A 3C9HA 4OQOA 4F3BA 1NV0A 1AOVA 3VDFA 3TUSA 4JDFA 5ITPA 1A55A 3BIGA 5H8QA 2QS3A 2UVIA 5I2NB 1D3KA 2KQZA 1LBYA 1FQFA 4P0IA 2HCAA 2HXWA 1D9VA 4PF8A 3U94A 2PVUA 1R9LA 4LZ5A 2Z22A 4EXLA 3M8UA 1MY1A 4Q8RA 2DQVA 3VVFA 2UVJA 5IGAA 4I8CA 1YTVA 2DWAA 2B4LA 4R73A 5I7IA 3AXFA 3UIFA 3EN3A 4F22A 2W7YA 3H6TA 3RT8A 4PF6A 4R74A 3ZS6A 5I59A 4GRKA 4P56A 5CC2A 1IXGA 4JB7A 2O7UA 2FA7A 1MXXA 3T1BA 4OVSA 1FBDA 1G0IA 5L9OA 3VVDA 5CI5A 3I5OA 3QIMA 2CMOA 4NEDA 4THIA 2Y7RA 4LZ8A 4P1EA 3K6WA 2Q2AA 4WEDA 4PETA 4JVIA 3O66A 1MXZA 1IXHA 2D3IA 1JP4A 3KC0A 2E1SA 5EQ7A 2ABHA 1B1HA 4IO2A 2DYXA 2OWZA 2H5YA 4YZZA 1OIBA 3DLNA 4IB2A 4WEPA 3PD8A 1POY1 1IIWA 2DE2A 1XI6A 2CZIA 2F7AA 4GWOA 1N04A 5DTBA 4YB7A 1ZU0A 1IMAA 3TQLA 4U23A 1UTBB 3L6GA 4NAPA 3NOHA 2I58A 4NX1A 4KHZE 3FVNA 1MS7A 2ZNSA 1ZLQA 3K1MA 4U1ZA 2XXKA 4LUBA 3PTYA 1DK4A 5FHNA 3T96B 3H6UA 3Q29A 4G2ZA 4XF5A 3MVZA 3FUZA 2XXUA 1ZMGA 1A40A 4Q30B 5JEIA 4HW8A 4XIGQ 3K1PA 1MPDA 4YB6A 5H8QB 3DP4A 1N3XA 3FATA 1AIVA 4H5GA 1N84A 3O97A 3UORA 3MAMA 1IMEA 3QK6A 3MJNA 3OSRA 4U4XA 1VE4A 4OERA 3HN0A 4PFUA 3BIHA 3FV1A 2VD3A 3HO7A 1MY0A 1FTKA 1DSNA 3MP1A 5H8HA 5AA1A 4O3BA 1IXIA 1O63A 3H3GA 1XVXA 5L9MA 1UQWA 3HFUA 4F29A 2UYFA 3ISPA 3N26A 3H03A 2V4CA 5AE4A 5CBSA 4RY1A 2HPGA 5ESYA 1FPEA 3TYHA 1ANFA 1POTA 3OENA 2Q8MA 4R6HA 3R6UA 5I59B 4GXAA 3KSXA 5TPAA 1SD3A 4P3LA 3V89B 2F97A 1DBZA 4OEUA 2DSFA 2DWIA 2VT5A 1AMFA 2DVZA 3KEIA 4XKNA 4I1DA 4DXCA 4Z7EA 4MX6A 1NUYA 4NF5A 2O84X 1US5A 1NV2A 2HQ0A 4ZEFA 1B1XA 1N7WA 2I3WA 3VLUA 3IFCA 4Q5TA 1AL3A 4MCOA 1Z7NE 2CZLA 4U4SA 4JBZA 3SEVA 3VLVA 4DE8A 3CSBA 2Y7PA 4R75A 4OVQA 1P1WA 4KD5A 1LBCA 1JW5A 4UACA 4GBWA 4U22A 2OK2A 1MY4A 5TP9A 2O69A 3TCGA 3M3KA 4TLMB 2RC7A 1JW4A 3K1NA 1CNQA 2O1MA 4FJPA 4QFKA 5IKBA 4OA4A 3KJ7A 1A8EA 4N4UA 2O51A 3N6UA 2H99A 4DXBA 2Y7WA 4YKKA 1MM7A 1MY3A 2F36A 4Q0CA 4YKJA 5H8SA 3CFLA 4X48A 3N5LA 4G61A 5I3SA 1AWBA 2HZLA 3BBRA 1ZJLA 4F18A 5I84A 4ZEBA 1DTGA 4N07A 3O2AA 1GVCA 1I6AA 4IR8A 3E78A 1LBZA 3C35A 5H8HB 3DELB 1B0HA 3HSTA 1FBCA 1PEBA 4ECFA 3PMXA 3SERA 4ELPA 1NUWA 4JSDA 1FQBA 4PFYA 4LONB 2D21A 1ZIUA
chains in the Genus database with same CATH topology
4OESA 4G8NA 1MQIA 1R6ZA 3H7MA 2P2AA 2B3BA 3PPOA 1XVYA 5TPAB 1EZOA 3IK6B 3F11A 2V25A 1Y1ZA 3USDA 1LAHE 3O6IA 1CE2A 3TQWA 2ALUA 4TLLB 4XTCQ 2M8CA 4ONYA 4NF5B 1M5EA 3S9EA 1BIYA 4BDMA 2QS1A 4QFOA 5EYFA 3IO6A 3O6GA 1GGGA 3S4UA 2O1LA 2X26A 4G68A 2R71A 4PE5B 5I58A 4OETA 4HTGA 4EQ7A 1JW1A 3K6VA 1MDQA 3OO7A 3IB1A 2O6AA 3CG3A 3W9WA 2AL5A 1JEUA 1B5IA 3MP8A 4GQOA 5ELVA 3PPRA 2ESNA 4YAHX 3E4RA 2G93A 2PYYA 4YMAA 4OMBA 4OFJA 4AB6A 5TP9B 1BTJA 1I6BA 1OQHA 4HS7A 2FNCA 3R26A 3U92A 3TEPA 2BJJX 3PU5A 2Q9TA 4NF4A 3LBSA 1IEJA 2I6EA 1PBQA 5AA2D 3WAEA 3I3VA 1B51A 4OXVA 4JSOA 1N76A 4PFWA 3FGSA 4H67A 1D4NA 1SW5A 4F39A 1MH3A 3RTFB 1PB9A 3WAFA 4ZS9A 4IGRA 5F7VA 2RCBA 1P99A 1FQAA 2GHAA 3I6VA 1JETA 2PT1A 2PX1A 3G3KA 5KCJA 4HCYA 4JWXA 1MRPA 2ZXTA 3MP6A 3VXBA 1B32A 3EHSA 5IAIA 1M5BA 1IXCA 1S9TA 3LC8A 4FECA 5BWJA 3GBAA 3FVOA 1EH3A 4TQUQ 3MW0A 2B3FA 4QSCA 2UXAA 1LB9A 4MLQA 1N0TA 3C36A 4OYVA 4OENA 4OTEA 4QFNA 2XXWA 3A3UA 3TZAA 3S9NC 3V8XB 3K4UA 4X1DA 2PMSA 3SEUA 3V5AA 3PGFA 3ODBA 1UIUA 5L8DA 4G68B 5I58B 1B7HA 2H4IA 2O68A 2H98A 1SW4A 1PC3A 4M4GA 2LAOA 4Z0IA 3W9VA 2AL4A 3TTKA 5H8NA 2ZYNA 2F5XA 2VD2A 3OO6A 2ANJA 4RK9A 2G29A 2ZYOA 4FE8A 4EF2A 1T0KA 3T9HB 1FTMA 3E13X 3K00A 2FYIA 3MC2A 3N94A 4NF4B 1OMPA 3FVGA 4O3AA 3UN6A 1H76A 4X9TA 3R7XA 4GIZA 2DWHA 1B05A 4IO6A 1A8FA 1JNFA 1H44A 4FEDA 5HPQA 1Y20A 1SW1A 1DTZA 1LFIA 1SI0A 4QRZA 1NNPA 2QS2A 4C0RA 4YKIA 4EUOA 1FW0A 1XC1A 3Q27A 3U72A 1H45A 1US4A 2REJA 2RC9A 2XXHA 3TPAA 2Q8JA 1URGA 3TDJA 4N13A 3EQ1A 5CBRA 5KCJB 3M3LA 2GRVA 2B65A 1I69A 4YKPA 1P1OA 3ZKKA 3KN7A 1EU8A 1S7YA 3SEYA 3OEKA 4DCXA 4RYAA 3U1OA 1MDP1 3N6TA 3JV9A 3IB0A 3KGCA 3LSXA 1Y3QA 2O7IA 3UGWA 3BFUA 4MH5A 5AA4A 4XKRA 3M3FA 4QSDA 1TWYA 3RUMA 4I9DA 3PV0E 1QUIA 3IO4A 3IJXB 2Y7KA 2XXVA 2HEUA 3GXAA 4LQ5A 3DP8A 4M1VA 4KPTA 4EDPA 3MVYA 2IEEA 3GLBA 3B6TA 1P1NA 1B7ZA 2NXOA 1MQHA 1Y4TA 1GR2A 1B4HA 3G3IA 3SDFA 5CMMA 1QUJA 4QFLA 5I56A 4N6PA 3IB2A 3TKDA 1Y4CA 2VGQA 2DP8A 5H8NB 2PT2A 1YCJA 1JEVA 3BFTA 4FORA 2F7CA 2QRYA 3TMGA 1JQFA 5ICQA 1LFHA 1MPBA 4OEVA 4EF1A 3T93B 3DP6A 4EQ9A 1WODA 1SYIA 2D5WA 3OOAA 4G8MA 3K0VA 4G77A 1P1QA 3D4GA 4RXLA 3ONMA 1LLSA 4TOZA 5TU0A 4KYEA 5B70A 1DPEA 1M5CA 2OZZA 2NOOA 3UA8A 1HSLA 2RKMA 3ILTB 2QMXA 1TXFA 4ZDMA 3QUFA 2OBGA 4YB5A 2V3UA 1VFEA 2THIA 2XHDA 5CMCA 5I2KA 1LB8A 3ECRA 3FVKA 3C31A 5DVJA 3SETA 4YMBA 1Z7ME 5JTYA 1UTHA 1XHYA 1O7TA 5AA4B 1MG1A 1LAGE 3UP9A 3OSQA 4IO4A 3TTRA 4F3PA 4U21A 2XXYA 2XX7A 4I62A 1B46A 2GH9A 1R9QA 4ZE8A 4GFRA 2XXQA 3KN3A 2UVHA 1ZTYA 3RQTA 1FCKA 5ITOA 3PPNA 3T66A 2RC8A 3LSWA 3O6HA 2Y7IA 4ZECA 4GXSB 4L17A 2DS9A 3C34A 4BDLA 4P0GA 3CRBA 5I56B 1HSJA 4U1OA 4FEBA 2HAUA 4G68C 1JVXA 2X7QA 3O28A 3B6QA 1B3FA 5LOMA 2V3QA 1MXVA 2XX9A 3C33A 3FD3A 3IOUA 1GV8A 4G4PA 2QMWA 4RK2A 3KFMA 1MPCA 1NH8A 1SDXA 4JXIA 4LP2B 4R9FA 1QW0A 2QL3A 4DZ1A 3CR9A 4YICA 1MH4A 4KCDA 1I6QA 4DXUA 4GD5A 4ZZEA 3SEXA 1BKAA 4IO7A 3C32A 4LQ2A 3EF7A 3CFXA 3LSLA 1B5JA 3KOTA 2HZKA 4LVQA 2GHBA 5FHMA 2F7BA 1HSEA 3BKIB 4QF9A 2XXXA 2A5SA 3PMWA 2RCAA 2OLBA 3TFLA 3QXMA 1M5FA 5CMKA 4POWA 4OWDA 3S2VA 4YU0A 3K02A 5DYHA 1NMUA 5I2KB 3MPLA 3HPIA 1BLFA 4QFPA 2DE4A 4JWOA 2ZNUA 2H9BA 3MVXA 4F31B 5JTYB 1UTHB 1YAEA 5BUUA 4GOTA 1Y9UA 1SQYA 2R9JA 1QJMA 3MVWA 2PBWA 2XD3A 4E0WA 1SW2A 4FIMA 1NKXA 4LZ7A 4H8JA 3KOSA 3H4ZA 1ATGA 3EPEA 1Q1KA 4OZ9A 4NF6A 1OLAA 3S9LC 2F8DA 3ZKLA 3IOWA 1B9JA 3FXUA 3RY3A 4F1UA 4NMYA 2ONSA 2UYEA 1B58A 1LCFA 2I0CA 1Y3NA 3L6HA 4DDDA 3T9XB 4LATA 4H0WA 3TTLA 1B6HA 4C1UA 3MUQA 5M2VA 4NWCA 3RLFE 1Q35A 3LSFB 3RN8A 3GZGA 4G8HA 2OCUA 4GF8A 1NNKA 1LCTA 2QS4A 4R2FA 4BLAA 3FZVA 1OVTA 4GL8A 3U8QA 1MXWA 1J1NA 4KFQA 3Q26A 3MBPA 3GBBA 5ICTA 1MM6A 5K2XA 3T9UA 3H6VA 4POXA 1VR5A 2VOZA 1QUKA 2WKYA 4WKMA 3TTNA 4ELQA 2ONRA 2UVGA 2XD2A 1PB7A 5DEXA 3PUYE 3HCQA 4IGTA 3QYTA 3UK4A 3IOTA 2F35A 5CM6A 1RYOA 1TT1A 3ILUB 4RJZA 4LA9A 3K2DA 2QSXA 3B6WA 3SKPA 1B3GA 1RYXA 1B3HA 1MY2A 5CMBA 3SEWA 1B3LA 4QSEA 5K2YA 4NF6B 2V93A 4BDRA 2AIXA 4F2OA 5I57A 1LAXA 5EHSA 5B7DA 2I48A 4ZEDA 3H6WA 4PQJA 1PBPA 1ZBMA 1RKMA 3JYRA 1B5HA 1LGBC 4H6DA 3IOVA 1M5DA 2REGA 1OLCA 4AB5A 1A99A 3U93A 4ELRA 3TELA 