4F3PA

Crystal structure of a glutamine-binding periplasmic protein from burkholderia pseudomallei in complex with glutamine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
226
structure length
223
Chain Sequence
KELVVGTDTSFMPFEFKQGDKYVGFDLDLWAEIAKGAGWTYKIQPMDFAGLIPALQTQNIDVALSGMTIKEERRKAIDFSDPYYDSGLAAMVQANNTTIKSIDDLNGKVIAAKTGTATIDWIKAHLKPKEIRQFPNIDQAYLALEAGRVDAAMHDTPNVLFFVNNEGKGRVKVAGAPVSGDKYGIGFPKGSPLVAKVNAELARMKADGRYAKIYKKWFGSEPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Glutamine-binding periplasmic protein from Burkholderia pseudomallei in complex with glutamine
rcsb
source organism Burkholderia pseudomallei
molecule tags Transport protein
molecule keywords Glutamine-binding periplasmic protein
total genus 78
structure length 223
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4f3pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4f3pA02
1MXXA 1OLAA 4F2OA 1FQCA 3OELA 1PDAA 2V93A 1HSEA 3MPKA 4IGTA 4G68C 4QRZA 4PFYA 1A99A 4U23A 1Y20A 3FASA 5L9OA 1A54A 4QFKA 1EZPA 1A8EA 2H98A 4GXSB 3RT8A 4EQ7A 4F1VA 5KDTB 4L17A 3RTFB 3KEIA 4TLLB 3K1NA 3N5LA 1Q1KA 2R71A 3OO9A 4IO3A 2HCAA 3CG3A 1BTJA 4QFNA 5JEIA 2QJEA 1PEBA 3CSBA 3H6UA 3GBBA 3H6VA 1ZLQA 4ND9A 4OVJA 1L5TA 1DPPA 4OTEA 4POXA 4YKPA 4IO7A 1MQDA 3R7XA 3ZS6A 2V3QA 2NOOA 2CZLA 4MFIA 1SI0A 2I4CA 3HV1A 3MZ9A 4R75A 2OJTA 4BDNA 5I84A 1NNKA 2HQ0A 3G3JA 3OO8A 5H8NB 1B7HA 2A5TB 3ZKKA 2HAVA 3H3GA 1SI1A 5CMBA 3ONMA 5I59B 2DS9A 3FJGA 3FVNA 4HTGA 4YZZA 3C9HA 1KWHA 2XXWA 4Q30B 4OFJA 2Y7RA 4RA1A 2B3BA 5H8FA 4X1BA 1NMUA 3IOUA 3U92A 1AH5A 1CE2A 1FQEA 5F1QA 4N6PA 2OZZA 1FW0A 1B3GA 4NE4A 2UVIA 4ZEFA 3TPAA 2D21A 2E0SA 2I0BA 1SD3A 4IB2A 2UVHA 4R72A 1PB9A 2DWHA 4C1TA 4JXIA 1P1QA 4QSEA 1S9TA 2X7QA 5H8HA 3L6HA 2ZXTA 3Q26A 3JV9A 4X1DA 2F7BA 5CM6A 3TFLA 2ONSA 2RINA 4QFPA 4OEUA 2I3VA 1IXGA 1TXFA 1SVXB 4G8HA 2M8CA 3OSQA 3QIMA 5L8DA 1B0HA 4GXAA 2DSFA 4NF4B 4EF1A 1US4A 2QS4A 1MQHA 3UORA 2ESNA 1AMFA 3PMWA 2W7YA 1B7ZA 1MRPA 2FNCA 3GBAA 2DVCA 2HXWA 1J1NA 3ODBA 4JWOA 5BWJA 4DIGA 2REGA 2H5YA 5M2VA 3LR1A 1H76A 3PMVA 5AA2A 3PUYE 4XKQA 2QSXA 1MPCA 3VLVA 3TYHA 4U22A 3MPLA 3BBRA 3PUZE 4OHNA 5I57A 1ZKBA 1B51A 1OQHA 3E9XA 2O68A 2XXHA 3KOSA 4ISUA 1URGA 4M4GA 4DE8A 2I58A 3B6TA 1Y1ZA 2VOZA 3G3IA 5CRYA 3TQWA 4OERA 5I58A 5KCJA 3SEUA 1ZMGA 5J1DA 1OIBA 1WODA 3HHGA 4ZZAA 1Y3PA 2IA4A 2V3TA 3CVGA 5DEXA 3LSFB 3MVXA 1MQGA 3MQ9A 1QKAA 2XXRA 5CMKA 3C33A 4RY1A 1LLSA 3EHSA 3HSTA 1UTHA 2RCAA 3W9VA 2R6GE 4LONB 2RC8A 2Z8EA 2ZYNA 4YKJA 1SYIA 4R73A 3GZGA 3RT6B 1MG1A 1SQYA 2HZLA 3FGSA 3G3HA 3R6UA 3G3KA 1ZIUA 3LBSA 1B5JA 1MH3A 3H7MA 2ANJA 5TP9B 5TPAB 2B3FA 2ZYKA 2GRVA 4MH5A 4F31B 2XHDA 1IXIA 4OEVA 1MY3A 4ELPA 4TLMB 4GIZA 4AB6A 3TQLA 2I49A 3L6GA 5H8QA 2QL3A 1XHYA 2Z8FA 1DTZA 2NVUB 3O9PA 2UXAA 1LCTA 3T22A 4F3PA 1B52A 3KN8A 3KG2A 3FVGA 3O29A 2O69A 3QUJA 4LVQA 4POWA 2ONKE 4Z0IA 3O66A 3IK6B 2DXRA 1JVYA 2OLBA 1LCFA 3LC8A 3MZBA 2XXUA 2O84X 3H03A 2THIA 2Y7WA 1NH8A 3MP1A 1UQWA 4F3GA 5I56B 1M5DA 2DWJA 4JWXA 3FD3A 3U8QA 3UA8A 2UVJA 1MS7A 2ZNUA 2ZYMA 3MVYA 1OLCA 3LSLA 3CR9A 3PV0E 1JETA 1M5CA 4NF6B 4XTCQ 5FHMA 5TU0A 1OVBA 3ECRA 3T93B 5ISUA 4NWDA 2BJJX 1JEVA 4THIA 2I48A 2Q2AA 4ZE8A 1O7TA 3A3UA 3C34A 3LSXA 4EXKA 1H43A 2GFEA 4H5FA 3IB1A 5L9SA 3EQ1A 2Q89A 3RLFE 2PT1A 3B7DA 5DT6A 4JB7A 4OFOA 2O6AA 1NNPA 1SW4A 3MP6A 3KSXA 4R6HA 4ZZEA 4U2RA 5L9MA 1I6QA 2F7AA 2OK2A 1B3FA 1ZTYA 2YJPA 5H8QB 3K1MA 2NUVA 3KZGA 4OMBA 1B9JA 1LFGA 1POTA 3LSWA 4PFWA 3CIJA 4PFUA 4GLIA 3THIA 1N84A 1ELJA 1QVSA 2XX8A 1NNTA 1OQGA 2RKMA 3TAJA 4X9TA 5AA2B 1LAFE 1H45A 1JEUA 2O7IA 1FQFA 1XVYA 2VD3A 4JWYA 4YB5A 3RUMA 1XC1A 2O1LA 3Q29A 3UN6A 1WVJA 1XS5A 2F6GA 1ZBMA 2RC7A 3CFZA 3FATA 5DTBA 2PMSA 1B1XA 3I6VA 3W15C 1MY2A 4GD5A 1IEJA 4G2ZA 4XXUA 1B6HA 4NMYA 3VXCA 2YLNA 4GL8A 4ZDMA 4F22A 1D9VA 3T96B 1YTVA 4DXUA 3Q25A 1MXVA 1QKBA 4R9GA 4WEPA 3K6WA 4JDFA 5FTIA 3TCHA 3BFUA 3UK4A 1MDP1 5CI5A 3UIFA 5HM4B 5A5XB 4F1UA 3TTNA 4O3BA 5I2KA 5I56A 1D3KA 4MF3A 2V3UA 1JW4A 2QRYA 4I8CA 1B58A 3BKIB 1MM7A 3QK6A 4FIMA 4G8NA 4KPTA 3VVEA 4DCYA 1FTLA 3IJOB 4LQ2A 1Y1MA 2F97A 1IZ1A 4YKKA 1MQIA 2QS3A 3EHTA 2DE2A 3V8XB 4OENA 4EDPA 4H67A 3VXBA 4NF8A 4ZE9A 2G93A 4KYSA 2OWSA 1ANFA 1FQDA 1FTKA 1VFEA 1I69A 2QPQA 3O6GA 3T9UA 1OVTA 2ZNTA 3JZJA 2DE3A 3W9WA 1AIVA 1MXZA 3PPPA 4FJPA 3SDFA 3SETA 3O28A 1MH4A 3FZVA 3P7IA 4XKRA 1URDA 1I6BA 1TFDA 3M3LA 3DP8A 3TELA 3U72A 4F18A 1MY4A 1B7UA 4C0RA 1SYHA 3FXUA 3OEKA 3A09A 2I4BA 1B4HA 3R26A 3ILTB 1LGBC 4IY6A 4YAHX 4DXCA 4F3BA 5I2NB 3T9VA 2ONRA 4BDMA 3H6WA 3MJNA 4E0XA 3SEVA 4TOZA 1LAXA 3VLWA 3FIRA 5AA3A 1JW1A 1NNFA 5DEXB 4MLQA 2HAUA 1LBCA 4I1DA 2FA7A 3IB0A 4IGRA 4LA9A 2Z23A 4N13A 4FEBA 4RJZA 3UP9A 3VDFA 2A5SA 4RK9A 3PPQA 5AA1A 3V89B 3TEPA 1R9LA 3MVWA 1B46A 2QMWA 2XXVA 2H25A 3C4MA 4OFLA 5ICQA 1IXHA 4KR5A 1A40A 2PX1A 3MUQA 4GOTA 3CRBA 2Y84A 4H65A 1MXYA 1Y3QA 3PPNA 4LQ5A 3MZ1A 5DVIA 3G3FA 3Q27A 5ELVA 3IO4A 4TQUQ 2XXIA 3TTKA 2V84A 2D3IA 1B1HA 4OESA 2P1SA 3KJ7A 4H1XA 2R9JA 4U4XA 1XVXA 4YICA 5EHMA 1USYE 1GVCA 3S9NC 2PVUA 1LAHE 2ZYOA 1DMBA 1CB6A 4H8IA 1QW0A 3FJMA 4EQ9A 2FYIA 1O64A 4ZEDA 4G4PA 4UA8A 3PPOA 3VVDA 3O2AA 1M5EA 1GGGA 2WKYA 3C36A 2DP8A 3I3VA 3C31A 4JBZA 4R6YA 3O97A 4Z7EA 4EUOA 1SW5A 1Y4CA 2ALUA 1RYXA 1TFAA 5FHNA 3WAEA 3SERA 3BFTA 4MBPA 3T66A 1A8FA 4OETA 1R6ZA 2O1MA 1NFTA 1B40A 1SW2A 2DXYA 3DELB 4H8JA 4LZ5A 5LOMA 1VR5A 4GRKA 4GVOA 2F7CA 1B4ZA 1NKXA 4BLAA 1DTGA 4DDDA 5H8FB 3VFJA 1BP5A 3K1PA 2XX7A 4NTLA 4YKIA 3KBRA 3E3KA 3SEYA 2B65A 1LB8A 1IITA 3IL1B 1B5HA 2Z8DA 3M8UA 3IOWA 1LFHA 5IAIA 4GWOA 2OWTA 3S9EA 1H3DA 2DE4A 2F35A 4KCCA 4XKPA 4N07A 3HPIA 4ZS9A 1N04A 1YAEA 2KLFA 1NH7A 1AL3A 1P1NA 2V25A 2Z22A 3OSRA 4OYVA 3UGWA 5KCJB 3PD9A 1M5BA 5IKBA 4IO4A 1URSA 1EZ9A 3OO6A 1UIVA 4MLVA 4R9FA 1ZU0A 2F34A 4Q8RA 3U94A 3O6HA 4ONYA 4HW8A 3GLBA 3H6TA 4P0GA 5I59A 4G68B 4LUBA 1FQBA 3HN0A 1IXCA 1FTJA 4LZ8A 4R74A 4WKMA 3N94A 3U1OA 3VV5A 2QS2A 2ABHA 4KQPA 2Q8JA 2G29A 4PQJA 4AQ4A 5I2NA 1POY1 1QULA 1DOTA 5CBSA 1MQJA 1P1WA 2Y7KA 3C32A 3IORA 3MAMA 2F6PA 3N26A 3VLUA 1O63A 2XXTA 2PBWA 4OXVA 1VSOA 3HCQA 5B7DA 1M5FA 4O3CA 1MXWA 4H0WA 2QMXA 1GTKA 1JVXA 4FE8A 4DXBA 4F3SA 1FTOA 4LATA 5AA4B 2DOJA 4R2BA 3SEXA 3T9XB 1ZJLA 2XXYA 1JQFA 4FECA 5ICTA 3PD8A 3TMGA 4F29A 4JSDA 5KZTA 4NF8B 2Y7IA 1QUKA 3CFLA 3RY3A 4ELRA 1USYH 2RCBA 3O6IA 2UYFA 1MM6A 2HZKA 3EPEA 4BDOA 4P0IA 1F9BA 4FEDA 4RPOA 5H8HB 3VE1B 4AB5A 3FVOA 3GXAA 3WAFA 4ELOA 1MPDA 2X26A 2F78A 3K6VA 3D4GA 3QUFA 4FORA 2P2AA 2D5WA 4YB7A 3A3CA 4QHQA 5FTHA 4C1UA 1B3EA 4KCDA 5JTYB 3V5AA 1PBPA 3RNNA 4PETA 1PC3A 2O51A 3D4CA 3K02A 4Q5TA 2F5XA 1EH3A 1FQAA 4GF8A 2AL4A 5JK4A 4NF4A 5AE4A 2CMOA 1LSTA 2XXXA 3S2VA 1AOVA 3MP8A 3S9LC 2I6EA 4I62A 3Q28A 3G3GA 3C35A 1LB9A 1DSNA 4QSCA 3TDJA 1PB8A 4JSOA 1JW5A 1VFDA 3OOAA 1QUIA 2LAOA 3HO7A 4G77A 4DZ1A 3TUSA 3KN7A 5ITOA 2XD3A 3SKPA 3IO6A 4DLDA 3KN3A 4XIGQ 2VGQA 3TCGA 1VE4A 3PPRA 4HCWA 2UVGA 1MY0A 3PUVE 3JYRA 4U21A 1UIUA 4NF5B 1UTBA 3RTWB 5HBCA 4QSDA 1EZOA 1QUJA 1JNFA 1B32A 1XOCA 1P1UA 2NXOA 3IAZA 2HFBA 1N3WA 2I3WA 2Q88A 3RN8A 3CG1A 3FV2A 4ESXA 4R6KA 4R2FA 2PYYA 4GQOA 4NF5A 3RGYA 1BKAA 1LFIA 3K2DA 1I6AA 4HCYA 2DYXA 4PE5B 1MY1A 3U93A 5TPAA 4F19A 3IX1A 4U1OA 3DP6A 3KFMA 3RPWA 2UYEA 1IQ7A 1IIWA 3OD7A 4G8MA 3F11A 1R1NA 3QXMA 3DLNA 1P1OA 4H6DA 4ZEIA 2H9BA 4H5GA 1N7XA 2GHBA 2YPNA 3TKDA 1MPBA 1OMPA 3AXFA 4KYEA 5CBRA 4KFQA 2PT2A 1MDQA 3FJ7A 3PGFA 4YU0A 5DYHA 5EYFA 3K4UA 3OO7A 5DVJA 1UTHB 3E4RA 1Y4TA 1GV8A 3EHUA 3T9HB 3USDA 4ZECA 1LBBA 2Q9TA 3B6QA 5H8NA 3ZSFA 4FAJA 2VHAA 4O3AA 1Z7ME 3IB2A 3ZKLA 1DPEA 2O7UA 4EF2A 5I58B 5A5XA 1S7YA 3H06B 5I2KB 3B6WA 3FVKA 1N76A 4WEDA 5FHOA 3LUYA 1QJMA 1TWYA 1A7LA 1UTBB 2VP1A 5AA2D 1ATGA 2REJA 5KDTA 1RYOA 3N6TA 2XD2A 1TT1A 4RNSA 4BDRA 4QFOA 3N6UA 3QAXA 3QSLA 1HSLA 4M1VA 1LAGE 4UACA 1BLFA 5CMMA 2HEUA 4ECFA 1Q35A 2Y7PA 1Y3NA 3EF7A 3SESA 4KHZE 2I0CA 3E13X 5CC2A 5B70A 1N7WA 1B0LA 3I5OA 1SDXA 3TODA 4PP0A 4Q0CA 4FATA 4GFRA 4F39A 5ITPA 2IEEA 3S9MC 3G7WA 2QS1A 3M3KA 2OCUA 1II5A 1B3LA 3OXNA 4ELQA 3K01A 1XT8A 4U4SA 1NL5A 4X48A 1FCKA 3PUXE 3MC2A 4IO2A 5H8SA 3SEWA 1YPNA 2RC9A 4F1YA 4RXLA 1SW1A 3IOVA 3FV1A 3M3FA 3CFXA 1IUDA 3OEMA 3KOTA 3PU5A 1YCJA 4G68A 3TZAA 3RQTA 4E0WA 1GR2A 3K0VA 3ILUB 2H4IA 4LZ7A 1B2HA 1B3HA 1Z7NE 3CI8A 3FUZA 1D9YA 2DWIA 4NWCA 1WDNA 2ZNSA 4WXJA 5DVFA 2A5TA 4YB6A 5F7VA 3S4UA 2ZMBA 3FXRA 4QFLA 2VD2A 3KGCA 3PMXA 4RPNA 2P0SA 4RYAA 3MWBA 4KD5A 4NF6A 4DCXA 3H4ZA 2X7PA 4PFTA 4ZEKA 1PB7A 5EHSA 2AYSA 4QF9A 1FTMA 2DQVA 4XKNA 4EQBA 3EN3A 5AA4A 1EU8A 3FXQA 1RKMA 1A55A 2XXPA 3HHFA 3OENA 4OWDA 3TTRA 1HSJA 3DM0A 4P11A 4RK2A 3K00A 4OQOA 1N3XA 4ESWA 3TCFA 4YMBA 4IO5A 4GL0A 5K2XA 4HS7A 1D4NA 3CSGA 4ZEBA 1US5A 3MW0A 4U1ZA 2XXQA 1S50A 2H99A 3TTLA 3PUWE 2F8DA 1B5IA 2DWAA 3OMBA 4KYDA 3MBPA 1H44A 3QYTA 4EXLA 2NWJA 2GHAA 3K6UA 4K3FA 4IY5A 5JTYA 2E1SA 1N0TA 5K2YA 3TTMA 2AIXA 3IOTA 4LP2B 5TP9A 4KI0E 2GH9A 1PBQA 2Q2CA 4YMAA 3V83A 4IO6A 1B05A 3IR1A 3IJXB 5HPQA 2F36A 3MVZA 1Y9UA 3VVFA 5I57B 2OBGA 4I9DA 5BUUA 1SBPA 4NEDA 1MXUA 1T0KA 1BIYA 3DP4A 3KJTA 5CMCA 4BDLA 2DVZA 4OZ9A 2AL5A 1R9QA 4BDQA 4F2QA 1P99A 2XX9A 3K6XA 2RF1A 3KSJA
