4F3PA

Crystal structure of a glutamine-binding periplasmic protein from burkholderia pseudomallei in complex with glutamine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
226
structure length
223
Chain Sequence
KELVVGTDTSFMPFEFKQGDKYVGFDLDLWAEIAKGAGWTYKIQPMDFAGLIPALQTQNIDVALSGMTIKEERRKAIDFSDPYYDSGLAAMVQANNTTIKSIDDLNGKVIAAKTGTATIDWIKAHLKPKEIRQFPNIDQAYLALEAGRVDAAMHDTPNVLFFVNNEGKGRVKVAGAPVSGDKYGIGFPKGSPLVAKVNAELARMKADGRYAKIYKKWFGSEPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Glutamine-binding periplasmic protein from Burkholderia pseudomallei in complex with glutamine
rcsb
source organism Burkholderia pseudomallei
molecule tags Transport protein
molecule keywords Glutamine-binding periplasmic protein
total genus 78
structure length 223
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4f3pA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4f3pA02
4ELOA 1MQHA 2OCUA 1P1WA 1SW4A 3H03A 2XXYA 1ZU0A 4YICA 3TCFA 4LVQA 2I0BA 1B9JA 2F97A 1SYIA 1LCFA 4R2BA 2Y7IA 2PBWA 5CMMA 2XXTA 4C0RA 2VOZA 3FVKA 1B0LA 1PBQA 3C4MA 5I56A 4C1TA 2F7AA 2X7PA 1FQCA 2F5XA 3QXMA 4JWXA 1LCTA 2QS3A 3B6QA 4K3FA 4O3AA 2LAOA 5FHOA 2V3QA 2F34A 4EXKA 1FW0A 4LZ8A 4FECA 4G77A 5L9MA 4U2RA 4BDQA 1MH3A 4NF6B 3TTRA 1Y4TA 3OD7A 3TUSA 5I56B 2ONRA 5I59A 1UIVA 4NF5A 2Q2AA 3E4RA 4KYSA 5EHMA 3UK4A 5JK4A 5LOMA 5KDTB 3H06B 5FHNA 1DTGA 2DOJA 1B05A 1B4HA 1XHYA 2RC7A 2UVGA 3K02A 3KSXA 4PE5B 4F3GA 5H8NB 4P0IA 5ITPA 5ISUA 2ZYKA 4N07A 3MVXA 1AL3A 1LSTA 1Y3NA 4YAHX 4Z7EA 2VD3A 5I58B 1XC1A 2H25A 1S9TA 3MP6A 3MZ1A 3W9WA 3S9NC 3MP1A 3A3UA 4ELQA 3OEMA 1JNFA 1R9LA 3C34A 4OWDA 2REJA 1GVCA 4F31B 4WEPA 2ZNSA 3TCHA 1I6AA 1AIVA 3GZGA 3IO6A 4DE8A 1SW1A 3FVGA 1US4A 3K6VA 4BDLA 3K00A 4NE4A 1XT8A 4ZEFA 3CFLA 4BDOA 2RC8A 2PX1A 3SEVA 4IO3A 5AA4A 3VXCA 5JTYA 4U1OA 1IEJA 4GWOA 2F7CA 4JB7A 4QFKA 2XXRA 1N84A 4X1DA 5L8DA 3LC8A 1R1NA 1M5DA 1MH4A 3D4CA 1YPNA 3D4GA 3N94A 2V25A 1A8FA 3HO7A 3ECRA 1DTZA 2M8CA 2ZMBA 3IR1A 3O6GA 4AB6A 4LA9A 2O1MA 3TEPA 3EHUA 3IOUA 1PDAA 4F2QA 1JEVA 3RPWA 1N76A 2Q9TA 2DE2A 3H6VA 1N3XA 1POY1 2RF1A 1LBCA 2Z8DA 2F78A 3LSLA 3QK6A 4IO5A 1OQHA 2HAVA 2UYFA 4XTCQ 1P1NA 1ZIUA 2RCAA 3K1MA 4GXAA 3CI8A 2F8DA 4IGTA 3U94A 2O7UA 3FVOA 3T22A 5AA4B 3Q27A 1MXWA 3MVWA 3E13X 4UACA 4OVJA 1D3KA 1JQFA 4KCDA 3OMBA 3EF7A 1FQEA 1QUIA 3TTNA 4BDNA 1MXVA 3OENA 3EHTA 4OMBA 3RNNA 4LQ2A 3N26A 3PPPA 5ICQA 1Y3QA 4NF8B 5ITOA 3I6VA 3RGYA 2AL4A 3T93B 3UIFA 4EQBA 5AA2B 1B7HA 5H8HA 5TP9A 1EH3A 1TFDA 4H1XA 4YKKA 1MY0A 3JYRA 3OO6A 4H67A 4OFLA 4QFLA 2D5WA 4M1VA 1BTJA 3TDJA 2QPQA 3V8XB 2DWIA 1PB8A 4IO7A 2ONKE 1FTJA 4IO2A 4F3PA 3MC2A 4OETA 1LFIA 2B3FA 4ZE9A 2PT1A 1OIBA 4JBZA 2H9BA 3EQ1A 3RTWB 3VVFA 1S7YA 3C35A 3RN8A 4OESA 4FE8A 1N7WA 1HSJA 4XKNA 2Y7KA 2DVCA 3KBRA 3PPRA 1MPCA 4LZ5A 4QSDA 5JTYB 3E3KA 3O6HA 3RLFE 1NMUA 1AMFA 4AB5A 1II5A 3TPAA 1PBPA 1EZOA 1B46A 4PP0A 4F1UA 1M5EA 3O97A 3TTLA 1MM6A 4H8IA 3TKDA 2Q89A 3V5AA 5B7DA 1MDQA 1MDP1 4DCYA 4ZEBA 5A5XA 2H98A 4M4GA 3T9VA 4DCXA 3PPOA 1ZTYA 3TCGA 1D9VA 3SEUA 4IY6A 3IOVA 4OERA 4P0GA 1OVBA 1POTA 3RY3A 4QSCA 2XXVA 1XOCA 1LBBA 1B40A 1IQ7A 4KQPA 1I6QA 1UTBB 3IOWA 3OO8A 1NFTA 4R9GA 3KN8A 3THIA 3KGCA 1SI0A 2AYSA 1B3FA 2ZNTA 3OXNA 3JZJA 2R6GE 4QFPA 3G3GA 2XXUA 4YB6A 4GQOA 1FQBA 3HHFA 5JEIA 3OOAA 2H4IA 3HSTA 3C32A 5TU0A 5K2XA 3IB0A 2XX9A 4JDFA 2E0SA 2G93A 5CMKA 1B5JA 4RY1A 4G68B 3T66A 3FJ7A 3BFUA 1OLAA 1GGGA 3FZVA 4YZZA 3B6WA 1JVXA 2DE4A 2VP1A 2QJEA 3C31A 4KYDA 3K01A 3MJNA 1H3DA 3A3CA 1B4ZA 4OFOA 1B5IA 3MWBA 4GD5A 4QSEA 4WKMA 4OXVA 4L17A 3MQ9A 4NF5B 4YKJA 5L9SA 5KCJA 3VXBA 2H5YA 3MUQA 4KFQA 3IOTA 3U1OA 1IIWA 3CIJA 3PV0E 3KZGA 4H6DA 2QMWA 4OYVA 3H4ZA 1GTKA 1NL5A 3G3KA 4G8HA 5B70A 3M8UA 4RA1A 3IORA 4F3BA 3FV2A 3EN3A 3IK6B 1DPPA 1MXUA 4G68A 4Z0IA 3L6GA 2O69A 2Y7RA 2NWJA 3QIMA 1VSOA 2Q88A 5I58A 3VFJA 2DVZA 2VD2A 3G3JA 1LFGA 3K6XA 1SW5A 1LLSA 4GOTA 3HHGA 3WAFA 3SEXA 3VLWA 1EZPA 4R72A 3SDFA 4WEDA 4F1YA 1M5CA 2QS4A 2P1SA 1NKXA 3MAMA 2OWSA 3O28A 4GFRA 4QFOA 4X1BA 3BKIB 2XXHA 4TQUQ 1LAHE 3SETA 4FAJA 4LATA 1ZBMA 3S9MC 4KPTA 1P1UA 3IX1A 3OO7A 4NF4B 3CR9A 4HCYA 1VR5A 4RYAA 1L5TA 1Y3PA 2O51A 5I84A 4GL8A 4ZS9A 3H7MA 1MXZA 2PVUA 5F1QA 2O7IA 1US5A 4ND9A 2OZZA 1JW1A 4TLMB 5H8SA 3MBPA 3S2VA 3T9XB 1PEBA 3PUXE 2FA7A 5CMBA 5I2KB 4ZECA 4LUBA 2QMXA 4LP2B 4NF4A 3OSQA 3UGWA 2A5SA 1BIYA 1B58A 4WXJA 2NVUB 3GBBA 1SQYA 2VHAA 2F6GA 1ZKBA 1NNFA 1S50A 1QKAA 2UVHA 2V93A 2O68A 3R26A 3TZAA 5CC2A 2Z23A 1UQWA 5IAIA 3UORA 4AQ4A 4YU0A 1IXGA 3S4UA 3T9HB 4IGRA 3KFMA 4NWDA 2XXWA 3QYTA 4N13A 1B6HA 3MVYA 4O3BA 4C1UA 2I4CA 1YCJA 2Y84A 3GXAA 3TAJA 1USYH 4ONYA 1F9BA 4ZDMA 3TFLA 5I59B 2UVJA 2AL5A 4U4SA 3FGSA 4RK2A 2F36A 2O6AA 3RTFB 1P1OA 1YAEA 4JSOA 1A54A 1O64A 1NNKA 5A5XB 2QL3A 1BKAA 4FEBA 5DYHA 5ICTA 2ZYNA 2F35A 3O9PA 4F39A 4GRKA 1PB9A 4Q5TA 4F18A 2DE3A 1B5HA 4JSDA 4U23A 3UA8A 4U1ZA 1MY4A 3H6UA 1UTBA 3I3VA 1Z7NE 1OLCA 3A09A 4OQOA 1LAGE 1ATGA 2VGQA 3MPLA 4H5GA 1M5BA 2I3WA 4GVOA 4P11A 5EYFA 5BWJA 3HCQA 3F11A 3VVDA 1B3GA 4NTLA 2OJTA 1ZJLA 3FATA 3IAZA 4ESXA 1DMBA 1SI1A 5TP9B 1H43A 4R73A 1Y9UA 3BFTA 3GBAA 1MQGA 3PGFA 4JXIA 3CFXA 3BBRA 3FVNA 2Q8JA 4G4PA 3U8QA 3ZS6A 3LSXA 3KOSA 5M2VA 3VDFA 3TYHA 2XXQA 4KYEA 5CM6A 4I8CA 5AA2A 2YLNA 1MPDA 3P7IA 3HV1A 3M3KA 2DQVA 3IL1B 4R75A 4NEDA 5FHMA 3UN6A 3CG1A 3FIRA 1FTLA 1VFEA 4I62A 4POWA 2UXAA 5EHSA 2Z8FA 3PMVA 3SKPA 4ECFA 4U21A 5CI5A 2GRVA 4OTEA 4F1VA 3ZKKA 5I2NA 4ESWA 3FJMA 4JWOA 4HS7A 1USYE 2I4BA 3HPIA 3PMWA 2IEEA 4FIMA 4EQ9A 1ZLQA 5HBCA 1B2HA 1MS7A 2OWTA 1MG1A 2ZYMA 4LONB 2XX8A 4R6KA 3ZKLA 4ZEIA 2DS9A 1ZMGA 2V84A 2XXIA 1MY2A 2OBGA 3O66A 4O3CA 1Y4CA 3N6TA 4H8JA 4ZZEA 1Z7ME 3ODBA 4RPNA 5CMCA 4DDDA 4MH5A 3WAEA 2R71A 2P2AA 3JV9A 4PFYA 4OEVA 1I6BA 4RK9A 3FUZA 1N04A 4RNSA 1XVXA 4MF3A 4TOZA 2I0CA 4QF9A 4DXBA 2R9JA 2X7QA 1YTVA 2XXXA 2XXPA 2ZNUA 3FJGA 4RJZA 1QUKA 3MZBA 4H0WA 4RXLA 2HCAA 2X26A 2THIA 3CRBA 3TMGA 4NF6A 1Q35A 2NXOA 2V3UA 1FQAA 1QULA 4OENA 1WODA 4UA8A 5DT6A 3PD8A 5AA2D 4MLQA 3FXRA 3LUYA 1LGBC 4YKIA 4BDRA 1ANFA 3DP4A 1Y1ZA 1B52A 3SEWA 3MW0A 4Q30B 3IO4A 4XIGQ 5I57A 3G3HA 2HXWA 3T96B 3PPNA 2E1SA 4R9FA 5TPAA 3PPQA 1IITA 1A40A 1MQIA 1QJMA 3IB1A 3QUFA 3N5LA 4MFIA 1GV8A 4YMBA 5IKBA 1EU8A 2ANJA 5AA1A 4DLDA 2OLBA 1D9YA 1OQGA 1FTKA 2ABHA 4ZE8A 2REGA 2UYEA 4TLLB 3KJ7A 1QUJA 2Y7PA 4IO6A 1NH8A 4PQJA 1H44A 2DXRA 3CSBA 3Q28A 1R9QA 1UIUA 2FYIA 5FTHA 4OHNA 1XS5A 3U72A 3CG3A 3EPEA 4I1DA 5I2KA 4DIGA 3LBSA 2HFBA 3VLUA 4X48A 2ZXTA 3FXQA 1IXCA 4X9TA 5CBRA 4DZ1A 1LB8A 1TXFA 2PMSA 1SYHA 4GL0A 1BP5A 1MQDA 1TWYA 3K1NA 3O29A 2DWHA 1DSNA 1FQFA 2NOOA 2Z8EA 2IA4A 4OEUA 3T9UA 2XD2A 5DEXB 4F19A 3S9LC 3QUJA 4ZEDA 1AOVA 3K1PA 3G3FA 3MPKA 2DSFA 2HEUA 2ONSA 2YPNA 3DELB 3QAXA 3H6TA 1OMPA 3U92A 1FTOA 1HSLA 4QFNA 1A55A 3KJTA 3RUMA 2FNCA 1MY3A 4G2ZA 3FV1A 4XKRA 3PUVE 4G68C 2XHDA 3VLVA 4DXUA 5CBSA 5L9OA 1H45A 4KHZE 4HCWA 1JEUA 2QS2A 1MQJA 2I6EA 3HN0A 4HTGA 1H76A 3PUWE 1SD3A 1ELJA 2QSXA 4DXCA 4F3SA 1WVJA 1LB9A 3OELA 1PC3A 4POXA 3TTKA 3VE1B 1D4NA 1NNTA 3V89B 5AA3A 1MRPA 1SBPA 1QVSA 4U4XA 3TTMA 3USDA 1JVYA 1RYXA 3LSWA 1Y20A 3TODA 5DVIA 1IXHA 2DWAA 3C33A 1A7LA 4LZ7A 2P0SA 4R74A 1JW5A 2ESNA 4E0XA 1UTHB 1B32A 2DP8A 4EDPA 1MXYA 4PFWA 5J1DA 3VVEA 5I2NB 1VE4A 1MY1A 1XVYA 1NNPA 3H6WA 1EZ9A 1SDXA 4R6HA 3VV5A 3QSLA 2KLFA 1SVXB 4XKQA 1B0HA 2NUVA 4Q8RA 3KN7A 4IB2A 4OFJA 4THIA 3U93A 1UTHA 4E0WA 3W15C 1LFHA 2CZLA 4YKPA 2AIXA 3GLBA 1B51A 1J1NA 4KR5A 2I48A 5AE4A 4ZEKA 1B1XA 1VFDA 2XX7A 4IO4A 4OZ9A 1A8EA 1GR2A 1JW4A 1Q1KA 3CFZA 3B6TA 1B7ZA 4G8MA 4XXUA 4EXLA 2W7YA 3Q25A 5KZTA 1MPBA 1DOTA 2GFEA 4FORA 5I57B 4Q0CA 4YB7A 4F29A 2A5TA 1TT1A 3TQLA 1KWHA 2HZKA 4H65A 4H5FA 2XD3A 2PYYA 1IZ1A 4MLVA 3KG2A 1A99A 1O63A 1P1QA 2I58A 2HAUA 3C36A 2D3IA 3MVZA 4IY5A 2RINA 3R7XA 3SEYA 2ZYOA 3KSJA 2DXYA 3H3GA 3K6WA 1B7UA 3L6HA 1CE2A 2DWJA 4N6PA 5FTIA 2V3TA 3OSRA 3FD3A 3V83A 3K2DA 2RCBA 3IB2A 1T0KA 2H99A 5HPQA 5TPAB 5F7VA 2A5TB 1N3WA 2Z22A 1OVTA 2GHAA 2I3VA 4PFTA 3FXUA 3SESA 1NH7A 2G29A 4GXSB 3E9XA 3PUZE 5H8FA 4KD5A 3DP8A 3TELA 3Q29A 3O2AA 4YMAA 1O7TA 4EUOA 5H8QB 5H8QA 1MM7A 1URGA 3DP6A 1IXIA 1RKMA 2F7BA 2BJJX 3PD9A 3N6UA 1SW2A 4ELRA 5HM4B 2DYXA 5KCJB 4PFUA 1M5FA 3M3FA 3PMXA 4RPOA 5ELVA 2PT2A 2QRYA 3S9EA 1IUDA 3ILTB 3MZ9A 1MXXA 2WKYA 4ELPA 4R6YA 5H8HB 1B3EA 2CMOA 3CSGA 3EHSA 1PB7A 2HQ0A 3LSFB 3O6IA 1N7XA 3DM0A 3OEKA 4NMYA 5DTBA 4QRZA 3K0VA 4KCCA 3UP9A 4EF2A 4FEDA 1B3HA 1BLFA 2Y7WA 4LQ5A 5H8NA 4GIZA 3SERA 1URSA 4FATA 4YB5A 3K6UA 3M3LA 5DVFA 5BUUA 3KN3A 2GH9A 2QS1A 3MP8A 4ISUA 2YJPA 1JETA 3B7DA 3K4UA 1FQDA 1R6ZA 4PETA 5KDTA 2D21A 1P99A 1RYOA 2F6PA 3DLNA 1N0TA 2O84X 1LAFE 3IJXB 3PUYE 5DVJA 3ILUB 1URDA 3RT8A 1B1HA 1WDNA 4EF1A 3G3IA 5DEXA 4R2FA 2RKMA 2HZLA 4BLAA 1Y1MA 1B3LA 3FASA 1FTMA 1I69A 2GHBA 3LR1A 3G7WA 4JWYA 4ZZAA 3TQWA 4HW8A 3R6UA 4FJPA 4NF8A 4QHQA 1DPEA 1TFAA 4BDMA 1AH5A 2RC9A 4F22A 4I9DA 2B65A 2UVIA 1QW0A 5H8FB 3W9VA 3KEIA 4GLIA 5K2YA 1CB6A 4EQ7A 4KI0E 4MBPA 2Q2CA 3I5OA 3RT6B 3ZSFA 1FCKA 1LAXA 4GF8A 3PU5A 3CVGA 3ONMA 1QKBA 4G8NA 2I49A 2ALUA 2O1LA 2OK2A 3AXFA 3Q26A 5CRYA 4F2OA 4NWCA 4XKPA 3RQTA 3KOTA 2B3BA 3OO9A 3IJOB 1HSEA 3C9HA 4U22A