4MLVA 1WDNA 1IQ7A 3PUXE 5DVIA 4BDOA 4IO3A 5HM4B 1H3DA 4IO5A 1B0LA 1B40A 3MZ9A 3FJGA 4C1TA 1QULA 2ZYMA 3DM0A 1B4ZA 4H1XA 1EZPA 1TFAA 2ONKE 3OD7A 4ZE9A 4KI0E 5DVFA 4DLDA 2QPQA 4KR5A 1URDA 1H43A 1UIVA 4BDQA 5J1DA 2Q89A 5DEXB 4F1VA 1IZ1A 1AH5A 1B52A 1URSA 3EHUA 4PFTA 1XOCA 4GL0A 4ESWA 2XXRA 3CG1A 4PP0A 1N7XA 4RPNA 3OMBA 4H5FA 2OJTA 1CB6A 1TFDA 1Y1MA 1PDAA 4F2QA 3PMVA 2I4CA 3TODA 3KSJA 4RA1A 1XT8A 4R9GA 4OHNA 1LAFE 2DE3A 5I57B 2XXTA 2RF1A 1NNFA 1VSOA 2XX8A 1LSTA 1PB8A 2DOJA 1WVJA 5ISUA 1FQDA 3QSLA 3FV2A 3G3HA 2Z23A 2I4BA 1DOTA 3Q28A 4FAJA 1USYH 2R6GE 4DIGA 3THIA 3K6XA 3PPQA 1SI1A 3KN8A 3D4CA 1B7UA 1OQGA 3FXRA 4QHQA 4WXJA 1A54A 1QVSA 1S50A 1B3EA 3EHTA 4U2RA 4UA8A 2KLFA 2IA4A 5HBCA 2VP1A 2NUVA 2V3TA 5AA3A 3OXNA 1QKAA 3PPPA 3CFZA 3RT6B 3MPKA 4BDNA 1LBBA 1YPNA 2Q2CA 4NE4A 4NWDA 2Z8FA 3G3GA 2QJEA 2OWSA 2ZMBA 4X1BA 2XXIA 2X7PA 2F6PA 5KDTA 3ZSFA 3G3JA 3G3FA 3VXCA 2F34A 4XKPA 3VV5A 3LR1A 3RPWA 5JK4A 4ELOA 4MF3A 2V84A 3RTWB 4GVOA 2HAVA 3PD9A 4F3GA 3JZJA 3HV1A 3KG2A 1NFTA 2NWJA 1NNTA 4RNSA 5AA2A 4KYSA 4GLIA 5A5XA 1NL5A 3K01A 4ESXA 1B2HA 4XKQA 2P1SA 3KZGA 4OVJA 3IJOB 4IY6A 3W15C 4IY5A 2Q88A 1XS5A 3PUWE 3LUYA 1VFDA 5L9SA 1N3WA 2XXPA 4EXKA 2YPNA 3IAZA 4MFIA 5F1QA 4NF8A 5FTIA 3B7DA 3HHGA 3IX1A 3IORA 3MZBA 3A3CA 4R6KA 4MBPA 2I3VA 3S9MC 1FQCA 2NVUB 2A5TA 4KCCA 4KQPA 4ND9A 2F78A 3VVEA 4H65A 1IITA 1FQEA 1FTJA 4JWYA 3CI8A 3C4MA 1NH7A 4R6YA 1USYE 3V83A 4F1YA 3PUZE 3QAXA 4ZEIA 1QKBA 3SESA 1SBPA 1EZ9A 3KBRA 3T22A 1ELJA 1JVYA 4KYDA 3Q25A 3OO9A 5H8FA 4F3SA 2P0SA 3O9PA 2H25A 2Y84A 1L5TA 3VE1B 2Z8DA 2VHAA 5KDTB 4EQBA 4R72A 2Z8EA 3H06B 3TTMA 4DCYA 1FTLA 1F9BA 3OO8A 1SYHA 2I0BA 2RINA 2DWJA 1II5A 1MXYA 1MQGA 3FASA 5AA2B 5I2NA 1GTKA 1LFGA 5DT6A 5A5XB 3FXQA 2ZYKA 4K3FA 1MQDA 5FTHA 4ZZAA 1P1UA 1DMBA 3PUVE 4OFOA 5KZTA 2ZNTA 3P7IA 3QUJA 3E9XA 1MQJA 4HCWA 1R1NA 4RPOA 3FJMA 2HFBA 2YJPA 4XXUA 2AYSA 4NF8B 2DVCA 1FTOA 2OWTA 4F19A 3VFJA 3RGYA 3FIRA 3TCFA 4FATA 3MQ9A 2DXYA 2A5TB 1KWHA 1SVXB 4ISUA 3IR1A 3A09A 1MXUA 2F6GA 3G7WA 4P11A 2GFEA 5EHMA 3OEMA 1ZKBA 3T9VA 3CSGA 1OVBA 3CVGA 1Y3PA 4NTLA 3OELA 5CRYA 1DPPA 5FHOA 3MWBA 4AQ4A 3TAJA 3FJ7A 4H8IA 2I49A 3O29A 4E0XA 2DXRA 1BP5A 1A7LA 3K6UA 5H8FB 4O3CA 3IL1B 1UTBA 3CIJA 3MZ1A 3TCHA 3KJTA 1IUDA 4ZEKA 4R2BA 2E0SA 3RNNA 4OFLA 3VLWA 2YLNA 1D9YA 3HHFA 3E3KA 1O64A 3C9HA 4OQOA 4F3BA 1AOVA 3VDFA 3TUSA 4JDFA 5ITPA 1A55A 5H8QA 2QS3A 2UVIA 5I2NB 1D3KA 1FQFA 4P0IA 2HCAA 2HXWA 1D9VA 3U94A 2PVUA 1R9LA 4LZ5A 2Z22A 4EXLA 3M8UA 1MY1A 4Q8RA 2DQVA 3VVFA 2UVJA 4I8CA 1YTVA 2DWAA 4R73A 3AXFA 3UIFA 3EN3A 4F22A 2W7YA 3H6TA 3RT8A 4R74A 3ZS6A 5I59A 4GRKA 5CC2A 1IXGA 4JB7A 2O7UA 2FA7A 1MXXA 5L9OA 3VVDA 5CI5A 3I5OA 3QIMA 2CMOA 4NEDA 4THIA 2Y7RA 4LZ8A 3K6WA 2Q2AA 4WEDA 4PETA 3O66A 1MXZA 1IXHA 2D3IA 2E1SA 2ABHA 1B1HA 4IO2A 2DYXA 2H5YA 4YZZA 1OIBA 3DLNA 4IB2A 4WEPA 3PD8A 1POY1 1IIWA 2DE2A 2F7AA 4GWOA 1N04A 5DTBA 4YB7A 1ZU0A 3TQLA 4U23A 1UTBB 3L6GA 2I58A 4KHZE 3FVNA 1MS7A 2ZNSA 1ZLQA 3K1MA 4U1ZA 4LUBA 5FHNA 3T96B 3H6UA 3Q29A 4G2ZA 3MVZA 3FUZA 2XXUA 1ZMGA 1A40A 4Q30B 5JEIA 4HW8A 4XIGQ 3K1PA 1MPDA 4YB6A 5H8QB 3DP4A 1N3XA 3FATA 1AIVA 4H5GA 1N84A 3O97A 3UORA 3MAMA 3QK6A 3MJNA 3OSRA 4U4XA 1VE4A 4OERA 3HN0A 4PFUA 3FV1A 2VD3A 3HO7A 1MY0A 1FTKA 1DSNA 3MP1A 5H8HA 5AA1A 4O3BA 1IXIA 1O63A 3H3GA 1XVXA 5L9MA 1UQWA 4F29A 2UYFA 3N26A 3H03A 5AE4A 5CBSA 4RY1A 3TYHA 1ANFA 1POTA 3OENA 4R6HA 3R6UA 5I59B 4GXAA 3KSXA 5TPAA 1SD3A 3V89B 2F97A 4OEUA 2DSFA 2DWIA 1AMFA 2DVZA 3KEIA 4XKNA 4I1DA 4DXCA 4Z7EA 4NF5A 2O84X 1US5A 2HQ0A 4ZEFA 1B1XA 1N7WA 2I3WA 3VLUA 4Q5TA 1AL3A 1Z7NE 2CZLA 4U4SA 4JBZA 3SEVA 3VLVA 4DE8A 3CSBA 2Y7PA 4R75A 1P1WA 4KD5A 1LBCA 1JW5A 4UACA 4U22A 2OK2A 1MY4A 5TP9A 2O69A 3TCGA 3M3KA 4TLMB 2RC7A 1JW4A 3K1NA 2O1MA 4FJPA 4QFKA 5IKBA 3KJ7A 1A8EA 2O51A 3N6UA 2H99A 4DXBA 2Y7WA 4YKKA 1MM7A 1MY3A 2F36A 4Q0CA 4YKJA 5H8SA 3CFLA 4X48A 3N5LA 2HZLA 3BBRA 1ZJLA 4F18A 5I84A 4ZEBA 1DTGA 4N07A 3O2AA 1GVCA 1I6AA 3C35A 5H8HB 3DELB 1B0HA 3HSTA 1PEBA 4ECFA 3PMXA 3SERA 4ELPA 4JSDA 1FQBA 4PFYA 4LONB 2D21A 1ZIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OES A;  4G8N A;  1MQI A;  1R6Z A;  3H7M A;  2P2A A;  2B3B A;  3PPO A;  1XVY A;  5TPA B;  1EZO A;  3IK6 B;  3F11 A;  2V25 A;  1Y1Z A;  3USD A;  1LAH E;  3O6I A;  1CE2 A;  3TQW A;  2ALU A;  4TLL B;  4XTC Q;  2M8C A;  4ONY A;  4NF5 B;  1M5E A;  3S9E A;  1BIY A;  4BDM A;  2QS1 A;  4QFO A;  5EYF A;  3IO6 A;  3O6G A;  1GGG A;  3S4U A;  2O1L A;  2X26 A;  4G68 A;  2R71 A;  4PE5 B;  5I58 A;  4OET A;  4HTG A;  4EQ7 A;  1JW1 A;  3K6V A;  1MDQ A;  3OO7 A;  3IB1 A;  2O6A A;  3CG3 A;  3W9W A;  2AL5 A;  1JEU A;  1B5I A;  3MP8 A;  4GQO A;  5ELV A;  3PPR A;  2ESN A;  4YAH X;  3E4R A;  2G93 A;  2PYY A;  4YMA A;  4OMB A;  4OFJ A;  4AB6 A;  5TP9 B;  1BTJ A;  1I6B A;  1OQH A;  4HS7 A;  2FNC A;  3R26 A;  3U92 A;  3TEP A;  2BJJ X;  3PU5 A;  2Q9T A;  4NF4 A;  3LBS A;  1IEJ A;  2I6E A;  1PBQ A;  5AA2 D;  3WAE A;  3I3V A;  1B51 A;  4OXV A;  4JSO A;  1N76 A;  4PFW A;  3FGS A;  4H67 A;  1D4N A;  1SW5 A;  4F39 A;  1MH3 A;  3RTF B;  1PB9 A;  3WAF A;  4ZS9 A;  4IGR A;  5F7V A;  2RCB A;  1P99 A;  1FQA A;  2GHA A;  3I6V A;  1JET A;  2PT1 A;  2PX1 A;  3G3K A;  5KCJ A;  4HCY A;  4JWX A;  1MRP A;  2ZXT A;  3MP6 A;  3VXB A;  1B32 A;  3EHS A;  5IAI A;  1M5B A;  1IXC A;  1S9T A;  3LC8 A;  4FEC A;  5BWJ A;  3GBA A;  3FVO A;  1EH3 A;  4TQU Q;  3MW0 A;  2B3F A;  4QSC A;  2UXA A;  1LB9 A;  4MLQ A;  1N0T A;  3C36 A;  4OYV A;  4OEN A;  4OTE A;  4QFN A;  2XXW A;  3A3U A;  3TZA A;  3S9N C;  3V8X B;  3K4U A;  4X1D A;  2PMS A;  3SEU A;  3V5A A;  3PGF A;  3ODB A;  1UIU A;  5L8D A;  4G68 B;  5I58 B;  1B7H A;  2H4I A;  2O68 A;  2H98 A;  1SW4 A;  1PC3 A;  4M4G A;  2LAO A;  4Z0I A;  3W9V A;  2AL4 A;  3TTK A;  5H8N A;  2ZYN A;  2F5X A;  2VD2 A;  3OO6 A;  2ANJ A;  4RK9 A;  2G29 A;  2ZYO A;  4FE8 A;  4EF2 A;  1T0K A;  3T9H B;  1FTM A;  3E13 X;  3K00 A;  2FYI A;  3MC2 A;  3N94 A;  4NF4 B;  1OMP A;  3FVG A;  4O3A A;  3UN6 A;  1H76 A;  4X9T A;  3R7X A;  4GIZ A;  2DWH A;  1B05 A;  4IO6 A;  1A8F A;  1JNF A;  1H44 A;  4FED A;  5HPQ A;  1Y20 A;  1SW1 A;  1DTZ A;  1LFI A;  1SI0 A;  4QRZ A;  1NNP A;  2QS2 A;  4C0R A;  4YKI A;  4EUO A;  1FW0 A;  1XC1 A;  3Q27 A;  3U72 A;  