chains in the Genus database with same CATH superfamily
5IGAA 1OLAA 3OELA 1PDAA 4LN5A 4G68C 2H98A 4GXSB 3RT8A 5KDTB 4X8RA 3OO9A 1FPBA 3H6UA 4OVQA 1ZLQA 4ND9A 4OVJA 4I40A 1L5TA 4IO7A 3ZS6A 4MFIA 3HV1A 5ET5A 5I84A 1NNKA 2A5TB 2HAVA 1LBWA 5CMBA 3ONMA 5I59B 2XXWA 5H8FA 3IOUA 2FIEA 4N6PA 2OZZA 1FW0A 1B3GA 1KA0A 2UVIA 4ZEFA 2E0SA 2UVHA 4QSEA 4GWWA 2ZXTA 4X1DA 1FPGA 5CM6A 2ZZVA 2I3VA 3OSQA 4OANA 5L8DA 4GXAA 2DSFA 3PMWA 2W7YA 1B7ZA 3GBAA 1J1NA 4G61A 2H5YA 3FBPA 5AA2A 4U22A 1B51A 1OQHA 3E9XA 2V4CA 5KCJA 3TQWA 4OERA 1OIBA 2IA4A 1QKAA 2CZIA 2RCAA 5EYHA 4LONB 1SYIA 3FGSA 3LBSA 4P47A 4F31B 1MY3A 4AB6A 2Z8FA 4F3PA 4XF5A 3O29A 2O69A 4Z0IA 3IK6B 2B4MA 1LCFA 2O84X 4P8BA 2THIA 2Y7WA 3FD3A 2UVJA 1MS7A 3MVYA 2ZYMA 3LSLA 5FHMA 3ECRA 4PFBA 1FPKA 1FBDA 4NWDA 3A3UA 4EXKA 1H43A 4OVSA 3IB1A 4JB7A 4OFOA 1NNPA 4MCOA 4R6HA 1I6QA 1ZTYA 2YJPA 4PFUA 1H45A 2O7IA 1FQFA 1XVYA 1XC1A 4X04A 1WVJA 5DTBA 1FBEA 1IEJA 4G2ZA 4NMYA 4GL8A 4MIJA 1D9VA 4F22A 2HPGA 3Q25A 1MXVA 4WEPA 5I56A 1D3KA 4MF3A 2V3UA 1JW4A 4G8NA 4DI3D 2CZKA 3VVEA 4PAKA 2QS3A 3V8XB 1ANFA 2QPQA 3O6GA 1AIVA 3W9WA 3PPPA 3SDFA 3O28A 1MH4A 3P7IA 1TFDA 3U72A 4F18A 1MY4A 1B7UA 2Q8MA 4C0RA 3R26A 5I2NB 1JW1A 1NNFA 4NG7A 4I1DA 3IB0A 4OA4A 4KR5A 4MMPA 4PTKA 1IMAA 3MZ1A 5EQ9A 5ELVA 1B1HA 2P1SA 1GVCA 1JP4A 2ZYOA 3FJMA 4PDDA 4UA8A 3C36A 2DP8A 1SW5A 2ALUA 4NF0A 1RYXA 3SERA 3BFTA 1A8FA 4N15A 4GVOA 1B4ZA 1DTGA 3VFJA 3K1PA 4NTLA 4PAFA 3IL1B 3M8UA 3IOWA 1LFHA 5IAIA 3S9EA 2OWTA 2F35A 4KCCA 1EYJA 2KLFA 1YAEA 5KCJB 3PD9A 4HE1A 4IO4A 4IR8A 4MLVA 1FBPA 4R9FA 3O6HA 3GLBA 4KQPA 2G29A 1NV4A 2Y7KA 3C32A 1O63A 2PBWA 1FTOA 2XXYA 2ZZXA 5ICTA 3PD8A 5KZTA 4I3EA 1USYH 2RCBA 3ISPA 4RPOA 3FVOA 1MPDA 2KR0A 4YB7A 4KCDA 2Y5LA 4Q5TA 2F5XA 1LSTA 4I62A 3C35A 3TDJA 4JSOA 1JW5A 3RYDA 4G77A 5ITOA 3IO6A 2VGQA 3PPRA 2XWVA 1UIUA 1UTBA 4QSDA 1JNFA 3IAZA 3RN8A 2I3WA 4R6KA 2PYYA 3RGYA 1FBCA 4PE5B 3U93A 4F19A 4FBPA 1IQ7A 4G8MA 1R1NA 3QXMA 1P1OA 4H6DA 3EKIA 2WYPA 3AXFA 4KYEA 5EYFA 3E4RA 1GV8A 3T9HB 2Q74A 4NQ8A 1Z7ME 1DPEA 5J16A 3H06B 4N6DA 5FHOA 1QJMA 5KDTA 1A7LA 5AA2D 1ATGA 4N6KA 1TT1A 3N6UA 1LAGE 4UACA 1BLFA 2HEUA 2Y7PA 1Y3NA 4NX1A 5CC2A 5B70A 3TODA 4PP0A 4FATA 1II5A 2HXRA 1LBVA 1BK4A 1FCKA 5H8SA 1YPNA 4OVTA 1SW1A 1IUDA 1K9ZA 3OEMA 3PU5A 1YCJA 3TZAA 1GR2A 2PFYA 3CI8A 4WXJA 5H8HA 2A5TA 4QFLA 3PMXA 3IFCA 4RPNA 2P0SA 1FSAA 4GWSA 3H4ZA 4PFTA 2CEYA 1PB7A 5EHSA 4QF9A 5AA4A 2DQVA 3EN3A 1EU8A 3FXQA 3LV0A 2XXPA 4PGNA 1HSJA 4P11A 4OQOA 1N3XA 1D4NA 4ZEBA 1US5A 2F8DA 2DWAA 3MBPA 1H44A 2GHAA 4IY5A 2E1SA 4KI0E 2Q2CA 3V83A 5HPQA 3A29A 3IJXB 5LTCA 3VVFA 3KJTA 5CMCA 4OZ9A 3K6XA 2RF1A 3KSJA 1FQCA 3MPKA 4QRZA 4PFYA 1A99A 4U23A 3FASA 1EZPA 1A8EA 4PE3A 3KEIA 4GWUA 3N5LA 1Q1KA 2R71A 4QFNA 3T1BA 5JEIA 2QJEA 1AWBA 4YKPA 2NOOA 2CZLA 4OVRA 5H8NB 5EQ7A 2DS9A 3E79A 4HTGA 2CZHA 1AH5A 5F1QA 4P56A 4IB2A 1SD3A 4R72A 2WBDA 4JXIA 1P1QA 2X7QA 3Q26A 3JV9A 2RINA 1TXFA 1SVXB 1NUWA 4EF1A 1US4A 3UORA 2ESNA 1FPLA 2HXWA 5BWJA 4DIGA 3PUYE 4XKQA 2QSXA 3TYHA 5I57A 3BBRA 4OHNA 1IMBA 1YZ0A 2O68A 2XXHA 3KOSA 4DE8A 3B6TA 1ZMGA 1WODA 1Y3PA 2V3TA 3MVXA 1MQGA 3MQ9A 4RY1A 1LLSA 3HSTA 3W9VA 2ZYNA 4YKJA 3RT6B 2FIXA 1MG1A 1RDXA 2HZLA 3T0JA 4PBHA 3G3HA 1MH3A 5TPAB 2B3FA 4MH5A 4ELPA 4TLMB 2QL3A 1XHYA 2NVUB 2UXAA 1B52A 3KN8A 3S2VA 3QUJA 1INPA 2DXRA 1JVYA 3MZBA 2XXUA 3H03A 1LBXA 3MP1A 4MJOA 5I56B 2DWJA 3UA8A 1NV7A 2FVZA 3CR9A 2Q2AA 2FBPA 4H5FA 2WYKA 5L9SA 3EQ1A 2PT1A 3B7DA 2O6AA 3MP6A 3KSXA 4U2RA 4PFWA 3LSWA 1XI6A 3CIJA 1ELJA 3TAJA 4PGPA 2VD3A 4JWYA 3RUMA 3CFZA 1ZBMA 4JVCA 2PMSA 1B1XA 2Y5KA 4XXUA 4PC9A 2YLNA 1YTVA 5FTIA 1QKBA 4R9GA 4F1UA 3QK6A 3IJOB 2F97A 1IZ1A 2DE2A 2G93A 1FTKA 3TTLA 1I69A 2QVVA 3JZJA 5ET6A 5ET7A 3SETA 1URDA 1I6BA 2I4BA 4IY6A 4YAHX 2ONRA 2F3BA 3MJNA 3SEVA 3FIRA 5AA3A 4QBAA 2HAUA 3VDFA 4N13A 3PPQA 5AA1A 1R9LA 2XXVA 5ICQA 4HE2A 3CRBA 4H65A 1Y3QA 3E78A 3Q27A 3IO4A 4TQUQ 2XXIA 1NV6A 4U4XA 2R9JA 3BIHA 2PVUA 4GBVA 1CB6A 4H8IA 2FYIA 3VVDA 3PPOA 2WKYA 4JBZA 3O97A 1Y4CA 4MBPA 4OETA 1R6ZA 2O1MA 1NFTA 2P3VA 3DELB 4GRKA 4BLAA 1BP5A 2XX7A 1IMFA 2B65A 2Z8DA 4GWOA 1H3DA 4ZS9A 1N04A 1AL3A 3OSRA 1NV3A 1EZ9A 1UIVA 2F34A 5EYGA 4N8GA 1EYIA 4P0GA 5I59A 4R74A 3VV5A 1QULA 5CBSA 3VLUA 3MAMA 2F6PA 2XXTA 4I3YA 5B7DA 4O3CA 4F3SA 1JVXA 4FE8A 4DXBA 1JQFA 3TMGA 1LEVA 4ELRA 3RY3A 3O6IA 5H8HB 4FEDA 3WAFA 4ELOA 2F78A 3QUFA 2P2AA 3A3CA 3V5AA 1PBPA 4PETA 1PC3A 2O51A 3K02A 1EH3A 4NF4A 2CMOA 2I6EA 3Q28A 1PB8A 1VFDA 3OOAA 3HO7A 4DZ1A 3KN7A 3SKPA 4DLDA 4XIGQ 3TCGA 1EYKA 3JYRA 4U21A 1EZOA 1QUJA 1B32A 3TELA 1XOCA 4O94A 2HFBA 2Q88A 4ESXA 1BKAA 2P3NA 3K2DA 2XWOA 1IIWA 3F11A 3QMFA 3K4UA 3OO7A 1UTHB 1Y4TA 3EHUA 4ZECA 5H8NA 3ZSFA 2O7UA 5A5XA 3B6WA 3FVKA 4WEDA 4PFIA 2REJA 4MEVA 4ECFA 1HSLA 4M1VA 5CMMA 1Q35A 3SESA 1N7WA 3I5OA 5ITPA 3S9MC 4ELQA 1B3LA 3OXNA 1XT8A 4U4SA 1NL5A 2RC9A 1FJ9A 3IOVA 3FV1A 3M3FA 3CFXA 4E0WA 3KOTA 3RQTA 4H46A 2H4IA 1B2HA 2DWIA 4GWYA 5I7IA 2ZNSA 2PCRA 3FXRA 1NUYA 5ESYA 2VD2A 1FBHA 4RYAA 5DW8A 4KD5A 4NF6A 4DCXA 2X7PA 4EQBA 4XKNA 3KC1A 3HHFA 1A55A 4ESWA 4PDHA 2XA5A 4YMBA 3MW0A 2H99A 1B5IA 2F3DA 3TTMA 4GWXA 5TP9A 4HXVA 4YMAA 4O7MA 1SPIA 2PFZA 3MVZA 4PAIA 5I57B 4I9DA 1SBPA 1T0KA 3DP4A 4F2QA 4N17A 4IGTA 1NV5A 1YXIA 5L9OA 1A54A 4QFKA 4L17A 1D9QA 3RTFB 4TLLB 4IO3A 3CG3A 1BTJA 3CSBA 3H6VA 1DPPA 4OTEA 1SI0A 3MZ9A 2OJTA 3G3JA 3OO8A 1B7HA 3ZKKA 3H3GA 5FBPA 3C9HA 1KWHA 4Q30B 4RA1A 4OFJA 2Y7RA 5I5PA 3U92A 1CE2A 1FQEA 3TPAA 2I0BA 1DCUA 4P9KA 2F7BA 3TFLA 4OEUA 1IXGA 3QIMA 2OX3A 4DI4B 2QS4A 3ODBA 2REGA 1H76A 3PMVA 3SZPA 1MPCA 3VLVA 3MPLA 5EQ8A 4ISUA 1URGA 4M4GA 3G3IA 1Y1ZA 2VOZA 5CRYA 5I58A 3CVGA 5CMKA 3C33A 3EHSA 1UTHA 2RC8A 1Q9DA 4KXPA 3G3KA 2ANJA 5TP9B 2ZYKA 2XHDA 2WBBA 4GIZA 4JVDA 1DTZA 3O9PA 3T22A 4LVQA 3FVGA 3LC8A 4F3GA 1NH8A 4JWXA 3U8QA 2ZNUA 1JETA 4NF6B 1OVBA 3T93B 5ISUA 2BJJX 1JEVA 4JVIA 4THIA 2I48A 1O7TA 3C34A 3LSXA 1IMEA 4PCDA 4ZZEA 5L9MA 2F7AA 3RPLB 4GLIA 1N84A 1QVSA 2XX8A 1OQGA 5AA2B 4X9TA 1LAFE 1JEUA 1XS5A 2MKZA 4GD5A 1G0HA 1B6HA 3T96B 3UK4A 4MNIA 3K6WA 4JDFA 5HM4B 3TCHA 5F24A 3FXBA 5CI5A 5I2KA 5A5XB 3TTNA 4O3BA 4I8CA 2QRYA 1B58A 1MM7A 4FIMA 2XWIA 1Y1MA 2KQZA 5T3JA 4YKKA 1MQIA 3EHTA 4OENA 1NV2A 4ZE9A 2OWSA 3T9UA 1OVTA 2ZNTA 1MXZA 4FJPA 3FZVA 1FPJA 4XKRA 3DP8A 3OEKA 3A09A 4UABA 3ILTB 1LGBC 4F3BA 3T9VA 3H6WA 1FPDA 2GQ1A 4H45A 3VLWA 5DEXB 4MLQA 1LBCA 4LA9A 2FA7A 3B50A 4RJZA 2Z23A 4FEBA 2A5SA 4RK9A 2H25A 4OFLA 4NGUA 3MUQA 4LQ5A 5DVIA 3G3FA 4MNCA 3TTKA 5IM2A 1KA1A 4OESA 4YICA 5EHMA 3S9NC 1XVXA 1USYE 1DMBA 4O8MA 4EQ9A 1O64A 4ZEDA 4G4PA 4PBQA 1GGGA 5FHNA 3WAEA 1NI9A 1SW2A 4LZ5A 4H8JA 2F7CA 4YKIA 3KBRA 1IITA 1B5HA 4XKPA 3HPIA 2V25A 4OYVA 1NH7A 3UGWA 2VPNA 5IKBA 5IZ3A 1URSA 4GBWA 3U94A 4HW8A 4N8YA 4G68B 1NUXA 4LUBA 1FTJA 3N94A 4QXDA 2Q8JA 4PQJA 4AQ4A 4OVPA 1DOTA 1P1WA 4OXVA 1VSOA 4H0WA 2QMXA 1GTKA 4LATA 4MX6A 4NHBA 3SEXA 3HFUA 4FECA 4NF8B 2Y7IA 1QUKA 3CFLA 1MM6A 3EPEA 4BDOA 4MNPA 3VE1B 2X26A 4FORA 2D5WA 4C1UA 1B3EA 5JTYB 3RNNA 3D4CA 1FQAA 1FTAA 5JK4A 1G0IA 2AL4A 5AE4A 2B4LA 2XXXA 1AOVA 3MP8A 5A5LA 3G3GA 4QSCA 1LB9A 4GX3A 2XD3A 1VE4A 3PUVE 3RTWB 5HBCA 2CEXA 2NXOA 4N4UA 5IZZA 1N3WA 1NV0A 3FV2A 4R2FA 4NF5A 4GQOA 1LFIA 2HHMA 2DYXA 5ET8A 1MY1A 5TPAA 3IX1A 4U1OA 3RPWA 3OD7A 4ZEIA 2H9BA 4H5GA 1N7XA 2GHBA 2YPNA 1MPBA 1OMPA 2PT2A 1MDQA 3FJ7A 4YU0A 5DYHA 5DVJA 3USDA 2VHAA 3IB2A 1S7YA 1TWYA 2VP1A 1K9YA 3NOHA 3U65A 1RYOA 2XD2A 4BDRA 4QFOA 3QSLA 3QAXA 4NN3A 3EF7A 4KHZE 2I0CA 1FRPA 2IEEA 3G7WA 2QS1A 3M3KA 3SEWA 4IO2A 3MC2A 3CHGA 4RXLA 3ILUB 4LZ7A 3FUZA 1D9YA 4NWCA 5F7VA 3KGCA 1VDWA 2WX9A 3MWBA 1RKMA 3OENA 4OWDA 3DM0A 4RK2A 1QGXA 3TCFA 5K2XA 4GL0A 3PUWE 3OMBA 4KYDA 3D1RA 3QYTA 5JTYA 1N0TA 2AIXA 3IOTA 2JJKA 4IO6A 2F36A 1Y9UA 1MXUA 1BIYA 2AL5A 4PF8A 4BDQA 1P99A 2XX9A 