4F45A

Crystal structure of human cd38 e226q mutant in complex with naadp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
253
structure length
249
Chain Sequence
EFWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human CD38 in Complex with NAADP and ADPRP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ADP-ribosyl cyclase 1
total genus 80
structure length 249
sequence length 253
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4f45A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f45A02
4RVHA 4CQLA 1N5DA 1NQTA 1C3VA 3A1NA 3IDSA 3PIIA 3X2FA 1BTOA 3CE6A 1BXGB 4CMIB 2DQ4A 3WB9A 1JU9A 3M2TA 3DAFA 4Z9FA 4J1QA 2YY7A 4LCEA 1UXIA 2ET6A 4YVFA 3AUAA 3BHJA 4MOWA 4JJGA 1PQWA 4GKBA 3S55A 4J49A 2CF6A 1SOVA 4IMRA 3W4JA 3TQHA 3STHA 4HNGA 2X0IA 2ZQZA 2DM6A 4E0BA 3BTSA 3M1AA 1T2DA 5JDIC 3I6QA 3C1OA 1IL0A 3INTA 4GMFA 4TRNA 1CEQA 1WAMA 4U6SA 2VHYA 4D0SA 3VZSA 4OKIA 4AFNA 3N58A 2WE8A 1E7MA 5L45A 1PZFA 2GDZA 3LLSA 1VI2A 5ENDA 4RLHA 4YAGA 3HNPA 1NPYA 2DAPA 3IKVA 2VZ9A 3OIGA 3WNVA 2OBYA 1CF2O 3PRJA 1P0FA 4MIOA 2W2KB 3ZH2A 2EGHA 1B7GO 3WIDA 2Q2VA 1E3EA 5CEEA 4NU6A 3S8MA 5KCZA 4EZBA 3ZN2A 1X1TA 1I3NA 4PZEA 2NTJA 3IL2A 3GG2A 5C7IO 1GPDG 3ZV5A 2YFQA 2OO5A 2W2KA 4OQZA 1XIVA 3OSUA 3U0BA 1U2DA 4RLSA 3AJRA 1WPQA 1EVYA 1XELA 1QLHA 5AOVA 1HKUA 4RQTA 5JCJA 2J5KA 1G6KA 1DAPA 1P33A 2WE7A 3H2ZA 4ZU3A 4YAIA 1GZ3A 2V65A 5AXCA 4B8WA 3GQVA 1NWHA 1HDZA 3GGGA 4XQGA 3ZWOA 4Y67A 4PLWA 4WLOA 3RSHA 4CL3A 1I01A 2FMUA 2ZK7A 5TSDA 3KHUA 4PGFA 4LISA 1ORRA 3VH3A 3AUUA 3D4PA 1T2AA 5IAAA 4CMBA 5KJ1A 3JQ8A 1C14A 4N7RA 4EITA 3GEDA 4RL6A 2GNAA 1B15A 2EKLA 2WEKA 1EE2A 1X1EA 1XCBA 2Z5LA 4JCOA 3VPXA 4XYBA 4EEZA 2ZTVA 2X86A 4OH1A 3VPSA 3KYCA 2NU8A 4NJMA 2VYNA 2JFFA 2VQ3A 3FRJA 4ZQHA 3KETA 5HTOA 1MC5A 1GUZA 1E3WB 2AG8A 2YUTA 3GMDA 3JQCA 4BNHA 3P19A 5G2OA 3U4IA 2G76A 1X14A 3BMNA 1GQQA 1BW9A 1U7TA 5JMWA 4BNUA 4L75A 4A26A 4D3SA 4ALNA 3O9ZA 1KVQA 1I3LA 4JJIA 2VWPA 1H9BA 2ZCUA 4IMPA 2BELA 1PEDA 1H93A 1FXSA 4EJMA 3WX0A 2Q1WA 4M54A 1WW8A 3DOOA 3MTGA 4TRMA 2I3AA 4TWRA 2OP1A 1T1RA 2J5RA 1P1HA 4BKUA 3EDMA 1LRLA 2O23A 3E5RA 4ALKA 1R4NB 2GN8A 2WDZA 3E5MA 1UP4A 4IDCA 4LCJA 3DBLB 3H5NA 3L6DA 3AOEC 1ADFA 4YAEA 2G0TA 1YBAA 1YB4A 2FR1A 1YWGO 3GNTA 3OA0A 5TS3A 4BHTA 2HMTA 1NNUA 1AXGA 1MG0A 4NG5A 3UHAA 4D43A 4HUJA 2B35A 1ISFA 4DBVO 4DIBA 4ZD6A 1F12A 3GRKA 2EJVA 1EUZA 3K92A 2X8LA 4RPKA 3ZV4A 3DFZA 5JFOA 4PLGA 2BLLA 4AJEA 3KXDA 2O3QA 1E3WA 1UXKA 5IZ4A 3OJEA 3UW3A 1CYDA 3JQGA 3W1VA 1E7YA 3UCXA 2C7VA 2DLDA 1PS0A 1LBEA 1ZMOA 2ZKLA 3HDQA 1O95A 4EW6A 3U62A 4ZICA 3QRWA 2I99A 3BXXA 1LC3A 3T4XA 1C1DB 2E49A 3WGQA 2VTEA 3TDKA 4ZQFA 1R15A 1N92A 1DRWA 2X23A 3RVDA 2CF5A 4BO4A 2EERA 3DZJA 5BQFA 3QHAA 3NKLA 4NPCA 2RHRA 4Z0PA 2AQ8A 3WJAA 2VN8A 4HFRA 4LVCA 5HM8A 4CM8A 5JYEA 4XDYA 2PA3A 1KVTA 1T4BA 3GRPA 3FBTA 1MXHA 1E1MA 2GZ2A 2PD3A 2DPGA 3AY7A 3OJOA 3VKUA 2OMEA 2AHRA 2CUKA 3WR5A 4GGPA 4B3IA 3ANMA 3GN2A 2EWMA 4DQVA 1UXHA 3A14A 3PTZA 2HSDA 3ANNA 3PHIA 4MVJG 4I9NA 3H8VA 1E1KA 4ILKA 4DTIA 5CDTA 4F6CA 1HDOA 3VH2A 4BO0A 3RASA 3L6EA 3DMYA 5G4LA 1Z74A 1GCOA 2IZZA 3MJEA 3JQAD 2VWGA 2JAPA 1EVZA 4XJTA 2V6GA 4BNIA 5A9RA 2O4UX 4CLOA 2EG9A 1RM3A 3JSAA 1D3AA 1QV7A 4FD3A 4CUKA 4FS3A 2C2YA 2BF7A 1T4DA 