chains in the Genus database with same CATH superfamily
4ELOA 5IGAA 1SW4A 1ZU0A 1FJ6A 1LCFA 2PBWA 2VPNA 1FQCA 4HE1A 5FHOA 4XF5A 1FW0A 4FECA 1MH3A 1NV1A 3FBPA 1Y4TA 2ONRA 1UIVA 5LOMA 5JK4A 4O7MA 2DOJA 5ITPA 3MVXA 1AL3A 1Y3NA 1S9TA 2WBBA 1FPBA 4ELQA 1R9LA 1GVCA 4PBHA 4F31B 2JJKA 2ZNSA 1I6AA 3TCHA 1AIVA 3GZGA 3FVGA 4ZEFA 4BDOA 2PX1A 5JTYA 4GWOA 1FPFA 2V25A 2M8CA 3EHUA 2Q8MA 1FPGA 1VDWA 1DCUA 1NV3A 2RF1A 4F18A 1LBCA 2RCAA 4QBAA 3LV0A 4AS4A 2O7UA 4QXDA 4N17A 1MXWA 4OVJA 3OMBA 1FQEA 3OENA 3N26A 5ITOA 5AA2B 5TP9A 1TFDA 3OO6A 4QFLA 4M1VA 1BTJA 4IO7A 1FTJA 4IO2A 4PBQA 5FBPA 5I3SA 3RTWB 4ZE9A 2H9BA 2XXKA 1HSJA 4XKNA 3PPRA 1AMFA 1II5A 3TPAA 1B46A 2Q89A 4P1EA 1MDP1 4ZEBA 4DCXA 3PPOA 4IY6A 3IOVA 4OERA 4QSCA 1XOCA 4KQPA 1I6QA 3IOWA 4R9GA 3KN8A 1B3FA 3JZJA 4YB6A 5K2XA 3IB0A 4JDFA 2G93A 4RY1A 3T66A 3FJ7A 4P56A 1OLAA 4Z0IA 3B6WA 2DE4A 3A29A 3C31A 4GD5A 5T3JA 4NF5B 3U1OA 3PV0E 3KZGA 4IR8A 4OYVA 1NL5A 4RA1A 3IORA 3EN3A 4PAKA 2Q88A 2VD2A 3G3JA 4GBWA 1EYJA 1NKXA 3MAMA 1NV2A 3S9MC 1RDYA 5I84A 1VR5A 3H7MA 2PVUA 1US5A 4ND9A 3B8BA 2PFYA 3T9XB 2QMXA 1B58A 1NNFA 1S50A 2V93A 2O68A 5CC2A 2Z23A 4AS5A 4YU0A 3S4UA 2XXWA 1LBXA 4C1UA 3TAJA 1USYH 2FIEA 1F9BA 2UVJA 4RK2A 2F36A 2O6AA 1P1OA 1YAEA 3B50A 1O64A 5A5XB 1BKAA 4OVSA 3O9PA 1PB9A 3UA8A 4JSDA 4U23A 3A09A 2VGQA 3MPLA 3VVDA 2OJTA 3FATA 1SI1A 3FVNA 3TYHA 2XXQA 4KYEA 2YLNA 3FIRA 4POWA 5EHSA 4OTEA 2HHMA 1FBHA 3ZKKA 5I2NA 3FJMA 4FIMA 5HBCA 2OWTA 1MG1A 2XX8A 1KA0A 3ZKLA 2DS9A 4ZZEA 4F2QA 1Z7ME 2PFZA 2XWOA 4MH5A 4PFYA 3FUZA 1XVXA 2XXPA 4RXLA 2X26A 1Q35A 3PD8A 5AA2D 4MNPA 3FXRA 4BDRA 3DP4A 1Y1ZA 3MW0A 3IO4A 2E1SA 4YMBA 4DI3D 1Q9DA 1OQGA 4IO6A 2DXRA 1UIUA 2FYIA 1KZ8A 3U72A 4UABA 3FXQA 2XWIA 4DZ1A 1MQDA 4PE3A 4OEUA 2IA4A 4F19A 3QUJA 1AOVA 3U92A 1HSLA 3KJTA 3RUMA 2FNCA 1MY3A 1NUZA 3FV1A 5L9OA 4DXUA 1H45A 2QVVA 1FBGA 3PUWE 1WVJA 3OELA 4POXA 5IAIA 4U4XA 1JVYA 1AWBA 3TODA 2P0SA 2WEFA 3H6WA 1SDXA 3VV5A 3QSLA 2KLFA 2NUVA 4IB2A 3W15C 4GWYA 4YKPA 4KR5A 1B1XA 1A8EA 2GFEA 4FORA 1NV0A 4I3EA 3TQLA 4H5FA 1IZ1A 4MLVA 1A99A 1P1QA 2ZYOA 2DXYA 3H3GA 5HPQA 4N4UA 2A5TB 1N3WA 1OVTA 3SESA 3FXUA 4KD5A 2QFLA 3Q29A 1KA1A 5H8QA 2F7BA 3PD9A 1SW2A 4ELRA 5KCJB 1M5FA 1FBEA 2QRYA 2KQZA 1MXXA 1B3EA 3EHSA 2HQ0A 3DM0A 4NMYA 5IZ3B 4QRZA 4I40A 3MP8A 2YJPA 1P99A 1RYOA 1N0TA 2O84X 3IJXB 3PUYE 5EQ9A 5DVJA 1URDA 5LTCA 1WDNA 4BLAA 2HZLA 1Y1MA 4NG7A 1FTMA 4ZZAA 4NF8A 1IMCA 1TFAA 4F22A 4I9DA 5K2YA 4EQ7A 2Q2CA 3E78A 1FCKA 3CVGA 4G8NA 1FPIA 1QKBA 2CEYA 2I49A 2ALUA 4XKPA 1NUYA 3IJOB 2R8TA 2XA5A 4U22A 1B9JA 1SYIA 3SZPA 4C0RA 2VOZA 5I56A 2X7PA 3U93A 5I59A 4K3FA 2QS3A 2LAOA 5IZ3A 3BIHA 2F34A 4LZ8A 4G77A 4PTKA 4NF6B 2Q2AA 3E4RA 4KYSA 3UK4A 1B05A 2ZZVA 4P0IA 2ZYKA 4YAHX 1LSTA 2H25A 3OEMA 2FHYA 3IO6A 2L5VA 1SW1A 2OX3A 1US4A 4BDLA 3K00A 1XT8A 1FJ9A 2F7CA 1N84A 3D4GA 1YPNA 2ZMBA 2V4CA 1N3XA 1POY1 4XTCQ 2HAVA 1JP4A 1ZIUA 3K1MA 3CI8A 2F8DA 3T22A 5AA4B 3Q27A 3MVWA 4UACA 1D3KA 1YYZA 1JQFA 4BDNA 1MXVA 1NUWA 3I6VA 3NOHA 2AL4A 5H8HA 4H1XA 3JYRA 4H67A 2D5WA 3V8XB 2QPQA 2ONKE 4F3PA 4OETA 1LFIA 2B3FA 2PT1A 4JBZA 1S7YA 3RN8A 4OESA 4FE8A 5EQAA 3RLFE 3E3KA 3O6HA 4AB5A 4PP0A 1M5EA 3TTLA 3V5AA 4H8IA 3TKDA 5B7DA 1MDQA 2HPGA 4PGPA 3TCGA 1D9VA 4P0GA 3RY3A 4JVDA 4NQ8A 1UTBB 3OO8A 1FPJA 1SI0A 2R6GE 2XXUA 3HSTA 3C32A 2XX9A 5CMKA 4O7IA 1B5JA 4PDHA 2QJEA 3K01A 1H3DA 1B4ZA 4L17A 5L9SA 5KCJA 2H5YA 3MUQA 4KFQA 3CIJA 3H4ZA 3G3KA 3ISPA 4F3BA 1DBZA 4GWZA 1MXUA 1D9QA 4G68A 3L6GA 2O69A 2Y7RA 2NWJA 5I58A 4GOTA 3WAFA 1LLSA 3SEXA 4P9KA 4F1YA 3SDFA 1M5CA 4QFOA 3SETA 1ZBMA 1P1UA 4RYAA 4GL8A 5F1QA 2O7IA 2ZZXA 1K9ZA 4TLMB 1PEBA 2FA7A 5CMBA 4LUBA 4LP2B 2A5SA 2B4MA 4MAGA 1SQYA 2F6GA 1QKAA 2UVHA 3R26A 3TZAA 1UQWA 4AQ4A 3KFMA 4NWDA 3QYTA 1B6HA 4NN3A 3TFLA 1IMDA 3RTFB 4U4SA 3FGSA 1FSAA 4F39A 4GRKA 4Q5TA 1B5HA 1QGXA 3H6UA 4N15A 1UTBA 3HFUA 3I3VA 1ATGA 1M5BA 4GVOA 5EYFA 5A5LA 4NTLA 3IAZA 1DMBA 4R73A 3BFTA 1MQGA 3PGFA 3CFXA 4G4PA 3U8QA 5IM2A 3P7IA 3M3KA 4NEDA 1YZ0A 4I62A 1FTLA 4GBVA 2Z8FA 4ECFA 1EYKA 4F1VA 4ESWA 1XI6A 1USYE 4EQ9A 2IEEA 1ZLQA 1B2HA 2ZYMA 4OVRA 1MY2A 3WAEA 2P2AA 3JV9A 4RNSA 4RK9A 1N04A 4TOZA 1FBPA 1LBVA 4DXBA 2X7QA 1NUXA 2XXXA 2ZNUA 3TMGA 2THIA 2B4LA 2V3UA 1FQAA 1WODA 2VPOA 4XIGQ 3G3HA 1LBZA 5IKBA 3N5LA 2OLBA 1D9YA 2UYEA 3KJ7A 2Y7PA 2XWVA 3CSBA 3D1RA 4I1DA 4DIGA 2HFBA 3IFCA 2ZXTA 4X9TA 1LBYA 2WYPA 3K1NA 1FQFA 2Z8EA 2XD2A 4ZEDA 3K1PA 3G3FA 4MNIA 2DSFA 3DELB 5EQ7A 4G68C 5CBSA 4KHZE 4MHFA 2QSXA 4F3SA 1RDZA 1PC3A 3V89B 1MRPA 3TTMA 4NAPA 5DVIA 1IXHA 3C33A 4LZ7A 1JW5A 4EDPA 1MXYA 4PFWA 5J1DA 3VVEA 1EZ9A 4Q8RA 3KN7A 1LFHA 1UTHA 4E0WA 1EYIA 1B51A 1J1NA 2GQ1A 1VFDA 4OZ9A 1GR2A 3RPLB 4XXUA 3B6TA 3Q25A 5KZTA 4N8GA 5I57B 1TT1A 1KWHA 4H65A 4PF6A 3KG2A 1O63A 3MVZA 3C36A 3R7XA 4IY5A 4N6PA 2V3TA 3FD3A 1NH7A 2G29A 4GXSB 3PUZE 1O7TA 5H8QB 1MM7A 1URGA 2BJJX 2QVRA 3M3FA 5ELVA 3S9EA 4RPOA 3ILTB 5H8HB 2CMOA 3MYUA 3O6IA 2HXRA 3LSFB 3K0VA 1B3HA 2Y7WA 5H8NA 3K6UA 3KN3A 2GH9A 3B7DA 4PETA 3DLNA 1LAFE 5DEXA 4PGNA 4R2FA 1I69A 3LR1A 5H8FB 3I5OA 5EQ8A 3RT6B 3ZSFA 4GF8A 3AXFA 1FRPA 3U65A 3C9HA 2OCUA 2FVZA 1P1WA 4GX6A 4YICA 2I0BA 4N8YA 4R2BA 2Y7IA 4NGUA 2XXTA 3FVKA 1B0LA 3C4MA 2F7AA 2F5XA 3QXMA 1LCTA 2V3QA 4EXKA 5L9MA 1YXIA 4U2RA 4BDQA 3TTRA 3QMFA 5EHMA 3H06B 5FHNA 2RC7A 1B4HA 2UVGA 5ISUA 1XC1A 3W9WA 3S9NC 3MP1A 2OWZA 3A3UA 4PF8A 2VT5A 4PCDA 3SEVA 3VXCA 4JB7A 4PAFA 2PCRA 5L8DA 4PC9A 3N94A 1M5DA 1A8FA 3O6GA 1DTZA 4AB6A 3IR1A 4LA9A 1PDAA 1JEVA 3RPWA 1N76A 2DE2A 2Z8DA 4FATA 3QK6A 4IO5A 2F78A 5H8NB 1OQHA 4OANA 4IGTA 1NV5A 3FVOA 3EF7A 1QUIA 3RNNA 4LQ2A 3PPPA 4NF8B 3T93B 3RGYA 2F3DA 3UIFA 1EH3A 4YKKA 1PB8A 4LN5A 3MC2A 3C35A 2Y7KA 2DVCA 3KBRA 4QSDA 1NMUA 3O97A 4PDDA 2H98A 4M4GA 4JVCA 3T9VA 1ZTYA 4MIJA 1OVBA 2XXVA 1LBBA 1IQ7A 3THIA 2ZNTA 3G3GA 1FQBA 3HHFA 5JEIA 3OOAA 2H4IA 5TU0A 2E0SA 3BFUA 1GGGA 3FZVA 4KYDA 1JVXA 2VP1A 4R6KA 1B5IA 1SPIA 4OXVA 3MQ9A 3IFAA 3VXBA 1K9YA 3IOTA 5I7IA 4H6DA 1GTKA 4G8HA 5B70A 2Y5KA 3QIMA 1VSOA 3K6XA 3HHGA 4PFBA 4R72A 4WEDA 4X1BA 4NF0A 2MKZA 4HXVA 3IX1A 3OO7A 4NF4B 3CR9A 1Y3PA 1MXZA 1LEVA 3MBPA 3PUXE 4GWUA 3UGWA 3OSQA 2NVUB 3GBBA 2VHAA 1ZKBA 1FBFA 1IXGA 3T9HB 3PTYA 4IGRA 3GXAA 5I59B 2XWKA 2AL5A 1A54A 2QL3A 2F35A 5IZ1A 4U1ZA 4O8MA 4P11A 5BWJA 3HCQA 3F11A 4HE0A 1ZJLA 4GWWA 4H45A 4ESXA 3BBRA 2Q8JA 3ZS6A 3LSXA 3KOSA 5M2VA 4I8CA 5AA2A 4R75A 2DQVA 3IL1B 5FHMA 3PMVA 4U21A 5CI5A 1FBCA 2GRVA 4JWOA 4HS7A 2I4BA 1MS7A 4ZEIA 3O66A 4O3CA 2OBGA 3N6TA 1RDXA 5ET8A 1I6BA 4MF3A 5ET6A 2I0CA 4OA4A 1YTVA 4RJZA 1QUKA 2HCAA 3CRBA 2NXOA 4UA8A 4OENA 1NV6A 4MLQA 3LUYA 1LGBC 1FPEA 5I57A 3T96B 5DW8A 3IB1A 3QUFA 4MFIA 1EU8A 5AA1A 4MEVA 1FTKA 2Q74A 4ZE8A 4TLLB 1QUJA 1NH8A 1R9QA 1BK4A 4PFRA 3LBSA 3VLUA 4P8BA 4X48A 4JVIA 5CBRA 1IXCA 2QVUA 1LB8A 1TXFA 1SYHA 4GL0A 4MCOA 1BP5A 3O29A 2DWHA 1DSNA 2NOOA 3S9LC 5DEXB 4NHBA 4HE2A 4X04A 2WX9A 1FTOA 1A55A 4HCWA 1JEUA 2QS2A 4DXCA 2ZZWA 1SD3A 2F3BA 3TTKA 1D4NA 1NNTA 3BIGA 1SBPA 3USDA 3LSWA 1A7LA 4R74A 2ESNA 1B32A 2DP8A 1IMEA 5I2NB 1VE4A 1MY1A 1B0HA 2CZLA 3GLBA 1Q1KA 3CFZA 4G8MA 2W7YA 4Q0CA 4YB7A 3RYDA 2HZKA 2XD3A 5I5PA 3SEUA 3RPLA 2D3IA 2RINA 3K6WA 3L6HA 1B7UA 1CE2A 2DWJA 5FTIA 2RCBA 3IB2A 4XEQA 5F7VA 4DI4B 2GHAA 4PFTA 3DP8A 3TELA 1DK4A 3O2AA 3MSTA 3N6UA 5HM4B 2DYXA 2FIXA 3MZ9A 2WKYA 4R6YA 5TP9B 3CSGA 3OEKA 1N7XA 4KCCA 3SERA 1URSA 4YB5A 3M3LA 5DVFA 5BUUA 3T0JA 4ISUA 5KDTA 2D21A 2F6PA 4EF1A 3RT8A 1B1HA 3G3IA 4MJOA 3G7WA 5ET5A 4BDMA 4O94A 1QW0A 3KBZA 3KEIA 4GLIA 3W9VA 4KI0E 4MBPA 4P3LA 2O1LA 2OK2A 4XFEA 4F2OA 1FPKA 3KOTA 4KXPA 3OO9A 4FJPA 1MQHA 5LDZA 3H03A 2XXYA 3TCFA 2Y5LA 4LVQA 4N91A 2F97A 2CZKA 5CMMA 1PBQA 4C1TA 4JWXA 4O3AA 3B6QA 2P3VA 3OD7A 3TUSA 5I56B 1CNQA 4NF5A 4GWXA 3EKIA 5KDTB 1DTGA 4PE5B 1XHYA 3K02A 3KSXA 4F3GA 4N07A 5I58B 