3LUZA 1MXXA 4F2OA 2V93A 1HSEA 1Y20A 4EQ7A 4F1VA 4NAPA 3K1NA 2HCAA 1FBGA 1PEBA 3GBBA 4P3LA 1NUZA 4POXA 3R7XA 1MQDA 1NV1A 1FPEA 2V3QA 4N81A 2I4CA 3KBZA 4MAGA 4R75A 4BDNA 2HQ0A 1SI1A 3FJGA 3FVNA 4YZZA 1RDZA 2B3BA 4X1BA 1NMUA 4NE4A 2D21A 1PB9A 2DWHA 4C1TA 1S9TA 3L6HA 4MHFA 1FPIA 2ONSA 4QFPA 3KC0A 4G8HA 4O7IA 2M8CA 1YYZA 1B0HA 2VPOA 4NF4B 1MQHA 1AMFA 2FNCA 1MRPA 2DVCA 4JWOA 2QVUA 5M2VA 3LR1A 5LDZA 3PUZE 1ZKBA 2I58A 3SEUA 5J1DA 3HHGA 4ZZAA 5DEXA 3LSFB 2XXRA 2R6GE 2Z8EA 4HE0A 4R73A 3GZGA 1SQYA 3BIGA 3R6UA 1ZIUA 1B5JA 3H7MA 2GRVA 2ZZWA 1IXIA 4GX4A 4OEVA 3TQLA 2I49A 3L6GA 5H8QA 1LCTA 3KG2A 4POWA 2ONKE 3O66A 2OLBA 1UQWA 1M5DA 1FBFA 1OLCA 3PV0E 4XTCQ 1M5CA 5TU0A 4ZE8A 2GFEA 2Q89A 3RLFE 5DT6A 1DK4A 1SW4A 2OK2A 1B3FA 5H8QB 2FHYA 3K1MA 2NUVA 3KZGA 4OMBA 1B9JA 1LFGA 1POTA 4PFRA 3THIA 1NNTA 2RKMA 2XXKA 4YB5A 1CNQA 2O1LA 3Q29A 3UN6A 2RC7A 3FATA 2F6GA 2QFLA 3W15C 3I6VA 1MY2A 3VXCA 3MYUA 3MSTA 4ZDMA 4DXUA 3BFUA 1MDP1 3UIFA 4EDPA 3BKIB 4KPTA 4DCYA 4N91A 1FTLA 4LQ2A 2VT5A 2BJIA 4H67A 3VXBA 4NF8A 4KYSA 1FQDA 3PTYA 1VFEA 2DE3A 3M3LA 1SYHA 3FXUA 1B4HA 4DXCA 4BDMA 4E0XA 1FJ6A 4TOZA 1LAXA 4YB6A 4IGRA 3UP9A 3V89B 3TEPA 3MVWA 1B46A 2QMWA 3C4MA 1IXHA 1A40A 2PX1A 4GOTA 3IFAA 2Y84A 1MXYA 3PPNA 2V84A 2D3IA 3KJ7A 4H1XA 1LAHE 1LBZA 1QW0A 3O2AA 1M5EA 3I3VA 4Z7EA 3C31A 4R6YA 4EUOA 1TFAA 2XWKA 3T66A 1B40A 2DXYA 5LOMA 1VR5A 4XFEA 1NKXA 2DDKA 5H8FB 4DDDA 3ROJA 3SEYA 3E3KA 1LB8A 1IMCA 2DE4A 4N07A 2Z22A 1P1NA 4P1EA 1M5BA 3OO6A 4AS5A 4XEQA 1ZU0A 4Q8RA 2R8TA 4ONYA 3H6TA 1FQBA 3HN0A 1IXCA 4LZ8A 3U1OA 4WKMA 2QS2A 2ABHA 5I2NA 1POY1 1MQJA 3N26A 3IORA 3HCQA 4P1LA 5I3SA 1M5FA 1MXWA 5AA4B 2DOJA 4R2BA 3T9XB 1ZJLA 4F29A 4JSDA 2UYFA 2HZKA 4P0IA 1F9BA 1KZ8A 4AB5A 3GXAA 4GWZA 3K6VA 3D4GA 5FTHA 4QHQA 4GF8A 3S9LC 1DSNA 1QUIA 2LAOA 4AS4A 3TUSA 3KN3A 2WEFA 4HCWA 2UVGA 1MY0A 3RPLA 4NF5B 1P1UA 3CG1A 2OWZA 1I6AA 4HCYA 1RDYA 3DP6A 3KFMA 2UYEA 3DLNA 3TKDA 5CBRA 4KFQA 1FPFA 3PGFA 5IZ1A 1LBBA 2Q9TA 3B6QA 4FAJA 4O3AA 3ZKLA 5I58B 4EF2A 5I2KB 2L5VA 1N76A 3LUYA 1UTBB 3GYYA 4RNSA 3N6TA 3E13X 5EQAA 1B0LA 4PF6A 1SDXA 4Q0CA 4GFRA 4F39A 2OCUA 4X48A 3K01A 3PUXE 4F1YA 4G68A 3K0VA 1Z7NE 1B3HA 5DVFA 1WDNA 3S4UA 2ZMBA 4ZEKA 2AYSA 1FTMA 3TTRA 3K00A 4IO5A 4HS7A 3CSGA 4U1ZA 2XXQA 1S50A 3B8BA 4EXLA 2NWJA 3K6UA 4K3FA 1DBZA 4GX6A 5K2YA 4LP2B 2GH9A 1PBQA 1LBYA 1IMDA 1B05A 3IR1A 5IZ3B 2QVRA 2OBGA 5BUUA 4NEDA 4BDLA 2DVZA 1R9QA
chains in the Genus database with same CATH topology
1MXXA 1OLAA 4F2OA 1FQCA 3OELA 1PDAA 2V93A 1HSEA 3MPKA 4IGTA 4G68C 4QRZA 4PFYA 1A99A 4U23A 1Y20A 3FASA 5L9OA 1A54A 4QFKA 1EZPA 1A8EA 2H98A 4GXSB 3RT8A 4EQ7A 4F1VA 5KDTB 4L17A 3RTFB 3KEIA 4TLLB 3K1NA 3N5LA 1Q1KA 2R71A 3OO9A 4IO3A 2HCAA 3CG3A 1BTJA 4QFNA 5JEIA 2QJEA 1PEBA 3CSBA 3H6UA 3GBBA 3H6VA 1ZLQA 4ND9A 4OVJA 1L5TA 1DPPA 4OTEA 4POXA 4YKPA 4IO7A 1MQDA 3R7XA 3ZS6A 2V3QA 2NOOA 2CZLA 4MFIA 1SI0A 2I4CA 3HV1A 3MZ9A 4R75A 2OJTA 4BDNA 5I84A 1NNKA 2HQ0A 3G3JA 3OO8A 5H8NB 1B7HA 2A5TB 3ZKKA 2HAVA 3H3GA 1SI1A 5CMBA 3ONMA 5I59B 2DS9A 3FJGA 3FVNA 4HTGA 4YZZA 3C9HA 1KWHA 2XXWA 4Q30B 4OFJA 2Y7RA 4RA1A 2B3BA 5H8FA 4X1BA 1NMUA 3IOUA 3U92A 1AH5A 1CE2A 1FQEA 5F1QA 4N6PA 2OZZA 1FW0A 1B3GA 4NE4A 2UVIA 4ZEFA 3TPAA 2D21A 2E0SA 2I0BA 1SD3A 4IB2A 2UVHA 4R72A 1PB9A 2DWHA 4C1TA 4JXIA 1P1QA 4QSEA 1S9TA 2X7QA 5H8HA 3L6HA 2ZXTA 3Q26A 3JV9A 4X1DA 2F7BA 5CM6A 3TFLA 2ONSA 2RINA 4QFPA 4OEUA 2I3VA 1IXGA 1TXFA 1SVXB 4G8HA 2M8CA 3OSQA 3QIMA 5L8DA 1B0HA 4GXAA 2DSFA 4NF4B 4EF1A 1US4A 2QS4A 1MQHA 3UORA 2ESNA 1AMFA 3PMWA 2W7YA 1B7ZA 1MRPA 2FNCA 3GBAA 2DVCA 2HXWA 1J1NA 3ODBA 4JWOA 5BWJA 4DIGA 2REGA 2H5YA 5M2VA 3LR1A 1H76A 3PMVA 5AA2A 3PUYE 4XKQA 2QSXA 1MPCA 3VLVA 3TYHA 4U22A 3MPLA 3BBRA 3PUZE 4OHNA 5I57A 1ZKBA 1B51A 1OQHA 3E9XA 2O68A 2XXHA 3KOSA 4ISUA 1URGA 4M4GA 4DE8A 2I58A 3B6TA 1Y1ZA 2VOZA 3G3IA 5CRYA 3TQWA 4OERA 5I58A 5KCJA 3SEUA 1ZMGA 5J1DA 1OIBA 1WODA 3HHGA 4ZZAA 1Y3PA 2IA4A 2V3TA 3CVGA 5DEXA 3LSFB 3MVXA 1MQGA 3MQ9A 1QKAA 2XXRA 5CMKA 3C33A 4RY1A 1LLSA 3EHSA 3HSTA 1UTHA 2RCAA 3W9VA 2R6GE 4LONB 2RC8A 2Z8EA 2ZYNA 4YKJA 1SYIA 4R73A 3GZGA 3RT6B 1MG1A 1SQYA 2HZLA 3FGSA 3G3HA 3R6UA 3G3KA 1ZIUA 3LBSA 1B5JA 1MH3A 3H7MA 2ANJA 5TP9B 5TPAB 2B3FA 2ZYKA 2GRVA 4MH5A 4F31B 2XHDA 1IXIA 4OEVA 1MY3A 4ELPA 4TLMB 4GIZA 4AB6A 3TQLA 2I49A 3L6GA 5H8QA 2QL3A 1XHYA 2Z8FA 1DTZA 2NVUB 3O9PA 2UXAA 1LCTA 3T22A 4F3PA 1B52A 3KN8A 3KG2A 3FVGA 3O29A 2O69A 3QUJA 4LVQA 4POWA 2ONKE 4Z0IA 3O66A 3IK6B 2DXRA 1JVYA 2OLBA 1LCFA 3LC8A 3MZBA 2XXUA 2O84X 3H03A 2THIA 2Y7WA 1NH8A 3MP1A 1UQWA 4F3GA 5I56B 1M5DA 2DWJA 4JWXA 3FD3A 3U8QA 3UA8A 2UVJA 1MS7A 2ZNUA 2ZYMA 3MVYA 1OLCA 3LSLA 3CR9A 3PV0E 1JETA 1M5CA 4NF6B 4XTCQ 5FHMA 5TU0A 1OVBA 3ECRA 3T93B 5ISUA 4NWDA 2BJJX 1JEVA 4THIA 2I48A 2Q2AA 4ZE8A 1O7TA 3A3UA 3C34A 3LSXA 4EXKA 1H43A 2GFEA 4H5FA 3IB1A 5L9SA 3EQ1A 2Q89A 3RLFE 2PT1A 3B7DA 5DT6A 4JB7A 4OFOA 2O6AA 1NNPA 1SW4A 3MP6A 3KSXA 4R6HA 4ZZEA 4U2RA 5L9MA 1I6QA 2F7AA 2OK2A 1B3FA 1ZTYA 2YJPA 5H8QB 3K1MA 2NUVA 3KZGA 4OMBA 1B9JA 1LFGA 1POTA 3LSWA 4PFWA 3CIJA 4PFUA 4GLIA 3THIA 1N84A 1ELJA 1QVSA 2XX8A 1NNTA 1OQGA 2RKMA 3TAJA 4X9TA 5AA2B 1LAFE 1H45A 1JEUA 2O7IA 1FQFA 1XVYA 2VD3A 4JWYA 4YB5A 3RUMA 1XC1A 2O1LA 3Q29A 3UN6A 1WVJA 1XS5A 2F6GA 1ZBMA 2RC7A 3CFZA 3FATA 5DTBA 2PMSA 1B1XA 3I6VA 3W15C 1MY2A 4GD5A 1IEJA 4G2ZA 4XXUA 1B6HA 4NMYA 3VXCA 2YLNA 4GL8A 4ZDMA 4F22A 1D9VA 3T96B 1YTVA 4DXUA 3Q25A 1MXVA 1QKBA 4R9GA 4WEPA 3K6WA 4JDFA 5FTIA 3TCHA 3BFUA 3UK4A 1MDP1 5CI5A 3UIFA 5HM4B 5A5XB 4F1UA 3TTNA 4O3BA 5I2KA 5I56A 1D3KA 4MF3A 2V3UA 1JW4A 2QRYA 4I8CA 1B58A 3BKIB 1MM7A 3QK6A 4FIMA 4G8NA 4KPTA 3VVEA 4DCYA 1FTLA 3IJOB 4LQ2A 1Y1MA 2F97A 1IZ1A 4YKKA 1MQIA 2QS3A 3EHTA 2DE2A 3V8XB 4OENA 4EDPA 4H67A 3VXBA 4NF8A 4ZE9A 2G93A 4KYSA 2OWSA 1ANFA 1FQDA 1FTKA 1VFEA 1I69A 2QPQA 3O6GA 3T9UA 1OVTA 2ZNTA 3JZJA 2DE3A 3W9WA 1AIVA 1MXZA 3PPPA 4FJPA 3SDFA 3SETA 3O28A 1MH4A 3FZVA 3P7IA 4XKRA 1URDA 1I6BA 1TFDA 3M3LA 3DP8A 3TELA 3U72A 4F18A 1MY4A 1B7UA 4C0RA 1SYHA 3FXUA 3OEKA 3A09A 2I4BA 1B4HA 3R26A 3ILTB 1LGBC 4IY6A 4YAHX 4DXCA 4F3BA 5I2NB 3T9VA 2ONRA 4BDMA 3H6WA 3MJNA 4E0XA 3SEVA 4TOZA 1LAXA 3VLWA 3FIRA 5AA3A 1JW1A 1NNFA 5DEXB 4MLQA 2HAUA 1LBCA 4I1DA 2FA7A 3IB0A 4IGRA 4LA9A 2Z23A 4N13A 4FEBA 4RJZA 3UP9A 3VDFA 2A5SA 4RK9A 3PPQA 5AA1A 3V89B 3TEPA 1R9LA 3MVWA 1B46A 2QMWA 2XXVA 2H25A 3C4MA 4OFLA 5ICQA 1IXHA 4KR5A 1A40A 2PX1A 3MUQA 4GOTA 3CRBA 2Y84A 4H65A 1MXYA 1Y3QA 3PPNA 4LQ5A 3MZ1A 5DVIA 3G3FA 3Q27A 5ELVA 3IO4A 4TQUQ 2XXIA 3TTKA 2V84A 2D3IA 1B1HA 4OESA 2P1SA 3KJ7A 4H1XA 2R9JA 4U4XA 1XVXA 4YICA 5EHMA 1USYE 1GVCA 3S9NC 2PVUA 1LAHE 2ZYOA 1DMBA 1CB6A 4H8IA 1QW0A 3FJMA 4EQ9A 2FYIA 1O64A 4ZEDA 4G4PA 4UA8A 3PPOA 3VVDA 3O2AA 1M5EA 1GGGA 2WKYA 3C36A 2DP8A 3I3VA 3C31A 4JBZA 4R6YA 3O97A 4Z7EA 4EUOA 1SW5A 1Y4CA 2ALUA 1RYXA 1TFAA 5FHNA 3WAEA 3SERA 3BFTA 4MBPA 3T66A 1A8FA 4OETA 1R6ZA 2O1MA 1NFTA 1B40A 1SW2A 2DXYA 3DELB 4H8JA 4LZ5A 5LOMA 1VR5A 4GRKA 4GVOA 2F7CA 1B4ZA 1NKXA 4BLAA 1DTGA 4DDDA 5H8FB 3VFJA 1BP5A 3K1PA 2XX7A 4NTLA 4YKIA 3KBRA 3E3KA 3SEYA 2B65A 1LB8A 1IITA 3IL1B 1B5HA 2Z8DA 3M8UA 3IOWA 1LFHA 5IAIA 4GWOA 2OWTA 3S9EA 1H3DA 2DE4A 2F35A 4KCCA 4XKPA 4N07A 3HPIA 4ZS9A 1N04A 1YAEA 2KLFA 1NH7A 1AL3A 1P1NA 2V25A 2Z22A 3OSRA 4OYVA 3UGWA 5KCJB 3PD9A 1M5BA 5IKBA 4IO4A 1URSA 1EZ9A 3OO6A 1UIVA 4MLVA 4R9FA 1ZU0A 2F34A 4Q8RA 3U94A 3O6HA 4ONYA 4HW8A 3GLBA 3H6TA 4P0GA 5I59A 4G68B 4LUBA 1FQBA 3HN0A 1IXCA 1FTJA 4LZ8A 4R74A 4WKMA 3N94A 3U1OA 3VV5A 2QS2A 2ABHA 4KQPA 2Q8JA 2G29A 4PQJA 4AQ4A 5I2NA 1POY1 1QULA 1DOTA 5CBSA 1MQJA 1P1WA 2Y7KA 3C32A 3IORA 3MAMA 2F6PA 3N26A 3VLUA 1O63A 2XXTA 2PBWA 4OXVA 1VSOA 3HCQA 5B7DA 1M5FA 4O3CA 1MXWA 4H0WA 2QMXA 1GTKA 1JVXA 4FE8A 4DXBA 4F3SA 1FTOA 4LATA 5AA4B 2DOJA 4R2BA 3SEXA 3T9XB 1ZJLA 2XXYA 1JQFA 4FECA 5ICTA 3PD8A 3TMGA 4F29A 4JSDA 5KZTA 4NF8B 2Y7IA 1QUKA 3CFLA 3RY3A 4ELRA 1USYH 2RCBA 3O6IA 2UYFA 1MM6A 2HZKA 3EPEA 4BDOA 4P0IA 1F9BA 4FEDA 4RPOA 5H8HB 3VE1B 4AB5A 3FVOA 3GXAA 3WAFA 4ELOA 1MPDA 2X26A 2F78A 3K6VA 3D4GA 3QUFA 4FORA 2P2AA 2D5WA 4YB7A 3A3CA 4QHQA 5FTHA 4C1UA 1B3EA 4KCDA 5JTYB 3V5AA 1PBPA 3RNNA 4PETA 1PC3A 2O51A 3D4CA 3K02A 4Q5TA 2F5XA 1EH3A 1FQAA 4GF8A 2AL4A 5JK4A 4NF4A 5AE4A 2CMOA 1LSTA 2XXXA 3S2VA 1AOVA 3MP8A 3S9LC 2I6EA 4I62A 3Q28A 3G3GA 3C35A 1LB9A 1DSNA 4QSCA 3TDJA 1PB8A 4JSOA 1JW5A 1VFDA 3OOAA 1QUIA 2LAOA 3HO7A 4G77A 4DZ1A 3TUSA 3KN7A 5ITOA 2XD3A 3SKPA 3IO6A 4DLDA 3KN3A 4XIGQ 2VGQA 3TCGA 1VE4A 