1H45 A;  1US4 A;  2REJ A;  2RC9 A;  2XXH A;  3TPA A;  2Q8J A;  1URG A;  3TDJ A;  4N13 A;  3EQ1 A;  5CBR A;  5KCJ B;  3M3L A;  2GRV A;  2B65 A;  1I69 A;  4YKP A;  1P1O A;  3ZKK A;  3KN7 A;  1EU8 A;  1S7Y A;  3SEY A;  3OEK A;  4DCX A;  4RYA A;  3U1O A;  1MDP 1;  3N6T A;  3JV9 A;  3IB0 A;  3KGC A;  3LSX A;  1Y3Q A;  2O7I A;  3UGW A;  3BFU A;  4MH5 A;  5AA4 A;  4XKR A;  3M3F A;  4QSD A;  1TWY A;  3RUM A;  4I9D A;  3PV0 E;  1QUI A;  3IO4 A;  3IJX B;  2Y7K A;  2XXV A;  2HEU A;  3GXA A;  4LQ5 A;  3DP8 A;  4M1V A;  4KPT A;  4EDP A;  3MVY A;  2IEE A;  3GLB A;  3B6T A;  1P1N A;  1B7Z A;  2NXO A;  1MQH A;  1Y4T A;  1GR2 A;  1B4H A;  3G3I A;  3SDF A;  5CMM A;  1QUJ A;  4QFL A;  5I56 A;  4N6P A;  3IB2 A;  3TKD A;  1Y4C A;  2VGQ A;  2DP8 A;  5H8N B;  2PT2 A;  1YCJ A;  1JEV A;  3BFT A;  4FOR A;  2F7C A;  2QRY A;  3TMG A;  1JQF A;  5ICQ A;  1LFH A;  1MPB A;  4OEV A;  4EF1 A;  3T93 B;  3DP6 A;  4EQ9 A;  1WOD A;  1SYI A;  2D5W A;  3OOA A;  4G8M A;  3K0V A;  4G77 A;  1P1Q A;  3D4G A;  4RXL A;  3ONM A;  1LLS A;  4TOZ A;  5TU0 A;  4KYE A;  5B70 A;  1DPE A;  1M5C A;  2OZZ A;  2NOO A;  3UA8 A;  1HSL A;  2RKM A;  3ILT B;  2QMX A;  1TXF A;  4ZDM A;  3QUF A;  2OBG A;  4YB5 A;  2V3U A;  1VFE A;  2THI A;  2XHD A;  5CMC A;  5I2K A;  1LB8 A;  3ECR A;  3FVK A;  3C31 A;  5DVJ A;  3SET A;  4YMB A;  1Z7M E;  5JTY A;  1UTH A;  1XHY A;  1O7T A;  5AA4 B;  1MG1 A;  1LAG E;  3UP9 A;  3OSQ A;  4IO4 A;  3TTR A;  4F3P A;  4U21 A;  2XXY A;  2XX7 A;  4I62 A;  1B46 A;  2GH9 A;  1R9Q A;  4ZE8 A;  4GFR A;  2XXQ A;  3KN3 A;  2UVH A;  1ZTY A;  3RQT A;  1FCK A;  5ITO A;  3PPN A;  3T66 A;  2RC8 A;  3LSW A;  3O6H A;  2Y7I A;  4ZEC A;  4GXS B;  4L17 A;  2DS9 A;  3C34 A;  4BDL A;  4P0G A;  3CRB A;  5I56 B;  1HSJ A;  4U1O A;  4FEB A;  2HAU A;  4G68 C;  1JVX A;  2X7Q A;  3O28 A;  3B6Q A;  1B3F A;  5LOM A;  2V3Q A;  1MXV A;  2XX9 A;  3C33 A;  3FD3 A;  3IOU A;  1GV8 A;  4G4P A;  2QMW A;  4RK2 A;  3KFM A;  1MPC A;  1NH8 A;  1SDX A;  4JXI A;  4LP2 B;  4R9F A;  1QW0 A;  2QL3 A;  4DZ1 A;  3CR9 A;  4YIC A;  1MH4 A;  4KCD A;  1I6Q A;  4DXU A;  4GD5 A;  4ZZE A;  3SEX A;  1BKA A;  4IO7 A;  3C32 A;  4LQ2 A;  3EF7 A;  3CFX A;  3LSL A;  1B5J A;  3KOT A;  2HZK A;  4LVQ A;  2GHB A;  5FHM A;  2F7B A;  1HSE A;  3BKI B;  4QF9 A;  2XXX A;  2A5S A;  3PMW A;  2RCA A;  2OLB A;  3TFL A;  3QXM A;  1M5F A;  5CMK A;  4POW A;  4OWD A;  3S2V A;  4YU0 A;  3K02 A;  5DYH A;  1NMU A;  5I2K B;  3MPL A;  3HPI A;  1BLF A;  4QFP A;  2DE4 A;  4JWO A;  2ZNU A;  2H9B A;  3MVX A;  4F31 B;  5JTY B;  1UTH B;  1YAE A;  5BUU A;  4GOT A;  1Y9U A;  1SQY A;  2R9J A;  1QJM A;  3MVW A;  2PBW A;  2XD3 A;  4E0W A;  1SW2 A;  4FIM A;  1NKX A;  4LZ7 A;  4H8J A;  3KOS A;  3H4Z A;  1ATG A;  3EPE A;  1Q1K A;  4OZ9 A;  4NF6 A;  1OLA A;  3S9L C;  2F8D A;  3ZKL A;  3IOW A;  1B9J A;  3FXU A;  3RY3 A;  4F1U A;  4NMY A;  2ONS A;  2UYE A;  1B58 A;  1LCF A;  2I0C A;  1Y3N A;  3L6H A;  4DDD A;  3T9X B;  4LAT A;  4H0W A;  3TTL A;  1B6H A;  4C1U A;  3MUQ A;  5M2V A;  4NWC A;  3RLF E;  1Q35 A;  3LSF B;  3RN8 A;  3GZG A;  4G8H A;  2OCU A;  4GF8 A;  1NNK A;  1LCT A;  2QS4 A;  4R2F A;  4BLA A;  3FZV A;  1OVT A;  4GL8 A;  3U8Q A;  1MXW A;  1J1N A;  4KFQ A;  3Q26 A;  3MBP A;  3GBB A;  5ICT A;  1MM6 A;  5K2X A;  3T9U A;  3H6V A;  4POX A;  1VR5 A;  2VOZ A;  1QUK A;  2WKY A;  4WKM A;  3TTN A;  4ELQ A;  2ONR A;  2UVG A;  2XD2 A;  1PB7 A;  5DEX A;  3PUY E;  3HCQ A;  4IGT A;  3QYT A;  3UK4 A;  3IOT A;  2F35 A;  5CM6 A;  1RYO A;  1TT1 A;  3ILU B;  4RJZ A;  4LA9 A;  3K2D A;  2QSX A;  3B6W A;  3SKP A;  1B3G A;  1RYX A;  1B3H A;  1MY2 A;  5CMB A;  3SEW A;  1B3L A;  4QSE A;  5K2Y A;  4NF6 B;  2V93 A;  4BDR A;  2AIX A;  4F2O A;  5I57 A;  1LAX A;  5EHS A;  5B7D A;  2I48 A;  4ZED A;  3H6W A;  4PQJ A;  1PBP A;  1ZBM A;  1RKM A;  3JYR A;  1B5H A;  1LGB C;  4H6D A;  3IOV A;  1M5D A;  2REG A;  1OLC A;  4AB5 A;  1A99 A;  3U93 A;  4ELR A;  3TEL A;  4MLV A;  1WDN A;  1IQ7 A;  3PUX E;  5DVI A;  4BDO A;  4IO3 A;  5HM4 B;  1H3D A;  4IO5 A;  1B0L A;  1B40 A;  3MZ9 A;  3FJG A;  4C1T A;  1QUL A;  2ZYM A;  3DM0 A;  1B4Z A;  4H1X A;  1EZP A;  1TFA A;  2ONK E;  3OD7 A;  4ZE9 A;  4KI0 E;  5DVF A;  4DLD A;  2QPQ A;  4KR5 A;  1URD A;  1H43 A;  1UIV A;  4BDQ A;  5J1D A;  2Q89 A;  5DEX B;  4F1V A;  1IZ1 A;  1AH5 A;  1B52 A;  1URS A;  3EHU A;  4PFT A;  1XOC A;  4GL0 A;  4ESW A;  2XXR A;  3CG1 A;  4PP0 A;  1N7X A;  4RPN A;  3OMB A;  4H5F A;  2OJT A;  1CB6 A;  1TFD A;  1Y1M A;  1PDA A;  4F2Q A;  3PMV A;  2I4C A;  3TOD A;  3KSJ A;  4RA1 A;  1XT8 A;  4R9G A;  4OHN A;  1LAF E;  2DE3 A;  5I57 B;  2XXT A;  2RF1 A;  1NNF A;  1VSO A;  2XX8 A;  1LST A;  1PB8 A;  2DOJ A;  1WVJ A;  5ISU A;  1FQD A;  3QSL A;  3FV2 A;  3G3H A;  2Z23 A;  2I4B A;  1DOT A;  3Q28 A;  4FAJ A;  1USY H;  2R6G E;  4DIG A;  3THI A;  3K6X A;  3PPQ A;  1SI1 A;  3KN8 A;  3D4C A;  1B7U A;  1OQG A;  3FXR A;  4QHQ A;  4WXJ A;  1A54 A;  1QVS A;  1S50 A;  1B3E A;  3EHT A;  4U2R A;  4UA8 A;  2KLF A;  2IA4 A;  5HBC A;  2VP1 A;  2NUV A;  2V3T A;  5AA3 A;  3OXN A;  1QKA A;  3PPP A;  3CFZ A;  3RT6 B;  3MPK A;  4BDN A;  1LBB A;  1YPN A;  2Q2C A;  4NE4 A;  4NWD A;  2Z8F A;  3G3G A;  2QJE A;  2OWS A;  2ZMB A;  4X1B A;  2XXI A;  2X7P A;  2F6P A;  5KDT A;  3ZSF A;  3G3J A;  3G3F A;  3VXC A;  2F34 A;  4XKP A;  3VV5 A;  3LR1 A;  3RPW A;  5JK4 A;  4ELO A;  4MF3 A;  2V84 A;  3RTW B;  4GVO A;  2HAV A;  3PD9 A;  4F3G A;  3JZJ A;  3HV1 A;  3KG2 A;  1NFT A;  2NWJ A;  1NNT A;  4RNS A;  5AA2 A;  4KYS A;  4GLI A;  5A5X A;  1NL5 A;  3K01 A;  4ESX A;  1B2H A;  4XKQ A;  2P1S A;  3KZG A;  4OVJ A;  3IJO B;  4IY6 A;  3W15 C;  4IY5 A;  2Q88 A;  1XS5 A;  3PUW E;  3LUY A;  1VFD A;  5L9S A;  1N3W A;  2XXP A;  4EXK A;  2YPN A;  3IAZ A;  4MFI A;  5F1Q A;  4NF8 A;  5FTI A;  3B7D A;  3HHG A;  3IX1 A;  3IOR A;  3MZB A;  3A3C A;  4R6K A;  4MBP A;  2I3V A;  3S9M C;  1FQC A;  2NVU B;  2A5T A;  4KCC A;  4KQP A;  4ND9 A;  2F78 A;  3VVE A;  4H65 A;  1IIT A;  1FQE A;  1FTJ A;  4JWY A;  3CI8 A;  3C4M A;  1NH7 A;  4R6Y A;  1USY E;  3V83 A;  4F1Y A;  3PUZ E;  3QAX A;  4ZEI A;  1QKB A;  3SES A;  1SBP A;  1EZ9 A;  3KBR A;  3T22 A;  1ELJ A;  1JVY A;  4KYD