3K2BA 3KTDA 1HTBA 2AA3A 2P9EA 5LDGA 3NTRA 2B37A 2E4AA 3BMQA 4OAQA 2X6TA 1ARZA 4JJFA 1O5IA 1JTVA 1VRWA 5L4LA 1PL6A 3I9NA 2OUIA 1P1JA 4E2ZA 2HKIA 1HE4A 5F5NA 3RQSA 3EVNA 1IOLA 2RH4A 4JBHA 4DC0A 2VRCA 2QYSA 2CDAA 1QP8A 3OH8A 2X9NA 3WGOA 5B4VA 3LF2A 1ZW1A 5COQA 4PRLA 1MFPA 4CLRA 1SZJG 1H6CA 3HN7A 4BNFA 3B6ZA 4D42A 3I9JA 1IYZA 2PK3A 4ND3A 1IHXA 3E1KA 5HS6A 4BB6A 2B4QA 1KS9A 1YL5A 4J7XA 1JA9A 4G81A 2I67A 2VOJA 1GAEO 1N9GA 3QE3A 3FWZA 3DZBA 4AJKA 4RV9A 3QVXA 3TPCA 4CODB 1EMDA 3I83A 4Y8VA 3D5QA 3E9MA 1LNQA 5CDSA 4IM7A 3I9MA 4UVDA 2FPPA 2GN4A 3LDHA 4IIUA 5F5LA 1C1DA 3DB2A 5EQDA 4B79A 2VWQA 3P5SA 2I76A 4XDZA 4R3WA 2E48A 1HL3A 2PR2A 3DZGA 1QORA 3NDJA 1KETA 5L7WA 4FOSA 1A27A 5I7VA 2E37A 2YV1A 5EJ2A 3WQQA 1I10A 3LC2O 3I4FA 3RUHA 5C3MA 4AJ2A 3AWDA 3LQFA 1HWYA 1H6DA 2X1HA 1VJTA 2O7QA 4M55A 2DBQA 4DLAA 3TZ6A 4I5EA 3OJFA 2NADA 4A2CA 3L9WA 3DBRB 4J9VA 5JCXA 5JAIA 4MO2A 3L4BA 3RROA 3FR8A 5A5EA 5EESA 3QVWA 4WEOA 3UCEA 3ONFA 4DVJA 3RBXA 2R6JA 2FN7A 1EUDA 1YBVA 3C8MA 2NU7A 4H15A 2VTDA 2SCUA 2C82A 4DREA 3RKUA 3L6OO 1ZSYA 3SXPA 4YDRA 3AUTA 4JN6B 4MVJI 1U28A 1K3TA 4G5HA 3PQFA 2IEDA 3ZCXA 5L53A 4QSMA 2P2SA 4C7KA 3D64A 3VDQA 4W9NC 3P7MA 4U5QA 1E3LA 3L9XA 2DBZA 2BRUA 1NQAO 2AQHA 4Q3DA 1X13A 3CMMA 4TMFA 3MZ0A 4HFJA 4XIJA 4FFMA 1B14A 3IP3A 4CMIA 4ZGWA 5KKCA 3GGPA 2OXIA 3ZDFA 4EDFA 2GERA 4J6FA 1J49A 1V0JA 1DLIA 3K9QO 3OA2A 1D4FA 4R68A 3G0OA 4N5LA 4FFNA 5JE8A 1K6IA 5CG2A 5DF1A 3P2YA 3R6DA 3VAZA 3PYXA 3JYNA 1DLJA 3PHJA 4GL4A 4Q9NA 2YDXA 3ITKA 1C0IA 5KVCA 5IFLA 4TQGA 3GHYA 4K6FA 4CV2A 1B26A 1QG6A 2GUGA 3NDRA 4WUVA 4QT0A 3ZWNA 3WGHA 1K0UA 5DDIP 4LSWA 1DBVO 3L77A 4ND5A 5T67A 1WDKA 3D1LA 3WSVA 1C0PA 3V2GA 3KUXA 4WEQA 1GZ6A 3VDRA 2CDCA 1UP7A 1T24A 4FJ2A 3RUAA 3QWFA 4N18A 4ND1A 2ZYAA 4FFLA 4BKQA 1ISHA 3TZKA 2X5KO 3GVXA 1DEHA 4L4RA 5I9NA 3NGLA 1S7CA 3SX2A 3IUSA 3ZHYA 5IXYA 2HU2A 4QTZA 4CJXA 4WNIA 1TT5A 3GOHA 1NYTA 3PHLA 4XJSA 2RAFA 1YQXA 3IMFA 4CLEA 3C1TA 3F1KA 1YDWA 2NQ8A 5BR7A 4Q3CA 3DAGA 2AEMA 5EL0A 4PZCA 4R16A 4KMSA 4KQWA 4S1VA 1A9ZA 4PLTA 2D0IA 1EE9A 4P38A 4TRJA 5MDHA 3ZU4A 1ENPA 4BKPA 4AICA 4KWIA 4JX8A 4Y6RA 3CPSA 1N2SA 5H81A 1E1NA 4XWYA 5U4QA 2CMDA 2EXXA 1Y5MA 4YAJA 4OGWA 4NNJA 4XX0A 3B70A 1LC0A 2EGGA 3LK7A 4MVJD 3S2IA 1A72A 4E33A 1RYDA 4I5FA 3CUKA 4E5YA 4RF2A 4WASA 4LN1A 1FDSA 4KTTE 2BFMA 2Y1EA 3FPLA 3LLVA 3GA0A 4JLWA 1ZKMA 2IZ0A 2OL4A 3JQBC 3GUCA 1JKFA 2Y1DA 4NJMB 2HRZA 1PZEA 3PQDA 4AL4A 4IGFA 3EHEA 3M2PA 4MVJM 1DJNA 3OHSX 5DOVA 5A3VA 1PWXA 1OMOA 1O8CA 3KBOA 3PLRA 3TZHA 2FSSA 2BGMA 1EZ4A 1K2WA 2JFGA 3G79A 4S3MA 4E30A 4YRBA 3SC4A 1PJQA 2C59A 4PG6A 1WMAA 4HP8A 5L51A 4IJVA 2BKAA 1ONPA 4PLPA 2JCVA 5THKA 1DB3A 4K1LA 3D3WA 4LGVA 3HB4X 4E31A 4BKOA 4EUEA 2CNBA 4CLOB 2UYYA 5CAEA 4Z9XA 5CG1A 3VVBA 4BNJA 1W73A 3WBBA 3ULKA 2WJPA 1I32A 1LDMA 6LDHA 1Q0LA 3MJSA 1W4ZA 5TQVA 4ALLA 1JKIA 2QIOA 4E21A 5AQ1A 1F06A 1LQUA 2AW5A 2Y1FA 4BB5A 3I4CA 3NTOA 1U5CA 4J3FA 5A3JA 4E5KA 5A9TA 5IN4A 2D8AA 2BH9A 3K31A 4ZHSA 4W82A 4XQ9A 1GPJA 4FC7A 4RORA 1DPGA 5A02A 3DQPA 5A4DA 1Q1NA 5JO9A 4CMKA 4RPHA 3ETDA 4RZHA 3ZWAA 4CLDA 4ZJUA 1C1XB 1ONOA 2X9GA 1GQYA 2FP4A 3TOXA 4J2OA 2VHVA 5JMPA 5CFZA 1EK5A 2HJSA 1UDBA 3D5TA 1A7KA 3FCOA 3PDUA 3IKTA 4R5MA 2VZ8A 5I7FA 4JROA 1BSVA 3EY4A 