3PPRA 4HCWA 2UVGA 1MY0A 3PUVE 3JYRA 4U21A 1UIUA 4NF5B 1UTBA 3RTWB 5HBCA 4QSDA 1EZOA 1QUJA 1JNFA 1B32A 1XOCA 1P1UA 2NXOA 3IAZA 2HFBA 1N3WA 2I3WA 2Q88A 3RN8A 3CG1A 3FV2A 4ESXA 4R6KA 4R2FA 2PYYA 4GQOA 4NF5A 3RGYA 1BKAA 1LFIA 3K2DA 1I6AA 4HCYA 2DYXA 4PE5B 1MY1A 3U93A 5TPAA 4F19A 3IX1A 4U1OA 3DP6A 3KFMA 3RPWA 2UYEA 1IQ7A 1IIWA 3OD7A 4G8MA 3F11A 1R1NA 3QXMA 3DLNA 1P1OA 4H6DA 4ZEIA 2H9BA 4H5GA 1N7XA 2GHBA 2YPNA 3TKDA 1MPBA 1OMPA 3AXFA 4KYEA 5CBRA 4KFQA 2PT2A 1MDQA 3FJ7A 3PGFA 4YU0A 5DYHA 5EYFA 3K4UA 3OO7A 5DVJA 1UTHB 3E4RA 1Y4TA 1GV8A 3EHUA 3T9HB 3USDA 4ZECA 1LBBA 2Q9TA 3B6QA 5H8NA 3ZSFA 4FAJA 2VHAA 4O3AA 1Z7ME 3IB2A 3ZKLA 1DPEA 2O7UA 4EF2A 5I58B 5A5XA 1S7YA 3H06B 5I2KB 3B6WA 3FVKA 1N76A 4WEDA 5FHOA 3LUYA 1QJMA 1TWYA 1A7LA 1UTBB 2VP1A 5AA2D 1ATGA 2REJA 5KDTA 1RYOA 3N6TA 2XD2A 1TT1A 4RNSA 4BDRA 4QFOA 3N6UA 3QAXA 3QSLA 1HSLA 4M1VA 1LAGE 4UACA 1BLFA 5CMMA 2HEUA 4ECFA 1Q35A 2Y7PA 1Y3NA 3EF7A 3SESA 4KHZE 2I0CA 3E13X 5CC2A 5B70A 1N7WA 1B0LA 3I5OA 1SDXA 3TODA 4PP0A 4Q0CA 4FATA 4GFRA 4F39A 5ITPA 2IEEA 3S9MC 3G7WA 2QS1A 3M3KA 2OCUA 1II5A 1B3LA 3OXNA 4ELQA 3K01A 1XT8A 4U4SA 1NL5A 4X48A 1FCKA 3PUXE 3MC2A 4IO2A 5H8SA 3SEWA 1YPNA 2RC9A 4F1YA 4RXLA 1SW1A 3IOVA 3FV1A 3M3FA 3CFXA 1IUDA 3OEMA 3KOTA 3PU5A 1YCJA 4G68A 3TZAA 3RQTA 4E0WA 1GR2A 3K0VA 3ILUB 2H4IA 4LZ7A 1B2HA 1B3HA 1Z7NE 3CI8A 3FUZA 1D9YA 2DWIA 4NWCA 1WDNA 2ZNSA 4WXJA 5DVFA 2A5TA 4YB6A 5F7VA 3S4UA 2ZMBA 3FXRA 4QFLA 2VD2A 3KGCA 3PMXA 4RPNA 2P0SA 4RYAA 3MWBA 4KD5A 4NF6A 4DCXA 3H4ZA 2X7PA 4PFTA 4ZEKA 1PB7A 5EHSA 2AYSA 4QF9A 1FTMA 2DQVA 4XKNA 4EQBA 3EN3A 5AA4A 1EU8A 3FXQA 1RKMA 1A55A 2XXPA 3HHFA 3OENA 4OWDA 3TTRA 1HSJA 3DM0A 4P11A 4RK2A 3K00A 4OQOA 1N3XA 4ESWA 3TCFA 4YMBA 4IO5A 4GL0A 5K2XA 4HS7A 1D4NA 3CSGA 4ZEBA 1US5A 3MW0A 4U1ZA 2XXQA 1S50A 2H99A 3TTLA 3PUWE 2F8DA 1B5IA 2DWAA 3OMBA 4KYDA 3MBPA 1H44A 3QYTA 4EXLA 2NWJA 2GHAA 3K6UA 4K3FA 4IY5A 5JTYA 2E1SA 1N0TA 5K2YA 3TTMA 2AIXA 3IOTA 4LP2B 5TP9A 4KI0E 2GH9A 1PBQA 2Q2CA 4YMAA 3V83A 4IO6A 1B05A 3IR1A 3IJXB 5HPQA 2F36A 3MVZA 1Y9UA 3VVFA 5I57B 2OBGA 4I9DA 5BUUA 1SBPA 4NEDA 1MXUA 1T0KA 1BIYA 3DP4A 3KJTA 5CMCA 4BDLA 2DVZA 4OZ9A 2AL5A 1R9QA 4BDQA 4F2QA 1P99A 2XX9A 3K6XA 2RF1A 3KSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MXX A;  1OLA A;  4F2O A;  1FQC A;  3OEL A;  1PDA A;  2V93 A;  1HSE A;  3MPK A;  4IGT A;  4G68 C;  4QRZ A;  4PFY A;  1A99 A;  4U23 A;  1Y20 A;  3FAS A;  5L9O A;  1A54 A;  4QFK A;  1EZP A;  1A8E A;  2H98 A;  4GXS B;  3RT8 A;  4EQ7 A;  4F1V A;  5KDT B;  4L17 A;  3RTF B;  3KEI A;  4TLL B;  3K1N A;  3N5L A;  1Q1K A;  2R71 A;  3OO9 A;  4IO3 A;  2HCA A;  3CG3 A;  1BTJ A;  4QFN A;  5JEI A;  2QJE A;  1PEB A;  3CSB A;  3H6U A;  3GBB A;  3H6V A;  1ZLQ A;  4ND9 A;  4OVJ A;  1L5T A;  1DPP A;  4OTE A;  4POX A;  4YKP A;  4IO7 A;  1MQD A;  3R7X A;  3ZS6 A;  2V3Q A;  2NOO A;  2CZL A;  4MFI A;  1SI0 A;  2I4C A;  3HV1 A;  3MZ9 A;  4R75 A;  2OJT A;  4BDN A;  5I84 A;  1NNK A;  2HQ0 A;  3G3J A;  3OO8 A;  5H8N B;  1B7H A;  2A5T B;  3ZKK A;  2HAV A;  3H3G A;  1SI1 A;  5CMB A;  3ONM A;  5I59 B;  2DS9 A;  3FJG A;  3FVN A;  4HTG A;  4YZZ A;  3C9H A;  1KWH A;  2XXW A;  4Q30 B;  4OFJ A;  2Y7R A;  4RA1 A;  2B3B A;  5H8F A;  4X1B A;  1NMU A;  3IOU A;  3U92 A;  1AH5 A;  1CE2 A;  1FQE A;  5F1Q A;  4N6P A;  2OZZ A;  1FW0 A;  1B3G A;  4NE4 A;  2UVI A;  4ZEF A;  3TPA A;  2D21 A;  2E0S A;  2I0B A;  1SD3 A;  4IB2 A;  2UVH A;  4R72 A;  1PB9 A;  2DWH A;  4C1T A;  4JXI A;  1P1Q A;  4QSE A;  1S9T A;  2X7Q A;  5H8H A;  3L6H A;  2ZXT A;  3Q26 A;  3JV9 A;  4X1D A;  2F7B A;  5CM6 A;  3TFL A;  2ONS A;  2RIN A;  4QFP A;  4OEU A;  2I3V A;  1IXG A;  1TXF A;  1SVX B;  4G8H A;  2M8C A;  3OSQ A;  3QIM A;  5L8D A;  1B0H A;  4GXA A;  2DSF A;  4NF4 B;  4EF1 A;  1US4 A;  2QS4 A;  1MQH A;  3UOR A;  2ESN A;  1AMF A;  3PMW A;  2W7Y A;  1B7Z A;  1MRP A;  2FNC A;  3GBA A;  2DVC A;  2HXW A;  1J1N A;  3ODB A;  4JWO A;  5BWJ A;  4DIG A;  2REG A;  2H5Y A;  5M2V A;  3LR1 A;  1H76 A;  3PMV A;  5AA2 A;  3PUY E;  4XKQ A;  2QSX A;  1MPC A;  3VLV A;  3TYH A;  4U22 A;  3MPL A;  3BBR A;  3PUZ E;  4OHN A;  5I57 A;  1ZKB A;  1B51 A;  1OQH A;  3E9X A;  2O68 A;  2XXH A;  3KOS A;  4ISU A;  1URG A;  4M4G A;  4DE8 A;  2I58 A;  3B6T A;  1Y1Z A;  2VOZ A;  3G3I A;  5CRY A;  3TQW A;  4OER A;  5I58 A;  5KCJ A;  3SEU A;  1ZMG A;  5J1D A;  1OIB A;  1WOD A;  3HHG A;  4ZZA A;  1Y3P A;  2IA4 A;  2V3T A;  3CVG A;  5DEX A;  3LSF B;  3MVX A;  1MQG A;  3MQ9 A;  1QKA A;  2XXR A;  5CMK A;  3C33 A;  4RY1 A;  1LLS A;  3EHS A;  3HST A;  1UTH A;  2RCA A;  3W9V A;  2R6G E;  4LON B;  2RC8 A;  2Z8E A;  2ZYN A;  4YKJ A;  1SYI A;  4R73 A;  3GZG A;  3RT6 B;  1MG1 A;  1SQY A;  2HZL A;  3FGS A;  3G3H A;  3R6U A;  3G3K A;  1ZIU A;  3LBS A;  1B5J A;  1MH3 A;  3H7M A;  2ANJ A;  5TP9 B;  5TPA B;  2B3F A;  2ZYK A;  2GRV A;  4MH5 A;  4F31 B;  2XHD A;  1IXI A;  4OEV A;  1MY3 A;  4ELP A;  4TLM B;  4GIZ A;  4AB6 A;  3TQL A;  2I49 A;  3L6G A;  5H8Q A;  2QL3 A;  1XHY A;  2Z8F A;  1DTZ A;  2NVU B;  3O9P A;  2UXA A;  1LCT A;  3T22 A;  4F3P A;  1B52 A;  3KN8 A;  3KG2 A;  3FVG A;  3O29 A;  2O69 A;  3QUJ A;  4LVQ A;  4POW A;  2ONK E;  4Z0I A;  3O66 A;  3IK6 B;  2DXR A;  1JVY A;  2OLB A;  1LCF A;  3LC8 A;  3MZB A;  2XXU A;  2O84 X;  3H03 A;  2THI A;  2Y7W A;  1NH8 A;  3MP1 A;  1UQW A;  4F3G A;  5I56 B;  1M5D A;  2DWJ A;  4JWX A;  3FD3 A;  3U8Q A;  3UA8 A;  2UVJ A;  1MS7 A;  2ZNU A;  2ZYM A;  3MVY A;  1OLC A;  3LSL A;  3CR9 A;  3PV0 E;  1JET A;  1M5C A;  4NF6 B;  4XTC Q;  5FHM A;  5TU0 A;  1OVB A;  3ECR A;  3T93 B;  5ISU A;  4NWD A;  2BJJ X;  1JEV A;  4THI A;  2I48 A;  2Q2A A;  4ZE8 A;  1O7T A;  3A3U A;  3C34 A;  3LSX A;  4EXK A;  1H43 A;  2GFE A;  4H5F A;  3IB1 A;  5L9S A;  3EQ1 A;  2Q89 A;  3RLF E;  2PT1 A;  3B7D A;  5DT6 A;  4JB7 A;  4OFO A;  2O6A A;  1NNP A;  1SW4 A;  3MP6 A;  3KSX A;  4R6H A;  4ZZE A;  4U2R A;  5L9M A;  1I6Q A;  2F7A A;  2OK2 A;  1B3F A;  1ZTY A;  2YJP A;  5H8Q B;  3K1M A;  2NUV A;  3KZG A;  4OMB A;  1B9J A;  1LFG A;  1POT A;  3LSW A;  4PFW A;  3CIJ A;  4PFU A;  4GLI A;  3THI A;  1N84 A;  1ELJ A;  1QVS A;  2XX8 A;  1NNT A;  1OQG A;  2RKM A;  3TAJ A;  4X9T A;  5AA2 B;  1LAF E;  1H45 A;  1JEU A;  2O7I A;  1FQF A;  1XVY A;  2VD3 A;  4JWY A;  4YB5 A;  3RUM A;  1XC1 A;  2O1L A;  3Q29 A;  3UN6 A;  1WVJ A;  1XS5 A;  2F6G A;  1ZBM A;  2RC7 A;  3CFZ A;  3FAT A;  5DTB A;  2PMS A;  1B1X A;  3I6V A;  3W15 C;  1MY2 A;  4GD5 A;  1IEJ A;  4G2Z A;  4XXU A;  1B6H A;  4NMY A;  3VXC A;  2YLN A;  4GL8 A;  4ZDM A;  4F22 A;  1D9V A;  3T96 B;  1YTV A;  4DXU A;  3Q25 A;  1MXV A;  1QKB A;  4R9G A;  4WEP A;  3K6W A;  4JDF A;  5FTI A;  3TCH A;  3BFU A;  3UK4 A;  1MDP 1;  5CI5 A;  3UIF A;  5HM4 B;  5A5X B;  4F1U A;  3TTN A;  4O3B A;  5I2K A;  5I56 A;  1D3K A;  4MF3 A;  2V3U A;  1JW4 A;  2QRY A;  4I8C A;  1B58 A;  3BKI B;  1MM7 A;  3QK6 A;  4FIM A;  4G8N A;  4KPT A;  3VVE A;  4DCY A;  1FTL A;  3IJO B;  4LQ2 A;  1Y1M A;  2F97 A;  1IZ1 A;  4YKK A;  1MQI A;  2QS3 A;  3EHT A;  2DE2 A;  3V8X B;  4OEN A;  4EDP A;  4H67 A;  3VXB A;  4NF8 A;  4ZE9 A;  2G93 A;  4KYS A;  2OWS A;  1ANF A;  1FQD A;  1FTK A;  1VFE A;  1I69 A;  2QPQ A;  3O6G A;  3T9U A;  1OVT A;  2ZNT A;  3JZJ A;  2DE3 A;  3W9W A;  1AIV A;  1MXZ A;  3PPP A;  4FJP A;  3SDF A;  3SET A;  3O28 A;  1MH4 A;  3FZV A;  3P7I A;  4XKR A;  1URD A;  1I6B A;  1TFD A;  3M3L A;  3DP8 A;  3TEL A;  3U72 A;  4F18 A;  1MY4 A;  1B7U A;  4C0R A;  1SYH A;  3FXU A;  3OEK A;  3A09 A;  2I4B A;  1B4H A;  3R26 A;  3ILT B;  1LGB C;  4IY6 A;  4YAH X;  4DXC A;  4F3B A;  5I2N B;  3T9V A;  2ONR A;  4BDM A;  3H6W A;  3MJN A;  4E0X A;  3SEV A;  4TOZ A;  1LAX A;  3VLW A;  3FIR A;  5AA3 A;  1JW1 A;  1NNF A;  5DEX B;  4MLQ A;  2HAU A;  1LBC A;  4I1D A;  2FA7 A;  3IB0 A;  4IGR A;  4LA9 A;  2Z23 A;  4N13 A;  4FEB A;  4RJZ A;  3UP9 A;  3VDF A;  2A5S A;  4RK9 A;  3PPQ A;  5AA1 A;  3V89 B;  3TEP A;  1R9L A;  3MVW A;  1B46 A;  2QMW A;  2XXV A;  2H25 A;  3C4M A;  4OFL A;  5ICQ A;  1IXH A;  4KR5 A;  1A40 A;  2PX1 A;  3MUQ A;  4GOT A;  3CRB A;  2Y84 A;  4H65 A;  1MXY A;  1Y3Q A;  3PPN A;  4LQ5 A;  3MZ1 A;  5DVI A;  3G3F A;  3Q27 A;  5ELV A;  3IO4 A;  4TQU Q;  2XXI A;  3TTK A;  2V84 A;  2D3I A;  1B1H A;  4OES A;  2P1S A;  3KJ7 A;  4H1X A;  2R9J A;  4U4X A;  1XVX A;  4YIC A;  5EHM A;  1USY E;  1GVC A;  