4Z7EA 2VD3A 3MZ1A 1IMAA 3MP6A 1JNFA 3C34A 4OWDA 2REJA 4WEPA 4DE8A 3K6VA 4NE4A 3CFLA 2RC8A 4IO3A 5AA4A 3GYYA 1IEJA 4U1OA 4QFKA 2XXRA 4X1DA 3LC8A 1R1NA 1MH4A 3D4CA 5J16A 1G0HA 3HO7A 3ECRA 3TEPA 2O1MA 3IOUA 3CHGA 2Q9TA 3H6VA 1FTAA 3LSLA 2UYFA 1P1NA 4GXAA 3U94A 3LUZA 2CZHA 3E13X 2WYKA 4N6KA 4KCDA 3TTNA 2FBPA 3EHTA 4OMBA 5ICQA 1Y3QA 4EQBA 1B7HA 1MY0A 4OFLA 3TDJA 2DWIA 1NI9A 1OIBA 3EQ1A 3VVFA 3T1BA 1N7WA 5JTYB 1MPCA 4LZ5A 1EZOA 1PBPA 4F1UA 1MM6A 4DCYA 5A5XA 2P3NA 1POTA 5ESYA 1B40A 2DDKA 1NFTA 4MX6A 3KGCA 2AYSA 3OXNA 4QFPA 2CEXA 4GQOA 4PFIA 4G68B 4YZZA 3MJNA 4QSEA 3A3CA 4OFOA 3MWBA 4WKMA 4YKJA 1IIWA 2QMWA 3M8UA 3FV2A 4FBPA 3IK6B 1DPPA 3FXBA 3VFJA 2DVZA 1LFGA 1SW5A 3VLWA 1EZPA 2QS4A 2P1SA 3O28A 2OWSA 4GFRA 4FAJA 3BKIB 2XXHA 4TQUQ 1LAHE 4LATA 4KPTA 4HCYA 1L5TA 2O51A 4ZS9A 2OZZA 1JW1A 5H8SA 3S2VA 4NX1A 5I2KB 4ZECA 1G0IA 4NF4A 1BIYA 4WXJA 3E79A 3UORA 5F24A 4N13A 3MVYA 4N81A 4O3BA 2I4CA 1YCJA 2Y84A 4ONYA 4ZDMA 5EYHA 4JSOA 5ICTA 1NNKA 5DYHA 4FEBA 2ZYNA 2DE3A 1MY4A 1Z7NE 1OLCA 4G61A 4OQOA 1LAGE 4H5GA 2I3WA 1IMFA 1B3GA 2CZIA 2KR0A 4P47A 1H43A 1Y9UA 3GBAA 4JXIA 3VDFA 5CM6A 1MPDA 3HV1A 4I3YA 3UN6A 3CG1A 1VFEA 2UXAA 3SKPA 5ET7A 3HPIA 3PMWA 4LONB 2XXIA 1ZMGA 2V84A 3KC0A 1Y4CA 4H8JA 4DDDA 3ODBA 4RPNA 5CMCA 2R71A 4OEVA 4OVPA 4QF9A 4PAIA 2R9JA 3FJGA 3MZBA 4H0WA 4NF6A 1QULA 5DT6A 4YKIA 1ANFA 1B52A 3SEWA 4Q30B 2HXWA 3PPNA 4R9FA 5TPAA 3PPQA 1QJMA 1IITA 1A40A 1MQIA 4OVQA 1GV8A 2BJIA 4P1LA 2ANJA 4DLDA 3ROJA 2ABHA 2REGA 4PQJA 1H44A 3Q28A 5FTHA 4OHNA 1XS5A 3CG3A 3EPEA 5I2KA 1FPDA 2PMSA 1TWYA 4MMPA 3T9UA 4MNCA 5EYGA 3MPKA 2HEUA 2ONSA 2YPNA 3QAXA 3H6TA 1OMPA 4QFNA 4G2ZA 4XKRA 3PUVE 2XHDA 3VLVA 1IMBA 1MQJA 2I6EA 3HN0A 4HTGA 1H76A 1ELJA 1LB9A 3VE1B 5AA3A 1QVSA 1RYXA 1Y20A 2DWAA 4H46A 4E0XA 1UTHB 1XVYA 1NNPA 4R6HA 1SVXB 4XKQA 4OFJA 4THIA 2AIXA 4GX4A 5AE4A 2I48A 4ZEKA 2XX7A 4IO4A 1JW4A 1B7ZA 4EXLA 1MPBA 1DOTA 4F29A 2A5TA 2PYYA 2I58A 2HAUA 3SEYA 3KSJA 3OSRA 3V83A 3K2DA 5IZZA 1T0KA 2H99A 5TPAB 2Z22A 2I3VA 3E9XA 5H8FA 1LBWA 1NV7A 4YMAA 4X8RA 4EUOA 4OVTA 3DP6A 1IXIA 1RKMA 4PFUA 3PMXA 2PT2A 4GX3A 1IUDA 4ELPA 1PB7A 5DTBA 3UP9A 4EF2A 4FEDA 1FPLA 1BLFA 4LQ5A 4GIZA 3KC1A 4N6DA 2QS1A 1JETA 3K4UA 1FQDA 1R6ZA 3ILUB 2RKMA 1B3LA 4GWSA 3FASA 3TQWA 4JWYA 2GHBA 1FBDA 4HW8A 3R6UA 4QHQA 1DPEA 1AH5A 2RC9A 1NV4A 2B65A 2UVIA 1INPA 1CB6A 1LAXA 2WBDA 3PU5A 3ONMA 3Q26A 5CRYA 4NWCA 3RQTA 2B3BA 1HSEA
chains in the Genus database with same CATH topology
4ELOA 1MQHA 2OCUA 1P1WA 1SW4A 3H03A 2XXYA 1ZU0A 4YICA 3TCFA 4LVQA 2I0BA 1B9JA 2F97A 1SYIA 1LCFA 4R2BA 2Y7IA 2PBWA 5CMMA 2XXTA 4C0RA 2VOZA 3FVKA 1B0LA 1PBQA 3C4MA 5I56A 4C1TA 2F7AA 2X7PA 1FQCA 2F5XA 3QXMA 4JWXA 1LCTA 2QS3A 3B6QA 4K3FA 4O3AA 2LAOA 5FHOA 2V3QA 2F34A 4EXKA 1FW0A 4LZ8A 4FECA 4G77A 5L9MA 4U2RA 4BDQA 1MH3A 4NF6B 3TTRA 1Y4TA 3OD7A 3TUSA 5I56B 2ONRA 5I59A 1UIVA 4NF5A 2Q2AA 3E4RA 4KYSA 5EHMA 3UK4A 5JK4A 5LOMA 5KDTB 3H06B 5FHNA 1DTGA 2DOJA 1B05A 1B4HA 1XHYA 2RC7A 2UVGA 3K02A 3KSXA 4PE5B 4F3GA 5H8NB 4P0IA 5ITPA 5ISUA 2ZYKA 4N07A 3MVXA 1AL3A 1LSTA 1Y3NA 4YAHX 4Z7EA 2VD3A 5I58B 1XC1A 2H25A 1S9TA 3MP6A 3MZ1A 3W9WA 3S9NC 3MP1A 3A3UA 4ELQA 3OEMA 1JNFA 1R9LA 3C34A 4OWDA 2REJA 1GVCA 4F31B 4WEPA 2ZNSA 3TCHA 1I6AA 1AIVA 3GZGA 3IO6A 4DE8A 1SW1A 3FVGA 1US4A 3K6VA 4BDLA 3K00A 4NE4A 1XT8A 4ZEFA 3CFLA 4BDOA 2RC8A 2PX1A 3SEVA 4IO3A 5AA4A 3VXCA 5JTYA 4U1OA 1IEJA 4GWOA 2F7CA 4JB7A 4QFKA 2XXRA 1N84A 4X1DA 5L8DA 3LC8A 1R1NA 1M5DA 1MH4A 3D4CA 1YPNA 3D4GA 3N94A 2V25A 1A8FA 3HO7A 3ECRA 1DTZA 2M8CA 2ZMBA 3IR1A 3O6GA 4AB6A 4LA9A 2O1MA 3TEPA 3EHUA 3IOUA 1PDAA 4F2QA 1JEVA 3RPWA 1N76A 2Q9TA 2DE2A 3H6VA 1N3XA 1POY1 2RF1A 1LBCA 2Z8DA 2F78A 3LSLA 3QK6A 4IO5A 1OQHA 2HAVA 2UYFA 4XTCQ 1P1NA 1ZIUA 2RCAA 3K1MA 4GXAA 3CI8A 2F8DA 4IGTA 3U94A 2O7UA 3FVOA 3T22A 5AA4B 3Q27A 1MXWA 3MVWA 3E13X 4UACA 4OVJA 1D3KA 1JQFA 4KCDA 3OMBA 3EF7A 1FQEA 1QUIA 3TTNA 4BDNA 1MXVA 3OENA 3EHTA 4OMBA 3RNNA 4LQ2A 3N26A 3PPPA 5ICQA 1Y3QA 4NF8B 5ITOA 3I6VA 3RGYA 2AL4A 3T93B 3UIFA 4EQBA 5AA2B 1B7HA 5H8HA 5TP9A 1EH3A 1TFDA 4H1XA 4YKKA 1MY0A 3JYRA 3OO6A 4H67A 4OFLA 4QFLA 2D5WA 4M1VA 1BTJA 3TDJA 2QPQA 3V8XB 2DWIA 1PB8A 4IO7A 2ONKE 1FTJA 4IO2A 4F3PA 3MC2A 4OETA 1LFIA 2B3FA 4ZE9A 2PT1A 1OIBA 4JBZA 2H9BA 3EQ1A 3RTWB 3VVFA 1S7YA 3C35A 3RN8A 4OESA 4FE8A 1N7WA 1HSJA 4XKNA 2Y7KA 2DVCA 3KBRA 3PPRA 1MPCA 4LZ5A 4QSDA 5JTYB 3E3KA 3O6HA 3RLFE 1NMUA 1AMFA 4AB5A 1II5A 3TPAA 1PBPA 1EZOA 1B46A 4PP0A 4F1UA 1M5EA 3O97A 3TTLA 1MM6A 4H8IA 3TKDA 2Q89A 3V5AA 5B7DA 1MDQA 1MDP1 4DCYA 4ZEBA 5A5XA 2H98A 4M4GA 3T9VA 4DCXA 3PPOA 1ZTYA 3TCGA 1D9VA 3SEUA 4IY6A 3IOVA 4OERA 4P0GA 1OVBA 1POTA 3RY3A 4QSCA 2XXVA 1XOCA 1LBBA 1B40A 1IQ7A 4KQPA 1I6QA 1UTBB 3IOWA 3OO8A 1NFTA 4R9GA 3KN8A 3THIA 3KGCA 1SI0A 2AYSA 1B3FA 2ZNTA 3OXNA 3JZJA 2R6GE 4QFPA 3G3GA 2XXUA 4YB6A 4GQOA 1FQBA 3HHFA 5JEIA 3OOAA 2H4IA 3HSTA 3C32A 5TU0A 5K2XA 3IB0A 2XX9A 4JDFA 2E0SA 2G93A 5CMKA 1B5JA 4RY1A 4G68B 3T66A 3FJ7A 3BFUA 1OLAA 1GGGA 3FZVA 4YZZA 3B6WA 1JVXA 2DE4A 2VP1A 2QJEA 3C31A 4KYDA 3K01A 3MJNA 1H3DA 3A3CA 1B4ZA 4OFOA 1B5IA 3MWBA 4GD5A 4QSEA 4WKMA 4OXVA 4L17A 3MQ9A 4NF5B 4YKJA 5L9SA 5KCJA 3VXBA 2H5YA 3MUQA 4KFQA 3IOTA 3U1OA 1IIWA 3CIJA 3PV0E 3KZGA 4H6DA 2QMWA 4OYVA 3H4ZA 1GTKA 1NL5A 3G3KA 4G8HA 5B70A 3M8UA 4RA1A 3IORA 4F3BA 3FV2A 3EN3A 3IK6B 1DPPA 1MXUA 4G68A 4Z0IA 3L6GA 2O69A 2Y7RA 2NWJA 3QIMA 1VSOA 2Q88A 5I58A 3VFJA 2DVZA 2VD2A 3G3JA 1LFGA 3K6XA 1SW5A 1LLSA 4GOTA 3HHGA 3WAFA 3SEXA 3VLWA 1EZPA 4R72A 3SDFA 4WEDA 4F1YA 1M5CA 2QS4A 2P1SA 1NKXA 3MAMA 2OWSA 3O28A 4GFRA 4QFOA 4X1BA 3BKIB 2XXHA 4TQUQ 1LAHE 3SETA 4FAJA 4LATA 1ZBMA 3S9MC 4KPTA 1P1UA 3IX1A 3OO7A 4NF4B 3CR9A 4HCYA 1VR5A 4RYAA 1L5TA 1Y3PA 2O51A 5I84A 4GL8A 4ZS9A 3H7MA 1MXZA 2PVUA 5F1QA 2O7IA 1US5A 4ND9A 2OZZA 1JW1A 4TLMB 5H8SA 3MBPA 3S2VA 3T9XB 1PEBA 3PUXE 2FA7A 5CMBA 5I2KB 4ZECA 4LUBA 2QMXA 4LP2B 4NF4A 3OSQA 3UGWA 2A5SA 1BIYA 1B58A 4WXJA 2NVUB 3GBBA 1SQYA 2VHAA 2F6GA 1ZKBA 1NNFA 1S50A 1QKAA 2UVHA 2V93A 2O68A 3R26A 3TZAA 5CC2A 2Z23A 1UQWA 5IAIA 3UORA 4AQ4A 4YU0A 1IXGA 3S4UA 3T9HB 4IGRA 3KFMA 4NWDA 2XXWA 3QYTA 4N13A 1B6HA 3MVYA 4O3BA 4C1UA 2I4CA 1YCJA 2Y84A 3GXAA 3TAJA 1USYH 4ONYA 1F9BA 4ZDMA 3TFLA 5I59B 2UVJA 2AL5A 4U4SA 3FGSA 4RK2A 2F36A 2O6AA 3RTFB 1P1OA 1YAEA 4JSOA 1A54A 1O64A 1NNKA 5A5XB 2QL3A 1BKAA 4FEBA 5DYHA 5ICTA 2ZYNA 2F35A 3O9PA 4F39A 4GRKA 1PB9A 4Q5TA 4F18A 2DE3A 1B5HA 4JSDA 4U23A 3UA8A 4U1ZA 1MY4A 3H6UA 1UTBA 3I3VA 1Z7NE 1OLCA 3A09A 4OQOA 1LAGE 1ATGA 2VGQA 3MPLA 4H5GA 1M5BA 2I3WA 4GVOA 4P11A 5EYFA 5BWJA 3HCQA 3F11A 3VVDA 1B3GA 4NTLA 2OJTA 1ZJLA 3FATA 3IAZA 4ESXA 1DMBA 1SI1A 5TP9B 1H43A 4R73A 1Y9UA 3BFTA 3GBAA 1MQGA 3PGFA 4JXIA 3CFXA 3BBRA 3FVNA 2Q8JA 4G4PA 3U8QA 3ZS6A 3LSXA 3KOSA 5M2VA 3VDFA 3TYHA 2XXQA 4KYEA 5CM6A 4I8CA 5AA2A 2YLNA 1MPDA 3P7IA 3HV1A 3M3KA 2DQVA 3IL1B 4R75A 4NEDA 5FHMA 3UN6A 3CG1A 3FIRA 1FTLA 1VFEA 4I62A 4POWA 2UXAA 5EHSA 2Z8FA 3PMVA 3SKPA 4ECFA 4U21A 5CI5A 2GRVA 4OTEA 4F1VA 3ZKKA 5I2NA 4ESWA 3FJMA 4JWOA 4HS7A 1USYE 2I4BA 3HPIA 3PMWA 2IEEA 4FIMA 4EQ9A 1ZLQA 5HBCA 1B2HA 1MS7A 2OWTA 1MG1A 2ZYMA 4LONB 2XX8A 4R6KA 3ZKLA 4ZEIA 2DS9A 1ZMGA 2V84A 2XXIA 1MY2A 2OBGA 3O66A 4O3CA 1Y4CA 3N6TA 4H8JA 4ZZEA 1Z7ME 3ODBA 4RPNA 5CMCA 4DDDA 4MH5A 3WAEA 2R71A 2P2AA 3JV9A 4PFYA 4OEVA 1I6BA 4RK9A 3FUZA 1N04A 4RNSA 1XVXA 4MF3A 4TOZA 2I0CA 4QF9A 4DXBA 2R9JA 2X7QA 1YTVA 2XXXA 2XXPA 2ZNUA 3FJGA 4RJZA 1QUKA 3MZBA 4H0WA 4RXLA 2HCAA 2X26A 2THIA 3CRBA 3TMGA 4NF6A 1Q35A 2NXOA 2V3UA 1FQAA 1QULA 4OENA 1WODA 4UA8A 5DT6A 3PD8A 5AA2D 4MLQA 3FXRA 3LUYA 1LGBC 4YKIA 4BDRA 1ANFA 3DP4A 1Y1ZA 1B52A 3SEWA 3MW0A 4Q30B 3IO4A 4XIGQ 5I57A 3G3HA 2HXWA 3T96B 3PPNA 2E1SA 4R9FA 5TPAA 3PPQA 1IITA 1A40A 1MQIA 1QJMA 3IB1A 3QUFA 3N5LA 4MFIA 1GV8A 4YMBA 5IKBA 1EU8A 2ANJA 5AA1A 4DLDA 2OLBA 1D9YA 1OQGA 1FTKA 2ABHA 4ZE8A 2REGA 2UYEA 4TLLB 3KJ7A 1QUJA 2Y7PA 4IO6A 1NH8A 4PQJA 1H44A 2DXRA 3CSBA 3Q28A 1R9QA 1UIUA 2FYIA 5FTHA 4OHNA 1XS5A 3U72A 3CG3A 3EPEA 4I1DA 5I2KA 4DIGA 3LBSA 2HFBA 3VLUA 4X48A 2ZXTA 3FXQA 1IXCA 4X9TA 5CBRA 4DZ1A 1LB8A 1TXFA 2PMSA 1SYHA 4GL0A 1BP5A 1MQDA 1TWYA 3K1NA 3O29A 2DWHA 1DSNA 1FQFA 2NOOA 2Z8EA 2IA4A 4OEUA 3T9UA 2XD2A 5DEXB 4F19A 3S9LC 3QUJA 4ZEDA 1AOVA 3K1PA 3G3FA 3MPKA 2DSFA 2HEUA 2ONSA 2YPNA 3DELB 3QAXA 3H6TA 1OMPA 3U92A 1FTOA 1HSLA 4QFNA 1A55A 3KJTA 3RUMA 2FNCA 1MY3A 4G2ZA 3FV1A 4XKRA 3PUVE 4G68C 2XHDA 3VLVA 4DXUA 5CBSA 5L9OA 1H45A 4KHZE 4HCWA 1JEUA 2QS2A 1MQJA 2I6EA 