A;  3Q25 A;  3OO9 A;  5H8F A;  4F3S A;  2P0S A;  3O9P A;  2H25 A;  2Y84 A;  1L5T A;  3VE1 B;  2Z8D A;  2VHA A;  5KDT B;  4EQB A;  4R72 A;  2Z8E A;  3H06 B;  3TTM A;  4DCY A;  1FTL A;  1F9B A;  3OO8 A;  1SYH A;  2I0B A;  2RIN A;  2DWJ A;  1II5 A;  1MXY A;  1MQG A;  3FAS A;  5AA2 B;  5I2N A;  1GTK A;  1LFG A;  5DT6 A;  5A5X B;  3FXQ A;  2ZYK A;  4K3F A;  1MQD A;  5FTH A;  4ZZA A;  1P1U A;  1DMB A;  3PUV E;  4OFO A;  5KZT A;  2ZNT A;  3P7I A;  3QUJ A;  3E9X A;  1MQJ A;  4HCW A;  1R1N A;  4RPO A;  3FJM A;  2HFB A;  2YJP A;  4XXU A;  2AYS A;  4NF8 B;  2DVC A;  1FTO A;  2OWT A;  4F19 A;  3VFJ A;  3RGY A;  3FIR A;  3TCF A;  4FAT A;  3MQ9 A;  2DXY A;  2A5T B;  1KWH A;  1SVX B;  4ISU A;  3IR1 A;  3A09 A;  1MXU A;  2F6G A;  3G7W A;  4P11 A;  2GFE A;  5EHM A;  3OEM A;  1ZKB A;  3T9V A;  3CSG A;  1OVB A;  3CVG A;  1Y3P A;  4NTL A;  3OEL A;  5CRY A;  1DPP A;  5FHO A;  3MWB A;  4AQ4 A;  3TAJ A;  3FJ7 A;  4H8I A;  2I49 A;  3O29 A;  4E0X A;  2DXR A;  1BP5 A;  1A7L A;  3K6U A;  5H8F B;  4O3C A;  3IL1 B;  1UTB A;  3CIJ A;  3MZ1 A;  3TCH A;  3KJT A;  1IUD A;  4ZEK A;  4R2B A;  2E0S A;  3RNN A;  4OFL A;  3VLW A;  2YLN A;  1D9Y A;  3HHF A;  3E3K A;  1O64 A;  3C9H A;  4OQO A;  4F3B A;  1AOV A;  3VDF A;  3TUS A;  4JDF A;  5ITP A;  1A55 A;  5H8Q A;  2QS3 A;  2UVI A;  5I2N B;  1D3K A;  1FQF A;  4P0I A;  2HCA A;  2HXW A;  1D9V A;  3U94 A;  2PVU A;  1R9L A;  4LZ5 A;  2Z22 A;  4EXL A;  3M8U A;  1MY1 A;  4Q8R A;  2DQV A;  3VVF A;  2UVJ A;  4I8C A;  1YTV A;  2DWA A;  4R73 A;  3AXF A;  3UIF A;  3EN3 A;  4F22 A;  2W7Y A;  3H6T A;  3RT8 A;  4R74 A;  3ZS6 A;  5I59 A;  4GRK A;  5CC2 A;  1IXG A;  4JB7 A;  2O7U A;  2FA7 A;  1MXX A;  5L9O A;  3VVD A;  5CI5 A;  3I5O A;  3QIM A;  2CMO A;  4NED A;  4THI A;  2Y7R A;  4LZ8 A;  3K6W A;  2Q2A A;  4WED A;  4PET A;  3O66 A;  1MXZ A;  1IXH A;  2D3I A;  2E1S A;  2ABH A;  1B1H A;  4IO2 A;  2DYX A;  2H5Y A;  4YZZ A;  1OIB A;  3DLN A;  4IB2 A;  4WEP A;  3PD8 A;  1POY 1;  1IIW A;  2DE2 A;  2F7A A;  4GWO A;  1N04 A;  5DTB A;  4YB7 A;  1ZU0 A;  3TQL A;  4U23 A;  1UTB B;  3L6G A;  2I58 A;  4KHZ E;  3FVN A;  1MS7 A;  2ZNS A;  1ZLQ A;  3K1M A;  4U1Z A;  4LUB A;  5FHN A;  3T96 B;  3H6U A;  3Q29 A;  4G2Z A;  3MVZ A;  3FUZ A;  2XXU A;  1ZMG A;  1A40 A;  4Q30 B;  5JEI A;  4HW8 A;  4XIG Q;  3K1P A;  1MPD A;  4YB6 A;  5H8Q B;  3DP4 A;  1N3X A;  3FAT A;  1AIV A;  4H5G A;  1N84 A;  3O97 A;  3UOR A;  3MAM A;  3QK6 A;  3MJN A;  3OSR A;  4U4X A;  1VE4 A;  4OER A;  3HN0 A;  4PFU A;  3FV1 A;  2VD3 A;  3HO7 A;  1MY0 A;  1FTK A;  1DSN A;  3MP1 A;  5H8H A;  5AA1 A;  4O3B A;  1IXI A;  1O63 A;  3H3G A;  1XVX A;  5L9M A;  1UQW A;  4F29 A;  2UYF A;  3N26 A;  3H03 A;  5AE4 A;  5CBS A;  4RY1 A;  3TYH A;  1ANF A;  1POT A;  3OEN A;  4R6H A;  3R6U A;  5I59 B;  4GXA A;  3KSX A;  5TPA A;  1SD3 A;  3V89 B;  2F97 A;  4OEU A;  2DSF A;  2DWI A;  1AMF A;  2DVZ A;  3KEI A;  4XKN A;  4I1D A;  4DXC A;  4Z7E A;  4NF5 A;  2O84 X;  1US5 A;  2HQ0 A;  4ZEF A;  1B1X A;  1N7W A;  2I3W A;  3VLU A;  4Q5T A;  1AL3 A;  1Z7N E;  2CZL A;  4U4S A;  4JBZ A;  3SEV A;  3VLV A;  4DE8 A;  3CSB A;  2Y7P A;  4R75 A;  1P1W A;  4KD5 A;  1LBC A;  1JW5 A;  4UAC A;  4U22 A;  2OK2 A;  1MY4 A;  5TP9 A;  2O69 A;  3TCG A;  3M3K A;  4TLM B;  2RC7 A;  1JW4 A;  3K1N A;  2O1M A;  4FJP A;  4QFK A;  5IKB A;  3KJ7 A;  1A8E A;  2O51 A;  3N6U A;  2H99 A;  4DXB A;  2Y7W A;  4YKK A;  1MM7 A;  1MY3 A;  2F36 A;  4Q0C A;  4YKJ A;  5H8S A;  3CFL A;  4X48 A;  3N5L A;  2HZL A;  3BBR A;  1ZJL A;  4F18 A;  5I84 A;  4ZEB A;  1DTG A;  4N07 A;  3O2A A;  1GVC A;  1I6A A;  3C35 A;  5H8H B;  3DEL B;  1B0H A;  3HST A;  1PEB A;  4ECF A;  3PMX A;  3SER A;  4ELP A;  4JSD A;  1FQB A;  4PFY A;  4LON B;  2D21 A;  1ZIU A; 
#chains in the Genus database with same CATH topology
 4OES A;  4G8N A;  2P3N A;  1MQI A;  1R6Z A;  3H7M A;  2P2A A;  5IM2 A;  2B3B A;  3PPO A;  1XVY A;  5TPA B;  1EZO A;  2CZH A;  3IK6 B;  3F11 A;  2V25 A;  4PBQ A;  5IZ3 A;  1Y1Z A;  3USD A;  1LAH E;  3O6I A;  1CE2 A;  3TQW A;  2ALU A;  4TLL B;  4XTC Q;  2M8C A;  4X8R A;  4ONY A;  4NF5 B;  1M5E A;  3S9E A;  1BIY A;  4BDM A;  2QS1 A;  4QFO A;  5EQ9 A;  3IO6 A;  3O6G A;  1GGG A;  5EYF A;  3S4U A;  2O1L A;  2X26 A;  4G68 A;  2JJK A;  4PDH A;  5EYG A;  2R71 A;  4PE5 B;  5I58 A;  4OET A;  4HTG A;  4EQ7 A;  1JW1 A;  3K6V A;  1YXI A;  1MDQ A;  3OO7 A;  3IB1 A;  5I5P A;  2O6A A;  3CG3 A;  3W9W A;  2AL5 A;  1JEU A;  1B5I A;  2F3D A;  3MP8 A;  4GQO A;  5ELV A;  3PPR A;  4H46 A;  5FBP A;  2ESN A;  4P9K A;  4YAH X;  3E4R A;  2G93 A;  3MST A;  2PYY A;  4YMA A;  4OMB A;  4OFJ A;  4AB6 A;  2ZZX A;  5TP9 B;  1BTJ A;  1I6B A;  1OQH A;  4HS7 A;  2FNC A;  3R26 A;  3U92 A;  3TEP A;  2BJJ X;  3PU5 A;  2Q9T A;  4NF4 A;  3LBS A;  4DI3 D;  1IEJ A;  2I6E A;  4N8G A;  3CHG A;  4PFI A;  1PBQ A;  5AA2 D;  3WAE A;  3I3V A;  1B51 A;  4I40 A;  4QBA A;  4OXV A;  4JSO A;  1N76 A;  4PFW A;  3FGS A;  4H67 A;  1D4N A;  1SW5 A;  4F39 A;  1MH3 A;  3RTF B;  4O7M A;  1PB9 A;  3WAF A;  4ZS9 A;  4IGR A;  5F7V A;  2RCB A;  3EKI A;  1P99 A;  4PAI A;  1FQA A;  2GHA A;  3I6V A;  1JET A;  2PT1 A;  2PX1 A;  3G3K A;  5KCJ A;  4I3Y A;  4HCY A;  4OVP A;  4JWX A;  1MRP A;  1RDX A;  2ZXT A;  3MP6 A;  3VXB A;  1B32 A;  3EHS A;  5IAI A;  1M5B A;  1IXC A;  1S9T A;  4DI4 B;  4H45 A;  3LC8 A;  4FEC A;  5BWJ A;  3GBA A;  3FVO A;  1EH3 A;  4TQU Q;  3MW0 A;  2B3F A;  1LBW A;  4QSC A;  2UXA A;  1LB9 A;  4NG7 A;  4MLQ A;  1N0T A;  1NI9 A;  3A29 A;  3C36 A;  5IZ3 B;  1SPI A;  4OYV A;  2WBB A;  4OEN A;  4OTE A;  4QFN A;  1NV4 A;  2PFZ A;  2XXW A;  3SZP A;  3A3U A;  3TZA A;  3S9N C;  3V8X B;  3K4U A;  4X1D A;  2PMS A;  3SEU A;  3V5A A;  3PGF A;  3ODB A;  1UIU A;  5L8D A;  4G68 B;  2FIE A;  5I58 B;  3RPL A;  3E79 A;  1B7H A;  2H4I A;  2O68 A;  2H98 A;  1SW4 A;  1PC3 A;  4OVR A;  4M4G A;  2LAO A;  4Z0I A;  3W9V A;  2AL4 A;  4AS4 A;  2CEX A;  3TTK A;  5H8N A;  2ZYN A;  2F5X A;  2VD2 A;  2QFL A;  3OO6 A;  1YZ0 A;  2ANJ A;  4RK9 A;  2G29 A;  1FJ6 A;  2ZYO A;  4FE8 A;  4EF2 A;  1T0K A;  3T9H B;  1FTM A;  3E13 X;  3K00 A;  2FYI A;  3MC2 A;  3N94 A;  4NF4 B;  1OMP A;  3FVG A;  4O3A A;  3UN6 A;  4NN3 A;  