1KVSA 4YRAA 1NXQA 4MINA 1T25A 3H3FA 5I9LA 5BSEA 1DC3A 1M2WA 1KBZA 2I9PA 3GH3A 1L7EA 1SB9A 3FF4A 5AYVA 5EQFA 2P5UA 4BNXA 3I9LA 4IDBA 4BNGA 2WYWA 2C2XA 3IQDB 2DBVO 1PS8A 4O5OA 4OXYA 5DN9A 1PJ3A 3K30A 4R4JA 3F1LA 4IS3A 3OIDA 2GASA 1B8UA 1QKIA 3DZKA 3K96A 4CM4B 1Z45A 3MWEB 1BXZA 2FR8A 2ZATA 3C85A 1EVJA 1ZCJA 3ICCA 4XIYA 5HBRA 3O4RA 1PGPA 1B8VA 1RM4A 3AM5A 2UAGA 1E3JA 2A9FA 1P1IA 3DC2A 1JWBB 4QFCA 3Q9UA 3Q9NA 4YJFB 3GVIA 4D44A 3B1FA 3WWZA 4QXMA 1P1RA 3A28A 3EGOA 4UAGA 3MTJA 4Q3EA 1Q7CA 3QVTA 4KWHA 1PZGA 3U4CA 1S6YA 4K9DA 1G0NA 2HK9A 3G1UA 3IOYA 4ZVVA 1VC2A 4E3ZA 2PZMA 1VL8A 2PZLA 4FJ0A 1JKJA 4TVBA 4YAKA 3ASUA 3NUGA 1NR7A 2VRBA 4DL9A 1PU2A 2Q3EA 3ABIA 4OMUA 2IDZA 1SOWA 4TVOA 3WGGA 1AN9A 2P68A 1P0CA 4FC6A 1IZ9A 1XLTA 3ZW9A 2TMGA 1R6DA 2VUTA 4WGGA 3VVCA 1NPTO 4R69A 4QUKA 1NVMB 5TF4A 1VKOA 1LLQA 2NVWA 3CTMA 3NEPX 3EK2A 2GLXA 3WIEA 2VYVA 3M6IA 3ZWXA 4RF3A 1Y6JA 3W4KA 3WJ7A 4IJUA 2Q1UA 3VTZA 1PQPA 4DA9A 3KRTA 4KZPA 3CH6A 3F4LA 3H2SA 1E6UA 1ZXBA 1UXJA 1XYGA 2ZTLA 3AW9A 4GX2A 1LSSA 1HLPA 4CLXA 2FZWA 4Z0TA 3OETA 1J4AA 2UUPA 5EN4A 2I5PO 3AY6A 2NTNA 3O03A 1VJ0A 4H16A 4YQYA 3WBFA 5BNTA 5KJFA 3TFOA 1KVRA 4A0SA 1VM6A 4XYLA 3DTTA 3EUWA 1HYHA 3BZUA 1TXGA 4BNMA 3KSUA 3T4EA 5LCXA 1Z73A 3OQ6A 3KYBA 3KYDA 3RBZA 5AXAA 3UFXA 4J43A 1ENYA 5COAA 4BMSA 5JAMA 3D4OA 4WCFB 3BYZA 5ILGA 3ON5A 3OJLA 1LDYA 1YBMA 3WS7A 2GPTA 4PZDA 4LK3A 4D46A 5C7OO 2NU6A 4E32A 1YB1A 2Q1TA 4ALMA 4BO2A 2XPCA 4A73A 3C24A 3IS3A 2Q99A 3HSKA 1WVGA 1NFQA 4GX1A 3RC7A 4MP8A 5I9MA 1FDWA 1MFZA 2PGLA 2OP0A 3SLGA 1V3UA 2NU9A 3PVZA 2WMDA 3TRIA 1W6UA 2EIHA 3DBRA 1RWBA 4PFJA 3RJ9A 4PRKA 4Q3BA 4OL9A 4IQ0A 3ZV3A 4IY1A 4E5MA 7ADHA 4MDHA 1NR1A 1U5AA 3ZWYA 3PPIA 3PP8A 4J1NA 4N5MA 4J4HA 2DVMA 3SC6A 3F47A 1HE2A 4O59O 3WTCA 1EK6A 1ZEJA 2BMAA 4WLVA 3ZHXA 5FI3A 3MOIA 4BO9A 1TA4A 1P1KA 5DULA 4YT5A 1I2ZA 1Q2XA 3HB5X 1YOVA 4UUMA 5A5FA 3QVOA 4CM9D 2VT3A 2NVUB 1VKNA 1Y5RA 3RD5A 1BWSA 3NT5A 2FRDA 3AFMA 1AHIA 2YHIB 3F9IA 3WLFA 4YT2A 7MDHA 1T2CA 1KVUA 1LX6A 4DYVA 1H6BA 4J16A 1T2FA 4FQ8A 3C1AA 1PJ4A 4BGUA 4JIGA 5B37A 2CZCA 1EFLA 2BFOA 8LDHA 3KVOA 3ICPA 2B0JA 3WFIA 1I8TA 2NLOA 4PLYA 3ZW8A 3DAPA 5DCWA 3O8QB 3HFSA 3HUDA 3IP1A 5GZ6A 1PJTA 1XR3A 3AI1A 3QV1A 2X5OA 1ULSA 3I23A 1G1AA 1TVEA 3PJDA 1XQ6A 2B4TO 3FR7A 3S1LA 5KVVA 5JDIA 3JQAB 3CIFA 1DJQA 4FGWA 4BO3A 3IAHA 1U8FO 3NJ4A 4QEDA 1Z75A 3D3WB 4HFMA 5KOIA 1J6UA 3JQFC 3W8EA 3QQPA 3RJ5A 3U3XA 4TZTA 3PFWO 2DKNA 4W4TA 3ADOA 2CFCA 2AG5A 2Q50A 1K89A 5KJEA 2X58A 5JBIA 3FNHA 4ONEA 4XEHA 3N7UA 1WWKA 3LT2A 5BNIA 1HYEA 2DFVA 4R41A 4BNVA 4EI2A 2P5YA 2C5EA 4KQXA 4DPKA 2A35A 3UH1A 4PG5A 4RVGA 3AK4A 4UVHA 1SAYA 3VPHA 5ITWA 3OJ0A 4IXTA 4EUHA 1H94A 1ISMA 1HLDA 2PD6A 3DOCA 4OXNA 4BNTA 4JK3A 3PYLA 4O1MA 2BGKA 4CMEC 2NWQA 3MJVA 4UUNA 1R37A 1WZIA 1Y7TA 1YONA 1I36A 1E7WA 4FFPA 5EIOA 5ITVA 3PLNA 2GO1A 3GZ4A 3WMXA 4GVXA 2VYND 1ZJZA 4RO0A 2DUUA 3JQDA 1JAYA 2G82A 4XR4A 3ADPA 3JQ7B 2VZ0A 3KEOA 5KJ6A 3AM4A 1NTOA 3G1TA 3IJRA 4YB8A 4DRYA 4BO8A 2CDBA 4J1SA 4Y98A 3RU9A 2AE1A 1KYQA 1E7QA 4B3JA 2YJZA 2JHFA 3NT4A 4GPD1 4UEKA 3UCFA 1U4OA 2YZ7A 1NP3A 1EUCA 4XGIA 3MWDB 4XKJA 5I8WA 2IZ1A 5IXSA 4KTVE 3A9WA 4E13A 1E5LA 1A7AA 1NASA 4CMHA 1B3RA 1WDMA 2BI7A 3FNFA 5BSHA 1DIHA 4M86A 3RC9A 3QJ5A 