3HN0A 4HTGA 1H76A 3PUWE 1SD3A 1ELJA 2QSXA 4DXCA 4F3SA 1WVJA 1LB9A 3OELA 1PC3A 4POXA 3TTKA 3VE1B 1D4NA 1NNTA 3V89B 5AA3A 1MRPA 1SBPA 1QVSA 4U4XA 3TTMA 3USDA 1JVYA 1RYXA 3LSWA 1Y20A 3TODA 5DVIA 1IXHA 2DWAA 3C33A 1A7LA 4LZ7A 2P0SA 4R74A 1JW5A 2ESNA 4E0XA 1UTHB 1B32A 2DP8A 4EDPA 1MXYA 4PFWA 5J1DA 3VVEA 5I2NB 1VE4A 1MY1A 1XVYA 1NNPA 3H6WA 1EZ9A 1SDXA 4R6HA 3VV5A 3QSLA 2KLFA 1SVXB 4XKQA 1B0HA 2NUVA 4Q8RA 3KN7A 4IB2A 4OFJA 4THIA 3U93A 1UTHA 4E0WA 3W15C 1LFHA 2CZLA 4YKPA 2AIXA 3GLBA 1B51A 1J1NA 4KR5A 2I48A 5AE4A 4ZEKA 1B1XA 1VFDA 2XX7A 4IO4A 4OZ9A 1A8EA 1GR2A 1JW4A 1Q1KA 3CFZA 3B6TA 1B7ZA 4G8MA 4XXUA 4EXLA 2W7YA 3Q25A 5KZTA 1MPBA 1DOTA 2GFEA 4FORA 5I57B 4Q0CA 4YB7A 4F29A 2A5TA 1TT1A 3TQLA 1KWHA 2HZKA 4H65A 4H5FA 2XD3A 2PYYA 1IZ1A 4MLVA 3KG2A 1A99A 1O63A 1P1QA 2I58A 2HAUA 3C36A 2D3IA 3MVZA 4IY5A 2RINA 3R7XA 3SEYA 2ZYOA 3KSJA 2DXYA 3H3GA 3K6WA 1B7UA 3L6HA 1CE2A 2DWJA 4N6PA 5FTIA 2V3TA 3OSRA 3FD3A 3V83A 3K2DA 2RCBA 3IB2A 1T0KA 2H99A 5HPQA 5TPAB 5F7VA 2A5TB 1N3WA 2Z22A 1OVTA 2GHAA 2I3VA 4PFTA 3FXUA 3SESA 1NH7A 2G29A 4GXSB 3E9XA 3PUZE 5H8FA 4KD5A 3DP8A 3TELA 3Q29A 3O2AA 4YMAA 1O7TA 4EUOA 5H8QB 5H8QA 1MM7A 1URGA 3DP6A 1IXIA 1RKMA 2F7BA 2BJJX 3PD9A 3N6UA 1SW2A 4ELRA 5HM4B 2DYXA 5KCJB 4PFUA 1M5FA 3M3FA 3PMXA 4RPOA 5ELVA 2PT2A 2QRYA 3S9EA 1IUDA 3ILTB 3MZ9A 1MXXA 2WKYA 4ELPA 4R6YA 5H8HB 1B3EA 2CMOA 3CSGA 3EHSA 1PB7A 2HQ0A 3LSFB 3O6IA 1N7XA 3DM0A 3OEKA 4NMYA 5DTBA 4QRZA 3K0VA 4KCCA 3UP9A 4EF2A 4FEDA 1B3HA 1BLFA 2Y7WA 4LQ5A 5H8NA 4GIZA 3SERA 1URSA 4FATA 4YB5A 3K6UA 3M3LA 5DVFA 5BUUA 3KN3A 2GH9A 2QS1A 3MP8A 4ISUA 2YJPA 1JETA 3B7DA 3K4UA 1FQDA 1R6ZA 4PETA 5KDTA 2D21A 1P99A 1RYOA 2F6PA 3DLNA 1N0TA 2O84X 1LAFE 3IJXB 3PUYE 5DVJA 3ILUB 1URDA 3RT8A 1B1HA 1WDNA 4EF1A 3G3IA 5DEXA 4R2FA 2RKMA 2HZLA 4BLAA 1Y1MA 1B3LA 3FASA 1FTMA 1I69A 2GHBA 3LR1A 3G7WA 4JWYA 4ZZAA 3TQWA 4HW8A 3R6UA 4FJPA 4NF8A 4QHQA 1DPEA 1TFAA 4BDMA 1AH5A 2RC9A 4F22A 4I9DA 2B65A 2UVIA 1QW0A 5H8FB 3W9VA 3KEIA 4GLIA 5K2YA 1CB6A 4EQ7A 4KI0E 4MBPA 2Q2CA 3I5OA 3RT6B 3ZSFA 1FCKA 1LAXA 4GF8A 3PU5A 3CVGA 3ONMA 1QKBA 4G8NA 2I49A 2ALUA 2O1LA 2OK2A 3AXFA 3Q26A 5CRYA 4F2OA 4NWCA 4XKPA 3RQTA 3KOTA 2B3BA 3OO9A 3IJOB 1HSEA 3C9HA 4U22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELO A;  1MQH A;  2OCU A;  1P1W A;  1SW4 A;  3H03 A;  2XXY A;  1ZU0 A;  4YIC A;  3TCF A;  4LVQ A;  2I0B A;  1B9J A;  2F97 A;  1SYI A;  1LCF A;  4R2B A;  2Y7I A;  2PBW A;  5CMM A;  2XXT A;  4C0R A;  2VOZ A;  3FVK A;  1B0L A;  1PBQ A;  3C4M A;  5I56 A;  4C1T A;  2F7A A;  2X7P A;  1FQC A;  2F5X A;  3QXM A;  4JWX A;  1LCT A;  2QS3 A;  3B6Q A;  4K3F A;  4O3A A;  2LAO A;  5FHO A;  2V3Q A;  2F34 A;  4EXK A;  1FW0 A;  4LZ8 A;  4FEC A;  4G77 A;  5L9M A;  4U2R A;  4BDQ A;  1MH3 A;  4NF6 B;  3TTR A;  1Y4T A;  3OD7 A;  3TUS A;  5I56 B;  2ONR A;  5I59 A;  1UIV A;  4NF5 A;  2Q2A A;  3E4R A;  4KYS A;  5EHM A;  3UK4 A;  5JK4 A;  5LOM A;  5KDT B;  3H06 B;  5FHN A;  1DTG A;  2DOJ A;  1B05 A;  1B4H A;  1XHY A;  2RC7 A;  2UVG A;  3K02 A;  3KSX A;  4PE5 B;  4F3G A;  5H8N B;  4P0I A;  5ITP A;  5ISU A;  2ZYK A;  4N07 A;  3MVX A;  1AL3 A;  1LST A;  1Y3N A;  4YAH X;  4Z7E A;  2VD3 A;  5I58 B;  1XC1 A;  2H25 A;  1S9T A;  3MP6 A;  3MZ1 A;  3W9W A;  3S9N C;  3MP1 A;  3A3U A;  4ELQ A;  3OEM A;  1JNF A;  1R9L A;  3C34 A;  4OWD A;  2REJ A;  1GVC A;  4F31 B;  4WEP A;  2ZNS A;  3TCH A;  1I6A A;  1AIV A;  3GZG A;  3IO6 A;  4DE8 A;  1SW1 A;  3FVG A;  1US4 A;  3K6V A;  4BDL A;  3K00 A;  4NE4 A;  1XT8 A;  4ZEF A;  3CFL A;  4BDO A;  2RC8 A;  2PX1 A;  3SEV A;  4IO3 A;  5AA4 A;  3VXC A;  5JTY A;  4U1O A;  1IEJ A;  4GWO A;  2F7C A;  4JB7 A;  4QFK A;  2XXR A;  1N84 A;  4X1D A;  5L8D A;  3LC8 A;  1R1N A;  1M5D A;  1MH4 A;  3D4C A;  1YPN A;  3D4G A;  3N94 A;  2V25 A;  1A8F A;  3HO7 A;  3ECR A;  1DTZ A;  2M8C A;  2ZMB A;  3IR1 A;  3O6G A;  4AB6 A;  4LA9 A;  2O1M A;  3TEP A;  3EHU A;  3IOU A;  1PDA A;  4F2Q A;  1JEV A;  3RPW A;  1N76 A;  2Q9T A;  2DE2 A;  3H6V A;  1N3X A;  1POY 1;  2RF1 A;  1LBC A;  2Z8D A;  2F78 A;  3LSL A;  3QK6 A;  4IO5 A;  1OQH A;  2HAV A;  2UYF A;  4XTC Q;  1P1N A;  1ZIU A;  2RCA A;  3K1M A;  4GXA A;  3CI8 A;  2F8D A;  4IGT A;  3U94 A;  2O7U A;  3FVO A;  3T22 A;  5AA4 B;  3Q27 A;  1MXW A;  3MVW A;  3E13 X;  4UAC A;  4OVJ A;  1D3K A;  1JQF A;  4KCD A;  3OMB A;  3EF7 A;  1FQE A;  1QUI A;  3TTN A;  4BDN A;  1MXV A;  3OEN A;  3EHT A;  4OMB A;  3RNN A;  4LQ2 A;  3N26 A;  3PPP A;  5ICQ A;  1Y3Q A;  4NF8 B;  5ITO A;  3I6V A;  3RGY A;  2AL4 A;  3T93 B;  3UIF A;  4EQB A;  5AA2 B;  1B7H A;  5H8H A;  5TP9 A;  1EH3 A;  1TFD A;  4H1X A;  4YKK A;  1MY0 A;  3JYR A;  3OO6 A;  4H67 A;  4OFL A;  4QFL A;  2D5W A;  4M1V A;  1BTJ A;  3TDJ A;  2QPQ A;  3V8X B;  2DWI A;  1PB8 A;  4IO7 A;  2ONK E;  1FTJ A;  4IO2 A;  4F3P A;  3MC2 A;  4OET A;  1LFI A;  2B3F A;  4ZE9 A;  2PT1 A;  1OIB A;  4JBZ A;  2H9B A;  3EQ1 A;  3RTW B;  3VVF A;  1S7Y A;  3C35 A;  3RN8 A;  4OES A;  4FE8 A;  1N7W A;  1HSJ A;  4XKN A;  2Y7K A;  2DVC A;  3KBR A;  3PPR A;  1MPC A;  4LZ5 A;  4QSD A;  5JTY B;  3E3K A;  3O6H A;  3RLF E;  1NMU A;  1AMF A;  4AB5 A;  1II5 A;  3TPA A;  1PBP A;  1EZO A;  1B46 A;  4PP0 A;  4F1U A;  1M5E A;  3O97 A;  3TTL A;  1MM6 A;  4H8I A;  3TKD A;  2Q89 A;  3V5A A;  5B7D A;  1MDQ A;  1MDP 1;  4DCY A;  4ZEB A;  5A5X A;  2H98 A;  4M4G A;  3T9V A;  4DCX A;  3PPO A;  1ZTY A;  3TCG A;  1D9V A;  3SEU A;  4IY6 A;  3IOV A;  4OER A;  4P0G A;  1OVB A;  1POT A;  3RY3 A;  4QSC A;  2XXV A;  1XOC A;  1LBB A;  1B40 A;  1IQ7 A;  4KQP A;  1I6Q A;  1UTB B;  3IOW A;  3OO8 A;  1NFT A;  4R9G A;  3KN8 A;  3THI A;  3KGC A;  1SI0 A;  2AYS A;  1B3F A;  2ZNT A;  3OXN A;  3JZJ A;  2R6G E;  4QFP A;  3G3G A;  2XXU A;  4YB6 A;  4GQO A;  1FQB A;  3HHF A;  5JEI A;  3OOA A;  2H4I A;  3HST A;  3C32 A;  5TU0 A;  5K2X A;  3IB0 A;  2XX9 A;  4JDF A;  2E0S A;  2G93 A;  5CMK A;  1B5J A;  4RY1 A;  4G68 B;  3T66 A;  3FJ7 A;  3BFU A;  1OLA A;  1GGG A;  3FZV A;  4YZZ A;  3B6W A;  1JVX A;  2DE4 A;  2VP1 A;  2QJE A;  3C31 A;  4KYD A;  3K01 A;  3MJN A;  1H3D A;  3A3C A;  1B4Z A;  4OFO A;  1B5I A;  3MWB A;  4GD5 A;  4QSE A;  4WKM A;  4OXV A;  4L17 A;  3MQ9 A;  4NF5 B;  4YKJ A;  5L9S A;  5KCJ A;  3VXB A;  2H5Y A;  3MUQ A;  4KFQ A;  3IOT A;  3U1O A;  1IIW A;  3CIJ A;  3PV0 E;  3KZG A;  4H6D A;  2QMW A;  4OYV A;  3H4Z A;  1GTK A;  1NL5 A;  3G3K A;  4G8H A;  5B70 A;  3M8U A;  4RA1 A;  3IOR A;  4F3B A;  3FV2 A;  3EN3 A;  3IK6 B;  1DPP A;  1MXU A;  4G68 A;  4Z0I A;  3L6G A;  2O69 A;  2Y7R A;  2NWJ A;  3QIM A;  1VSO A;  2Q88 A;  5I58 A;  3VFJ A;  2DVZ A;  2VD2 A;  3G3J A;  1LFG A;  3K6X A;  1SW5 A;  1LLS A;  4GOT A;  3HHG A;  3WAF A;  3SEX A;  3VLW A;  1EZP A;  4R72 A;  3SDF A;  4WED A;  4F1Y A;  1M5C A;  2QS4 A;  2P1S A;  1NKX A;  3MAM A;  2OWS A;  3O28 A;  4GFR A;  4QFO A;  4X1B A;  3BKI B;  2XXH A;  4TQU Q;  1LAH E;  3SET A;  4FAJ A;  4LAT A;  1ZBM A;  3S9M C;  4KPT A;  1P1U A;  3IX1 A;  3OO7 A;  4NF4 B;  3CR9 A;  4HCY A;  1VR5 A;  4RYA A;  1L5T A;  1Y3P A;  2O51 A;  5I84 A;  4GL8 A;  4ZS9 A;  3H7M A;  1MXZ A;  2PVU A;  5F1Q A;  2O7I A;  1US5 A;  4ND9 A;  2OZZ A;  1JW1 A;  4TLM B;  5H8S A;  3MBP A;  3S2V A;  3T9X B;  1PEB A;  3PUX E;  2FA7 A;  5CMB A;  5I2K B;  4ZEC A;  4LUB A;  2QMX A;  4LP2 B;  4NF4 A;  3OSQ A;  3UGW A;  2A5S A;  1BIY A;  1B58 A;  4WXJ A;  2NVU B;  3GBB A;  1SQY A;  2VHA A;  2F6G A;  1ZKB A;  1NNF A;  1S50 A;  1QKA A;  2UVH A;  2V93 A;  2O68 A;  3R26 A;  3TZA A;  5CC2 A;  2Z23 A;  1UQW A;  5IAI A;  3UOR A;  4AQ4 A;  4YU0 A;  1IXG A;  3S4U A;  3T9H B;  4IGR A;  3KFM A;  4NWD A;  2XXW A;  3QYT A;  4N13 A;  1B6H A;  3MVY A;  4O3B A;  4C1U A;  2I4C A;  1YCJ A;  2Y84 A;  3GXA A;  3TAJ A;  1USY H;  4ONY A;  1F9B A;  4ZDM A;  3TFL A;  5I59 B;  2UVJ A;  2AL5 A;  4U4S A;  3FGS A;  4RK2 A;  2F36 A;  2O6A A;  3RTF B;  1P1O A;  1YAE A;  4JSO A;  1A54 A;  1O64 A;  1NNK A;  5A5X B;  2QL3 A;  1BKA A;  4FEB A;  5DYH A;  5ICT A;  2ZYN A;  2F35 A;  3O9P A;  4F39 A;  4GRK A;  1PB9 A;  4Q5T A;  4F18 A;  2DE3 A;  1B5H A;  4JSD A;  4U23 A;  3UA8 A;  4U1Z A;  1MY4 A;  3H6U A;  1UTB A;  3I3V A;  1Z7N E;  1OLC A;  3A09 A;  4OQO A;  1LAG E;  1ATG A;  2VGQ A;  3MPL A;  4H5G A;  1M5B A;  2I3W A;  4GVO A;  4P11 A;  5EYF A;  5BWJ A;  3HCQ A;  3F11 A;  3VVD A;  1B3G A;  4NTL A;  2OJT A;  1ZJL A;  