1H76 A;  4X9T A;  3R7X A;  4GIZ A;  4MIJ A;  2DWH A;  4XFE A;  1B05 A;  4IO6 A;  4OVT A;  1A8F A;  2QVV A;  1JNF A;  1H44 A;  4FED A;  5HPQ A;  1Y20 A;  1SW1 A;  1DTZ A;  1LFI A;  4GWZ A;  1SI0 A;  2ZZW A;  4QRZ A;  1NNP A;  2QS2 A;  4C0R A;  1FBP A;  4YKI A;  4EUO A;  1FW0 A;  1XC1 A;  2OX3 A;  3Q27 A;  1FPD A;  3U72 A;  1H45 A;  1US4 A;  2REJ A;  2RC9 A;  2XXH A;  4MAG A;  3TPA A;  2Q8J A;  2XWK A;  1URG A;  3TDJ A;  4N13 A;  3EQ1 A;  5CBR A;  5KCJ B;  3M3L A;  2GRV A;  2B65 A;  1I69 A;  4YKP A;  1P1O A;  3ZKK A;  3KN7 A;  1EU8 A;  1S7Y A;  3SEY A;  3OEK A;  4DCX A;  4RYA A;  3U1O A;  1MDP 1;  3N6T A;  1NUZ A;  3JV9 A;  3IB0 A;  3KGC A;  4GWY A;  3LSX A;  1FBH A;  1Y3Q A;  2O7I A;  3UGW A;  3BFU A;  4MH5 A;  5AA4 A;  4XKR A;  3M3F A;  4QSD A;  1TWY A;  4N17 A;  3RUM A;  4I9D A;  4MHF A;  3PV0 E;  1QUI A;  3IO4 A;  3IJX B;  2Y7K A;  2XXV A;  2QVR A;  2HEU A;  3GXA A;  4LQ5 A;  3DP8 A;  4M1V A;  4KPT A;  4EDP A;  5J16 A;  3MVY A;  2IEE A;  3FBP A;  3GLB A;  3B6T A;  4N6K A;  1P1N A;  1B7Z A;  2NXO A;  3MYU A;  1MQH A;  1Y4T A;  1GR2 A;  1B4H A;  3G3I A;  3SDF A;  3RPL B;  5CMM A;  1QUJ A;  4PAF A;  4QFL A;  5I56 A;  4N6P A;  3IB2 A;  3TKD A;  1Y4C A;  1NV5 A;  2VGQ A;  2DP8 A;  5H8N B;  2PT2 A;  1YCJ A;  1JEV A;  3BFT A;  4FOR A;  2F7C A;  2QRY A;  1EYK A;  3TMG A;  1JQF A;  4HE1 A;  5ICQ A;  4N6D A;  1LFH A;  1MPB A;  4OEV A;  1FPF A;  4EF1 A;  3T93 B;  3DP6 A;  4EQ9 A;  1WOD A;  1SYI A;  2D5W A;  3OOA A;  4G8M A;  3K0V A;  4G77 A;  1P1Q A;  3D4G A;  4RXL A;  3ONM A;  1LLS A;  4TOZ A;  5TU0 A;  4KYE A;  5B70 A;  1DPE A;  1M5C A;  2OZZ A;  2NOO A;  5EQ8 A;  1NV6 A;  3UA8 A;  1HSL A;  2RKM A;  3ILT B;  2QMX A;  5T3J A;  1TXF A;  4ZDM A;  1IMD A;  3QUF A;  2OBG A;  4YB5 A;  2V3U A;  1VFE A;  2THI A;  2XHD A;  5CMC A;  1FPL A;  5I2K A;  2MKZ A;  1LB8 A;  3ECR A;  3FVK A;  3C31 A;  5DVJ A;  3SET A;  4YMB A;  1Z7M E;  1G0H A;  5JTY A;  1UTH A;  1XHY A;  1O7T A;  2XWI A;  5ET5 A;  5AA4 B;  2BJI A;  1MG1 A;  1LAG E;  3UP9 A;  3OSQ A;  1EYI A;  2P3V A;  1LEV A;  4IO4 A;  3TTR A;  4F3P A;  4U21 A;  2XXY A;  2XX7 A;  4I62 A;  1B46 A;  2GH9 A;  1R9Q A;  5F24 A;  4ZE8 A;  4GFR A;  2XXQ A;  3KN3 A;  2UVH A;  1ZTY A;  3RQT A;  1FCK A;  5ITO A;  3PPN A;  3T66 A;  2RC8 A;  3LSW A;  3O6H A;  4NGU A;  2Y7I A;  4ZEC A;  4GXS B;  4L17 A;  2DS9 A;  3C34 A;  4BDL A;  4P0G A;  3CRB A;  4KXP A;  1DCU A;  5I56 B;  1HSJ A;  4PGN A;  4U1O A;  4FEB A;  2B4M A;  2HAU A;  4G68 C;  1JVX A;  2X7Q A;  1FSA A;  3O28 A;  3B6Q A;  2FIX A;  1B3F A;  5LOM A;  2V3Q A;  1MXV A;  2XX9 A;  3C33 A;  3FD3 A;  3IOU A;  1GV8 A;  4G4P A;  2QMW A;  4RK2 A;  3KFM A;  1MPC A;  1NH8 A;  1FRP A;  1SDX A;  4JXI A;  4LP2 B;  4R9F A;  1QW0 A;  2QL3 A;  4DZ1 A;  3CR9 A;  4YIC A;  1MH4 A;  4KCD A;  1I6Q A;  4DXU A;  4GD5 A;  4JVD A;  4ZZE A;  3SEX A;  1BKA A;  4IO7 A;  3C32 A;  2XA5 A;  4LQ2 A;  3EF7 A;  1IMB A;  3CFX A;  3LSL A;  1B5J A;  3KOT A;  4PAK A;  2HZK A;  4N91 A;  4LVQ A;  2GHB A;  5FHM A;  2F7B A;  1HSE A;  3BKI B;  4QF9 A;  2XXX A;  3D1R A;  1LBV A;  2A5S A;  3PMW A;  2RCA A;  2OLB A;  1FTA A;  3TFL A;  5IZ1 A;  3QXM A;  1M5F A;  5CMK A;  4POW A;  3IFA A;  2Y5K A;  4OWD A;  3S2V A;  4YU0 A;  3K02 A;  5DYH A;  1NMU A;  5I2K B;  3MPL A;  1BK4 A;  3HPI A;  1BLF A;  4QFP A;  2DE4 A;  4JWO A;  2ZNU A;  2H9B A;  2KR0 A;  3MVX A;  4F31 B;  4GWU A;  5JTY B;  1UTH B;  1YAE A;  5BUU A;  4GOT A;  1Y9U A;  1SQY A;  2R9J A;  1QJM A;  3MVW A;  2PBW A;  1EYJ A;  2XD3 A;  4E0W A;  1SW2 A;  4FIM A;  2ZZV A;  1NKX A;  4LZ7 A;  4H8J A;  3KOS A;  3H4Z A;  1ATG A;  3EPE A;  1Q1K A;  4OZ9 A;  4NF6 A;  4XEQ A;  1OLA A;  3S9L C;  2F8D A;  3ZKL A;  3IOW A;  1B9J A;  3FXU A;  3RY3 A;  4F1U A;  4O8M A;  4NMY A;  2ONS A;  2UYE A;  1B58 A;  1LCF A;  1NUX A;  2I0C A;  1Y3N A;  3L6H A;  1FPI A;  3T9X B;  4DDD A;  4LAT A;  4H0W A;  3TTL A;  1B6H A;  4C1U A;  2VPN A;  1QGX A;  3MUQ A;  5M2V A;  5DW8 A;  4NWC A;  4AS5 A;  3RLF E;  1Q35 A;  3LSF B;  5IZZ A;  3RN8 A;  3GZG A;  4G8H A;  2OCU A;  4GF8 A;  1NNK A;  1LCT A;  2QS4 A;  4R2F A;  4BLA A;  3KC1 A;  3FZV A;  2FHY A;  2L5V A;  1OVT A;  4GL8 A;  3U8Q A;  1MXW A;  1J1N A;  4KFQ A;  3Q26 A;  3LV0 A;  3MBP A;  3GBB A;  5ICT A;  1MM6 A;  5K2X A;  3T9U A;  3H6V A;  4POX A;  4UAB A;  1VR5 A;  2VOZ A;  1QUK A;  2WKY A;  4WKM A;  3TTN A;  4ELQ A;  2ONR A;  2UVG A;  2XD2 A;  1PB7 A;  4HE0 A;  5DEX A;  3PUY E;  3HCQ A;  4IGT A;  3QYT A;  3UK4 A;  3IOT A;  2F35 A;  5CM6 A;  5ET7 A;  1RYO A;  1TT1 A;  3ILU B;  4RJZ A;  4LA9 A;  3K2D A;  4GX3 A;  2QSX A;  4MEV A;  3B6W A;  3SKP A;  2CZK A;  2R8T A;  3B50 A;  1B3G A;  1RYX A;  3KBZ A;  1B3H A;  1MY2 A;  5CMB A;  4MNI A;  2WYP A;  3SEW A;  1VDW A;  1B3L A;  1KZ8 A;  4QSE A;  5K2Y A;  4NF6 B;  2V93 A;  4BDR A;  2AIX A;  4F2O A;  5I57 A;  1LAX A;  5EHS A;  5B7D A;  2I48 A;  4ZED A;  3H6W A;  2GQ1 A;  4PQJ A;  1PBP A;  1ZBM A;  1RKM A;  3JYR A;  1B5H A;  2Q74 A;  1LGB C;  4H6D A;  3IOV A;  1M5D A;  2REG A;  1OLC A;  4AB5 A;  1A99 A;  3U93 A;  4ELR A;  3TEL A;  4MLV A;  1WDN A;  1IQ7 A;  3PUX E;  5DVI A;  4BDO A;  4IO3 A;  4HE2 A;  1NV1 A;  5HM4 B;  1H3D A;  4IO5 A;  1B0L A;  1B40 A;  3MZ9 A;  4HXV A;  3FJG A;  4C1T A;  3U65 A;  1QUL A;  2ZYM A;  3DM0 A;  1B4Z A;  4H1X A;  1EZP A;  1RDZ A;  1TFA A;  4N81 A;  2ONK E;  3OD7 A;  1KA1 A;  4PC9 A;  4ZE9 A;  4KI0 E;  5DVF A;  4DLD A;  2QPQ A;  4KR5 A;  1URD A;  1H43 A;  1UIV A;  4BDQ A;  5J1D A;  2Q89 A;  5DEX B;  4PE3 A;  2HHM A;  4F1V A;  1NV3 A;  1IZ1 A;  1AH5 A;  1B52 A;  1URS A;  3EHU A;  4PFT A;  4FBP A;  1FBF A;  1XOC A;  4GL0 A;  4ESW A;  2XXR A;  3CG1 A;  4GWW A;  4PP0 A;  1N7X A;  4RPN A;  3OMB A;  4H5F A;  2OJT A;  4PGP A;  1CB6 A;  1TFD A;  1Y1M A;  1PDA A;  4F2Q A;  3PMV A;  2I4C A;  3TOD A;  3KSJ A;  4RA1 A;  1XT8 A;  4R9G A;  2FBP A;  4OHN A;  1LAF E;  2DE3 A;  2FVZ A;  5I57 B;  2XXT A;  2RF1 A;  1NNF A;  1VSO A;  2XX8 A;  2CEY A;  1LST A;  1PB8 A;  2DOJ A;  1WVJ A;  5ISU A;  4GX4 A;  3T0J A;  1K9Z A;  3FXB A;  1FQD A;  3QSL A;  4PCD A;  4GWX A;  3FV2 A;  2DDK A;  3G3H A;  2Z23 A;  3GYY A;  2I4B A;  1DOT A;  1FPB A;  3Q28 A;  4FAJ A;  