3S9N C;  2PVU A;  1LAH E;  2ZYO A;  1DMB A;  1CB6 A;  4H8I A;  1QW0 A;  3FJM A;  4EQ9 A;  2FYI A;  1O64 A;  4ZED A;  4G4P A;  4UA8 A;  3PPO A;  3VVD A;  3O2A A;  1M5E A;  1GGG A;  2WKY A;  3C36 A;  2DP8 A;  3I3V A;  3C31 A;  4JBZ A;  4R6Y A;  3O97 A;  4Z7E A;  4EUO A;  1SW5 A;  1Y4C A;  2ALU A;  1RYX A;  1TFA A;  5FHN A;  3WAE A;  3SER A;  3BFT A;  4MBP A;  3T66 A;  1A8F A;  4OET A;  1R6Z A;  2O1M A;  1NFT A;  1B40 A;  1SW2 A;  2DXY A;  3DEL B;  4H8J A;  4LZ5 A;  5LOM A;  1VR5 A;  4GRK A;  4GVO A;  2F7C A;  1B4Z A;  1NKX A;  4BLA A;  1DTG A;  4DDD A;  5H8F B;  3VFJ A;  1BP5 A;  3K1P A;  2XX7 A;  4NTL A;  4YKI A;  3KBR A;  3E3K A;  3SEY A;  2B65 A;  1LB8 A;  1IIT A;  3IL1 B;  1B5H A;  2Z8D A;  3M8U A;  3IOW A;  1LFH A;  5IAI A;  4GWO A;  2OWT A;  3S9E A;  1H3D A;  2DE4 A;  2F35 A;  4KCC A;  4XKP A;  4N07 A;  3HPI A;  4ZS9 A;  1N04 A;  1YAE A;  2KLF A;  1NH7 A;  1AL3 A;  1P1N A;  2V25 A;  2Z22 A;  3OSR A;  4OYV A;  3UGW A;  5KCJ B;  3PD9 A;  1M5B A;  5IKB A;  4IO4 A;  1URS A;  1EZ9 A;  3OO6 A;  1UIV A;  4MLV A;  4R9F A;  1ZU0 A;  2F34 A;  4Q8R A;  3U94 A;  3O6H A;  4ONY A;  4HW8 A;  3GLB A;  3H6T A;  4P0G A;  5I59 A;  4G68 B;  4LUB A;  1FQB A;  3HN0 A;  1IXC A;  1FTJ A;  4LZ8 A;  4R74 A;  4WKM A;  3N94 A;  3U1O A;  3VV5 A;  2QS2 A;  2ABH A;  4KQP A;  2Q8J A;  2G29 A;  4PQJ A;  4AQ4 A;  5I2N A;  1POY 1;  1QUL A;  1DOT A;  5CBS A;  1MQJ A;  1P1W A;  2Y7K A;  3C32 A;  3IOR A;  3MAM A;  2F6P A;  3N26 A;  3VLU A;  1O63 A;  2XXT A;  2PBW A;  4OXV A;  1VSO A;  3HCQ A;  5B7D A;  1M5F A;  4O3C A;  1MXW A;  4H0W A;  2QMX A;  1GTK A;  1JVX A;  4FE8 A;  4DXB A;  4F3S A;  1FTO A;  4LAT A;  5AA4 B;  2DOJ A;  4R2B A;  3SEX A;  3T9X B;  1ZJL A;  2XXY A;  1JQF A;  4FEC A;  5ICT A;  3PD8 A;  3TMG A;  4F29 A;  4JSD A;  5KZT A;  4NF8 B;  2Y7I A;  1QUK A;  3CFL A;  3RY3 A;  4ELR A;  1USY H;  2RCB A;  3O6I A;  2UYF A;  1MM6 A;  2HZK A;  3EPE A;  4BDO A;  4P0I A;  1F9B A;  4FED A;  4RPO A;  5H8H B;  3VE1 B;  4AB5 A;  3FVO A;  3GXA A;  3WAF A;  4ELO A;  1MPD A;  2X26 A;  2F78 A;  3K6V A;  3D4G A;  3QUF A;  4FOR A;  2P2A A;  2D5W A;  4YB7 A;  3A3C A;  4QHQ A;  5FTH A;  4C1U A;  1B3E A;  4KCD A;  5JTY B;  3V5A A;  1PBP A;  3RNN A;  4PET A;  1PC3 A;  2O51 A;  3D4C A;  3K02 A;  4Q5T A;  2F5X A;  1EH3 A;  1FQA A;  4GF8 A;  2AL4 A;  5JK4 A;  4NF4 A;  5AE4 A;  2CMO A;  1LST A;  2XXX A;  3S2V A;  1AOV A;  3MP8 A;  3S9L C;  2I6E A;  4I62 A;  3Q28 A;  3G3G A;  3C35 A;  1LB9 A;  1DSN A;  4QSC A;  3TDJ A;  1PB8 A;  4JSO A;  1JW5 A;  1VFD A;  3OOA A;  1QUI A;  2LAO A;  3HO7 A;  4G77 A;  4DZ1 A;  3TUS A;  3KN7 A;  5ITO A;  2XD3 A;  3SKP A;  3IO6 A;  4DLD A;  3KN3 A;  4XIG Q;  2VGQ A;  3TCG A;  1VE4 A;  3PPR A;  4HCW A;  2UVG A;  1MY0 A;  3PUV E;  3JYR A;  4U21 A;  1UIU A;  4NF5 B;  1UTB A;  3RTW B;  5HBC A;  4QSD A;  1EZO A;  1QUJ A;  1JNF A;  1B32 A;  1XOC A;  1P1U A;  2NXO A;  3IAZ A;  2HFB A;  1N3W A;  2I3W A;  2Q88 A;  3RN8 A;  3CG1 A;  3FV2 A;  4ESX A;  4R6K A;  4R2F A;  2PYY A;  4GQO A;  4NF5 A;  3RGY A;  1BKA A;  1LFI A;  3K2D A;  1I6A A;  4HCY A;  2DYX A;  4PE5 B;  1MY1 A;  3U93 A;  5TPA A;  4F19 A;  3IX1 A;  4U1O A;  3DP6 A;  3KFM A;  3RPW A;  2UYE A;  1IQ7 A;  1IIW A;  3OD7 A;  4G8M A;  3F11 A;  1R1N A;  3QXM A;  3DLN A;  1P1O A;  4H6D A;  4ZEI A;  2H9B A;  4H5G A;  1N7X A;  2GHB A;  2YPN A;  3TKD A;  1MPB A;  1OMP A;  3AXF A;  4KYE A;  5CBR A;  4KFQ A;  2PT2 A;  1MDQ A;  3FJ7 A;  3PGF A;  4YU0 A;  5DYH A;  5EYF A;  3K4U A;  3OO7 A;  5DVJ A;  1UTH B;  3E4R A;  1Y4T A;  1GV8 A;  3EHU A;  3T9H B;  3USD A;  4ZEC A;  1LBB A;  2Q9T A;  3B6Q A;  5H8N A;  3ZSF A;  4FAJ A;  2VHA A;  4O3A A;  1Z7M E;  3IB2 A;  3ZKL A;  1DPE A;  2O7U A;  4EF2 A;  5I58 B;  5A5X A;  1S7Y A;  3H06 B;  5I2K B;  3B6W A;  3FVK A;  1N76 A;  4WED A;  5FHO A;  3LUY A;  1QJM A;  1TWY A;  1A7L A;  1UTB B;  2VP1 A;  5AA2 D;  1ATG A;  2REJ A;  5KDT A;  1RYO A;  3N6T A;  2XD2 A;  1TT1 A;  4RNS A;  4BDR A;  4QFO A;  3N6U A;  3QAX A;  3QSL A;  1HSL A;  4M1V A;  1LAG E;  4UAC A;  1BLF A;  5CMM A;  2HEU A;  4ECF A;  1Q35 A;  2Y7P A;  1Y3N A;  3EF7 A;  3SES A;  4KHZ E;  2I0C A;  3E13 X;  5CC2 A;  5B70 A;  1N7W A;  1B0L A;  3I5O A;  1SDX A;  3TOD A;  4PP0 A;  4Q0C A;  4FAT A;  4GFR A;  4F39 A;  5ITP A;  2IEE A;  3S9M C;  3G7W A;  2QS1 A;  3M3K A;  2OCU A;  1II5 A;  1B3L A;  3OXN A;  4ELQ A;  3K01 A;  1XT8 A;  4U4S A;  1NL5 A;  4X48 A;  1FCK A;  3PUX E;  3MC2 A;  4IO2 A;  5H8S A;  3SEW A;  1YPN A;  2RC9 A;  4F1Y A;  4RXL A;  1SW1 A;  3IOV A;  3FV1 A;  3M3F A;  3CFX A;  1IUD A;  3OEM A;  3KOT A;  3PU5 A;  1YCJ A;  4G68 A;  3TZA A;  3RQT A;  4E0W A;  1GR2 A;  3K0V A;  3ILU B;  2H4I A;  4LZ7 A;  1B2H A;  1B3H A;  1Z7N E;  3CI8 A;  3FUZ A;  1D9Y A;  2DWI A;  4NWC A;  1WDN A;  2ZNS A;  4WXJ A;  5DVF A;  2A5T A;  4YB6 A;  5F7V A;  3S4U A;  2ZMB A;  3FXR A;  4QFL A;  2VD2 A;  3KGC A;  3PMX A;  4RPN A;  2P0S A;  4RYA A;  3MWB A;  4KD5 A;  4NF6 A;  4DCX A;  3H4Z A;  2X7P A;  4PFT A;  4ZEK A;  1PB7 A;  5EHS A;  2AYS A;  4QF9 A;  1FTM A;  2DQV A;  4XKN A;  4EQB A;  3EN3 A;  5AA4 A;  1EU8 A;  3FXQ A;  1RKM A;  1A55 A;  2XXP A;  3HHF A;  3OEN A;  4OWD A;  3TTR A;  1HSJ A;  3DM0 A;  4P11 A;  4RK2 A;  3K00 A;  4OQO A;  1N3X A;  4ESW A;  3TCF A;  4YMB A;  4IO5 A;  4GL0 A;  5K2X A;  4HS7 A;  1D4N A;  3CSG A;  4ZEB A;  1US5 A;  3MW0 A;  4U1Z A;  2XXQ A;  1S50 A;  2H99 A;  3TTL A;  3PUW E;  2F8D A;  1B5I A;  2DWA A;  3OMB A;  4KYD A;  3MBP A;  1H44 A;  3QYT A;  4EXL A;  2NWJ A;  2GHA A;  3K6U A;  4K3F A;  4IY5 A;  5JTY A;  2E1S A;  1N0T A;  5K2Y A;  3TTM A;  2AIX A;  3IOT A;  4LP2 B;  5TP9 A;  4KI0 E;  2GH9 A;  1PBQ A;  2Q2C A;  4YMA A;  3V83 A;  4IO6 A;  1B05 A;  3IR1 A;  3IJX B;  5HPQ A;  2F36 A;  3MVZ A;  1Y9U A;  3VVF A;  5I57 B;  2OBG A;  4I9D A;  5BUU A;  1SBP A;  4NED A;  1MXU A;  1T0K A;  1BIY A;  3DP4 A;  3KJT A;  5CMC A;  4BDL A;  2DVZ A;  4OZ9 A;  2AL5 A;  1R9Q A;  4BDQ A;  4F2Q A;  1P99 A;  2XX9 A;  3K6X A;  2RF1 A;  3KSJ A; 
#chains in the Genus database with same CATH topology
 5IGA A;  1OLA A;  3OEL A;  1PDA A;  4LN5 A;  4G68 C;  2H98 A;  4GXS B;  3RT8 A;  5KDT B;  4X8R A;  3OO9 A;  1FPB A;  3H6U A;  4OVQ A;  1ZLQ A;  4ND9 A;  4OVJ A;  4I40 A;  1L5T A;  4IO7 A;  3ZS6 A;  4MFI A;  3HV1 A;  5ET5 A;  5I84 A;  1NNK A;  2A5T B;  2HAV A;  1LBW A;  5CMB A;  3ONM A;  5I59 B;  2XXW A;  5H8F A;  3IOU A;  2FIE A;  4N6P A;  2OZZ A;  1FW0 A;  1B3G A;  1KA0 A;  2UVI A;  4ZEF A;  2E0S A;  2UVH A;  4QSE A;  4GWW A;  2ZXT A;  4X1D A;  1FPG A;  5CM6 A;  2ZZV A;  2I3V A;  3OSQ A;  4OAN A;  5L8D A;  4GXA A;  2DSF A;  3PMW A;  2W7Y A;  1B7Z A;  3GBA A;  1J1N A;  4G61 A;  2H5Y A;  3FBP A;  5AA2 A;  4U22 A;  1B51 A;  1OQH A;  3E9X A;  2V4C A;  5KCJ A;  3TQW A;  4OER A;  1OIB A;  2IA4 A;  1QKA A;  2CZI A;  2RCA A;  5EYH A;  4LON B;  1SYI A;  3FGS A;  3LBS A;  4P47 A;  4F31 B;  1MY3 A;  4AB6 A;  2Z8F A;  4F3P A;  4XF5 A;  3O29 A;  2O69 A;  4Z0I A;  3IK6 B;  2B4M A;  1LCF A;  2O84 X;  4P8B A;  2THI A;  2Y7W A;  3FD3 A;  2UVJ A;  1MS7 A;  3MVY A;  2ZYM A;  3LSL A;  5FHM A;  3ECR A;  4PFB A;  1FPK A;  1FBD A;  4NWD A;  3A3U A;  4EXK A;  1H43 A;  4OVS A;  3IB1 A;  4JB7 A;  4OFO A;  1NNP A;  4MCO A;  4R6H A;  1I6Q A;  1ZTY A;  2YJP A;  4PFU A;  1H45 A;  2O7I A;  1FQF A;  1XVY A;  1XC1 A;  4X04 A;  1WVJ A;  5DTB A;  1FBE A;  1IEJ A;  4G2Z A;  4NMY A;  4GL8 A;  4MIJ A;  1D9V A;  4F22 A;  2HPG A;  3Q25 A;  1MXV A;  4WEP A;  5I56 A;  1D3K A;  4MF3 A;  2V3U A;  1JW4 A;  4G8N A;  4DI3 D;  2CZK A;  3VVE A;  4PAK A;  2QS3 A;  3V8X B;  1ANF A;  2QPQ A;  3O6G A;  1AIV A;  3W9W A;  3PPP A;  3SDF A;  3O28 A;  1MH4 A;  3P7I A;  1TFD A;  3U72 A;  4F18 A;  1MY4 A;  1B7U A;  2Q8M A;  4C0R A;  3R26 A;  5I2N B;  1JW1 A;  1NNF A;  4NG7 A;  4I1D A;  3IB0 A;  4OA4 A;  4KR5 A;  4MMP A;  4PTK A;  1IMA A;  3MZ1 A;  5EQ9 A;  5ELV A;  1B1H A;  2P1S A;  1GVC A;  1JP4 A;  2ZYO A;  3FJM A;  4PDD A;  4UA8 A;  3C36 A;  2DP8 A;  1SW5 A;  2ALU A;  4NF0 A;  1RYX A;  3SER A;  3BFT A;  1A8F A;  4N15 A;  4GVO A;  1B4Z A;  1DTG A;  3VFJ A;  3K1P A;  4NTL A;  4PAF A;  3IL1 B;  3M8U A;  3IOW A;  1LFH A;  5IAI A;  3S9E A;  2OWT A;  2F35 A;  4KCC A;  1EYJ A;  2KLF A;  1YAE A;  5KCJ B;  3PD9 A;  4HE1 A;  4IO4 A;  4IR8 A;  4MLV