3FAT A;  3IAZ A;  4ESX A;  1DMB A;  1SI1 A;  5TP9 B;  1H43 A;  4R73 A;  1Y9U A;  3BFT A;  3GBA A;  1MQG A;  3PGF A;  4JXI A;  3CFX A;  3BBR A;  3FVN A;  2Q8J A;  4G4P A;  3U8Q A;  3ZS6 A;  3LSX A;  3KOS A;  5M2V A;  3VDF A;  3TYH A;  2XXQ A;  4KYE A;  5CM6 A;  4I8C A;  5AA2 A;  2YLN A;  1MPD A;  3P7I A;  3HV1 A;  3M3K A;  2DQV A;  3IL1 B;  4R75 A;  4NED A;  5FHM A;  3UN6 A;  3CG1 A;  3FIR A;  1FTL A;  1VFE A;  4I62 A;  4POW A;  2UXA A;  5EHS A;  2Z8F A;  3PMV A;  3SKP A;  4ECF A;  4U21 A;  5CI5 A;  2GRV A;  4OTE A;  4F1V A;  3ZKK A;  5I2N A;  4ESW A;  3FJM A;  4JWO A;  4HS7 A;  1USY E;  2I4B A;  3HPI A;  3PMW A;  2IEE A;  4FIM A;  4EQ9 A;  1ZLQ A;  5HBC A;  1B2H A;  1MS7 A;  2OWT A;  1MG1 A;  2ZYM A;  4LON B;  2XX8 A;  4R6K A;  3ZKL A;  4ZEI A;  2DS9 A;  1ZMG A;  2V84 A;  2XXI A;  1MY2 A;  2OBG A;  3O66 A;  4O3C A;  1Y4C A;  3N6T A;  4H8J A;  4ZZE A;  1Z7M E;  3ODB A;  4RPN A;  5CMC A;  4DDD A;  4MH5 A;  3WAE A;  2R71 A;  2P2A A;  3JV9 A;  4PFY A;  4OEV A;  1I6B A;  4RK9 A;  3FUZ A;  1N04 A;  4RNS A;  1XVX A;  4MF3 A;  4TOZ A;  2I0C A;  4QF9 A;  4DXB A;  2R9J A;  2X7Q A;  1YTV A;  2XXX A;  2XXP A;  2ZNU A;  3FJG A;  4RJZ A;  1QUK A;  3MZB A;  4H0W A;  4RXL A;  2HCA A;  2X26 A;  2THI A;  3CRB A;  3TMG A;  4NF6 A;  1Q35 A;  2NXO A;  2V3U A;  1FQA A;  1QUL A;  4OEN A;  1WOD A;  4UA8 A;  5DT6 A;  3PD8 A;  5AA2 D;  4MLQ A;  3FXR A;  3LUY A;  1LGB C;  4YKI A;  4BDR A;  1ANF A;  3DP4 A;  1Y1Z A;  1B52 A;  3SEW A;  3MW0 A;  4Q30 B;  3IO4 A;  4XIG Q;  5I57 A;  3G3H A;  2HXW A;  3T96 B;  3PPN A;  2E1S A;  4R9F A;  5TPA A;  3PPQ A;  1IIT A;  1A40 A;  1MQI A;  1QJM A;  3IB1 A;  3QUF A;  3N5L A;  4MFI A;  1GV8 A;  4YMB A;  5IKB A;  1EU8 A;  2ANJ A;  5AA1 A;  4DLD A;  2OLB A;  1D9Y A;  1OQG A;  1FTK A;  2ABH A;  4ZE8 A;  2REG A;  2UYE A;  4TLL B;  3KJ7 A;  1QUJ A;  2Y7P A;  4IO6 A;  1NH8 A;  4PQJ A;  1H44 A;  2DXR A;  3CSB A;  3Q28 A;  1R9Q A;  1UIU A;  2FYI A;  5FTH A;  4OHN A;  1XS5 A;  3U72 A;  3CG3 A;  3EPE A;  4I1D A;  5I2K A;  4DIG A;  3LBS A;  2HFB A;  3VLU A;  4X48 A;  2ZXT A;  3FXQ A;  1IXC A;  4X9T A;  5CBR A;  4DZ1 A;  1LB8 A;  1TXF A;  2PMS A;  1SYH A;  4GL0 A;  1BP5 A;  1MQD A;  1TWY A;  3K1N A;  3O29 A;  2DWH A;  1DSN A;  1FQF A;  2NOO A;  2Z8E A;  2IA4 A;  4OEU A;  3T9U A;  2XD2 A;  5DEX B;  4F19 A;  3S9L C;  3QUJ A;  4ZED A;  1AOV A;  3K1P A;  3G3F A;  3MPK A;  2DSF A;  2HEU A;  2ONS A;  2YPN A;  3DEL B;  3QAX A;  3H6T A;  1OMP A;  3U92 A;  1FTO A;  1HSL A;  4QFN A;  1A55 A;  3KJT A;  3RUM A;  2FNC A;  1MY3 A;  4G2Z A;  3FV1 A;  4XKR A;  3PUV E;  4G68 C;  2XHD A;  3VLV A;  4DXU A;  5CBS A;  5L9O A;  1H45 A;  4KHZ E;  4HCW A;  1JEU A;  2QS2 A;  1MQJ A;  2I6E A;  3HN0 A;  4HTG A;  1H76 A;  3PUW E;  1SD3 A;  1ELJ A;  2QSX A;  4DXC A;  4F3S A;  1WVJ A;  1LB9 A;  3OEL A;  1PC3 A;  4POX A;  3TTK A;  3VE1 B;  1D4N A;  1NNT A;  3V89 B;  5AA3 A;  1MRP A;  1SBP A;  1QVS A;  4U4X A;  3TTM A;  3USD A;  1JVY A;  1RYX A;  3LSW A;  1Y20 A;  3TOD A;  5DVI A;  1IXH A;  2DWA A;  3C33 A;  1A7L A;  4LZ7 A;  2P0S A;  4R74 A;  1JW5 A;  2ESN A;  4E0X A;  1UTH B;  1B32 A;  2DP8 A;  4EDP A;  1MXY A;  4PFW A;  5J1D A;  3VVE A;  5I2N B;  1VE4 A;  1MY1 A;  1XVY A;  1NNP A;  3H6W A;  1EZ9 A;  1SDX A;  4R6H A;  3VV5 A;  3QSL A;  2KLF A;  1SVX B;  4XKQ A;  1B0H A;  2NUV A;  4Q8R A;  3KN7 A;  4IB2 A;  4OFJ A;  4THI A;  3U93 A;  1UTH A;  4E0W A;  3W15 C;  1LFH A;  2CZL A;  4YKP A;  2AIX A;  3GLB A;  1B51 A;  1J1N A;  4KR5 A;  2I48 A;  5AE4 A;  4ZEK A;  1B1X A;  1VFD A;  2XX7 A;  4IO4 A;  4OZ9 A;  1A8E A;  1GR2 A;  1JW4 A;  1Q1K A;  3CFZ A;  3B6T A;  1B7Z A;  4G8M A;  4XXU A;  4EXL A;  2W7Y A;  3Q25 A;  5KZT A;  1MPB A;  1DOT A;  2GFE A;  4FOR A;  5I57 B;  4Q0C A;  4YB7 A;  4F29 A;  2A5T A;  1TT1 A;  3TQL A;  1KWH A;  2HZK A;  4H65 A;  4H5F A;  2XD3 A;  2PYY A;  1IZ1 A;  4MLV A;  3KG2 A;  1A99 A;  1O63 A;  1P1Q A;  2I58 A;  2HAU A;  3C36 A;  2D3I A;  3MVZ A;  4IY5 A;  2RIN A;  3R7X A;  3SEY A;  2ZYO A;  3KSJ A;  2DXY A;  3H3G A;  3K6W A;  1B7U A;  3L6H A;  1CE2 A;  2DWJ A;  4N6P A;  5FTI A;  2V3T A;  3OSR A;  3FD3 A;  3V83 A;  3K2D A;  2RCB A;  3IB2 A;  1T0K A;  2H99 A;  5HPQ A;  5TPA B;  5F7V A;  2A5T B;  1N3W A;  2Z22 A;  1OVT A;  2GHA A;  2I3V A;  4PFT A;  3FXU A;  3SES A;  1NH7 A;  2G29 A;  4GXS B;  3E9X A;  3PUZ E;  5H8F A;  4KD5 A;  3DP8 A;  3TEL A;  3Q29 A;  3O2A A;  4YMA A;  1O7T A;  4EUO A;  5H8Q B;  5H8Q A;  1MM7 A;  1URG A;  3DP6 A;  1IXI A;  1RKM A;  2F7B A;  2BJJ X;  3PD9 A;  3N6U A;  1SW2 A;  4ELR A;  5HM4 B;  2DYX A;  5KCJ B;  4PFU A;  1M5F A;  3M3F A;  3PMX A;  4RPO A;  5ELV A;  2PT2 A;  2QRY A;  3S9E A;  1IUD A;  3ILT B;  3MZ9 A;  1MXX A;  2WKY A;  4ELP A;  4R6Y A;  5H8H B;  1B3E A;  2CMO A;  3CSG A;  3EHS A;  1PB7 A;  2HQ0 A;  3LSF B;  3O6I A;  1N7X A;  3DM0 A;  3OEK A;  4NMY A;  5DTB A;  4QRZ A;  3K0V A;  4KCC A;  3UP9 A;  4EF2 A;  4FED A;  1B3H A;  1BLF A;  2Y7W A;  4LQ5 A;  5H8N A;  4GIZ A;  3SER A;  1URS A;  4FAT A;  4YB5 A;  3K6U A;  3M3L A;  5DVF A;  5BUU A;  3KN3 A;  2GH9 A;  2QS1 A;  3MP8 A;  4ISU A;  2YJP A;  1JET A;  3B7D A;  3K4U A;  1FQD A;  1R6Z A;  4PET A;  5KDT A;  2D21 A;  1P99 A;  1RYO A;  2F6P A;  3DLN A;  1N0T A;  2O84 X;  1LAF E;  3IJX B;  3PUY E;  5DVJ A;  3ILU B;  1URD A;  3RT8 A;  1B1H A;  1WDN A;  4EF1 A;  3G3I A;  5DEX A;  4R2F A;  2RKM A;  2HZL A;  4BLA A;  1Y1M A;  1B3L A;  3FAS A;  1FTM A;  1I69 A;  2GHB A;  3LR1 A;  3G7W A;  4JWY A;  4ZZA A;  3TQW A;  4HW8 A;  3R6U A;  4FJP A;  4NF8 A;  4QHQ A;  1DPE A;  1TFA A;  4BDM A;  1AH5 A;  2RC9 A;  4F22 A;  4I9D A;  2B65 A;  2UVI A;  1QW0 A;  5H8F B;  3W9V A;  3KEI A;  4GLI A;  5K2Y A;  1CB6 A;  4EQ7 A;  4KI0 E;  4MBP A;  2Q2C A;  3I5O A;  3RT6 B;  3ZSF A;  1FCK A;  1LAX A;  4GF8 A;  3PU5 A;  3CVG A;  3ONM A;  1QKB A;  4G8N A;  2I49 A;  2ALU A;  2O1L A;  2OK2 A;  3AXF A;  3Q26 A;  5CRY A;  4F2O A;  4NWC A;  4XKP A;  3RQT A;  3KOT A;  2B3B A;  3OO9 A;  3IJO B;  1HSE A;  3C9H A;  4U22 A; 
#chains in the Genus database with same CATH topology
 4ELO A;  5IGA A;  1SW4 A;  1ZU0 A;  1FJ6 A;  1LCF A;  2PBW A;  2VPN A;  1FQC A;  4HE1 A;  5FHO A;  4XF5 A;  1FW0 A;  4FEC A;  1MH3 A;  1NV1 A;  3FBP A;  1Y4T A;  2ONR A;  1UIV A;  5LOM A;  5JK4 A;  4O7M A;  2DOJ A;  5ITP A;  3MVX A;  1AL3 A;  1Y3N A;  1S9T A;  2WBB A;  1FPB A;  4ELQ A;  1R9L A;  1GVC A;  4PBH A;  4F31 B;  2JJK A;  2ZNS A;  1I6A A;  3TCH A;  1AIV A;  3GZG A;  3FVG A;  4ZEF A;  4BDO A;  2PX1 A;  5JTY A;  4GWO A;  1FPF A;  2V25 A;  2M8C A;  3EHU A;  2Q8M A;  1FPG A;  1VDW A;  1DCU A;  1NV3 A;  2RF1 A;  4F18 A;  1LBC A;  2RCA A;  4QBA A;  3LV0 A;  4AS4 A;  2O7U A;  4QXD A;  4N17 A;  1MXW A;  4OVJ A;  3OMB A;  1FQE A;  3OEN A;  3N26 A;  5ITO A;  5AA2 B;  5TP9 A;  1TFD A;  3OO6 A;  4QFL A;  4M1V A;  1BTJ A;  4IO7 A;  1FTJ A;  4IO2 A;  4PBQ A;  5FBP A;  5I3S A;  3RTW B;  4ZE9 A;  2H9B A;  2XXK A;  1HSJ A;  4XKN A;  3PPR A;  1AMF A;  1II5 A;  3TPA A;  1B46 A;  2Q89 A;  4P1E A;  1MDP 1;  4ZEB A;  4DCX A;  3PPO A;  4IY6 A;  3IOV A;  4OER A;  4QSC A;  1XOC A;  4KQP A;  1I6Q A;  3IOW A;  4R9G A;  3KN8 A;  1B3F A;  3JZJ A;  4YB6 A;  5K2X A;  3IB0 A;  4JDF A;  2G93 A;  4RY1 A;  3T66 A;  3FJ7 A;  4P56 A;  1OLA A;  4Z0I A;  3B6W A;  2DE4 A;  3A29 A;  3C31 A;  4GD5 A;  5T3J A;  4NF5 B;  3U1O A;  3PV0 E;  3KZG A;  4IR8 A;  4OYV A;  1NL5 A;  4RA1 A;  3IOR A;  3EN3 A;  4PAK A;  2Q88 A;  2VD2 A;  3G3J A;  4GBW A;  1EYJ A;  1NKX A;  3MAM A;  1NV2 A;  3S9M C;  1RDY A;  5I84 A;  1VR5 A;  3H7M A;  2PVU A;  1US5 A;  4ND9 A;  3B8B A;  2PFY A;  3T9X B;  2QMX A;  1B58 A;  1NNF A;  1S50 A;  2V93 A;  2O68 A;  5CC2 A;  2Z23 A;  4AS5 A;  4YU0 A;  3S4U A;  2XXW A;  1LBX A;  4C1U A;  3TAJ A;  1USY H;  2FIE A;  1F9B A;  2UVJ A;  4RK2 A;  2F36 A;  2O6A A;  1P1O A;  1YAE A;  3B50 A;  1O64 A;  5A5X B;  1BKA A;  4OVS A;  3O9P A;  1PB9 A;  3UA8 A;  4JSD A;  4U23 A;  3A09 A;  2VGQ A;  3MPL A;  3VVD A;  2OJT A;  3FAT A;  1SI1 A;  3FVN A;  3TYH A;  2XXQ A;  4KYE A;  2YLN A;  3FIR A;  4POW A;  5EHS A;  4OTE A;  2HHM A;  1FBH A;  3ZKK A;  5I2N A;  3FJM A;  4FIM A;  5HBC A;  2OWT A;  1MG1 A;  2XX8 A;  1KA0 A;  3ZKL A;  2DS9 A;  4ZZE A;  4F2Q A;  1Z7M E;  2PFZ A;  2XWO A;  4MH5 A;  4PFY A;  3FUZ A;  1XVX A;  2XXP