1USY H;  2R6G E;  2XWO A;  4DIG A;  3THI A;  3K6X A;  3PPQ A;  1SI1 A;  3KN8 A;  3RYD A;  3D4C A;  1B7U A;  1OQG A;  3FXR A;  4QHQ A;  5ET8 A;  4WXJ A;  1A54 A;  1QVS A;  5A5L A;  1S50 A;  1B3E A;  3EHT A;  4U2R A;  4UA8 A;  2KLF A;  2IA4 A;  5HBC A;  2VP1 A;  2NUV A;  2V3T A;  5AA3 A;  3OXN A;  1QKA A;  4N15 A;  3PPP A;  3CFZ A;  2Y5L A;  3RT6 B;  3MPK A;  4BDN A;  4PBH A;  1LBB A;  4NQ8 A;  1YPN A;  2Q2C A;  4NE4 A;  4NWD A;  4LN5 A;  2Z8F A;  3G3G A;  2QJE A;  2OWS A;  2ZMB A;  4X1B A;  2XXI A;  2X7P A;  4QXD A;  3QMF A;  2F6P A;  5KDT A;  1Q9D A;  1FJ9 A;  3ZSF A;  3G3J A;  4PFB A;  3G3F A;  4GBV A;  3VXC A;  2F34 A;  4XKP A;  3VV5 A;  3LR1 A;  3RPW A;  4MNP A;  5JK4 A;  4MJO A;  4ELO A;  4MF3 A;  2V84 A;  3RTW B;  4GVO A;  2HAV A;  3PD9 A;  4F3G A;  3JZJ A;  3HV1 A;  3KG2 A;  1NFT A;  2NWJ A;  1NNT A;  4RNS A;  5AA2 A;  4KYS A;  4GLI A;  3LUZ A;  5A5X A;  1NL5 A;  3K01 A;  4ESX A;  1B2H A;  4XKQ A;  2P1S A;  3KZG A;  4OVJ A;  4P1L A;  3IJO B;  1RDY A;  4IY6 A;  3W15 C;  4IY5 A;  2Q88 A;  1XS5 A;  3PUW E;  2HXR A;  3LUY A;  1VFD A;  5L9S A;  1N3W A;  2XXP A;  4EXK A;  2YPN A;  3IAZ A;  4MFI A;  1KA0 A;  5F1Q A;  4NF8 A;  5FTI A;  3B7D A;  4O94 A;  3HHG A;  2WX9 A;  3IX1 A;  4NF0 A;  3IOR A;  3MZB A;  3A3C A;  4R6K A;  4MBP A;  2I3V A;  3S9M C;  1FQC A;  5LTC A;  2NVU B;  2A5T A;  4KCC A;  1FPG A;  4KQP A;  1D9Q A;  4ND9 A;  2F78 A;  3VVE A;  4H65 A;  1IIT A;  1FQE A;  1FTJ A;  4JWY A;  1FPJ A;  3CI8 A;  4GWS A;  3C4M A;  1LBX A;  1NH7 A;  4R6Y A;  1USY E;  3V83 A;  4F1Y A;  4PDD A;  3PUZ E;  3QAX A;  4ZEI A;  1IMC A;  1QKB A;  3SES A;  2PFY A;  1SBP A;  1EZ9 A;  3KBR A;  3T22 A;  1ELJ A;  1JVY A;  4KYD A;  3Q25 A;  4O7I A;  3OO9 A;  1FPK A;  5H8F A;  2F3B A;  4F3S A;  2P0S A;  4MNC A;  3O9P A;  2H25 A;  2Y84 A;  1L5T A;  3VE1 B;  2Z8D A;  2VHA A;  5KDT B;  4EQB A;  4R72 A;  2Z8E A;  3H06 B;  3TTM A;  4DCY A;  4P8B A;  1FTL A;  1F9B A;  3OO8 A;  4P47 A;  1SYH A;  2I0B A;  2RIN A;  4GX6 A;  2DWJ A;  1II5 A;  4PTK A;  1MXY A;  1MQG A;  3FAS A;  5AA2 B;  5I2N A;  1GTK A;  5EQA A;  1LFG A;  1NV7 A;  5DT6 A;  2WYK A;  5A5X B;  3FXQ A;  2ZYK A;  4K3F A;  2QVU A;  1IMF A;  5LDZ A;  2WBD A;  1MQD A;  2VPO A;  5FTH A;  1K9Y A;  5ET6 A;  4ZZA A;  1P1U A;  1DMB A;  3PUV E;  4OFO A;  5KZT A;  2ZNT A;  3P7I A;  3QUJ A;  3E9X A;  1MQJ A;  4HCW A;  1R1N A;  4RPO A;  3FJM A;  2HFB A;  2YJP A;  4XXU A;  2AYS A;  4NF8 B;  2DVC A;  1FTO A;  2OWT A;  4F19 A;  3VFJ A;  3RGY A;  4JVC A;  3FIR A;  3TCF A;  1YYZ A;  3B8B A;  4FAT A;  3MQ9 A;  2DXY A;  2A5T B;  2WEF A;  1KWH A;  1SVX B;  4MMP A;  4ISU A;  3IR1 A;  3A09 A;  1MXU A;  2F6G A;  3G7W A;  4P11 A;  2GFE A;  5EHM A;  3OEM A;  1ZKB A;  4NHB A;  3T9V A;  3CSG A;  1OVB A;  3CVG A;  1Y3P A;  4X04 A;  4N8Y A;  4NTL A;  3OEL A;  5CRY A;  1DPP A;  5FHO A;  2PCR A;  3MWB A;  4OAN A;  4AQ4 A;  3TAJ A;  3FJ7 A;  4H8I A;  2I49 A;  3O29 A;  1INP A;  1FBE A;  4PFR A;  4E0X A;  2DXR A;  1BP5 A;  1A7L A;  3K6U A;  5H8F B;  4O3C A;  3IL1 B;  1UTB A;  3CIJ A;  3MZ1 A;  3ROJ A;  3TCH A;  1FBG A;  3KJT A;  4I3E A;  1IUD A;  5EYH A;  4ZEK A;  2XWV A;  4R2B A;  2E0S A;  3RNN A;  4OFL A;  3VLW A;  2YLN A;  1D9Y A;  3HHF A;  3E3K A;  1O64 A;  3C9H A;  4OQO A;  4F3B A;  1NV0 A;  1AOV A;  3VDF A;  3TUS A;  4JDF A;  5ITP A;  1A55 A;  3BIG A;  5H8Q A;  2QS3 A;  2UVI A;  5I2N B;  1D3K A;  2KQZ A;  1LBY A;  1FQF A;  4P0I A;  2HCA A;  2HXW A;  1D9V A;  4PF8 A;  3U94 A;  2PVU A;  1R9L A;  4LZ5 A;  2Z22 A;  4EXL A;  3M8U A;  1MY1 A;  4Q8R A;  2DQV A;  3VVF A;  2UVJ A;  5IGA A;  4I8C A;  1YTV A;  2DWA A;  2B4L A;  4R73 A;  5I7I A;  3AXF A;  3UIF A;  3EN3 A;  4F22 A;  2W7Y A;  3H6T A;  3RT8 A;  4PF6 A;  4R74 A;  3ZS6 A;  5I59 A;  4GRK A;  4P56 A;  5CC2 A;  1IXG A;  4JB7 A;  2O7U A;  2FA7 A;  1MXX A;  3T1B A;  4OVS A;  1FBD A;  1G0I A;  5L9O A;  3VVD A;  5CI5 A;  3I5O A;  3QIM A;  2CMO A;  4NED A;  4THI A;  2Y7R A;  4LZ8 A;  4P1E A;  3K6W A;  2Q2A A;  4WED A;  4PET A;  4JVI A;  3O66 A;  1MXZ A;  1IXH A;  2D3I A;  1JP4 A;  3KC0 A;  2E1S A;  5EQ7 A;  2ABH A;  1B1H A;  4IO2 A;  2DYX A;  2OWZ A;  2H5Y A;  4YZZ A;  1OIB A;  3DLN A;  4IB2 A;  4WEP A;  3PD8 A;  1POY 1;  1IIW A;  2DE2 A;  1XI6 A;  2CZI A;  2F7A A;  4GWO A;  1N04 A;  5DTB A;  4YB7 A;  1ZU0 A;  1IMA A;  3TQL A;  4U23 A;  1UTB B;  3L6G A;  4NAP A;  3NOH A;  2I58 A;  4NX1 A;  4KHZ E;  3FVN A;  1MS7 A;  2ZNS A;  1ZLQ A;  3K1M A;  4U1Z A;  2XXK A;  4LUB A;  3PTY A;  1DK4 A;  5FHN A;  3T96 B;  3H6U A;  3Q29 A;  4G2Z A;  4XF5 A;  3MVZ A;  3FUZ A;  2XXU A;  1ZMG A;  1A40 A;  4Q30 B;  5JEI A;  4HW8 A;  4XIG Q;  3K1P A;  1MPD A;  4YB6 A;  5H8Q B;  3DP4 A;  1N3X A;  3FAT A;  1AIV A;  4H5G A;  1N84 A;  3O97 A;  3UOR A;  3MAM A;  1IME A;  3QK6 A;  3MJN A;  3OSR A;  4U4X A;  1VE4 A;  4OER A;  3HN0 A;  4PFU A;  3BIH A;  3FV1 A;  2VD3 A;  3HO7 A;  1MY0 A;  1FTK A;  1DSN A;  3MP1 A;  5H8H A;  5AA1 A;  4O3B A;  1IXI A;  1O63 A;  3H3G A;  1XVX A;  5L9M A;  1UQW A;  3HFU A;  4F29 A;  2UYF A;  3ISP A;  3N26 A;  3H03 A;  2V4C A;  5AE4 A;  5CBS A;  4RY1 A;  2HPG A;  5ESY A;  1FPE A;  3TYH A;  1ANF A;  1POT A;  3OEN A;  2Q8M A;  4R6H A;  3R6U A;  5I59 B;  4GXA A;  3KSX A;  5TPA A;  1SD3 A;  4P3L A;  3V89 B;  2F97 A;  1DBZ A;  4OEU A;  2DSF A;  2DWI A;  2VT5 A;  1AMF A;  2DVZ A;  3KEI A;  4XKN A;  4I1D A;  4DXC A;  4Z7E A;  4MX6 A;  1NUY A;  4NF5 A;  2O84 X;  1US5 A;  1NV2 A;  2HQ0 A;  4ZEF A;  1B1X A;  1N7W A;  2I3W A;  3VLU A;  3IFC A;  4Q5T A;  1AL3 A;  4MCO A;  1Z7N E;  2CZL A;  4U4S A;  4JBZ A;  3SEV A;  3VLV A;  4DE8 A;  3CSB A;  2Y7P A;  4R75 A;  4OVQ A;  1P1W A;  4KD5 A;  1LBC A;  1JW5 A;  4UAC A;  4GBW A;  4U22 A;  2OK2 A;  1MY4 A;  5TP9 A;  2O69 A;  3TCG A;  3M3K A;  4TLM B;  2RC7 A;  1JW4 A;  3K1N A;  1CNQ A;  2O1M A;  4FJP A;  4QFK A;  5IKB A;  4OA4 A;  3KJ7 A;  1A8E A;  4N4U A;  2O51 A;  3N6U A;  2H99 A;  4DXB A;  2Y7W A;  4YKK A;  1MM7 A;  1MY3 A;  2F36 A;  4Q0C A;  4YKJ A;  5H8S A;  3CFL A;  4X48 A;  3N5L A;  4G61 A;  5I3S A;  1AWB A;  2HZL A;  3BBR A;  1ZJL A;  4F18 A;  5I84 A;  4ZEB A;  1DTG A;  4N07 A;  3O2A A;  1GVC A;  1I6A A;  4IR8 A;  3E78 A;  1LBZ A;  3C35 A;  5H8H B;  3DEL B;  1B0H A;  3HST A;  1FBC A;  1PEB A;  4ECF A;  3PMX A;  3SER A;  4ELP A;  1NUW A;  4JSD A;  1FQB A;  4PFY A;  4LON B;  2D21 A;  1ZIU A; 