3HN2A 4XYMA 2JKVA 3ETGA 3Q3CA 4CQMB 1PGOA 1GV0A 3RFTA 2J6IA 4JBIA 3KYDB 1DIGA 4Z9YA 4URFA 4UVGA 1JQBA 4OOEA 4PLHA 1LTHR 1Y9AA 1U9JA 5I8ZA 2DUWA 4D45A 2GSDA 2YV3A 3RUEA 1N8KA 3L0DA 1WDLA 1DRUA 1NFRA 2QHXA 2V7PA 4I1IA 1EFKA 3GNQA 2D5AA 3EMKA 3OMLA 1QXSA 4FBGA 3WICA 2B83A 2H5LA 2UV8A 2C7GA 3W6ZA 3UKOA 3VH1A 1Y8QB 2WM3A 4D3DA 1EBFA 3K6JA 3ZNPA 1OFGA 3DEYX 2Y67A 4GX0A 4YT4A 1R4NA 1TT7A 1N9GB 2PH3A 4EEXA 4IDEA 3NRCA 3ZZNA 1NHGA 3MEQA 4FOOA 5COBA 3UOGA 4WK6A 3U49A 2DBRA 3RWBA 1FDVA 2Z1NA 3AY3A 1XQ1A 5DBIA 2H6EA 3ZHBA 1D1SA 3ORFA 3BMQB 5DZSA 2F1KA 1AE1A 1R16A 2P4QA 2AQIA 3GEGA 4IJKA 4CMJA 1OBFO 4XR9A 3V1YA 4Q3NA 5G0UA 2I66A 2DTEA 4Z0HO 2C5AA 4J7UA 3VZRA 4YBZA 1NQ5A 4OQYA 1FMCA 3QIVA 1P77A 5TT0A 1GY8A 4A5OA 5ICMA 1J0XO 3AU9A 3CINA 3NTQA 4DIOA 4UEJA 1A9YA 1B2LA 2O3RA 4YXFA 3AM3A 1PGQA 4WCDA 2D1YA 5KVQA 2RBEA 3GAFA 5G0SA 5K9ZA 3UVEA 5MGBA 4NFSA 2W2LD 2PGJA 2NACA 1BHSA 2Q4EA 4OIMA 2CSUA 3VPFA 1FF9A 1PTJA 4K6CA 4XD2A 1LU9A 5KWEA 4M1QA 4W7IA 5K0ZA 1GEGA 4GI2A 2YFHA 3HQ4O 1ZSNA 1EBUA 3ENKA 3QWHA 4BL5A 1DFHA 5BT9A 3S2EA 3PJFA 5ADHA 1U3VA 3FD8A 1F8FA 1TI7A 3GDFA 5TJ9A 3GEMA 3UUWA 5JSFA 3ZI0A 1UP6A 1ZIDA 1AGNA 1V6AA 1HSZA 4CR7A 1JN0A 1KC1A 1WNTA 2PKRA 2HJRA 1W0CA 4U0JA 4IPTA 3ZWBA 4XQEA 1U8XX 3DBVO 4XGKA 1OC4A 3RU7A 3RIHA 1P3DA 3Q11A 2XF8A 3GVCA 2XAAA 4PLCA 2NQTA 3WYEA 1KOLA 2Z95A 3BAZA 1N1EA 3C7CB 3B20A 3DHEA 1ADCA 3BA1A 3WTBA 2NSDA 1PL8A 2I65A 1ZJYA 4CQLB 4AJJA 5I7EA 3ZWPA 3WXBA 3G49A 5DP2A 5F1OA 1UR5A 2FZEA 4BNLA 5L7TA 4CL8A 2O3UA 1KC3A 3VC7A 3WSWA 4IDAA 4C4OA 4I08A 1ZH8A 3WQRA 5AXDA 3ZWMA 1CIVA 2X4GA 2PV7A 2O3TA 3V8BA 4RPGA 3CSDA 3RUIA 4JNKA 4CM6A 1ADBA 1LLCA 1Z6ZA 2HAEA 4INAA 5KKAA 4FB5A 3HHPA 1I33A 4BO6A 1OOEA 2OBNA 2VHXA 5DP1A 4TSKA 3LU1A 5G4KA 1X15A 2PH5A 3AI2A 2QX7A 3LSYA 3SJ7A 3JQ8B 1WP4A 3PXXA 5ES3A 5TIIA 1Q7BA 1Q0HA 3LVFO 4TKMA 3E48A 1EVIA 3ZWVA 3PHGA 2E6UX 3QA9A 4UEOA 3H9QA 1DOHA 1P74A 1NVTA 3PWZA 1PJSA 1SMKA 1UAYA 1XA0A 2G5CA 4G65A 1YJ8A 1HETA 3AU8A 5J23A 4DYDA 5JW6A 3KYCB 4QO8A 5CDGA 4A27A 4BNZA 5JY1A 4OYRA 2BHLA 1LRKA 3HDYA 4B4WA 2BGLA 5DCUA 3CXRA 2W4QA 4UVEA 5T8KC 1FDTA 2X9VA 1O6ZA 2NM0A 5FWNA 1ENZA 1TT5B 4PG8A 1H2BA 1BW9B 1SB8A 2ZQYA 3H9GA 4NDNE 3NX4A 1H6AA 3G17A 1ZVMA 1MC4A 4WKGA 1UZLA 4YJGA 4PVDA 2F00A 5THQA 2GRAA 1KEWA 3GN1A 3Q6IA 1O94A 1CETA 3HFGA 4OOFA 1FK8A 4W9NA 5KVSA 1GDHA 3DONA 3F46A 3JD2A 2FPIA 3F3SA 2LDBA 2HDHA 2PY6A 1QR6A 4R51A 3F5QA 2CY0A 3BHMA 3KOUA 2O2SA 4EBFA 2X0NA 5A04A 4I5DA 1RPNA 1RM5A 3VHRA 2HMUA 3W4IA 4FJ1A 2IODA 3PGXA 2YV2A 4GH5A 1SCUA 1BVRA 2RH8A 2FSVA 1R4MA 4QFDA 2AEJA 1QYWA 4HY3A 2GD1O 5H82A 3BTOA 2O48X 2AEFA 4J0FA 3DR3A 3K8ZA 5LDHA 3ROPA 1YO6A 1YJQA 1DO8A 1DDOA 1SC6A 2EP7A 2EJWA 1P31A 2RIRA 4GVLA 4PG7A 4DIFA 4CM5A 2QZZA 1H5QA 4BS9A 3ANLA 1A5ZA 5HWSA 1Y9EA 3JQ7A 4MIEA 4B4UA 3GC6A 3UGKA 4DBZA 3CZRA 4M8SA 1HZZA 1ZSVA 3JYQA 1BGVA 5BNFA 2GCGA 1GYPA 1R0LA 3BTUA 5T8KA 1GEEA 3PIDA 4UREA 3PZBA 4HV4A 1EQUA 4D41A 1J5PA 3F5SA 3L4SO 2B5WA 3DHYA 3GF4A 4QX6A 5KIAA 2JFHA 4L76A 2PNFA 3ZHZA 2A94A 3W8DA 1UZNA 4JP3A 1M66A 4P4LA 3EAGA 5K6AA 1HSOA 4RF5A 2VYVD 3Q0EA 1G0OA 1ZK0A 2OFPA 1VL0A 3JQ9A 4J9UE 1QLJA 3WGZA 3PHHA 5TC4A 4L0QA 1Q0QA 1L7DA 2BD0A 1MLDA 2NNLD 2Q2QA 1UZMA 3GPIA 1CRWG 1HEUA 1SBYA 2BFAA 5CPFA 1PIWA 5B12A 2J8ZA 3ENNA 1EDZA 1ISJA 1YL6A 4MVJP 3JQAA 4BNYA 2FPGA 4BV9A 1T1SA 3HDHA 4J4TA 1KERA 4IQGA 4CV1A 5IZCC 3GNSA 4NR0A 1E6EA 2VNAA 3KB6A 4XB1A 4KP7A 3RUDA 1X0VA 1LSUA 1YE3A 4FCCA 4YACA 3GHHA 3H4VA 2UUOA 1PGNA 1NM5A 1OAAA 1SEVA 2PFGA 4RZIA 4K26A 3A06A 2WD7B 2P4HX 3MOGA 3ZNNA 3R3SA 3DMTC 4RCVA 3H9JA 1MA0A 4CMCA 4YYZA 2VWHA 1HDXA 1ZBQA 3EYWA 1RJWA 3RUFA 2Q46A 1HT0A 2D59A 2OORA 1UAGA 3DOJA 3OEYA 4YR9A 3BTVA 3ZU2A 1PR3A 2Y68A 3SBOA 3VZQA 4YJDA 1PS9A 2PWZA 4QECA 3LT1A 5DBGA 4DXHA 4XCVA 3D3EA 3E9NA 4YJHA 1ZK2A 4MP3A 4W7HA 4OSOA 5F1PA 4E2YA 3CEAA 4F46A 3TN7A 3TFQA 3V5NA 2O4CA 3AFNA 3MJCA 3U4HA 3W6UA 5FF9A 3GDOA 4NQZA 1D7OA 5BSGA 2J5QA 1R0SA 3PZRA 3CZMA 2IXBA 4L74A 2Z1MA 2JJYA 1DSSG 1GTMA 2D2IA 3E82A 3OEWA 2VUSA 4B8ZA 3LF1A 1DHRA 3RFVA 3ZNOA 3RUCA 5JAZA 1NX6A 1DIBA 4RGBA 4BMNA 4IDFA 5IDQA 2GZ1A 2Y0EA 4R9SA 5DNAA 2R00C 1DIRA 2HUNA 3GDGA 4PIVA 3FI9A 3K5PA 4GGOA 1YB5A 1ZMTA 1ISGA 2YHUA 4L73A 4MVJH 2IRWA 3RC2A 2Y1CA 1U2GA 5CDUA 1N1GA 4CPDA 4ROSA 2P9GA 1TEHA 1Z7EA 4FW8A 1ZXLA 3KLPX 3T7EA 3WG9A 3CMCO 1ENOA 2JCYA 3E6AA 1GFSA 1LSJA 3GUYA 1YQGA 3MJTA 4E4YA 2DU8A 3WGTA 3KV3O 4YCAA 2XXJA 3WDSA 4CV0A 2JAHA 1E3IA 5A06A 1F17A 1MP0A 5B4TA 1PJCA 1DAOA 4RQUA 1GV1A 5CEFA 3CKYA 4E2XA 1Y8QA 3DHNA 4IINA 4CM9A 1XG5A 2BFPA 4U7WA 2NV6A 2O7SA 1XEAA 5A1TA 1MX3A 2ZJ1A 1E3SA 2JL1A 1OZAA 1FJHA 4BIIA 3ETEA 3GLQA 5H83A 2TMDA 5HRUA 1WLYA 2EKQA 2H9IA 1BG6A 4JQCA 4FPXA 1ZK3A 3OBBA 5KNLA 4LVUA 2YHIA 4BV8A 1HRDA 4NK4A 3JQBA 2FOIA 4KUEA 1GUFA 2JHGA 2VHZA 3R3JA 4OSPA 2DTDA 2PKQP 3BMOA 3PQEA 3WWYA 1NBOA 3C7AA 2NVBA 3G3EA 1WMBA 5JC1A 1GZ4A 5CHEA 1M6HA 2B5VA 3GR6A 4NU5A 1PGJA 4PCVA 3S2FA 4AJNA 4BNNA 4KUHA 2DFDA 1KIFA 4NBVA 5IN5A 4Z6KA 4I5GA 3NYWA 3RI3A 4R1TA 2HK7A 5L3ZA 1NPDA 1YKFA 2WYVA 1DFGA 5CPBA 4YRDA 2PZKA 3I3OA 1K6JA 3FTPA 4Q39A 1YS4A 4GMGA 4R9RA 1SO8A 3HWRA 5TRTA 3DBLA 4RDIA 4AJ1A 3VPGA 2HO5A 3TWOA 2IYPA 3TOZA 3D0OA 4LW8A 4NFYA 1ZK1A 1IUKA 1MXFA 4L9RA 3UN1A 5U9CA 1IZ0A 2DTXA 4RF4A 3I52A 1Y81A 4CMEA 1ZFNA 1UUFA 4B4OA 1YXMA 4CM1A 4ZA2A 3PFFA 4OO3A 3WGIA 1U1IA 5IDXA 4CR8A 4ALJA 3JD1A 1DRVA 4M87A 5G0TA 1NFFA 3ZU3A 3HADA 3FTNA 3DFUA 2W8ZA 4WLUA 4DLLA 1YH3A 3KLMX 3ZGYA 4NZ9A 4GSKA 4K28A 1KEVA 4BGVA 4BOYA 1Z7BA 3KEQA 4XGNA 5C5IA 2WWRA 6ADHA 4HX5A 3DO5A 3C3XA 5C7LO 3F6YA 4FFOA 1I3MA 1HDGO 1ONNA 3JQGB 4BNKA 4J4BA 2V6FA 2VT2A 5TX7A 5FYDA 4AVYA 2HMVA 2JD0A 3ROKA 3AOEA 1I0ZA 4IDGA 2HLPA 3GFBA 1MGOA 5ENVA 3MJ4A 3L4BC 2GN6A 3GY0A 3QVSA 1ZUD1 1HE3A 3B1JA 3GZNA 1ID1A 1O89A 4P4GA 4NBTA 1A4UA 5IDYA 4OHUA 3COSA 1DC4A 4R5HA 4N5NA 5JO0A 2ZYGA 3FWNA 5JDCC 2CVZA 1GU7A 1HXHA 1MUUA 1GCUA 4CM7A 1BMDA 3GPDG 1XGKA 4B7UA 3ITDA 3TZCA 4NH4A 4BVAA 1M75A 1MB4A 2C29D 3BMCA 4WECA 1HDCA 3DMTA 2HRBA 3DL2A 3UF0A 3OIFA 3FNGA 5ILOA 5JYDA 1M76A 1GYQA 4Y6SA 1PQUA 4OJNA 2EF1A 2VOEA 2WD8A 2AMFA 4LSMA 4BGIA 3EZLA 2AXQA 4JBGA 4EGFA 5IDWA 2FWMX 4A7PA 4KDFA 2D5CA 2RCYA 4WCFA 4NIMA 4YWJA 3QW2A 1NQOA 4CM4A 4IXWA 1I2BA 4U8GA 3UICA 3V1UA 1IE3A 3SJUA 4WNCA 3X2EA 1CWUA 1BXGA 3DBHB 3ZV6A 1QYCA 3LC7O 5JLAA 4MJLA 3WYCA 2AE2A 1JWAB 4J7CA 4ZRNA 3OM9A 2QYTA 1GADO 4NJOA 4W6ZA 3GZNB 4H3VA 1IB6A 3LYLA 1BDMA 4EJ6A 4PLVA 3Q2KA 3TJRA 1H9AA 4TKLA 4GLOA 2EP5A 3TF5A 2I3GA 3JCZA 4IUYA 4O0LA 1XHLA 2R00A 