A;  4RXL A;  2X26 A;  1Q35 A;  3PD8 A;  5AA2 D;  4MNP A;  3FXR A;  4BDR A;  3DP4 A;  1Y1Z A;  3MW0 A;  3IO4 A;  2E1S A;  4YMB A;  4DI3 D;  1Q9D A;  1OQG A;  4IO6 A;  2DXR A;  1UIU A;  2FYI A;  1KZ8 A;  3U72 A;  4UAB A;  3FXQ A;  2XWI A;  4DZ1 A;  1MQD A;  4PE3 A;  4OEU A;  2IA4 A;  4F19 A;  3QUJ A;  1AOV A;  3U92 A;  1HSL A;  3KJT A;  3RUM A;  2FNC A;  1MY3 A;  1NUZ A;  3FV1 A;  5L9O A;  4DXU A;  1H45 A;  2QVV A;  1FBG A;  3PUW E;  1WVJ A;  3OEL A;  4POX A;  5IAI A;  4U4X A;  1JVY A;  1AWB A;  3TOD A;  2P0S A;  2WEF A;  3H6W A;  1SDX A;  3VV5 A;  3QSL A;  2KLF A;  2NUV A;  4IB2 A;  3W15 C;  4GWY A;  4YKP A;  4KR5 A;  1B1X A;  1A8E A;  2GFE A;  4FOR A;  1NV0 A;  4I3E A;  3TQL A;  4H5F A;  1IZ1 A;  4MLV A;  1A99 A;  1P1Q A;  2ZYO A;  2DXY A;  3H3G A;  5HPQ A;  4N4U A;  2A5T B;  1N3W A;  1OVT A;  3SES A;  3FXU A;  4KD5 A;  2QFL A;  3Q29 A;  1KA1 A;  5H8Q A;  2F7B A;  3PD9 A;  1SW2 A;  4ELR A;  5KCJ B;  1M5F A;  1FBE A;  2QRY A;  2KQZ A;  1MXX A;  1B3E A;  3EHS A;  2HQ0 A;  3DM0 A;  4NMY A;  5IZ3 B;  4QRZ A;  4I40 A;  3MP8 A;  2YJP A;  1P99 A;  1RYO A;  1N0T A;  2O84 X;  3IJX B;  3PUY E;  5EQ9 A;  5DVJ A;  1URD A;  5LTC A;  1WDN A;  4BLA A;  2HZL A;  1Y1M A;  4NG7 A;  1FTM A;  4ZZA A;  4NF8 A;  1IMC A;  1TFA A;  4F22 A;  4I9D A;  5K2Y A;  4EQ7 A;  2Q2C A;  3E78 A;  1FCK A;  3CVG A;  4G8N A;  1FPI A;  1QKB A;  2CEY A;  2I49 A;  2ALU A;  4XKP A;  1NUY A;  3IJO B;  2R8T A;  2XA5 A;  4U22 A;  1B9J A;  1SYI A;  3SZP A;  4C0R A;  2VOZ A;  5I56 A;  2X7P A;  3U93 A;  5I59 A;  4K3F A;  2QS3 A;  2LAO A;  5IZ3 A;  3BIH A;  2F34 A;  4LZ8 A;  4G77 A;  4PTK A;  4NF6 B;  2Q2A A;  3E4R A;  4KYS A;  3UK4 A;  1B05 A;  2ZZV A;  4P0I A;  2ZYK A;  4YAH X;  1LST A;  2H25 A;  3OEM A;  2FHY A;  3IO6 A;  2L5V A;  1SW1 A;  2OX3 A;  1US4 A;  4BDL A;  3K00 A;  1XT8 A;  1FJ9 A;  2F7C A;  1N84 A;  3D4G A;  1YPN A;  2ZMB A;  2V4C A;  1N3X A;  1POY 1;  4XTC Q;  2HAV A;  1JP4 A;  1ZIU A;  3K1M A;  3CI8 A;  2F8D A;  3T22 A;  5AA4 B;  3Q27 A;  3MVW A;  4UAC A;  1D3K A;  1YYZ A;  1JQF A;  4BDN A;  1MXV A;  1NUW A;  3I6V A;  3NOH A;  2AL4 A;  5H8H A;  4H1X A;  3JYR A;  4H67 A;  2D5W A;  3V8X B;  2QPQ A;  2ONK E;  4F3P A;  4OET A;  1LFI A;  2B3F A;  2PT1 A;  4JBZ A;  1S7Y A;  3RN8 A;  4OES A;  4FE8 A;  5EQA A;  3RLF E;  3E3K A;  3O6H A;  4AB5 A;  4PP0 A;  1M5E A;  3TTL A;  3V5A A;  4H8I A;  3TKD A;  5B7D A;  1MDQ A;  2HPG A;  4PGP A;  3TCG A;  1D9V A;  4P0G A;  3RY3 A;  4JVD A;  4NQ8 A;  1UTB B;  3OO8 A;  1FPJ A;  1SI0 A;  2R6G E;  2XXU A;  3HST A;  3C32 A;  2XX9 A;  5CMK A;  4O7I A;  1B5J A;  4PDH A;  2QJE A;  3K01 A;  1H3D A;  1B4Z A;  4L17 A;  5L9S A;  5KCJ A;  2H5Y A;  3MUQ A;  4KFQ A;  3CIJ A;  3H4Z A;  3G3K A;  3ISP A;  4F3B A;  1DBZ A;  4GWZ A;  1MXU A;  1D9Q A;  4G68 A;  3L6G A;  2O69 A;  2Y7R A;  2NWJ A;  5I58 A;  4GOT A;  3WAF A;  1LLS A;  3SEX A;  4P9K A;  4F1Y A;  3SDF A;  1M5C A;  4QFO A;  3SET A;  1ZBM A;  1P1U A;  4RYA A;  4GL8 A;  5F1Q A;  2O7I A;  2ZZX A;  1K9Z A;  4TLM B;  1PEB A;  2FA7 A;  5CMB A;  4LUB A;  4LP2 B;  2A5S A;  2B4M A;  4MAG A;  1SQY A;  2F6G A;  1QKA A;  2UVH A;  3R26 A;  3TZA A;  1UQW A;  4AQ4 A;  3KFM A;  4NWD A;  3QYT A;  1B6H A;  4NN3 A;  3TFL A;  1IMD A;  3RTF B;  4U4S A;  3FGS A;  1FSA A;  4F39 A;  4GRK A;  4Q5T A;  1B5H A;  1QGX A;  3H6U A;  4N15 A;  1UTB A;  3HFU A;  3I3V A;  1ATG A;  1M5B A;  4GVO A;  5EYF A;  5A5L A;  4NTL A;  3IAZ A;  1DMB A;  4R73 A;  3BFT A;  1MQG A;  3PGF A;  3CFX A;  4G4P A;  3U8Q A;  5IM2 A;  3P7I A;  3M3K A;  4NED A;  1YZ0 A;  4I62 A;  1FTL A;  4GBV A;  2Z8F A;  4ECF A;  1EYK A;  4F1V A;  4ESW A;  1XI6 A;  1USY E;  4EQ9 A;  2IEE A;  1ZLQ A;  1B2H A;  2ZYM A;  4OVR A;  1MY2 A;  3WAE A;  2P2A A;  3JV9 A;  4RNS A;  4RK9 A;  1N04 A;  4TOZ A;  1FBP A;  1LBV A;  4DXB A;  2X7Q A;  1NUX A;  2XXX A;  2ZNU A;  3TMG A;  2THI A;  2B4L A;  2V3U A;  1FQA A;  1WOD A;  2VPO A;  4XIG Q;  3G3H A;  1LBZ A;  5IKB A;  3N5L A;  2OLB A;  1D9Y A;  2UYE A;  3KJ7 A;  2Y7P A;  2XWV A;  3CSB A;  3D1R A;  4I1D A;  4DIG A;  2HFB A;  3IFC A;  2ZXT A;  4X9T A;  1LBY A;  2WYP A;  3K1N A;  1FQF A;  2Z8E A;  2XD2 A;  4ZED A;  3K1P A;  3G3F A;  4MNI A;  2DSF A;  3DEL B;  5EQ7 A;  4G68 C;  5CBS A;  4KHZ E;  4MHF A;  2QSX A;  4F3S A;  1RDZ A;  1PC3 A;  3V89 B;  1MRP A;  3TTM A;  4NAP A;  5DVI A;  1IXH A;  3C33 A;  4LZ7 A;  1JW5 A;  4EDP A;  1MXY A;  4PFW A;  5J1D A;  3VVE A;  1EZ9 A;  4Q8R A;  3KN7 A;  1LFH A;  1UTH A;  4E0W A;  1EYI A;  1B51 A;  1J1N A;  2GQ1 A;  1VFD A;  4OZ9 A;  1GR2 A;  3RPL B;  4XXU A;  3B6T A;  3Q25 A;  5KZT A;  4N8G A;  5I57 B;  1TT1 A;  1KWH A;  4H65 A;  4PF6 A;  3KG2 A;  1O63 A;  3MVZ A;  3C36 A;  3R7X A;  4IY5 A;  4N6P A;  2V3T A;  3FD3 A;  1NH7 A;  2G29 A;  4GXS B;  3PUZ E;  1O7T A;  5H8Q B;  1MM7 A;  1URG A;  2BJJ X;  2QVR A;  3M3F A;  5ELV A;  3S9E A;  4RPO A;  3ILT B;  5H8H B;  2CMO A;  3MYU A;  3O6I A;  2HXR A;  3LSF B;  3K0V A;  1B3H A;  2Y7W A;  5H8N A;  3K6U A;  3KN3 A;  2GH9 A;  3B7D A;  4PET A;  3DLN A;  1LAF E;  5DEX A;  4PGN A;  4R2F A;  1I69 A;  3LR1 A;  5H8F B;  3I5O A;  5EQ8 A;  3RT6 B;  3ZSF A;  4GF8 A;  3AXF A;  1FRP A;  3U65 A;  3C9H A;  2OCU A;  2FVZ A;  1P1W A;  4GX6 A;  4YIC A;  2I0B A;  4N8Y A;  4R2B A;  2Y7I A;  4NGU A;  2XXT A;  3FVK A;  1B0L A;  3C4M A;  2F7A A;  2F5X A;  3QXM A;  1LCT A;  2V3Q A;  4EXK A;  5L9M A;  1YXI A;  4U2R A;  4BDQ A;  3TTR A;  3QMF A;  5EHM A;  3H06 B;  5FHN A;  2RC7 A;  1B4H A;  2UVG A;  5ISU A;  1XC1 A;  3W9W A;  3S9N C;  3MP1 A;  2OWZ A;  3A3U A;  4PF8 A;  2VT5 A;  4PCD A;  3SEV A;  3VXC A;  4JB7 A;  4PAF A;  2PCR A;  5L8D A;  4PC9 A;  3N94 A;  1M5D A;  1A8F A;  3O6G A;  1DTZ A;  4AB6 A;  3IR1 A;  4LA9 A;  1PDA A;  1JEV A;  3RPW A;  1N76 A;  2DE2 A;  2Z8D A;  4FAT A;  3QK6 A;  4IO5 A;  2F78 A;  5H8N B;  1OQH A;  4OAN A;  4IGT A;  1NV5 A;  3FVO A;  3EF7 A;  1QUI A;  3RNN A;  4LQ2 A;  3PPP A;  4NF8 B;  3T93 B;  3RGY A;  2F3D A;  3UIF A;  1EH3 A;  4YKK A;  1PB8 A;  4LN5 A;  3MC2 A;  3C35 A;  2Y7K A;  2DVC A;  3KBR A;  4QSD A;  1NMU A;  3O97 A;  4PDD A;  2H98 A;  4M4G A;  4JVC A;  3T9V A;  1ZTY A;  4MIJ A;  1OVB A;  2XXV A;  1LBB A;  1IQ7 A;  3THI A;  2ZNT A;  3G3G A;  1FQB A;  3HHF A;  5JEI A;  3OOA A;  2H4I A;  5TU0 A;  2E0S A;  3BFU A;  1GGG A;  3FZV A;  4KYD A;  1JVX A;  2VP1 A;  4R6K A;  1B5I A;  1SPI A;  4OXV A;  3MQ9 A;  3IFA A;  3VXB A;  1K9Y A;  3IOT A;  5I7I A;  4H6D A;  1GTK A;  4G8H A;  5B70 A;  2Y5K A;  3QIM A;  1VSO A;  3K6X A;  3HHG A;  4PFB A;  4R72 A;  4WED A;  4X1B A;  4NF0 A;  2MKZ A;  4HXV A;  3IX1 A;  3OO7 A;  4NF4 B;  3CR9 A;  1Y3P A;  1MXZ A;  1LEV A;  3MBP A;  3PUX E;  4GWU A;  3UGW A;  3OSQ A;  2NVU B;  3GBB A;  2VHA A;  1ZKB A;  1FBF A;  1IXG A;  3T9H B;  3PTY A;  4IGR A;  3GXA A;  5I59 B;  2XWK A;  2AL5 A;  1A54 A;  2QL3 A;  2F35 A;  5IZ1 A;  4U1Z A;  4O8M A;  4P11 A;  5BWJ A;  3HCQ A;  3F11 A;  4HE0 A;  1ZJL A;  4GWW A;  4H45 A;  4ESX A;  3BBR A;  2Q8J A;  3ZS6 A;  3LSX A;  3KOS A;  5M2V A;  4I8C A;  5AA2 A;  4R75 A;  2DQV A;  3IL1 B;  5FHM A;  3PMV A;  4U21 A;  5CI5 A;  1FBC A;  2GRV A;  4JWO A;  4HS7 A;  2I4B A;  1MS7 A;  4ZEI A;  3O66 A;  4O3C A;  2OBG A;  3N6T A;  1RDX A;  5ET8 A;  1I6B A;  4MF3 A;  5ET6 A;  2I0C A;  4OA4 A;  1YTV A;  4RJZ A;  1QUK A;  2HCA A;  3CRB A;  2NXO A;  4UA8 A;  4OEN A;  1NV6 A;  4MLQ A;  3LUY A;  1LGB C;  1FPE A;  5I57 A;  3T96 B;  5DW8 A;  3IB1 A;  3QUF A;  4MFI A;  1EU8 A;  5AA1 A;  4MEV A;  1FTK A;  2Q74 A;  4ZE8 A;  4TLL B;  1QUJ A;  1NH8 A;  1R9Q A;  1BK4 A;  4PFR A;  3LBS A;  3VLU A;  4P8B A;  4X48 A;  4JVI A;  5CBR A;  1IXC A;  2QVU A;  1LB8 A;  1TXF A;  1SYH A;  4GL0 A;  4MCO A;  1BP5 A;  3O29 A;  2DWH A;  1DSN A;  2NOO A;  3S9L C;  5DEX B;  4NHB A;  4HE2 A;  4X04 A;  2WX9 A;  1FTO A;  1A55 A;  4HCW A;  1JEU A;  2QS2 A;  4DXC A;  2ZZW A;  1SD3 A;  2F3B A;  3TTK A;  1D4N A;  1NNT A;  3BIG A;  1SBP A;  3USD A;  3LSW A;  1A7L A;  4R74 A;  2ESN A;  1B32 A;  2DP8 A;  1IME A;  5I2N B;  1VE4 A;  1MY1 A;  1B0H A;  2CZL A;  3GLB A;  1Q1K A;  3CFZ A;  4G8M A;  2W7Y A;  4Q0C A;  4YB7 A;  3RYD A;  2HZK A;  2XD3 A;  5I5P A;  3SEU A;  3RPL A;  2D3I A;  2RIN A;  3K6W A;  3L6H A;  1B7U A;  1CE2 A;  2DWJ A;  5FTI A;  2RCB A;  3IB2 A;  4XEQ A;  5F7V A;  4DI4 B;  2GHA