A;  1FBP A;  4R9F A;  3O6H A;  3GLB A;  4KQP A;  2G29 A;  1NV4 A;  2Y7K A;  3C32 A;  1O63 A;  2PBW A;  1FTO A;  2XXY A;  2ZZX A;  5ICT A;  3PD8 A;  5KZT A;  4I3E A;  1USY H;  2RCB A;  3ISP A;  4RPO A;  3FVO A;  1MPD A;  2KR0 A;  4YB7 A;  4KCD A;  2Y5L A;  4Q5T A;  2F5X A;  1LST A;  4I62 A;  3C35 A;  3TDJ A;  4JSO A;  1JW5 A;  3RYD A;  4G77 A;  5ITO A;  3IO6 A;  2VGQ A;  3PPR A;  2XWV A;  1UIU A;  1UTB A;  4QSD A;  1JNF A;  3IAZ A;  3RN8 A;  2I3W A;  4R6K A;  2PYY A;  3RGY A;  1FBC A;  4PE5 B;  3U93 A;  4F19 A;  4FBP A;  1IQ7 A;  4G8M A;  1R1N A;  3QXM A;  1P1O A;  4H6D A;  3EKI A;  2WYP A;  3AXF A;  4KYE A;  5EYF A;  3E4R A;  1GV8 A;  3T9H B;  2Q74 A;  4NQ8 A;  1Z7M E;  1DPE A;  5J16 A;  3H06 B;  4N6D A;  5FHO A;  1QJM A;  5KDT A;  1A7L A;  5AA2 D;  1ATG A;  4N6K A;  1TT1 A;  3N6U A;  1LAG E;  4UAC A;  1BLF A;  2HEU A;  2Y7P A;  1Y3N A;  4NX1 A;  5CC2 A;  5B70 A;  3TOD A;  4PP0 A;  4FAT A;  1II5 A;  2HXR A;  1LBV A;  1BK4 A;  1FCK A;  5H8S A;  1YPN A;  4OVT A;  1SW1 A;  1IUD A;  1K9Z A;  3OEM A;  3PU5 A;  1YCJ A;  3TZA A;  1GR2 A;  2PFY A;  3CI8 A;  4WXJ A;  5H8H A;  2A5T A;  4QFL A;  3PMX A;  3IFC A;  4RPN A;  2P0S A;  1FSA A;  4GWS A;  3H4Z A;  4PFT A;  2CEY A;  1PB7 A;  5EHS A;  4QF9 A;  5AA4 A;  2DQV A;  3EN3 A;  1EU8 A;  3FXQ A;  3LV0 A;  2XXP A;  4PGN A;  1HSJ A;  4P11 A;  4OQO A;  1N3X A;  1D4N A;  4ZEB A;  1US5 A;  2F8D A;  2DWA A;  3MBP A;  1H44 A;  2GHA A;  4IY5 A;  2E1S A;  4KI0 E;  2Q2C A;  3V83 A;  5HPQ A;  3A29 A;  3IJX B;  5LTC A;  3VVF A;  3KJT A;  5CMC A;  4OZ9 A;  3K6X A;  2RF1 A;  3KSJ A;  1FQC A;  3MPK A;  4QRZ A;  4PFY A;  1A99 A;  4U23 A;  3FAS A;  1EZP A;  1A8E A;  4PE3 A;  3KEI A;  4GWU A;  3N5L A;  1Q1K A;  2R71 A;  4QFN A;  3T1B A;  5JEI A;  2QJE A;  1AWB A;  4YKP A;  2NOO A;  2CZL A;  4OVR A;  5H8N B;  5EQ7 A;  2DS9 A;  3E79 A;  4HTG A;  2CZH A;  1AH5 A;  5F1Q A;  4P56 A;  4IB2 A;  1SD3 A;  4R72 A;  2WBD A;  4JXI A;  1P1Q A;  2X7Q A;  3Q26 A;  3JV9 A;  2RIN A;  1TXF A;  1SVX B;  1NUW A;  4EF1 A;  1US4 A;  3UOR A;  2ESN A;  1FPL A;  2HXW A;  5BWJ A;  4DIG A;  3PUY E;  4XKQ A;  2QSX A;  3TYH A;  5I57 A;  3BBR A;  4OHN A;  1IMB A;  1YZ0 A;  2O68 A;  2XXH A;  3KOS A;  4DE8 A;  3B6T A;  1ZMG A;  1WOD A;  1Y3P A;  2V3T A;  3MVX A;  1MQG A;  3MQ9 A;  4RY1 A;  1LLS A;  3HST A;  3W9V A;  2ZYN A;  4YKJ A;  3RT6 B;  2FIX A;  1MG1 A;  1RDX A;  2HZL A;  3T0J A;  4PBH A;  3G3H A;  1MH3 A;  5TPA B;  2B3F A;  4MH5 A;  4ELP A;  4TLM B;  2QL3 A;  1XHY A;  2NVU B;  2UXA A;  1B52 A;  3KN8 A;  3S2V A;  3QUJ A;  1INP A;  2DXR A;  1JVY A;  3MZB A;  2XXU A;  3H03 A;  1LBX A;  3MP1 A;  4MJO A;  5I56 B;  2DWJ A;  3UA8 A;  1NV7 A;  2FVZ A;  3CR9 A;  2Q2A A;  2FBP A;  4H5F A;  2WYK A;  5L9S A;  3EQ1 A;  2PT1 A;  3B7D A;  2O6A A;  3MP6 A;  3KSX A;  4U2R A;  4PFW A;  3LSW A;  1XI6 A;  3CIJ A;  1ELJ A;  3TAJ A;  4PGP A;  2VD3 A;  4JWY A;  3RUM A;  3CFZ A;  1ZBM A;  4JVC A;  2PMS A;  1B1X A;  2Y5K A;  4XXU A;  4PC9 A;  2YLN A;  1YTV A;  5FTI A;  1QKB A;  4R9G A;  4F1U A;  3QK6 A;  3IJO B;  2F97 A;  1IZ1 A;  2DE2 A;  2G93 A;  1FTK A;  3TTL A;  1I69 A;  2QVV A;  3JZJ A;  5ET6 A;  5ET7 A;  3SET A;  1URD A;  1I6B A;  2I4B A;  4IY6 A;  4YAH X;  2ONR A;  2F3B A;  3MJN A;  3SEV A;  3FIR A;  5AA3 A;  4QBA A;  2HAU A;  3VDF A;  4N13 A;  3PPQ A;  5AA1 A;  1R9L A;  2XXV A;  5ICQ A;  4HE2 A;  3CRB A;  4H65 A;  1Y3Q A;  3E78 A;  3Q27 A;  3IO4 A;  4TQU Q;  2XXI A;  1NV6 A;  4U4X A;  2R9J A;  3BIH A;  2PVU A;  4GBV A;  1CB6 A;  4H8I A;  2FYI A;  3VVD A;  3PPO A;  2WKY A;  4JBZ A;  3O97 A;  1Y4C A;  4MBP A;  4OET A;  1R6Z A;  2O1M A;  1NFT A;  2P3V A;  3DEL B;  4GRK A;  4BLA A;  1BP5 A;  2XX7 A;  1IMF A;  2B65 A;  2Z8D A;  4GWO A;  1H3D A;  4ZS9 A;  1N04 A;  1AL3 A;  3OSR A;  1NV3 A;  1EZ9 A;  1UIV A;  2F34 A;  5EYG A;  4N8G A;  1EYI A;  4P0G A;  5I59 A;  4R74 A;  3VV5 A;  1QUL A;  5CBS A;  3VLU A;  3MAM A;  2F6P A;  2XXT A;  4I3Y A;  5B7D A;  4O3C A;  4F3S A;  1JVX A;  4FE8 A;  4DXB A;  1JQF A;  3TMG A;  1LEV A;  4ELR A;  3RY3 A;  3O6I A;  5H8H B;  4FED A;  3WAF A;  4ELO A;  2F78 A;  3QUF A;  2P2A A;  3A3C A;  3V5A A;  1PBP A;  4PET A;  1PC3 A;  2O51 A;  3K02 A;  1EH3 A;  4NF4 A;  2CMO A;  2I6E A;  3Q28 A;  1PB8 A;  1VFD A;  3OOA A;  3HO7 A;  4DZ1 A;  3KN7 A;  3SKP A;  4DLD A;  4XIG Q;  3TCG A;  1EYK A;  3JYR A;  4U21 A;  1EZO A;  1QUJ A;  1B32 A;  3TEL A;  1XOC A;  4O94 A;  2HFB A;  2Q88 A;  4ESX A;  1BKA A;  2P3N A;  3K2D A;  2XWO A;  1IIW A;  3F11 A;  3QMF A;  3K4U A;  3OO7 A;  1UTH B;  1Y4T A;  3EHU A;  4ZEC A;  5H8N A;  3ZSF A;  2O7U A;  5A5X A;  3B6W A;  3FVK A;  4WED A;  4PFI A;  2REJ A;  4MEV A;  4ECF A;  1HSL A;  4M1V A;  5CMM A;  1Q35 A;  3SES A;  1N7W A;  3I5O A;  5ITP A;  3S9M C;  4ELQ A;  1B3L A;  3OXN A;  1XT8 A;  4U4S A;  1NL5 A;  2RC9 A;  1FJ9 A;  3IOV A;  3FV1 A;  3M3F A;  3CFX A;  4E0W A;  3KOT A;  3RQT A;  4H46 A;  2H4I A;  1B2H A;  2DWI A;  4GWY A;  5I7I A;  2ZNS A;  2PCR A;  3FXR A;  1NUY A;  5ESY A;  2VD2 A;  1FBH A;  4RYA A;  5DW8 A;  4KD5 A;  4NF6 A;  4DCX A;  2X7P A;  4EQB A;  4XKN A;  3KC1 A;  3HHF A;  1A55 A;  4ESW A;  4PDH A;  2XA5 A;  4YMB A;  3MW0 A;  2H99 A;  1B5I A;  2F3D A;  3TTM A;  4GWX A;  5TP9 A;  4HXV A;  4YMA A;  4O7M A;  1SPI A;  2PFZ A;  3MVZ A;  4PAI A;  5I57 B;  4I9D A;  1SBP A;  1T0K A;  3DP4 A;  4F2Q A;  4N17 A;  4IGT A;  1NV5 A;  1YXI A;  5L9O A;  1A54 A;  4QFK A;  4L17 A;  1D9Q A;  3RTF B;  4TLL B;  4IO3 A;  3CG3 A;  1BTJ A;  3CSB A;  3H6V A;  1DPP A;  4OTE A;  1SI0 A;  3MZ9 A;  2OJT A;  3G3J A;  3OO8 A;  1B7H A;  3ZKK A;  3H3G A;  5FBP A;  3C9H A;  1KWH A;  4Q30 B;  4RA1 A;  4OFJ A;  2Y7R A;  5I5P A;  3U92 A;  1CE2 A;  1FQE A;  3TPA A;  2I0B A;  1DCU A;  4P9K A;  2F7B A;  3TFL A;  4OEU A;  1IXG A;  3QIM A;  2OX3 A;  4DI4 B;  2QS4 A;  3ODB A;  2REG A;  1H76 A;  3PMV A;  3SZP A;  1MPC A;  3VLV A;  3MPL A;  5EQ8 A;  4ISU A;  1URG A;  4M4G A;  3G3I A;  1Y1Z A;  2VOZ A;  5CRY A;  5I58 A;  3CVG A;  5CMK A;  3C33 A;  3EHS A;  1UTH A;  2RC8 A;  1Q9D A;  4KXP A;  3G3K A;  2ANJ A;  5TP9 B;  2ZYK A;  2XHD A;  2WBB A;  4GIZ A;  4JVD A;  1DTZ A;  3O9P A;  3T22 A;  4LVQ A;  3FVG A;  3LC8 A;  4F3G A;  1NH8 A;  4JWX A;  3U8Q A;  2ZNU A;  1JET A;  4NF6 B;  1OVB A;  3T93 B;  5ISU A;  2BJJ X;  1JEV A;  4JVI A;  4THI A;  2I48 A;  1O7T A;  3C34 A;  3LSX A;  1IME A;  4PCD A;  4ZZE A;  5L9M A;  2F7A A;  3RPL B;  4GLI A;  1N84 A;  1QVS A;  2XX8 A;  1OQG A;  5AA2 B;  4X9T A;  1LAF E;  1JEU A;  1XS5 A;  2MKZ A;  4GD5 A;  1G0H A;  1B6H A;  3T96 B;  3UK4 A;  4MNI A;  3K6W A;  4JDF A;  5HM4 B;  3TCH A;  5F24 A;  3FXB A;  5CI5 A;  5I2K A;  5A5X B;  3TTN A;  4O3B A;  4I8C A;  2QRY A;  1B58 A;  1MM7 A;  4FIM A;  2XWI A;  1Y1M A;  2KQZ A;  5T3J A;  4YKK A;  1MQI A;  3EHT A;  4OEN A;  1NV2 A;  4ZE9 A;  2OWS A;  3T9U A;  1OVT A;  2ZNT A;  1MXZ A;  4FJP A;  3FZV A;  1FPJ A;  4XKR A;  3DP8 A;  3OEK A;  3A09 A;  4UAB A;  3ILT B;  1LGB C;  4F3B A;  3T9V A;  3H6W A;  1FPD A;  2GQ1 A;  4H45 A;  3VLW A;  5DEX B;  4MLQ A;  1LBC A;  4LA9 A;  2FA7 A;  3B50 A;  4RJZ A;  2Z23 A;  4FEB A;  2A5S A;  4RK9 A;  2H25 A;  4OFL A;  4NGU A;  3MUQ A;  4LQ5 A;  5DVI A;  3G3F A;  4MNC A;  3TTK A;  5IM2 A;  1KA1 A;  4OES A;  4YIC A;  5EHM A;  3S9N C;  1XVX A;  1USY E;  1DMB A;  4O8M A;  4EQ9 A;  1O64 A;  4ZED A;  4G4P A;  4PBQ A;  1GGG A;  5FHN A;  3WAE A;  1NI9 A;  1SW2 A;  4LZ5 A;  4H8J A;  2F7C A;  4YKI A;  3KBR A;  1IIT A;  1B5H A;  4XKP A;  3HPI A;  2V25 A;  4OYV A;  1NH7 A;  3UGW A;  2VPN A;  5IKB A;  5IZ3 A;  1URS A;  4GBW A;  3U94 A;  4HW8 A;  4N8Y A;  4G68 B;  1NUX A;  4LUB A;  1FTJ A;  3N94 A;  4QXD A;  2Q8J A;  4PQJ A;  4AQ4 A;  4OVP A;  1DOT A;  1P1W A;  4OXV A;  1VSO A;  4H0W A;  2QMX A;  1GTK A;  4LAT A;  4MX6 A;  4NHB A;  3SEX A;  3HFU A;  4FEC A;  4NF8 B;  2Y7I A;  1QUK A;  3CFL A;  1MM6 A;  3EPE A;  4BDO A;  4MNP A;  3VE1 B;  2X26 A;  4FOR A;  2D5W A;  4C1U A;  1B3E A;  5JTY B;  3RNN A;  3D4C A;  1FQA A;  1FTA A;  5JK4 A;  1G0I A;  2AL4 A;  5AE4 A;  2B4L A;  2XXX A;  1AOV A;  3MP8 A;  5A5L A;  3G3G A;  4QSC A;  1LB9 A;  4GX3 A;  2XD3 A;  1VE4 A;  3PUV E;  3RTW B;  5HBC A;  2CEX A;  2NXO A;  4N4U A;  5IZZ A;  1N3W A;  1NV0 A;  3FV2 A;  4R2F A;  4NF5 A;  4GQO A;  1LFI A;  2HHM A;  2DYX A;  5ET8 