4DQUA 4C7JA 3I5MA 2ZB7A 4MVJE 4W99A 3UXYA 4CLRB 3TZQA 1F14A 5K6AC 1N7HA 2QG4A 3M1LA 1IPFA 2C20A 1K5HA 1F0YA 1JDJA 3QSGA 5CEJA 5ER9A 5EMHA 5LC1A 4ID9A 4RDHA 1XDWA 2EEZA 4NBUA 3UAGA 3DTYA 3GGOA 3H65A 2EHDA 2UDPA 4PG4A 1JLLA 3PJEA 4NK5A 5KTKA 1KY4A 1E77A 4PLFA 1T26A 3K73O 2FR0A 3PWKA 3PYMA 1BVUA 3E9QA 4B3HA 5GMOA 5JC8A 3NAQA 2ZB3A 4KUGA 1M6WA 4P22A 4MIYA 2J3KA 2PGDA 1E1LA 1RYEA 4F3YA 4MPDA 5EPOA 1MV8A 3WMWA 1PJBA 1QYXA 1X7HA 4CLHA 2EKPA 2HCTA 4CUJA 4BNWA 1HDYA 1QV6A 2NVUA 1LDNA 1QYDA 2JD2A 1HYGA 4IZHA 1YVEI 3NV9A 1C0LA 2NUAA 5DBFA 4HNHA 2QRJA 3QWAA 3LC1O 1OI7A 3RKRA 1DC5A 3JQ6A 5B4UA 4MVJF 1PR9A 4XYEA 9LDTA 4IGEA 4F45A 1YQDA 1CQJA 3R0IA 4CM8B 4HKTA 3IIEA 2YW9A 4CQMA 3ST7A 3O8QA 3V2UA 5FI5A 1EDOA 5TLSA 4DWVA 1QMGA 1QYVA 1I2CA 4RVSA 1LRJA 1U7HA 1GD1O 1ULUA 4CM3A 3H9EO 2EW2A 1PJ2A 1T2EA 2UVDA 1PZHA 2PZJA 4B4VA 2WSBA 1R4MB 3QP9A 2IXAA 1LJ8A 3IUPA 3H5RA 1ZNQO 4EJ0A 1WZEA 4O6VA 1X7DA 3ONDA 4AJHA 4I9UA 4YT8A 1D8AA 1XKQA 2A92A 4L8VA 4MVJA 5G0WA 1I30A 5L40A 2GR9A 4ZRMA 1V3VA 2Y05A 1U3WA 4FR5A 4HBGA 3MCVA 4XA8A 3SEFA 4YJGB 1B8PA 2Q49A 3SLKA 2C54A 4R01A 1N7GA 4DMLA 3S2GA 1GUYA 2FHSA 3VTFA 2LDXA 1XU9A 2YDYA 5I7SA 2Q1SA 3PEFA 4DC1A 1XWFA 3FSRA 2P9CA 2CD9A 1Y8RB 2C07A 4Z3KA 1VJ1A 5IZCA 2PKQO 2Y93A 1DHTA 3JYOA 1PL7A 3T7CA 4RVFA 3F4BA 4GSLA 4BMVA 1B16A 5DT9A 3KZVA 3ROMA 2HK8A 3DWFA 3QWIA 1DXYA 3TSCA 1LDEA 4BO5A 5TGDA 4NI5A 1CERA 4ZQEA 5T5QA 5DCYA 4AJLA 4NMHA 2WYUA 4HXYA 3JD4A 5T6BA 4E6PA 2R2GA 4ZQGA 4E2WA 2W2LA 3TL2A 1R12A 1XU7A 2CVQA 5GZ3A 4J91A 4B7XA 2PD4A 2O50A 1V8BA 3BMNB 1CQIA 1YGYA 3QY9A 3JD3A 4CV3A 1JW9B 2A4KA 5IJZA 5ER6A 4DPLA 2H1SA 3E8XA 5T64A 3Q2IA 3U5TA 1H0KA 5EERA 4HADA 3RFXA 1E6WA 5FFFA 1UH5A 4BQPA 4MP6A 3L07A 5DOZA 1EQ2A 5AVOA 4AJPA 2RHCA 2YQ4A 1VL6A 1K6XA 4MKRA 4XYGA 4JP2A 3B1KA 1KEPA 2YQ5A 3BIOA 1RM0A 1Y8RA 2GN9A 4PLZA 4MKXA 4Z3DA 2GZ3A 3GMSA 1VLLA 3ZWCA 4CR6A 2WD7A 1V35A 3EC7A 2EW8A 1EEHA 4JXKA 3VH4A 1CDOA 5AXBA 4H7PA 3WQSB 4A10A 2QRKA 4L4SA 2O2YA 3GFGA 4IBOA 3AOGA 2ZCVA 4GBJA 4GAEA 1LQTA 3BHIA 1ZEMA 4TZKA 4EYEA 2Y66A 3D4NA 5JXWA 1AUPA 2HQ1A 2Y99A 2IE0A 1PX0A 2PTGA 3R1IA 4D7AA 1Y1PA 1ZK4A 1P9LA 4TRRA 4IJWA 1NVGA 1HZJA 1V9LA 1UDAA 3DZIA 2QRLA 4IIVA 1P45A 4XB2A 1SPXA 2VHWA 3GT0A 1AXEA 1JVSA 3I6IA 2E82A 4D0RA 1DIAA 3NJ8A 3KO8A 4L4XA 5U1PA 5L4SA 1LDGA 5CDYA 1JVBA 1A71A 3O26A 3ONEA 1LLUA 2BI8A 3RAJA 5F3RA 3EZYA 1VE9A 4FGSA 3PGJA 5JAQA 2Y1GA 1SNYA 1E5QA 3GG9A 1A4IA 3FHLA 2PLAA 5T57A 3A4VA 5L95A 1U4SA 3I9KA 3PI7A 1HDRA 1LUAA 1PSDA 2VNSA 2G17A 3I1JA 3KM0A 3NGXA 4MKZA 4DGSA 1JAXA 2VUUA 2ZTUA 3AUSA 1LEHA 2CVOA 5C37A 3HG7A 4UULA 4Q3AA 3EVTA 3OQ1A 9LDBA 2OHXA 5L9AA 3I9OA 1D1TA 1FDUA 5EINA 4UVIA 3DZFA 1NAHA 3FBGA 4IZIA 3U09A 1I3KA 3JTMA 4M89A 5TNXA 2HMWA 4ND4A 4NHEA 1X7GA 3H7AA 3INRA 4FFRA 4WOKA 2B36A 1E7RA 1TB4A 4FSHA 1QRRA 1GYRA 3H5AA 3HDJA 4YA6A 3PWSA 3OF2A 2QZ9A 4OM8A 3SVTA 4QQRA 3WGYA 1UDCA 4I8XA 3ZWWA 1Z82A 4NBRA 4U6QA 3D7LA 4II3A 3NDIA 3OICA 2W90A 2DC1A 4P8RA 2IYOA 5JCJD 4UUPA 2O3JA 1IULA 3PK0A 5HA5A 2V6BA 4J90A 5A9SB 3QWBA 3OP4A 4Y9DA 4RJTA 4AG3A 2VRCD 1YOVB 1W8DA 3KSDO 2EV9A 1BXKA 2NTVA 3FNEA 4ND2A 1RKXA 4AJOA 3E18A 5JY6A 5GZ1A 3WFJA 2X0RA 1O0SA 1P1FA 1LSOA 3OFSA 4OXKA 3JD0A 4LMRA 3JQEA 1HE5A 3WYBA 5HS4A 4D79A 4RPLA 