A;  4PFT A;  3DP8 A;  3TEL A;  1DK4 A;  3O2A A;  3MST A;  3N6U A;  5HM4 B;  2DYX A;  2FIX A;  3MZ9 A;  2WKY A;  4R6Y A;  5TP9 B;  3CSG A;  3OEK A;  1N7X A;  4KCC A;  3SER A;  1URS A;  4YB5 A;  3M3L A;  5DVF A;  5BUU A;  3T0J A;  4ISU A;  5KDT A;  2D21 A;  2F6P A;  4EF1 A;  3RT8 A;  1B1H A;  3G3I A;  4MJO A;  3G7W A;  5ET5 A;  4BDM A;  4O94 A;  1QW0 A;  3KBZ A;  3KEI A;  4GLI A;  3W9V A;  4KI0 E;  4MBP A;  4P3L A;  2O1L A;  2OK2 A;  4XFE A;  4F2O A;  1FPK A;  3KOT A;  4KXP A;  3OO9 A;  4FJP A;  1MQH A;  5LDZ A;  3H03 A;  2XXY A;  3TCF A;  2Y5L A;  4LVQ A;  4N91 A;  2F97 A;  2CZK A;  5CMM A;  1PBQ A;  4C1T A;  4JWX A;  4O3A A;  3B6Q A;  2P3V A;  3OD7 A;  3TUS A;  5I56 B;  1CNQ A;  4NF5 A;  4GWX A;  3EKI A;  5KDT B;  1DTG A;  4PE5 B;  1XHY A;  3K02 A;  3KSX A;  4F3G A;  4N07 A;  5I58 B;  4Z7E A;  2VD3 A;  3MZ1 A;  1IMA A;  3MP6 A;  1JNF A;  3C34 A;  4OWD A;  2REJ A;  4WEP A;  4DE8 A;  3K6V A;  4NE4 A;  3CFL A;  2RC8 A;  4IO3 A;  5AA4 A;  3GYY A;  1IEJ A;  4U1O A;  4QFK A;  2XXR A;  4X1D A;  3LC8 A;  1R1N A;  1MH4 A;  3D4C A;  5J16 A;  1G0H A;  3HO7 A;  3ECR A;  3TEP A;  2O1M A;  3IOU A;  3CHG A;  2Q9T A;  3H6V A;  1FTA A;  3LSL A;  2UYF A;  1P1N A;  4GXA A;  3U94 A;  3LUZ A;  2CZH A;  3E13 X;  2WYK A;  4N6K A;  4KCD A;  3TTN A;  2FBP A;  3EHT A;  4OMB A;  5ICQ A;  1Y3Q A;  4EQB A;  1B7H A;  1MY0 A;  4OFL A;  3TDJ A;  2DWI A;  1NI9 A;  1OIB A;  3EQ1 A;  3VVF A;  3T1B A;  1N7W A;  5JTY B;  1MPC A;  4LZ5 A;  1EZO A;  1PBP A;  4F1U A;  1MM6 A;  4DCY A;  5A5X A;  2P3N A;  1POT A;  5ESY A;  1B40 A;  2DDK A;  1NFT A;  4MX6 A;  3KGC A;  2AYS A;  3OXN A;  4QFP A;  2CEX A;  4GQO A;  4PFI A;  4G68 B;  4YZZ A;  3MJN A;  4QSE A;  3A3C A;  4OFO A;  3MWB A;  4WKM A;  4YKJ A;  1IIW A;  2QMW A;  3M8U A;  3FV2 A;  4FBP A;  3IK6 B;  1DPP A;  3FXB A;  3VFJ A;  2DVZ A;  1LFG A;  1SW5 A;  3VLW A;  1EZP A;  2QS4 A;  2P1S A;  3O28 A;  2OWS A;  4GFR A;  4FAJ A;  3BKI B;  2XXH A;  4TQU Q;  1LAH E;  4LAT A;  4KPT A;  4HCY A;  1L5T A;  2O51 A;  4ZS9 A;  2OZZ A;  1JW1 A;  5H8S A;  3S2V A;  4NX1 A;  5I2K B;  4ZEC A;  1G0I A;  4NF4 A;  1BIY A;  4WXJ A;  3E79 A;  3UOR A;  5F24 A;  4N13 A;  3MVY A;  4N81 A;  4O3B A;  2I4C A;  1YCJ A;  2Y84 A;  4ONY A;  4ZDM A;  5EYH A;  4JSO A;  5ICT A;  1NNK A;  5DYH A;  4FEB A;  2ZYN A;  2DE3 A;  1MY4 A;  1Z7N E;  1OLC A;  4G61 A;  4OQO A;  1LAG E;  4H5G A;  2I3W A;  1IMF A;  1B3G A;  2CZI A;  2KR0 A;  4P47 A;  1H43 A;  1Y9U A;  3GBA A;  4JXI A;  3VDF A;  5CM6 A;  1MPD A;  3HV1 A;  4I3Y A;  3UN6 A;  3CG1 A;  1VFE A;  2UXA A;  3SKP A;  5ET7 A;  3HPI A;  3PMW A;  4LON B;  2XXI A;  1ZMG A;  2V84 A;  3KC0 A;  1Y4C A;  4H8J A;  4DDD A;  3ODB A;  4RPN A;  5CMC A;  2R71 A;  4OEV A;  4OVP A;  4QF9 A;  4PAI A;  2R9J A;  3FJG A;  3MZB A;  4H0W A;  4NF6 A;  1QUL A;  5DT6 A;  4YKI A;  1ANF A;  1B52 A;  3SEW A;  4Q30 B;  2HXW A;  3PPN A;  4R9F A;  5TPA A;  3PPQ A;  1QJM A;  1IIT A;  1A40 A;  1MQI A;  4OVQ A;  1GV8 A;  2BJI A;  4P1L A;  2ANJ A;  4DLD A;  3ROJ A;  2ABH A;  2REG A;  4PQJ A;  1H44 A;  3Q28 A;  5FTH A;  4OHN A;  1XS5 A;  3CG3 A;  3EPE A;  5I2K A;  1FPD A;  2PMS A;  1TWY A;  4MMP A;  3T9U A;  4MNC A;  5EYG A;  3MPK A;  2HEU A;  2ONS A;  2YPN A;  3QAX A;  3H6T A;  1OMP A;  4QFN A;  4G2Z A;  4XKR A;  3PUV E;  2XHD A;  3VLV A;  1IMB A;  1MQJ A;  2I6E A;  3HN0 A;  4HTG A;  1H76 A;  1ELJ A;  1LB9 A;  3VE1 B;  5AA3 A;  1QVS A;  1RYX A;  1Y20 A;  2DWA A;  4H46 A;  4E0X A;  1UTH B;  1XVY A;  1NNP A;  4R6H A;  1SVX B;  4XKQ A;  4OFJ A;  4THI A;  2AIX A;  4GX4 A;  5AE4 A;  2I48 A;  4ZEK A;  2XX7 A;  4IO4 A;  1JW4 A;  1B7Z A;  4EXL A;  1MPB A;  1DOT A;  4F29 A;  2A5T A;  2PYY A;  2I58 A;  2HAU A;  3SEY A;  3KSJ A;  3OSR A;  3V83 A;  3K2D A;  5IZZ A;  1T0K A;  2H99 A;  5TPA B;  2Z22 A;  2I3V A;  3E9X A;  5H8F A;  1LBW A;  1NV7 A;  4YMA A;  4X8R A;  4EUO A;  4OVT A;  3DP6 A;  1IXI A;  1RKM A;  4PFU A;  3PMX A;  2PT2 A;  4GX3 A;  1IUD A;  4ELP A;  1PB7 A;  5DTB A;  3UP9 A;  4EF2 A;  4FED A;  1FPL A;  1BLF A;  4LQ5 A;  4GIZ A;  3KC1 A;  4N6D A;  2QS1 A;  1JET A;  3K4U A;  1FQD A;  1R6Z A;  3ILU B;  2RKM A;  1B3L A;  4GWS A;  3FAS A;  3TQW A;  4JWY A;  2GHB A;  1FBD A;  4HW8 A;  3R6U A;  4QHQ A;  1DPE A;  1AH5 A;  2RC9 A;  1NV4 A;  2B65 A;  2UVI A;  1INP A;  1CB6 A;  1LAX A;  2WBD A;  3PU5 A;  3ONM A;  3Q26 A;  5CRY A;  4NWC A;  3RQT A;  2B3B A;  1HSE A; 
#chains in the Genus database with same CATH homology
 4ELO A;  1MQH A;  2OCU A;  1P1W A;  1SW4 A;  3H03 A;  2XXY A;  1ZU0 A;  4YIC A;  3TCF A;  4LVQ A;  2I0B A;  1B9J A;  2F97 A;  1SYI A;  1LCF A;  4R2B A;  2Y7I A;  2PBW A;  5CMM A;  2XXT A;  4C0R A;  2VOZ A;  3FVK A;  1B0L A;  1PBQ A;  3C4M A;  5I56 A;  4C1T A;  2F7A A;  2X7P A;  1FQC A;  2F5X A;  3QXM A;  4JWX A;  1LCT A;  2QS3 A;  3B6Q A;  4K3F A;  4O3A A;  2LAO A;  5FHO A;  2V3Q A;  2F34 A;  4EXK A;  1FW0 A;  4LZ8 A;  4FEC A;  4G77 A;  5L9M A;  4U2R A;  4BDQ A;  1MH3 A;  4NF6 B;  3TTR A;  1Y4T A;  3OD7 A;  3TUS A;  5I56 B;  2ONR A;  5I59 A;  1UIV A;  4NF5 A;  2Q2A A;  3E4R A;  4KYS A;  5EHM A;  3UK4 A;  5JK4 A;  5LOM A;  5KDT B;  3H06 B;  5FHN A;  1DTG A;  2DOJ A;  1B05 A;  1B4H A;  1XHY A;  2RC7 A;  2UVG A;  3K02 A;  3KSX A;  4PE5 B;  4F3G A;  5H8N B;  4P0I A;  5ITP A;  5ISU A;  2ZYK A;  4N07 A;  3MVX A;  1AL3 A;  1LST A;  1Y3N A;  4YAH X;  4Z7E A;  2VD3 A;  5I58 B;  1XC1 A;  2H25 A;  1S9T A;  3MP6 A;  3MZ1 A;  3W9W A;  3S9N C;  3MP1 A;  3A3U A;  4ELQ A;  3OEM A;  1JNF A;  1R9L A;  3C34 A;  4OWD A;  2REJ A;  1GVC A;  4F31 B;  4WEP A;  2ZNS A;  3TCH A;  1I6A A;  1AIV A;  3GZG A;  3IO6 A;  4DE8 A;  1SW1 A;  3FVG A;  1US4 A;  3K6V A;  4BDL A;  3K00 A;  4NE4 A;  1XT8 A;  4ZEF A;  3CFL A;  4BDO A;  2RC8 A;  2PX1 A;  3SEV A;  4IO3 A;  5AA4 A;  3VXC A;  5JTY A;  4U1O A;  1IEJ A;  4GWO A;  2F7C A;  4JB7 A;  4QFK A;  2XXR A;  1N84 A;  4X1D A;  5L8D A;  3LC8 A;  1R1N A;  1M5D A;  1MH4 A;  3D4C A;  1YPN A;  3D4G A;  3N94 A;  2V25 A;  1A8F A;  3HO7 A;  3ECR A;  1DTZ A;  2M8C A;  2ZMB A;  3IR1 A;  3O6G A;  4AB6 A;  4LA9 A;  2O1M A;  3TEP A;  3EHU A;  3IOU A;  1PDA A;  4F2Q A;  1JEV A;  3RPW A;  1N76 A;  2Q9T A;  2DE2 A;  3H6V A;  1N3X A;  1POY 1;  2RF1 A;  1LBC A;  2Z8D A;  2F78 A;  3LSL A;  3QK6 A;  4IO5 A;  1OQH A;  2HAV A;  2UYF A;  4XTC Q;  1P1N A;  1ZIU A;  2RCA A;  3K1M A;  4GXA A;  3CI8 A;  2F8D A;  4IGT A;  3U94 A;  2O7U A;  3FVO A;  3T22 A;  5AA4 B;  3Q27 A;  1MXW A;  3MVW A;  3E13 X;  4UAC A;  4OVJ A;  1D3K A;  1JQF A;  4KCD A;  3OMB A;  3EF7 A;  1FQE A;  1QUI A;  3TTN A;  4BDN A;  1MXV A;  3OEN A;  3EHT A;  4OMB A;  3RNN A;  4LQ2 A;  3N26 A;  3PPP A;  5ICQ A;  1Y3Q A;  4NF8 B;  5ITO A;  3I6V A;  3RGY A;  2AL4 A;  3T93 B;  3UIF A;  4EQB A;  5AA2 B;  1B7H A;  5H8H A;  5TP9 A;  1EH3 A;  1TFD A;  4H1X A;  4YKK A;  1MY0 A;  3JYR A;  3OO6 A;  4H67 A;  4OFL A;  4QFL A;  2D5W A;  4M1V A;  1BTJ A;  3TDJ A;  2QPQ A;  3V8X B;  2DWI A;  1PB8 A;  4IO7 A;  2ONK E;  1FTJ A;  4IO2 A;  4F3P A;  3MC2 A;  4OET A;  1LFI A;  2B3F A;  4ZE9 A;  2PT1 A;  1OIB A;  4JBZ A;  2H9B A;  3EQ1 A;  3RTW B;  3VVF A;  1S7Y A;  3C35 A;  3RN8 A;  4OES A;  4FE8 A;  1N7W A;  1HSJ A;  4XKN A;  2Y7K A;  2DVC A;  3KBR A;  3PPR A;  1MPC A;  4LZ5 A;  4QSD A;  5JTY B;  3E3K A;  3O6H A;  3RLF E;  1NMU A;  1AMF A;  4AB5 A;  1II5 A;  3TPA A;  1PBP A;  1EZO A;  1B46 A;  4PP0 A;  4F1U A;  1M5E A;  3O97 A;  3TTL A;  1MM6 A;  4H8I A;  3TKD A;  2Q89 A;  3V5A A;  5B7D A;  1MDQ A;  1MDP 1;  4DCY A;  4ZEB A;  5A5X A;  2H98 A;  4M4G A;  3T9V A;  4DCX A;  3PPO A;  1ZTY A;  3TCG A;  1D9V A;  3SEU A;  4IY6 A;  3IOV A;  4OER A;  4P0G A;  1OVB A;  1POT A;  3RY3 A;  4QSC A;  2XXV A;  1XOC A;  1LBB A;  1B40 A;  1IQ7 A;  4KQP A;  1I6Q A;  1UTB B;  3IOW A;  3OO8 A;  1NFT A;  4R9G A;  3KN8 A;  3THI A;  3KGC A;  1SI0 A;  2AYS A;  1B3F A;  2ZNT A;  3OXN A;  3JZJ A;  2R6G E;  4QFP A;  3G3G A;  2XXU A;  4YB6 A;  4GQO A;  1FQB A;  3HHF A;  5JEI A;  3OOA A;  2H4I A;  3HST A;  3C32 A;  5TU0 A;  5K2X A;  3IB0 A;  2XX9 A;  4JDF A;  2E0S A;  2G93 A;  5CMK A;  1B5J A;  4RY1 A;  4G68 B;  3T66 A;  3FJ7 A;  3BFU A;  1OLA A;  1GGG A;  3FZV A;  4YZZ A;  3B6W A;  1JVX A;  2DE4 A;  2VP1 A;  2QJE A;  3C31 A;  4KYD A;  3K01 A;  3MJN A;  1H3D A;  3A3C A;  1B4Z A;  4OFO A;  1B5I