A;  1MY1 A;  5TPA A;  3IX1 A;  4U1O A;  3RPW A;  3OD7 A;  4ZEI A;  2H9B A;  4H5G A;  1N7X A;  2GHB A;  2YPN A;  1MPB A;  1OMP A;  2PT2 A;  1MDQ A;  3FJ7 A;  4YU0 A;  5DYH A;  5DVJ A;  3USD A;  2VHA A;  3IB2 A;  1S7Y A;  1TWY A;  2VP1 A;  1K9Y A;  3NOH A;  3U65 A;  1RYO A;  2XD2 A;  4BDR A;  4QFO A;  3QSL A;  3QAX A;  4NN3 A;  3EF7 A;  4KHZ E;  2I0C A;  1FRP A;  2IEE A;  3G7W A;  2QS1 A;  3M3K A;  3SEW A;  4IO2 A;  3MC2 A;  3CHG A;  4RXL A;  3ILU B;  4LZ7 A;  3FUZ A;  1D9Y A;  4NWC A;  5F7V A;  3KGC A;  1VDW A;  2WX9 A;  3MWB A;  1RKM A;  3OEN A;  4OWD A;  3DM0 A;  4RK2 A;  1QGX A;  3TCF A;  5K2X A;  4GL0 A;  3PUW E;  3OMB A;  4KYD A;  3D1R A;  3QYT A;  5JTY A;  1N0T A;  2AIX A;  3IOT A;  2JJK A;  4IO6 A;  2F36 A;  1Y9U A;  1MXU A;  1BIY A;  2AL5 A;  4PF8 A;  4BDQ A;  1P99 A;  2XX9 A;  3LUZ A;  1MXX A;  4F2O A;  2V93 A;  1HSE A;  1Y20 A;  4EQ7 A;  4F1V A;  4NAP A;  3K1N A;  2HCA A;  1FBG A;  1PEB A;  3GBB A;  4P3L A;  1NUZ A;  4POX A;  3R7X A;  1MQD A;  1NV1 A;  1FPE A;  2V3Q A;  4N81 A;  2I4C A;  3KBZ A;  4MAG A;  4R75 A;  4BDN A;  2HQ0 A;  1SI1 A;  3FJG A;  3FVN A;  4YZZ A;  1RDZ A;  2B3B A;  4X1B A;  1NMU A;  4NE4 A;  2D21 A;  1PB9 A;  2DWH A;  4C1T A;  1S9T A;  3L6H A;  4MHF A;  1FPI A;  2ONS A;  4QFP A;  3KC0 A;  4G8H A;  4O7I A;  2M8C A;  1YYZ A;  1B0H A;  2VPO A;  4NF4 B;  1MQH A;  1AMF A;  2FNC A;  1MRP A;  2DVC A;  4JWO A;  2QVU A;  5M2V A;  3LR1 A;  5LDZ A;  3PUZ E;  1ZKB A;  2I58 A;  3SEU A;  5J1D A;  3HHG A;  4ZZA A;  5DEX A;  3LSF B;  2XXR A;  2R6G E;  2Z8E A;  4HE0 A;  4R73 A;  3GZG A;  1SQY A;  3BIG A;  3R6U A;  1ZIU A;  1B5J A;  3H7M A;  2GRV A;  2ZZW A;  1IXI A;  4GX4 A;  4OEV A;  3TQL A;  2I49 A;  3L6G A;  5H8Q A;  1LCT A;  3KG2 A;  4POW A;  2ONK E;  3O66 A;  2OLB A;  1UQW A;  1M5D A;  1FBF A;  1OLC A;  3PV0 E;  4XTC Q;  1M5C A;  5TU0 A;  4ZE8 A;  2GFE A;  2Q89 A;  3RLF E;  5DT6 A;  1DK4 A;  1SW4 A;  2OK2 A;  1B3F A;  5H8Q B;  2FHY A;  3K1M A;  2NUV A;  3KZG A;  4OMB A;  1B9J A;  1LFG A;  1POT A;  4PFR A;  3THI A;  1NNT A;  2RKM A;  2XXK A;  4YB5 A;  1CNQ A;  2O1L A;  3Q29 A;  3UN6 A;  2RC7 A;  3FAT A;  2F6G A;  2QFL A;  3W15 C;  3I6V A;  1MY2 A;  3VXC A;  3MYU A;  3MST A;  4ZDM A;  4DXU A;  3BFU A;  1MDP 1;  3UIF A;  4EDP A;  3BKI B;  4KPT A;  4DCY A;  4N91 A;  1FTL A;  4LQ2 A;  2VT5 A;  2BJI A;  4H67 A;  3VXB A;  4NF8 A;  4KYS A;  1FQD A;  3PTY A;  1VFE A;  2DE3 A;  3M3L A;  1SYH A;  3FXU A;  1B4H A;  4DXC A;  4BDM A;  4E0X A;  1FJ6 A;  4TOZ A;  1LAX A;  4YB6 A;  4IGR A;  3UP9 A;  3V89 B;  3TEP A;  3MVW A;  1B46 A;  2QMW A;  3C4M A;  1IXH A;  1A40 A;  2PX1 A;  4GOT A;  3IFA A;  2Y84 A;  1MXY A;  3PPN A;  2V84 A;  2D3I A;  3KJ7 A;  4H1X A;  1LAH E;  1LBZ A;  1QW0 A;  3O2A A;  1M5E A;  3I3V A;  4Z7E A;  3C31 A;  4R6Y A;  4EUO A;  1TFA A;  2XWK A;  3T66 A;  1B40 A;  2DXY A;  5LOM A;  1VR5 A;  4XFE A;  1NKX A;  2DDK A;  5H8F B;  4DDD A;  3ROJ A;  3SEY A;  3E3K A;  1LB8 A;  1IMC A;  2DE4 A;  4N07 A;  2Z22 A;  1P1N A;  4P1E A;  1M5B A;  3OO6 A;  4AS5 A;  4XEQ A;  1ZU0 A;  4Q8R A;  2R8T A;  4ONY A;  3H6T A;  1FQB A;  3HN0 A;  1IXC A;  4LZ8 A;  3U1O A;  4WKM A;  2QS2 A;  2ABH A;  5I2N A;  1POY 1;  1MQJ A;  3N26 A;  3IOR A;  3HCQ A;  4P1L A;  5I3S A;  1M5F A;  1MXW A;  5AA4 B;  2DOJ A;  4R2B A;  3T9X B;  1ZJL A;  4F29 A;  4JSD A;  2UYF A;  2HZK A;  4P0I A;  1F9B A;  1KZ8 A;  4AB5 A;  3GXA A;  4GWZ A;  3K6V A;  3D4G A;  5FTH A;  4QHQ A;  4GF8 A;  3S9L C;  1DSN A;  1QUI A;  2LAO A;  4AS4 A;  3TUS A;  3KN3 A;  2WEF A;  4HCW A;  2UVG A;  1MY0 A;  3RPL A;  4NF5 B;  1P1U A;  3CG1 A;  2OWZ A;  1I6A A;  4HCY A;  1RDY A;  3DP6 A;  3KFM A;  2UYE A;  3DLN A;  3TKD A;  5CBR A;  4KFQ A;  1FPF A;  3PGF A;  5IZ1 A;  1LBB A;  2Q9T A;  3B6Q A;  4FAJ A;  4O3A A;  3ZKL A;  5I58 B;  4EF2 A;  5I2K B;  2L5V A;  1N76 A;  3LUY A;  1UTB B;  3GYY A;  4RNS A;  3N6T A;  3E13 X;  5EQA A;  1B0L A;  4PF6 A;  1SDX A;  4Q0C A;  4GFR A;  4F39 A;  2OCU A;  4X48 A;  3K01 A;  3PUX E;  4F1Y A;  4G68 A;  3K0V A;  1Z7N E;  1B3H A;  5DVF A;  1WDN A;  3S4U A;  2ZMB A;  4ZEK A;  2AYS A;  1FTM A;  3TTR A;  3K00 A;  4IO5 A;  4HS7 A;  3CSG A;  4U1Z A;  2XXQ A;  1S50 A;  3B8B A;  4EXL A;  2NWJ A;  3K6U A;  4K3F A;  1DBZ A;  4GX6 A;  5K2Y A;  4LP2 B;  2GH9 A;  1PBQ A;  1LBY A;  1IMD A;  1B05 A;  3IR1 A;  5IZ3 B;  2QVR A;  2OBG A;  5BUU A;  4NED A;  4BDL A;  2DVZ A;  1R9Q A; 
#chains in the Genus database with same CATH homology
 1MXX A;  1OLA A;  4F2O A;  1FQC A;  3OEL A;  1PDA A;  2V93 A;  1HSE A;  3MPK A;  4IGT A;  4G68 C;  4QRZ A;  4PFY A;  1A99 A;  4U23 A;  1Y20 A;  3FAS A;  5L9O A;  1A54 A;  4QFK A;  1EZP A;  1A8E A;  2H98 A;  4GXS B;  3RT8 A;  4EQ7 A;  4F1V A;  5KDT B;  4L17 A;  3RTF B;  3KEI A;  4TLL B;  3K1N A;  3N5L A;  1Q1K A;  2R71 A;  3OO9 A;  4IO3 A;  2HCA A;  3CG3 A;  1BTJ A;  4QFN A;  5JEI A;  2QJE A;  1PEB A;  3CSB A;  3H6U A;  3GBB A;  3H6V A;  1ZLQ A;  4ND9 A;  4OVJ A;  1L5T A;  1DPP A;  4OTE A;  4POX A;  4YKP A;  4IO7 A;  1MQD A;  3R7X A;  3ZS6 A;  2V3Q A;  2NOO A;  2CZL A;  4MFI A;  1SI0 A;  2I4C A;  3HV1 A;  3MZ9 A;  4R75 A;  2OJT A;  4BDN A;  5I84 A;  1NNK A;  2HQ0 A;  3G3J A;  3OO8 A;  5H8N B;  1B7H A;  2A5T B;  3ZKK A;  2HAV A;  3H3G A;  1SI1 A;  5CMB A;  3ONM A;  5I59 B;  2DS9 A;  3FJG A;  3FVN A;  4HTG A;  4YZZ A;  3C9H A;  1KWH A;  2XXW A;  4Q30 B;  4OFJ A;  2Y7R A;  4RA1 A;  2B3B A;  5H8F A;  4X1B A;  1NMU A;  3IOU A;  3U92 A;  1AH5 A;  1CE2 A;  1FQE A;  5F1Q A;  4N6P A;  2OZZ A;  1FW0 A;  1B3G A;  4NE4 A;  2UVI A;  4ZEF A;  3TPA A;  2D21 A;  2E0S A;  2I0B A;  1SD3 A;  4IB2 A;  2UVH A;  4R72 A;  1PB9 A;  2DWH A;  4C1T A;  4JXI A;  1P1Q A;  4QSE A;  1S9T A;  2X7Q A;  5H8H A;  3L6H A;  2ZXT A;  3Q26 A;  3JV9 A;  4X1D A;  2F7B A;  5CM6 A;  3TFL A;  2ONS A;  2RIN A;  4QFP A;  4OEU A;  2I3V A;  1IXG A;  1TXF A;  1SVX B;  4G8H A;  2M8C A;  3OSQ A;  3QIM A;  5L8D A;  1B0H A;  4GXA A;  2DSF A;  4NF4 B;  4EF1 A;  1US4 A;  2QS4 A;  1MQH A;  3UOR A;  2ESN A;  1AMF A;  3PMW A;  2W7Y A;  1B7Z A;  1MRP A;  2FNC A;  3GBA A;  2DVC A;  2HXW A;  1J1N A;  3ODB A;  4JWO A;  5BWJ A;  4DIG A;  2REG A;  2H5Y A;  5M2V A;  3LR1 A;  1H76 A;  3PMV A;  5AA2 A;  3PUY E;  4XKQ A;  2QSX A;  1MPC A;  3VLV A;  3TYH A;  4U22 A;  3MPL A;  3BBR A;  3PUZ E;  4OHN A;  5I57 A;  1ZKB A;  1B51 A;  1OQH A;  3E9X A;  2O68 A;  2XXH A;  3KOS A;  4ISU A;  1URG A;  4M4G A;  4DE8 A;  2I58 A;  3B6T A;  1Y1Z A;  2VOZ A;  3G3I A;  5CRY A;  3TQW A;  4OER A;  5I58 A;  5KCJ A;  3SEU A;  1ZMG A;  5J1D A;  1OIB A;  1WOD A;  3HHG A;  4ZZA A;  1Y3P A;  2IA4 A;  2V3T A;  3CVG A;  5DEX A;  3LSF B;  3MVX A;  1MQG A;  3MQ9 A;  1QKA A;  2XXR A;  5CMK A;  3C33 A;  4RY1 A;  1LLS A;  3EHS A;  3HST A;  1UTH A;  2RCA A;  3W9V A;  2R6G E;  4LON B;  2RC8 A;  2Z8E A;  2ZYN A;  4YKJ A;  1SYI A;  4R73 A;  3GZG A;  3RT6 B;  1MG1 A;  1SQY A;  2HZL A;  3FGS A;  3G3H A;  3R6U A;  3G3K A;  1ZIU A;  3LBS A;  1B5J A;  1MH3 A;  3H7M A;  2ANJ A;  5TP9 B;  5TPA B;  2B3F A;  2ZYK A;  2GRV A;  4MH5 A;  4F31 B;  2XHD A;  1IXI A;  4OEV A;  1MY3 A;  4ELP A;  4TLM B;  4GIZ A;  4AB6 A;  3TQL A;  2I49 A;  3L6G A;  5H8Q A;  2QL3 A;  1XHY A;  2Z8F A;  1DTZ A;  2NVU B;  3O9P A;  2UXA A;  1LCT A;  3T22 A;  4F3P A;  1B52 A;  3KN8 A;  3KG2 A;  3FVG A;  3O29 A;  2O69 A;  3QUJ A;  4LVQ A;  4POW A;  2ONK E;  4Z0I A;  3O66 A;  3IK6 B;  2DXR A;  1JVY A;  2OLB A;  1LCF A;  3LC8 A;  3MZB A;  2XXU A;  2O84 X;  3H03 A;  2THI A;  2Y7W A;  1NH8 A;  3MP1 A;  1UQW A;  4F3G A;  5I56 B;  1M5D A;  2DWJ A;  4JWX A;  3FD3 A;  3U8Q A;  3UA8 A;  2UVJ A;  1MS7 A;  2ZNU A;  2ZYM A;  3MVY A;  1OLC A;  3LSL A;  3CR9 A;  3PV0 E;  1JET A;  1M5C A;  4NF6 B;  4XTC Q;  5FHM A;  5TU0 A;  1OVB A;  3ECR A;  3T93 B;  5ISU A;  4NWD A;  2BJJ X;  1JEV A;  4THI A;  2I48 A;  2Q2A A;  4ZE8 A;  1O7T A;  3A3U A;  3C34 A;  3LSX A;  4EXK A;  1H43 A;  2GFE A;  4H5F A;  3IB1 A;  5L9S A;  3EQ1 A;  2Q89 A;  3RLF E;  2PT1 A;  3B7D A;  5DT6 A;  4JB7 A;  4OFO A;  2O6A A;  1NNP A;  1SW4 A;  3MP6 A;  3KSX A;  4R6H A;  4ZZE A;  4U2R A;  5L9M A;  1I6Q A;  2F7A A;  2OK2 A;  1B3F A;  1ZTY A;  2YJP A;  5H8Q B;  3K1M A;  2NUV A;  3KZG A;  4OMB A;  1B9J A;  1LFG A;  1POT A;  3LSW A;  4PFW A;  3CIJ A;  4PFU A;  4GLI A;  3THI A;  1N84 A;  1ELJ A;  1QVS A;  2XX8 A;  1NNT A;  1OQG A;  2RKM A;  3TAJ A;  4X9T A;  5AA2 B;  1LAF E;  1H45 A;  1JEU A;  2O7I A;  1FQF A;  1XVY A;  2VD3 A;  4JWY A;  4YB5 A;  3RUM A;  1XC1 A;  2O1L A;  3Q29 A;  3UN6 A;  1WVJ A;  1XS5 A;  2F6G A;  1ZBM A;  2RC7 A;  3CFZ A;  3FAT A;  5DTB A;  2PMS A;  1B1X A;  3I6V A;  3W15 C;  1MY2 A;  4GD5 A;  1IEJ A;  4G2Z A;  4XXU A;  1B6H A;  4NMY A;  3VXC A;  2YLN A;  4GL8 A;  4ZDM A;  4F22 A;  1D9V A;  3T96 B;  1YTV A;  4DXU A;  3Q25 A;  1MXV A;  1QKB A;  4R9G A;  4WEP A;  3K6W A;  4JDF A;  5FTI A;  3TCH A;  3BFU A;  3UK4 A;  1MDP 1;  5CI5 A;  3UIF A;  5HM4 B;  5A5X B;  4F1U A;  3TTN A;  4O3B A;  5I2K A;  5I56 A;  1D3K A;  4MF3 A;  2V3U A;  1JW4 A;  2QRY A;  4I8C A;  1B58 A;  3BKI B;  1MM7 A;  3QK6 A;  4FIM A;  4G8N A;  4KPT A;  3VVE A;  4DCY A;  1FTL A;  3IJO B;  4LQ2 A;  1Y1M A;  2F97 A;  1IZ1 A;  4YKK A;  1MQI A;  2QS3 A;  3EHT A;  2DE2 A;  3V8X B;  4OEN A;  4EDP A;  4H67 A;  3VXB A;  4NF8 A;  4ZE9 A;  2G93 A;  4KYS A;  2OWS A;  1ANF A;  1FQD A;  1FTK A;  1VFE A;  1I69 A;  2QPQ A;  3O6G A;  3T9U A;  1OVT A;  2ZNT A;  3JZJ A;  2DE3 A;  3W9W A;  1AIV A;  1MXZ A;  3PPP A;  4FJP A;  3SDF A;  3SET A;  3O28 A;  1MH4 A;  3FZV A;  3P7I A;  4XKR A;  1URD A;  1I6B A;  1TFD A;  3M3L A;  3DP8 A;  3TEL A;  3U72 A;  4F18 A;  1MY4 A;  1B7U A;  4C0R A;  1SYH A;  3FXU A;  3OEK A;  3A09 A;  2I4B A;  1B4H A;  3R26 A;  3ILT B;  1LGB C;  4IY6 A;  4YAH X;  4DXC A;  4F3B A;  5I2N B;  3T9V A;  2ONR A;  4BDM A;  3H6W A;  3MJN A;  4E0X A;  3SEV A;  4TOZ A;  1LAX A;  3VLW A;  3FIR A;  5AA3 A;  1JW1 A;  1NNF A;  5DEX B;  4MLQ A;  2HAU A;  1LBC A;  4I1D A;  2FA7 A;  3IB0 A;  4IGR A;  4LA9 A;  2Z23 A;  4N13 A;  4FEB A;  4RJZ A;  3UP9 A;  3VDF A;  2A5S A;  4RK9 A;  3PPQ A;  5AA1 A;  3V89 B;  3TEP A;  1R9L A;  3MVW A;  1B46 A;  2QMW A;  2XXV A;  2H25 A;  3C4M A;  4OFL A;  5ICQ A;  1IXH A;  4KR5 A;  1A40 A;  2PX1 A;  3MUQ A;  4GOT A;  3CRB A;  2Y84 A;  4H65 A;  1MXY A;  1Y3Q A;  3PPN A;  4LQ5 A;  3MZ1 A;  5DVI A;  3G3F A;  3Q27 A;  5ELV A;  3IO4 A;  4TQU Q;  2XXI A;  3TTK A;  2V84 A;  2D3I A;  1B1H A;  4OES A;  2P1S A;  3KJ7 A;  4H1X A;  2R9J A;  4U4X A;  1XVX A;  4YIC A;  5EHM A;  1USY E;  1GVC A;  3S9N C;  2PVU A;  1LAH E;  2ZYO A;  1DMB A;  1CB6 A;  4H8I A;  1QW0 A;  3FJM A;  4EQ9 A;  2FYI A;  1O64 A;  4ZED A;  4G4P A;  4UA8 A;  3PPO A;  3VVD A;  3O2A A;  1M5E A;  1GGG A;  2WKY A;  3C36 A;  2DP8 A;  3I3V A;  3C31 A;  4JBZ A;  4R6Y A;  3O97 A;  4Z7E A;  4EUO A;  1SW5 A;  1Y4C A;  2ALU A;  1RYX A;  1TFA A;  5FHN A;  3WAE A;  3SER A;  3BFT A;  4MBP A;  3T66 A;  1A8F A;  4OET A;  1R6Z A;  2O1M A;  1NFT A;  1B40 A;  1SW2 A;  2DXY A;  3DEL B;  4H8J A;  4LZ5 A;  5LOM A;  1VR5 A;  4GRK A;  4GVO A;  2F7C A;  1B4Z A;  1NKX A;  4BLA A;  1DTG A;  4DDD A;  5H8F B;  3VFJ A;  1BP5 A;  3K1P A;  2XX7 A;  4NTL A;  4YKI A;  3KBR A;  3E3K A;  3SEY A;  2B65 A;  1LB8 A;  1IIT A;  3IL1 B;  1B5H A;  2Z8D A;  3M8U A;  3IOW A;  1LFH A;  5IAI A;  4GWO A;  2OWT A;  3S9E A;  1H3D A;  2DE4 A;  2F35 A;  4KCC A;  4XKP A;  4N07 A;  3HPI A;  4ZS9 A;  1N04 A;  1YAE A;  2KLF A;  1NH7 A;  1AL3 A;  1P1N A;  2V25 A;  2Z22 A;  3OSR A;  4OYV A;  3UGW A;  5KCJ B;  3PD9 A;  1M5B A;  5IKB A;  4IO4 A;  1URS A;  1EZ9 A;  3OO6 A;  1UIV A;  4MLV A;  4R9F A;  1ZU0 A;  2F34 A;  4Q8R A;  3U94 A;  3O6H A;  4ONY A;  4HW8 A;  3GLB A;  3H6T A;  4P0G A;  5I59 A;  4G68 B;  4LUB A;  1FQB A;  3HN0 A;  1IXC A;  1FTJ A;  4LZ8 A;  4R74 A;  4WKM A;  3N94 A;  3U1O A;  3VV5 A;  2QS2 A;  2ABH A;  4KQP A;  2Q8J A;  2G29 A;  4PQJ A;  4AQ4 A;  5I2N A;  1POY 1;  1QUL A;  1DOT A;  5CBS A;  1MQJ A;  1P1W A;  2Y7K A;  3C32 A;  3IOR A;  3MAM A;  2F6P A;  3N26 A;  3VLU A;  1O63 A;  2XXT A;  2PBW A;  4OXV A;  1VSO A;  3HCQ A;  5B7D A;  1M5F A;  4O3C A;  1MXW A;  4H0W A;  2QMX A;  1GTK A;  1JVX A;  4FE8 A;  4DXB A;  4F3S A;  1FTO A;  4LAT A;  5AA4 B;  2DOJ A;  4R2B A;  3SEX A;  3T9X B;  1ZJL A;  2XXY A;  1JQF A;  4FEC A;  5ICT A;  3PD8 A;  3TMG A;  4F29 A;  4JSD A;  5KZT A;  4NF8 B;  2Y7I A;  1QUK A;  3CFL A;  3RY3 A;  4ELR A;  1USY H;  2RCB A;  3O6I A;  2UYF A;  1MM6 A;  2HZK A;  3EPE A;  4BDO A;  4P0I A;  1F9B A;  4FED A;  4RPO A;  5H8H B;  3VE1 B;  4AB5 A;  3FVO A;  3GXA A;  3WAF A;  4ELO A;  1MPD A;  2X26 A;  2F78 A;  3K6V A;  3D4G A;  3QUF A;  4FOR A;  2P2A A;  2D5W A;  4YB7 A;  3A3C A;  4QHQ A;  5FTH A;  4C1U A;  1B3E A;  4KCD A;  5JTY B;  3V5A A;  1PBP A;  3RNN A;  4PET A;  1PC3 A;  2O51 A;  3D4C A;  3K02 A;  4Q5T A;  2F5X A;  1EH3 A;  1FQA A;  4GF8 A;  2AL4 A;  5JK4 A;  4NF4 A;  5AE4 A;  2CMO A;  1LST A;  2XXX A;  3S2V A;  1AOV A;  3MP8 A;  3S9L C;  2I6E A;  4I62 A;  3Q28 A;  3G3G A;  3C35 A;  1LB9 A;  1DSN A;  4QSC A;  3TDJ A;  1PB8 A;  4JSO A;  1JW5 A;  1VFD A;  3OOA A;  1QUI A;  2LAO A;  3HO7 A;  4G77 A;  4DZ1 A;  3TUS A;  3KN7 A;  5ITO A;  2XD3 A;  3SKP A;  3IO6 A;  4DLD A;  3KN3 A;  4XIG Q;  2VGQ A;  3TCG A;  1VE4 A;  3PPR A;  4HCW A;  2UVG A;  1MY0 A;  3PUV E;  3JYR A;  4U21 A;  1UIU A;  4NF5 B;  1UTB A;  3RTW B;  5HBC A;  4QSD A;  1EZO A;  1QUJ A;  1JNF A;  1B32 A;  1XOC A;  1P1U A;  2NXO A;  3IAZ A;  2HFB A;  1N3W A;  2I3W A;  2Q88 A;  3RN8 A;  3CG1 A;  3FV2 A;  4ESX A;  4R6K A;  4R2F A;  2PYY A;  4GQO A;  4NF5 A;  3RGY A;  1BKA A;  1LFI A;  3K2D A;  1I6A A;  4HCY A;  2DYX A;  4PE5 B;  1MY1 A;  3U93 A;  5TPA A;  4F19 A;  3IX1 A;  4U1O A;  3DP6 A;  3KFM A;  3RPW A;  2UYE A;  1IQ7 A;  1IIW A;  3OD7 A;  4G8M A;  3F11 A;  1R1N A;  3QXM A;  3DLN A;  1P1O A;  4H6D A;  4ZEI A;  2H9B A;  4H5G A;  1N7X A;  2GHB A;  2YPN A;  3TKD A;  1MPB A;  1OMP A;  3AXF A;  4KYE A;  5CBR A;  4KFQ A;  2PT2 A;  1MDQ A;  3FJ7 A;  3PGF A;  4YU0 A;  5DYH A;  5EYF A;  3K4U A;  3OO7 A;  5DVJ A;  1UTH B;  3E4R A;  1Y4T A;  1GV8 A;  3EHU A;  3T9H B;  3USD A;  4ZEC A;  1LBB A;  2Q9T A;  3B6Q A;  5H8N A;  3ZSF A;  4FAJ A;  2VHA A;  4O3A A;  1Z7M E;  3IB2 A;  3ZKL A;  1DPE A;  2O7U A;  4EF2 A;  5I58 B;  5A5X A;  1S7Y A;  3H06 B;  5I2K B;  3B6W A;  3FVK A;  1N76 A;  4WED A;  5FHO A;  3LUY A;  1QJM A;  1TWY A;  1A7L A;  1UTB B;  2VP1 A;  5AA2 D;  1ATG A;  2REJ A;  5KDT A;  1RYO A;  3N6T A;  2XD2 A;  1TT1 A;  4RNS A;  4BDR A;  4QFO A;  3N6U A;  3QAX A;  3QSL A;  1HSL A;  4M1V A;  1LAG E;  4UAC A;  1BLF A;  5CMM A;  2HEU A;  4ECF A;  1Q35 A;  2Y7P A;  1Y3N A;  3EF7 A;  3SES A;  4KHZ E;  2I0C A;  3E13 X;  5CC2 A;  5B70 A;  1N7W A;  1B0L A;  3I5O A;  1SDX A;  3TOD A;  4PP0 A;  4Q0C A;  4FAT A;  4GFR A;  4F39 A;  5ITP A;  2IEE A;  3S9M C;  3G7W A;  2QS1 A;  3M3K A;  2OCU A;  1II5 A;  1B3L A;  3OXN A;  4ELQ A;  3K01 A;  1XT8 A;  4U4S A;  1NL5 A;  4X48 A;  1FCK A;  3PUX E;  3MC2 A;  4IO2 A;  5H8S A;  3SEW A;  1YPN A;  2RC9 A;  4F1Y A;  4RXL A;  1SW1 A;  3IOV A;  3FV1 A;  3M3F A;  3CFX A;  1IUD A;  3OEM A;  3KOT A;  3PU5 A;  1YCJ A;  4G68 A;  3TZA A;  3RQT A;  4E0W A;  1GR2 A;  3K0V A;  3ILU B;  2H4I A;  4LZ7 A;  1B2H A;  1B3H A;  1Z7N E;  3CI8 A;  3FUZ A;  1D9Y A;  2DWI A;  4NWC A;  1WDN A;  2ZNS A;  4WXJ A;  5DVF A;  2A5T A;  4YB6 A;  5F7V A;  3S4U A;  2ZMB A;  3FXR A;  4QFL A;  2VD2 A;  3KGC A;  3PMX A;  4RPN A;  2P0S A;  4RYA A;  3MWB A;  4KD5 A;  4NF6 A;  4DCX A;  3H4Z A;  2X7P A;  4PFT A;  4ZEK A;  1PB7 A;  5EHS A;  2AYS A;  4QF9 A;  1FTM A;  2DQV A;  4XKN A;  4EQB A;  3EN3 A;  5AA4 A;  1EU8 A;  3FXQ A;  1RKM A;  1A55 A;  2XXP A;  3HHF A;  3OEN A;  4OWD A;  3TTR A;  1HSJ A;  3DM0 A;  4P11 A;  4RK2 A;  3K00 A;  4OQO A;  1N3X A;  4ESW A;  3TCF A;  4YMB A;  4IO5 A;  4GL0 A;  5K2X A;  4HS7 A;  1D4N A;  3CSG A;  4ZEB A;  1US5 A;  3MW0 A;  4U1Z A;  2XXQ A;  1S50 A;  2H99 A;  3TTL A;  3PUW E;  2F8D A;  1B5I A;  2DWA A;  3OMB A;  4KYD A;  3MBP A;  1H44 A;  3QYT A;  4EXL A;  2NWJ A;  2GHA A;  3K6U A;  4K3F A;  4IY5 A;  5JTY A;  2E1S A;  1N0T A;  5K2Y A;  3TTM A;  2AIX A;  3IOT A;  4LP2 B;  5TP9 A;  4KI0 E;  2GH9 A;  1PBQ A;  2Q2C A;  4YMA A;  3V83 A;  4IO6 A;  1B05 A;  3IR1 A;  3IJX B;  5HPQ A;  2F36 A;  3MVZ A;  1Y9U A;  3VVF A;  5I57 B;  2OBG A;  4I9D A;  5BUU A;  1SBP A;  4NED A;  1MXU A;  1T0K A;  1BIY A;  3DP4 A;  3KJT A;  5CMC A;  4BDL A;  2DVZ A;  4OZ9 A;  2AL5 A;  1R9Q A;  4BDQ A;  4F2Q A;  1P99 A;  2XX9 A;  3K6X A;  2RF1 A;  3KSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...