5JPIA 4YQZA 1V3TA 3DZHA 2Q45A 5ICSA 5G4KB 4DLBA 1E0DA 2X5JO 3K2EA 4AJIA 3KSZO 1SEPA 4FIZA 4WLFA 1PWZA 1BDBA 2Y0CA 2X0JA 4GKVA 3RC1A 2GF2A 2J3HA 1ISIA 3GK3A 3P2OA 3WLEA 1Q7GA 4GQAA 4YEDA 2ILTA 5L7YA 1YRLA 2X22A 3C7DB 4R54A 4I9HA 4GWKA 4B7CA 3Q1LA 4BUCA 2ZIZA 5JDCA 4LMPA 1LI4A 1NWCA 3WNQA 5L4NA 2QQ5A 2Y1OA 2D4AA 2OGUA 1MG5A 4X54A 4U0KA 4D3FA 3AI3A 1BRMA 4FN4A 1TLTA 2JCXA 4R1NA 1QSGA 4YJFA 3TL3A 1GQ2A 4GX5A 4ALIA 2J3JA 5A05A 4ITUA 5F1KA 2G1UA 1X0XA 4WCFC 2J3IA 3ROQA 3LT0A 4II2A 3IC5A 1LA2A 4BQRA 3EW7A 8ADHA 4YTEA 4G2NA 3HJAA 1F8GA 4BO1A 4CMAA 4O63O 4FDAA 4BO7A 1ML3A 2DPHA 2W98A 4AJ4A 3U9LA 2QW8A 4PN3A 5G0VA 3N74A 2ZTMA 2X7HA 1KY5A 4J1TA 4WJZA 5TJHA 2Q4BA 4F6LA 2POQX 1E7SA 4KDEA 1YL7A 4IS2A 2GYYA 4RPJA 4WLNA 5F21A 1HF3A 4LRSB 1UXGA 2OZPA 1VSVA 4R1UA 2ZJ0A 1B0AA 2GGSA 4YJHB 3PDJA 4YPOA 4KOAA 4XZ3A 2C0CA 5FEUA 3JYLA 1M67A 4RVUA 1C1XA 1YDEA 1DC6A 3ZNQA 2H63A 1R0KA 3GAZA 3JYPA 4XRGA 1LXCA 4PVCA 4UUOA 2Q2WA 4HWKA 3DDNA 2B69A 3QLJA 1GL3A 5A9SA 3NT2A 2OOSA 4OKNA 3PJGA 3JQ9C 3H3JA 1L1FA 2XXBA 4NBWA 3VOSA 3OECA 1I5RA 1O9BA 4IDDA 2DT5A 3H9UA 4DMMA 2VCYA 3RCBA 3TNLA 3ZU5A 3IJPA 4Y6PA 3JV7A 1IPEA 1IHYA 3FPCA 4HFNA 4R3NA 1B3BA 1VPDA 2V6MA 3E03A 4GLLA 4CUZA 5KJCA 1WXDA 3GVHA 2IEBA 3O38A 2YYYA 2XOXA 4WLEA 3OQBA 4BGEA 4A03A 3ASVA 4LRTB 4BKRA 4DQXA 1VSUA 1H2HA 1ADGA 3RBVA 3U4DA 4J2HA 1XSEA 5JS6A 4QO7A 4DUPA 2O3SA 1UJMA 3V2HA 2ZB8A 4GWGA 3LZ6A 4IQ8A 2ZB4A 1AHHA 4XRRA 1NAIA 4NFHA 2Y0DA 4N54A 5JNLA 5A03A 4E5NA 1LDBA 4M49A 1OC2A 2P91A 4EUFA 3WOHA 1P44A 4ESOA 1R66A 2I6TA 1E92A 3W8FA 3GVPA 5IF3A 4WE3A 3DBHA 4ZN6A 1U3TA 3HZZA 4CQMD 1I24A 5IG2A 1ZZEA 4DPMA 1ZO8A 1C0KA 4TROA 2AQKA 3INGA 1LLDA 1DFIA 4RVDA 2D3TA 1PJLA 1U3UA 3DXFA 5BSFA 4P4NA 3VKVA 3V1TC 5CP8A 1NHWA 3FN4A 4JGBA 3BMCB 4R1SA 3LT4A 4ZQBA 4CMGA 4J0EA 4XQCA 5TT1A 3JQFA 5B1YA 1CJCA 4E12A 3H6KA 4WPGA 3VZPA 3HE3A 4WOJA 1IY8A 2FY8A 2JD1A 2ZYDA 3BMOB 2WTBA 2HMSA 1GR0A 1KEUA 5GY7A 2B4RO 4E5PA
chains in the Genus database with same CATH superfamily
2ZXEA 1CCWA 4GU5A 2AIRA 3ID6C 3B6IA 3ORRA 4XFKA 4CQLA 3UMBA 3EARA 4LBYA 1YZGA 3GCDA 4QEKA 3AL2A 3DEFA 5HGJA 4LXQA 3C43A 4RD1A 3R9KA 1TC1A 4B6SA 3X2FA 3PIIA 3QFCA 1RZ3A 3DW3X 4NU8X 4ZV4A 5B1HA 2LVBA 2HV8A 1T4CB 3WB9A 3MHTA 3WWCA 4KRFA 5H9WA 3OUZA 4DQKA 5ESRA 1B00A 3HJGA 2Y1LA 4HHEA 3BFKA 1NXOA 4J1QA 4JOSA 3KEFA 5AICA 5KREA 2PX3A 1RWQA 3A31A 3O0DA 4LJ4A 3KJZA 4O4LA 1U81A 3GAMA 4H31A 4CKEB 1SQSA 3O6VA 4JJGA 4ZT5A 4M0DA 2ZSAA 5J1TB 3S55A 4B09A 1A9PA 4RUKA 4DILA 3GX1A 5JJBA 1BGXT 2WFLA 4EHAA 4X62B 4EAQA 2PSSA 1QV9A 1G66A 5DGHA 1DQNA 4S35A 1YZUA 4HNGA 3VNQA 5AI5A 4YV2A 4HDNB 3BTSA 3BT7A 3DWIA 4EKEA 4P81A 3HWSA 5KI6A 1L7QA 4LY9A 4QUJA 2YIJA 4ZO7A 4EPYA 1GAXA 1CEQA 3TJZA 4ZZ3A 1UBGA 3BD7A 2LIPA 1YQWA 2DWOA 4D0SA 4OKIA 5HJ7A 4D99A 4FTWA 5L45A 2ZPTX 3ZXXA 5HFJA 5F9MA 2VBFA 1VI2A 5T4EA 3QW4B 1MOZA 3AF4A 3E7FA 1BA2A 1RTKA 1NPYA 3V9PA 3IMCA 3IBSA 2OBYA 3R44A 3DB1A 4WKPA 1NA5A 3VSAA 4QIHA 3ZH2A 3TECE 1B7GO 1F2VA 4A6DA 2Q2VA 4ZXFA 2RFLA 3EJWA 3I45A 3OU2A 3S8MA 2OKGA 1DAIA 3D81A 1I3NA 3Q2OA 1APBA 2ANBA 3VR5D 1DGQA 1PLJA 1SBTA 2Q3CA 4FCTA 1FTSA 2IIVA 4B7AA 4UFNA 1C9KA 2OO5A 3O8BA 1CFJA 4GR4A 4OQZA 1USGA 4WK0B 5DWVA 3NHWA 4CEHB 2H4HA 4FEGA 4EG3A 4RLSA 2XADA 