#chains in the Genus database with same CATH homology
 4OES A;  4G8N A;  1MQI A;  1R6Z A;  3H7M A;  2P2A A;  2B3B A;  3PPO A;  1XVY A;  5TPA B;  1EZO A;  3IK6 B;  3F11 A;  2V25 A;  1Y1Z A;  3USD A;  1LAH E;  3O6I A;  1CE2 A;  3TQW A;  2ALU A;  4TLL B;  4XTC Q;  2M8C A;  4ONY A;  4NF5 B;  1M5E A;  3S9E A;  1BIY A;  4BDM A;  2QS1 A;  4QFO A;  5EYF A;  3IO6 A;  3O6G A;  1GGG A;  3S4U A;  2O1L A;  2X26 A;  4G68 A;  2R71 A;  4PE5 B;  5I58 A;  4OET A;  4HTG A;  4EQ7 A;  1JW1 A;  3K6V A;  1MDQ A;  3OO7 A;  3IB1 A;  2O6A A;  3CG3 A;  3W9W A;  2AL5 A;  1JEU A;  1B5I A;  3MP8 A;  4GQO A;  5ELV A;  3PPR A;  2ESN A;  4YAH X;  3E4R A;  2G93 A;  2PYY A;  4YMA A;  4OMB A;  4OFJ A;  4AB6 A;  5TP9 B;  1BTJ A;  1I6B A;  1OQH A;  4HS7 A;  2FNC A;  3R26 A;  3U92 A;  3TEP A;  2BJJ X;  3PU5 A;  2Q9T A;  4NF4 A;  3LBS A;  1IEJ A;  2I6E A;  1PBQ A;  5AA2 D;  3WAE A;  3I3V A;  1B51 A;  4OXV A;  4JSO A;  1N76 A;  4PFW A;  3FGS A;  4H67 A;  1D4N A;  1SW5 A;  4F39 A;  1MH3 A;  3RTF B;  1PB9 A;  3WAF A;  4ZS9 A;  4IGR A;  5F7V A;  2RCB A;  1P99 A;  1FQA A;  2GHA A;  3I6V A;  1JET A;  2PT1 A;  2PX1 A;  3G3K A;  5KCJ A;  4HCY A;  4JWX A;  1MRP A;  2ZXT A;  3MP6 A;  3VXB A;  1B32 A;  3EHS A;  5IAI A;  1M5B A;  1IXC A;  1S9T A;  3LC8 A;  4FEC A;  5BWJ A;  3GBA A;  3FVO A;  1EH3 A;  4TQU Q;  3MW0 A;  2B3F A;  4QSC A;  2UXA A;  1LB9 A;  4MLQ A;  1N0T A;  3C36 A;  4OYV A;  4OEN A;  4OTE A;  4QFN A;  2XXW A;  3A3U A;  3TZA A;  3S9N C;  3V8X B;  3K4U A;  4X1D A;  2PMS A;  3SEU A;  3V5A A;  3PGF A;  3ODB A;  1UIU A;  5L8D A;  4G68 B;  5I58 B;  1B7H A;  2H4I A;  2O68 A;  2H98 A;  1SW4 A;  1PC3 A;  4M4G A;  2LAO A;  4Z0I A;  3W9V A;  2AL4 A;  3TTK A;  5H8N A;  2ZYN A;  2F5X A;  2VD2 A;  3OO6 A;  2ANJ A;  4RK9 A;  2G29 A;  2ZYO A;  4FE8 A;  4EF2 A;  1T0K A;  3T9H B;  1FTM A;  3E13 X;  3K00 A;  2FYI A;  3MC2 A;  3N94 A;  4NF4 B;  1OMP A;  3FVG A;  4O3A A;  3UN6 A;  1H76 A;  4X9T A;  3R7X A;  4GIZ A;  2DWH A;  1B05 A;  4IO6 A;  1A8F A;  1JNF A;  1H44 A;  4FED A;  5HPQ A;  1Y20 A;  1SW1 A;  1DTZ A;  1LFI A;  1SI0 A;  4QRZ A;  1NNP A;  2QS2 A;  4C0R A;  4YKI A;  4EUO A;  1FW0 A;  1XC1 A;  3Q27 A;  3U72 A;  1H45 A;  1US4 A;  2REJ A;  2RC9 A;  2XXH A;  3TPA A;  2Q8J A;  1URG A;  3TDJ A;  4N13 A;  3EQ1 A;  5CBR A;  5KCJ B;  3M3L A;  2GRV A;  2B65 A;  1I69 A;  4YKP A;  1P1O A;  3ZKK A;  3KN7 A;  1EU8 A;  1S7Y A;  3SEY A;  3OEK A;  4DCX A;  4RYA A;  3U1O A;  1MDP 1;  3N6T A;  3JV9 A;  3IB0 A;  3KGC A;  3LSX A;  1Y3Q A;  2O7I A;  3UGW A;  3BFU A;  4MH5 A;  5AA4 A;  4XKR A;  3M3F A;  4QSD A;  1TWY A;  3RUM A;  4I9D A;  3PV0 E;  1QUI A;  3IO4 A;  3IJX B;  2Y7K A;  2XXV A;  2HEU A;  3GXA A;  4LQ5 A;  3DP8 A;  4M1V A;  4KPT A;  4EDP A;  3MVY A;  2IEE A;  3GLB A;  3B6T A;  1P1N A;  1B7Z A;  2NXO A;  1MQH A;  1Y4T A;  1GR2 A;  1B4H A;  3G3I A;  3SDF A;  5CMM A;  1QUJ A;  4QFL A;  5I56 A;  4N6P A;  3IB2 A;  3TKD A;  1Y4C A;  2VGQ A;  2DP8 A;  5H8N B;  2PT2 A;  1YCJ A;  1JEV A;  3BFT A;  4FOR A;  2F7C A;  2QRY A;  3TMG A;  1JQF A;  5ICQ A;  1LFH A;  1MPB A;  4OEV A;  4EF1 A;  3T93 B;  3DP6 A;  4EQ9 A;  1WOD A;  1SYI A;  2D5W A;  3OOA A;  4G8M A;  3K0V A;  4G77 A;  1P1Q A;  3D4G A;  4RXL A;  3ONM A;  1LLS A;  4TOZ A;  5TU0 A;  4KYE A;  5B70 A;  1DPE A;  1M5C A;  2OZZ A;  2NOO A;  3UA8 A;  1HSL A;  2RKM A;  3ILT B;  2QMX A;  1TXF A;  4ZDM A;  3QUF A;  2OBG A;  4YB5 A;  2V3U A;  1VFE A;  2THI A;  2XHD A;  5CMC A;  5I2K A;  1LB8 A;  3ECR A;  3FVK A;  3C31 A;  5DVJ A;  3SET A;  4YMB A;  1Z7M E;  5JTY A;  1UTH A;  1XHY A;  1O7T A;  5AA4 B;  1MG1 A;  1LAG E;  3UP9 A;  3OSQ A;  4IO4 A;  3TTR A;  4F3P A;  4U21 A;  2XXY A;  2XX7 A;  4I62 A;  1B46 A;  2GH9 A;  1R9Q A;  4ZE8 A;  4GFR A;  2XXQ A;  3KN3 A;  2UVH A;  1ZTY A;  3RQT A;  1FCK A;  5ITO A;  3PPN A;  3T66 A;  2RC8 A;  3LSW A;  3O6H A;  2Y7I A;  4ZEC A;  4GXS B;  4L17 A;  2DS9 A;  3C34 A;  4BDL A;  4P0G A;  3CRB A;  5I56 B;  1HSJ A;  4U1O A;  4FEB A;  2HAU A;  4G68 C;  1JVX A;  2X7Q A;  3O28 A;  3B6Q A;  1B3F A;  5LOM A;  2V3Q A;  1MXV A;  2XX9 A;  3C33 A;  3FD3 A;  3IOU A;  1GV8 A;  4G4P A;  2QMW A;  4RK2 A;  3KFM A;  1MPC A;  1NH8 A;  1SDX A;  4JXI A;  4LP2 B;  4R9F A;  1QW0 A;  2QL3 A;  4DZ1 A;  3CR9 A;  4YIC A;  1MH4 A;  4KCD A;  1I6Q A;  4DXU A;  4GD5 A;  4ZZE A;  3SEX A;  1BKA A;  4IO7 A;  3C32 A;  4LQ2 A;  3EF7 A;  3CFX A;  3LSL A;  1B5J A;  3KOT A;  2HZK A;  4LVQ A;  2GHB A;  5FHM A;  2F7B A;  1HSE A;  3BKI B;  4QF9 A;  2XXX A;  2A5S A;  3PMW A;  2RCA A;  2OLB A;  3TFL A;  3QXM A;  1M5F A;  5CMK A;  4POW A;  4OWD A;  3S2V A;  4YU0 A;  3K02 A;  5DYH A;  1NMU A;  5I2K B;  3MPL A;  3HPI A;  1BLF A;  4QFP A;  2DE4 A;  4JWO A;  2ZNU A;  2H9B A;  3MVX A;  4F31 B;  5JTY B;  1UTH B;  1YAE A;  5BUU A;  4GOT A;  1Y9U A;  1SQY A;  2R9J A;  1QJM A;  3MVW A;  2PBW A;  2XD3 A;  4E0W A;  1SW2 A;  4FIM A;  1NKX A;  4LZ7 A;  4H8J A;  3KOS A;  3H4Z A;  1ATG A;  3EPE A;  1Q1K A;  4OZ9 A;  4NF6 A;  1OLA A;  3S9L C;  2F8D A;  3ZKL A;  3IOW A;  1B9J A;  3FXU A;  3RY3 A;  4F1U A;  4NMY A;  2ONS A;  2UYE A;  1B58 A;  1LCF A;  2I0C A;  1Y3N A;  3L6H A;  4DDD A;  3T9X B;  4LAT A;  4H0W A;  3TTL A;  1B6H A;  4C1U A;  3MUQ A;  5M2V A;  4NWC A;  3RLF E;  1Q35 A;  3LSF B;  3RN8 A;  3GZG A;  4G8H A;  2OCU A;  4GF8 A;  1NNK A;  1LCT A;  2QS4 A;  4R2F A;  4BLA A;  3FZV A;  1OVT A;  4GL8 A;  3U8Q A;  1MXW A;  1J1N A;  4KFQ A;  3Q26 A;  3MBP A;  3GBB A;  5ICT A;  1MM6 A;  5K2X A;  3T9U A;  3H6V A;  4POX A;  1VR5 A;  2VOZ A;  1QUK A;  2WKY A;  4WKM A;  3TTN A;  4ELQ A;  2ONR A;  2UVG A;  2XD2 A;  1PB7 A;  5DEX A;  3PUY E;  3HCQ A;  4IGT A;  3QYT A;  3UK4 A;  3IOT A;  2F35 A;  5CM6 A;  1RYO A;  1TT1 A;  3ILU B;  4RJZ A;  4LA9 A;  3K2D A;  2QSX A;  3B6W A;  3SKP A;  1B3G A;  1RYX A;  1B3H A;  1MY2 A;  5CMB A;  3SEW A;  1B3L A;  4QSE A;  5K2Y A;  4NF6 B;  2V93 A;  4BDR A;  2AIX A;  4F2O A;  5I57 A;  1LAX A;  5EHS A;  5B7D A;  2I48 A;  4ZED A;  3H6W A;  4PQJ A;  1PBP A;  