A;  3MWB A;  4GD5 A;  4QSE A;  4WKM A;  4OXV A;  4L17 A;  3MQ9 A;  4NF5 B;  4YKJ A;  5L9S A;  5KCJ A;  3VXB A;  2H5Y A;  3MUQ A;  4KFQ A;  3IOT A;  3U1O A;  1IIW A;  3CIJ A;  3PV0 E;  3KZG A;  4H6D A;  2QMW A;  4OYV A;  3H4Z A;  1GTK A;  1NL5 A;  3G3K A;  4G8H A;  5B70 A;  3M8U A;  4RA1 A;  3IOR A;  4F3B A;  3FV2 A;  3EN3 A;  3IK6 B;  1DPP A;  1MXU A;  4G68 A;  4Z0I A;  3L6G A;  2O69 A;  2Y7R A;  2NWJ A;  3QIM A;  1VSO A;  2Q88 A;  5I58 A;  3VFJ A;  2DVZ A;  2VD2 A;  3G3J A;  1LFG A;  3K6X A;  1SW5 A;  1LLS A;  4GOT A;  3HHG A;  3WAF A;  3SEX A;  3VLW A;  1EZP A;  4R72 A;  3SDF A;  4WED A;  4F1Y A;  1M5C A;  2QS4 A;  2P1S A;  1NKX A;  3MAM A;  2OWS A;  3O28 A;  4GFR A;  4QFO A;  4X1B A;  3BKI B;  2XXH A;  4TQU Q;  1LAH E;  3SET A;  4FAJ A;  4LAT A;  1ZBM A;  3S9M C;  4KPT A;  1P1U A;  3IX1 A;  3OO7 A;  4NF4 B;  3CR9 A;  4HCY A;  1VR5 A;  4RYA A;  1L5T A;  1Y3P A;  2O51 A;  5I84 A;  4GL8 A;  4ZS9 A;  3H7M A;  1MXZ A;  2PVU A;  5F1Q A;  2O7I A;  1US5 A;  4ND9 A;  2OZZ A;  1JW1 A;  4TLM B;  5H8S A;  3MBP A;  3S2V A;  3T9X B;  1PEB A;  3PUX E;  2FA7 A;  5CMB A;  5I2K B;  4ZEC A;  4LUB A;  2QMX A;  4LP2 B;  4NF4 A;  3OSQ A;  3UGW A;  2A5S A;  1BIY A;  1B58 A;  4WXJ A;  2NVU B;  3GBB A;  1SQY A;  2VHA A;  2F6G A;  1ZKB A;  1NNF A;  1S50 A;  1QKA A;  2UVH A;  2V93 A;  2O68 A;  3R26 A;  3TZA A;  5CC2 A;  2Z23 A;  1UQW A;  5IAI A;  3UOR A;  4AQ4 A;  4YU0 A;  1IXG A;  3S4U A;  3T9H B;  4IGR A;  3KFM A;  4NWD A;  2XXW A;  3QYT A;  4N13 A;  1B6H A;  3MVY A;  4O3B A;  4C1U A;  2I4C A;  1YCJ A;  2Y84 A;  3GXA A;  3TAJ A;  1USY H;  4ONY A;  1F9B A;  4ZDM A;  3TFL A;  5I59 B;  2UVJ A;  2AL5 A;  4U4S A;  3FGS A;  4RK2 A;  2F36 A;  2O6A A;  3RTF B;  1P1O A;  1YAE A;  4JSO A;  1A54 A;  1O64 A;  1NNK A;  5A5X B;  2QL3 A;  1BKA A;  4FEB A;  5DYH A;  5ICT A;  2ZYN A;  2F35 A;  3O9P A;  4F39 A;  4GRK A;  1PB9 A;  4Q5T A;  4F18 A;  2DE3 A;  1B5H A;  4JSD A;  4U23 A;  3UA8 A;  4U1Z A;  1MY4 A;  3H6U A;  1UTB A;  3I3V A;  1Z7N E;  1OLC A;  3A09 A;  4OQO A;  1LAG E;  1ATG A;  2VGQ A;  3MPL A;  4H5G A;  1M5B A;  2I3W A;  4GVO A;  4P11 A;  5EYF A;  5BWJ A;  3HCQ A;  3F11 A;  3VVD A;  1B3G A;  4NTL A;  2OJT A;  1ZJL A;  3FAT A;  3IAZ A;  4ESX A;  1DMB A;  1SI1 A;  5TP9 B;  1H43 A;  4R73 A;  1Y9U A;  3BFT A;  3GBA A;  1MQG A;  3PGF A;  4JXI A;  3CFX A;  3BBR A;  3FVN A;  2Q8J A;  4G4P A;  3U8Q A;  3ZS6 A;  3LSX A;  3KOS A;  5M2V A;  3VDF A;  3TYH A;  2XXQ A;  4KYE A;  5CM6 A;  4I8C A;  5AA2 A;  2YLN A;  1MPD A;  3P7I A;  3HV1 A;  3M3K A;  2DQV A;  3IL1 B;  4R75 A;  4NED A;  5FHM A;  3UN6 A;  3CG1 A;  3FIR A;  1FTL A;  1VFE A;  4I62 A;  4POW A;  2UXA A;  5EHS A;  2Z8F A;  3PMV A;  3SKP A;  4ECF A;  4U21 A;  5CI5 A;  2GRV A;  4OTE A;  4F1V A;  3ZKK A;  5I2N A;  4ESW A;  3FJM A;  4JWO A;  4HS7 A;  1USY E;  2I4B A;  3HPI A;  3PMW A;  2IEE A;  4FIM A;  4EQ9 A;  1ZLQ A;  5HBC A;  1B2H A;  1MS7 A;  2OWT A;  1MG1 A;  2ZYM A;  4LON B;  2XX8 A;  4R6K A;  3ZKL A;  4ZEI A;  2DS9 A;  1ZMG A;  2V84 A;  2XXI A;  1MY2 A;  2OBG A;  3O66 A;  4O3C A;  1Y4C A;  3N6T A;  4H8J A;  4ZZE A;  1Z7M E;  3ODB A;  4RPN A;  5CMC A;  4DDD A;  4MH5 A;  3WAE A;  2R71 A;  2P2A A;  3JV9 A;  4PFY A;  4OEV A;  1I6B A;  4RK9 A;  3FUZ A;  1N04 A;  4RNS A;  1XVX A;  4MF3 A;  4TOZ A;  2I0C A;  4QF9 A;  4DXB A;  2R9J A;  2X7Q A;  1YTV A;  2XXX A;  2XXP A;  2ZNU A;  3FJG A;  4RJZ A;  1QUK A;  3MZB A;  4H0W A;  4RXL A;  2HCA A;  2X26 A;  2THI A;  3CRB A;  3TMG A;  4NF6 A;  1Q35 A;  2NXO A;  2V3U A;  1FQA A;  1QUL A;  4OEN A;  1WOD A;  4UA8 A;  5DT6 A;  3PD8 A;  5AA2 D;  4MLQ A;  3FXR A;  3LUY A;  1LGB C;  4YKI A;  4BDR A;  1ANF A;  3DP4 A;  1Y1Z A;  1B52 A;  3SEW A;  3MW0 A;  4Q30 B;  3IO4 A;  4XIG Q;  5I57 A;  3G3H A;  2HXW A;  3T96 B;  3PPN A;  2E1S A;  4R9F A;  5TPA A;  3PPQ A;  1IIT A;  1A40 A;  1MQI A;  1QJM A;  3IB1 A;  3QUF A;  3N5L A;  4MFI A;  1GV8 A;  4YMB A;  5IKB A;  1EU8 A;  2ANJ A;  5AA1 A;  4DLD A;  2OLB A;  1D9Y A;  1OQG A;  1FTK A;  2ABH A;  4ZE8 A;  2REG A;  2UYE A;  4TLL B;  3KJ7 A;  1QUJ A;  2Y7P A;  4IO6 A;  1NH8 A;  4PQJ A;  1H44 A;  2DXR A;  3CSB A;  3Q28 A;  1R9Q A;  1UIU A;  2FYI A;  5FTH A;  4OHN A;  1XS5 A;  3U72 A;  3CG3 A;  3EPE A;  4I1D A;  5I2K A;  4DIG A;  3LBS A;  2HFB A;  3VLU A;  4X48 A;  2ZXT A;  3FXQ A;  1IXC A;  4X9T A;  5CBR A;  4DZ1 A;  1LB8 A;  1TXF A;  2PMS A;  1SYH A;  4GL0 A;  1BP5 A;  1MQD A;  1TWY A;  3K1N A;  3O29 A;  2DWH A;  1DSN A;  1FQF A;  2NOO A;  2Z8E A;  2IA4 A;  4OEU A;  3T9U A;  2XD2 A;  5DEX B;  4F19 A;  3S9L C;  3QUJ A;  4ZED A;  1AOV A;  3K1P A;  3G3F A;  3MPK A;  2DSF A;  2HEU A;  2ONS A;  2YPN A;  3DEL B;  3QAX A;  3H6T A;  1OMP A;  3U92 A;  1FTO A;  1HSL A;  4QFN A;  1A55 A;  3KJT A;  3RUM A;  2FNC A;  1MY3 A;  4G2Z A;  3FV1 A;  4XKR A;  3PUV E;  4G68 C;  2XHD A;  3VLV A;  4DXU A;  5CBS A;  5L9O A;  1H45 A;  4KHZ E;  4HCW A;  1JEU A;  2QS2 A;  1MQJ A;  2I6E A;  3HN0 A;  4HTG A;  1H76 A;  3PUW E;  1SD3 A;  1ELJ A;  2QSX A;  4DXC A;  4F3S A;  1WVJ A;  1LB9 A;  3OEL A;  1PC3 A;  4POX A;  3TTK A;  3VE1 B;  1D4N A;  1NNT A;  3V89 B;  5AA3 A;  1MRP A;  1SBP A;  1QVS A;  4U4X A;  3TTM A;  3USD A;  1JVY A;  1RYX A;  3LSW A;  1Y20 A;  3TOD A;  5DVI A;  1IXH A;  2DWA A;  3C33 A;  1A7L A;  4LZ7 A;  2P0S A;  4R74 A;  1JW5 A;  2ESN A;  4E0X A;  1UTH B;  1B32 A;  2DP8 A;  4EDP A;  1MXY A;  4PFW A;  5J1D A;  3VVE A;  5I2N B;  1VE4 A;  1MY1 A;  1XVY A;  1NNP A;  3H6W A;  1EZ9 A;  1SDX A;  4R6H A;  3VV5 A;  3QSL A;  2KLF A;  1SVX B;  4XKQ A;  1B0H A;  2NUV A;  4Q8R A;  3KN7 A;  4IB2 A;  4OFJ A;  4THI A;  3U93 A;  1UTH A;  4E0W A;  3W15 C;  1LFH A;  2CZL A;  4YKP A;  2AIX A;  3GLB A;  1B51 A;  1J1N A;  4KR5 A;  2I48 A;  5AE4 A;  4ZEK A;  1B1X A;  1VFD A;  2XX7 A;  4IO4 A;  4OZ9 A;  1A8E A;  1GR2 A;  1JW4 A;  1Q1K A;  3CFZ A;  3B6T A;  1B7Z A;  4G8M A;  4XXU A;  4EXL A;  2W7Y A;  3Q25 A;  5KZT A;  1MPB A;  1DOT A;  2GFE A;  4FOR A;  5I57 B;  4Q0C A;  4YB7 A;  4F29 A;  2A5T A;  1TT1 A;  3TQL A;  1KWH A;  2HZK A;  4H65 A;  4H5F A;  2XD3 A;  2PYY A;  1IZ1 A;  4MLV A;  3KG2 A;  1A99 A;  1O63 A;  1P1Q A;  2I58 A;  2HAU A;  3C36 A;  2D3I A;  3MVZ A;  4IY5 A;  2RIN A;  3R7X A;  3SEY A;  2ZYO A;  3KSJ A;  2DXY A;  3H3G A;  3K6W A;  1B7U A;  3L6H A;  1CE2 A;  2DWJ A;  4N6P A;  5FTI A;  2V3T A;  3OSR A;  3FD3 A;  3V83 A;  3K2D A;  2RCB A;  3IB2 A;  1T0K A;  2H99 A;  5HPQ A;  5TPA B;  5F7V A;  2A5T B;  1N3W A;  2Z22 A;  1OVT A;  2GHA A;  2I3V A;  4PFT A;  3FXU A;  3SES A;  1NH7 A;  2G29 A;  4GXS B;  3E9X A;  3PUZ E;  5H8F A;  4KD5 A;  3DP8 A;  3TEL A;  3Q29 A;  3O2A A;  4YMA A;  1O7T A;  4EUO A;  5H8Q B;  5H8Q A;  1MM7 A;  1URG A;  3DP6 A;  1IXI A;  1RKM A;  2F7B A;  2BJJ X;  3PD9 A;  3N6U A;  1SW2 A;  4ELR A;  5HM4 B;  2DYX A;  5KCJ B;  4PFU A;  1M5F A;  3M3F A;  3PMX A;  4RPO A;  5ELV A;  2PT2 A;  2QRY A;  3S9E A;  1IUD A;  3ILT B;  3MZ9 A;  1MXX A;  2WKY A;  4ELP A;  4R6Y A;  5H8H B;  1B3E A;  2CMO A;  3CSG A;  3EHS A;  1PB7 A;  2HQ0 A;  3LSF B;  3O6I A;  1N7X A;  3DM0 A;  3OEK A;  4NMY A;  5DTB A;  4QRZ A;  3K0V A;  4KCC A;  3UP9 A;  4EF2 A;  4FED A;  1B3H A;  1BLF A;  2Y7W A;  4LQ5 A;  5H8N A;  4GIZ A;  3SER A;  1URS A;  4FAT A;  4YB5 A;  3K6U A;  3M3L A;  5DVF A;  5BUU A;  3KN3 A;  2GH9 A;  2QS1 A;  3MP8 A;  4ISU A;  2YJP A;  1JET A;  3B7D A;  3K4U A;  1FQD A;  1R6Z A;  4PET A;  5KDT A;  2D21 A;  1P99 A;  1RYO A;  2F6P A;  3DLN A;  1N0T A;  2O84 X;  1LAF E;  3IJX B;  3PUY E;  5DVJ A;  3ILU B;  1URD A;  3RT8 A;  1B1H A;  1WDN A;  4EF1 A;  3G3I A;  5DEX A;  4R2F A;  2RKM A;  2HZL A;  4BLA A;  1Y1M A;  1B3L A;  3FAS A;  1FTM A;  1I69 A;  2GHB A;  3LR1 A;  3G7W A;  4JWY A;  4ZZA A;  3TQW A;  4HW8 A;  3R6U A;  4FJP A;  4NF8 A;  4QHQ A;  1DPE A;  1TFA A;  4BDM A;  1AH5 A;  2RC9 A;  4F22 A;  4I9D A;  2B65 A;  2UVI A;  1QW0 A;  5H8F B;  3W9V A;  3KEI A;  4GLI A;  5K2Y A;  1CB6 A;  4EQ7 A;  4KI0 E;  4MBP A;  2Q2C A;  3I5O A;  3RT6 B;  3ZSF A;  1FCK A;  1LAX A;  4GF8 A;  3PU5 A;  3CVG A;  3ONM A;  1QKB A;  4G8N A;  2I49 A;  2ALU A;  2O1L A;  2OK2 A;  3AXF A;  3Q26 A;  5CRY A;  4F2O A;  4NWC A;  4XKP A;  3RQT A;  3KOT A;  2B3B A;  3OO9 A;  3IJO B;  1HSE A;  3C9H A;  4U22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...