1ZBM A;  1RKM A;  3JYR A;  1B5H A;  1LGB C;  4H6D A;  3IOV A;  1M5D A;  2REG A;  1OLC A;  4AB5 A;  1A99 A;  3U93 A;  4ELR A;  3TEL A;  4MLV A;  1WDN A;  1IQ7 A;  3PUX E;  5DVI A;  4BDO A;  4IO3 A;  5HM4 B;  1H3D A;  4IO5 A;  1B0L A;  1B40 A;  3MZ9 A;  3FJG A;  4C1T A;  1QUL A;  2ZYM A;  3DM0 A;  1B4Z A;  4H1X A;  1EZP A;  1TFA A;  2ONK E;  3OD7 A;  4ZE9 A;  4KI0 E;  5DVF A;  4DLD A;  2QPQ A;  4KR5 A;  1URD A;  1H43 A;  1UIV A;  4BDQ A;  5J1D A;  2Q89 A;  5DEX B;  4F1V A;  1IZ1 A;  1AH5 A;  1B52 A;  1URS A;  3EHU A;  4PFT A;  1XOC A;  4GL0 A;  4ESW A;  2XXR A;  3CG1 A;  4PP0 A;  1N7X A;  4RPN A;  3OMB A;  4H5F A;  2OJT A;  1CB6 A;  1TFD A;  1Y1M A;  1PDA A;  4F2Q A;  3PMV A;  2I4C A;  3TOD A;  3KSJ A;  4RA1 A;  1XT8 A;  4R9G A;  4OHN A;  1LAF E;  2DE3 A;  5I57 B;  2XXT A;  2RF1 A;  1NNF A;  1VSO A;  2XX8 A;  1LST A;  1PB8 A;  2DOJ A;  1WVJ A;  5ISU A;  1FQD A;  3QSL A;  3FV2 A;  3G3H A;  2Z23 A;  2I4B A;  1DOT A;  3Q28 A;  4FAJ A;  1USY H;  2R6G E;  4DIG A;  3THI A;  3K6X A;  3PPQ A;  1SI1 A;  3KN8 A;  3D4C A;  1B7U A;  1OQG A;  3FXR A;  4QHQ A;  4WXJ A;  1A54 A;  1QVS A;  1S50 A;  1B3E A;  3EHT A;  4U2R A;  4UA8 A;  2KLF A;  2IA4 A;  5HBC A;  2VP1 A;  2NUV A;  2V3T A;  5AA3 A;  3OXN A;  1QKA A;  3PPP A;  3CFZ A;  3RT6 B;  3MPK A;  4BDN A;  1LBB A;  1YPN A;  2Q2C A;  4NE4 A;  4NWD A;  2Z8F A;  3G3G A;  2QJE A;  2OWS A;  2ZMB A;  4X1B A;  2XXI A;  2X7P A;  2F6P A;  5KDT A;  3ZSF A;  3G3J A;  3G3F A;  3VXC A;  2F34 A;  4XKP A;  3VV5 A;  3LR1 A;  3RPW A;  5JK4 A;  4ELO A;  4MF3 A;  2V84 A;  3RTW B;  4GVO A;  2HAV A;  3PD9 A;  4F3G A;  3JZJ A;  3HV1 A;  3KG2 A;  1NFT A;  2NWJ A;  1NNT A;  4RNS A;  5AA2 A;  4KYS A;  4GLI A;  5A5X A;  1NL5 A;  3K01 A;  4ESX A;  1B2H A;  4XKQ A;  2P1S A;  3KZG A;  4OVJ A;  3IJO B;  4IY6 A;  3W15 C;  4IY5 A;  2Q88 A;  1XS5 A;  3PUW E;  3LUY A;  1VFD A;  5L9S A;  1N3W A;  2XXP A;  4EXK A;  2YPN A;  3IAZ A;  4MFI A;  5F1Q A;  4NF8 A;  5FTI A;  3B7D A;  3HHG A;  3IX1 A;  3IOR A;  3MZB A;  3A3C A;  4R6K A;  4MBP A;  2I3V A;  3S9M C;  1FQC A;  2NVU B;  2A5T A;  4KCC A;  4KQP A;  4ND9 A;  2F78 A;  3VVE A;  4H65 A;  1IIT A;  1FQE A;  1FTJ A;  4JWY A;  3CI8 A;  3C4M A;  1NH7 A;  4R6Y A;  1USY E;  3V83 A;  4F1Y A;  3PUZ E;  3QAX A;  4ZEI A;  1QKB A;  3SES A;  1SBP A;  1EZ9 A;  3KBR A;  3T22 A;  1ELJ A;  1JVY A;  4KYD A;  3Q25 A;  3OO9 A;  5H8F A;  4F3S A;  2P0S A;  3O9P A;  2H25 A;  2Y84 A;  1L5T A;  3VE1 B;  2Z8D A;  2VHA A;  5KDT B;  4EQB A;  4R72 A;  2Z8E A;  3H06 B;  3TTM A;  4DCY A;  1FTL A;  1F9B A;  3OO8 A;  1SYH A;  2I0B A;  2RIN A;  2DWJ A;  1II5 A;  1MXY A;  1MQG A;  3FAS A;  5AA2 B;  5I2N A;  1GTK A;  1LFG A;  5DT6 A;  5A5X B;  3FXQ A;  2ZYK A;  4K3F A;  1MQD A;  5FTH A;  4ZZA A;  1P1U A;  1DMB A;  3PUV E;  4OFO A;  5KZT A;  2ZNT A;  3P7I A;  3QUJ A;  3E9X A;  1MQJ A;  4HCW A;  1R1N A;  4RPO A;  3FJM A;  2HFB A;  2YJP A;  4XXU A;  2AYS A;  4NF8 B;  2DVC A;  1FTO A;  2OWT A;  4F19 A;  3VFJ A;  3RGY A;  3FIR A;  3TCF A;  4FAT A;  3MQ9 A;  2DXY A;  2A5T B;  1KWH A;  1SVX B;  4ISU A;  3IR1 A;  3A09 A;  1MXU A;  2F6G A;  3G7W A;  4P11 A;  2GFE A;  5EHM A;  3OEM A;  1ZKB A;  3T9V A;  3CSG A;  1OVB A;  3CVG A;  1Y3P A;  4NTL A;  3OEL A;  5CRY A;  1DPP A;  5FHO A;  3MWB A;  4AQ4 A;  3TAJ A;  3FJ7 A;  4H8I A;  2I49 A;  3O29 A;  4E0X A;  2DXR A;  1BP5 A;  1A7L A;  3K6U A;  5H8F B;  4O3C A;  3IL1 B;  1UTB A;  3CIJ A;  3MZ1 A;  3TCH A;  3KJT A;  1IUD A;  4ZEK A;  4R2B A;  2E0S A;  3RNN A;  4OFL A;  3VLW A;  2YLN A;  1D9Y A;  3HHF A;  3E3K A;  1O64 A;  3C9H A;  4OQO A;  4F3B A;  1AOV A;  3VDF A;  3TUS A;  4JDF A;  5ITP A;  1A55 A;  5H8Q A;  2QS3 A;  2UVI A;  5I2N B;  1D3K A;  1FQF A;  4P0I A;  2HCA A;  2HXW A;  1D9V A;  3U94 A;  2PVU A;  1R9L A;  4LZ5 A;  2Z22 A;  4EXL A;  3M8U A;  1MY1 A;  4Q8R A;  2DQV A;  3VVF A;  2UVJ A;  4I8C A;  1YTV A;  2DWA A;  4R73 A;  3AXF A;  3UIF A;  3EN3 A;  4F22 A;  2W7Y A;  3H6T A;  3RT8 A;  4R74 A;  3ZS6 A;  5I59 A;  4GRK A;  5CC2 A;  1IXG A;  4JB7 A;  2O7U A;  2FA7 A;  1MXX A;  5L9O A;  3VVD A;  5CI5 A;  3I5O A;  3QIM A;  2CMO A;  4NED A;  4THI A;  2Y7R A;  4LZ8 A;  3K6W A;  2Q2A A;  4WED A;  4PET A;  3O66 A;  1MXZ A;  1IXH A;  2D3I A;  2E1S A;  2ABH A;  1B1H A;  4IO2 A;  2DYX A;  2H5Y A;  4YZZ A;  1OIB A;  3DLN A;  4IB2 A;  4WEP A;  3PD8 A;  1POY 1;  1IIW A;  2DE2 A;  2F7A A;  4GWO A;  1N04 A;  5DTB A;  4YB7 A;  1ZU0 A;  3TQL A;  4U23 A;  1UTB B;  3L6G A;  2I58 A;  4KHZ E;  3FVN A;  1MS7 A;  2ZNS A;  1ZLQ A;  3K1M A;  4U1Z A;  4LUB A;  5FHN A;  3T96 B;  3H6U A;  3Q29 A;  4G2Z A;  3MVZ A;  3FUZ A;  2XXU A;  1ZMG A;  1A40 A;  4Q30 B;  5JEI A;  4HW8 A;  4XIG Q;  3K1P A;  1MPD A;  4YB6 A;  5H8Q B;  3DP4 A;  1N3X A;  3FAT A;  1AIV A;  4H5G A;  1N84 A;  3O97 A;  3UOR A;  3MAM A;  3QK6 A;  3MJN A;  3OSR A;  4U4X A;  1VE4 A;  4OER A;  3HN0 A;  4PFU A;  3FV1 A;  2VD3 A;  3HO7 A;  1MY0 A;  1FTK A;  1DSN A;  3MP1 A;  5H8H A;  5AA1 A;  4O3B A;  1IXI A;  1O63 A;  3H3G A;  1XVX A;  5L9M A;  1UQW A;  4F29 A;  2UYF A;  3N26 A;  3H03 A;  5AE4 A;  5CBS A;  4RY1 A;  3TYH A;  1ANF A;  1POT A;  3OEN A;  4R6H A;  3R6U A;  5I59 B;  4GXA A;  3KSX A;  5TPA A;  1SD3 A;  3V89 B;  2F97 A;  4OEU A;  2DSF A;  2DWI A;  1AMF A;  2DVZ A;  3KEI A;  4XKN A;  4I1D A;  4DXC A;  4Z7E A;  4NF5 A;  2O84 X;  1US5 A;  2HQ0 A;  4ZEF A;  1B1X A;  1N7W A;  2I3W A;  3VLU A;  4Q5T A;  1AL3 A;  1Z7N E;  2CZL A;  4U4S A;  4JBZ A;  3SEV A;  3VLV A;  4DE8 A;  3CSB A;  2Y7P A;  4R75 A;  1P1W A;  4KD5 A;  1LBC A;  1JW5 A;  4UAC A;  4U22 A;  2OK2 A;  1MY4 A;  5TP9 A;  2O69 A;  3TCG A;  3M3K A;  4TLM B;  2RC7 A;  1JW4 A;  3K1N A;  2O1M A;  4FJP A;  4QFK A;  5IKB A;  3KJ7 A;  1A8E A;  2O51 A;  3N6U A;  2H99 A;  4DXB A;  2Y7W A;  4YKK A;  1MM7 A;  1MY3 A;  2F36 A;  4Q0C A;  4YKJ A;  5H8S A;  3CFL A;  4X48 A;  3N5L A;  2HZL A;  3BBR A;  1ZJL A;  4F18 A;  5I84 A;  4ZEB A;  1DTG A;  4N07 A;  3O2A A;  1GVC A;  1I6A A;  3C35 A;  5H8H B;  3DEL B;  1B0H A;  3HST A;  1PEB A;  4ECF A;  3PMX A;  3SER A;  4ELP A;  4JSD A;  1FQB A;  4PFY A;  4LON B;  2D21 A;  1ZIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...