4HN2A 2QP3A 3WADA 2J5KA 3VSDA 4YAIA 1AQIA 1P33A 2IGTA 1PF7E 4ZU3A 4GF5A 4BJ6A 4RMIA 1GZ3A 2V65A 4UJ5A 1TRHA 1BU5A 3G5MA 3R5KA 5AXCA 1TAUA 4DXAA 2ZS8A 4URZR 3AF6A 4LOHA 1H85A 3PX3A 1NWHA 3OM1A 6CHYA 1YE5A 2D62A 3GGGA 4XQGA 3ZWOA 3W3ZB 4OK3A 3AFOA 3HR4A 2AX3A 1IXKA 4JJEA 3OPYA 5D51S 3RSHA 2FMUA 4GC9A 4LF5B 3WOVA 1FXWF 4UMFA 1WMEA 3N3BC 2Q3MA 5CFPA 1GL9B 3JQ8A 5TMEA 4N7RA 3U1TA 4I7EA 4LYJA 4EITA 2QTWB 1CRPA 1F6DA 2XRYA 2PYIA 3R3XA 3OWHA 3RIYA 4W63A 4DZRA 2DPLA 3FYUB 1MOQA 4XYBA 4OFWA 5FUWA 4O1HA 1JG4A 4HDCA 4DZTA 4QGHA 4JT8A 3KYCA 4IICA 4NJMA 2E5LB 4BX0A 1ZNZA 3D3JA 1P0MA 4TXNA 3L4JA 2IGBA 2HYIC 2JAUA 5F7OA 2KX7A 4U00A 2FFRA 3MMPA 5JT1A 2F9MA 2ZTSA 1HFEL 3IUEA 3NBQA 1P7VA 2OHVA 4ZVMA 2YUTA 3JQCA 2XQGA 4NJEB 5AW1A 1YBHA 3IELA 3AYZB 4PINA 5JZOA 2ZBUA 5E3IA 4AKSA 2HCFA 3MJFA 4PX3A 4BNUA 1F5NA 3DQQA 4CKWB 3VUFA 1OV4A 2OKCA 4ALNA 2I3BA 2FGKA 3IDZA 1FJ2A 1I3LA 2ZIAA 3T5GA 4IWNA 1WCV1 3UGTA 2X0FA 1S2LA 1Z7YA 2CWDA 2ZCUA 4MKIA 4HX9A 1XQVA 4JQSA 5HW0A 3Q8KA 5AJUA 1NMSA 3CG0A 3D2CA 5HE8A 5AKKA 2VBGA 2R97A 5AJZA 3R7WB 3IHWA 1KSGA 1SRQA 4TRMA 3TW6A 5FWYA 4TWRA 4WKOA 2VPXA 4UHBA 2OP1A 5K3CA 4YMVA 5K8CA 2J5RA 2J9GA 2WSLA 3EDMA 1LRLA 3MXOA 4BKUA 3W2EA 1R50A 1UP4A 4IDCA 5HIMA 3QKSA 3DBLB 4IQ4A 2B3DA 5JJIA 1U1FA 4CXMA 1NE7A 1ADFA 1SKYE 3AOEC 4YAEA 3GGJA 3QEKA 2VLIA 2JH9A 1GQFA 4ZJPA 2OSVA 4BHTA 2LBPA 4LZLA 1NNUA 3R0VA 2GRJA 3P2EA 4QXAA 4HUJA 1TZ2A 2BEWB 4F9GA 2B35A 4O4IA 1ISFA 2Y1WA 2BBSA 4DBVO 5IJ0B 1PFQA 4RVCA 2EL9A 2ANCA 4ZVQA 2OO7A 3NBUA 3GRKA 1VLQA 1VIVA 2EJVA 3SXUA 1G8MA 2YN0A 1EUZA 3K92A 1IM8A 4TPKA 4RPKA 3TQFA 3ZV4A 1TVCA 3DFZA 4PLGA 1SIOA 1JYEA 1XNHA 2BLLA 5IT9A 1E3WA 1UXKA 5LYJF 5IZ4A 1G20E 1QQ6A 1EXWA 5EJ4A 2O0KA 3UW3A 1CYDA 2CMKA 3KCQA 2VDMB 2DLDA 2Z2ZA 2ZANA 4BX8A 2PCJA 2QQGA 1E0SA 3MTDA 3WYGA 4JUDX 1UBOS 2VF8A 3I1YA 2CJYA 5HZMA 4ZICA 1L5NA 4F38A 3QRWA 4UPDA 4Y2XA 2Z43A 1ZGAA 3WO1A 2I99A 5GM1A 3BXXA 1JVNA 4DUGA 2VUIB 3EXFB 1V1JA 1RQRA 3T3MB 1R8XA 5D01A 1T3GA 5IMBA 1RHMA 3UHFA 2O8EB 1R15A 1DRWA 2JIBA 2X23A 3QH4A 2V4MA 2WJIA 4BO4A 3LWBA 1EFTA 4F5ZA 3VM6A 3QHAA 5CK4A 3NKLA 4V0LA 3UHPA 3WJAA 3RV3A 4HFRA 3PVSA 1BHJA 1TM7E 3CNHA 1GFWA 1UL1X 1OFUX 3E2IA 1KVTA 4M1EA 5JYEA 2R96A 4Y2HA 1RYYA 2ZWPA 5DWQA 1L8XA 1M6YA 4DV3B 4QC2A 2HGSA 4BKMA 2G36A 3IO3A 4RY0A 2R4TA 3MS4A 3G8YA 1I6WA 2PPLA 3PHIA 2LUOA 5IKXA 4HWGA 2F8LA 4I1VA 5IYZA 4OU4A 5BOSB 5LYJB 4ILKA 4DTIA 3SY8A 5CDTA 2NXJA 2P9JA 3VH2A 4LJ7A 3TR6A 1K8XB 3NLLA 2VSNA 5G4LA 1Z74A 3R6WA 1GCOA 4C08A 2IZZA 1S3IA 1ZR2A 2IFTA 2NZVG 3JQAD 3UJPA 2JAPA 1U2GC 5GGYA 3ISVA 2JZCA 3I0ZA 3WLKX 5A9RA 1KL7A 4B17A 1JPNA 3CW8X 1PK9A 3D0RA 4Q3OA 1QV7A 1Z6TA 2HD4A 2HLHA 3EFHA 4FS3A 5ALXA 4CUKA 1T4DA 4OQQA 2AA3A 3H17A 3IV6A 3C3KA 4TKUA 1BJKA 5LDGA 3NTRA 5FOVA 2QTZA 3JYHA 1O5IA 4Y9SA 4YFVA 3DJYA 1B4DA 4J03A 4YIHA 1CD5A 2PS3A 3DZ8A 3U61B 5K0FA 1P1JA 4YECA 4E2ZA 2G04A 3RQSA 4PGAA 3V8RA 2RH4A 1JQEA 2NZYA 5JVDB 4MDYA 3IKMB 1QP8A 3PUHA 2R60A 1LJUA 3WGOA 1EFRA 3HKCA 4FLMA 2FEOA 4OM7A 3LF2A 1ZW1A 5COQA 4C5BA 3ZWDA 2C9DA 2R8XA 4AF7A 3AB3A 3IAM6 5K4AA 3UXHA 4F6RB 4BNFA 2J41A 4D42A 1CUWA 1EFUA 1V5IA 5WRFA 4RS4A 1IYZA 2PK3A 3IUMA 3UG6A 3E1KA 1JHVA 2H7XA 5IJAA 2ZJ4A 4H1VA 3I2JA 3ZVNA 2CT8A 3PTLA 3VBCA 1QHNA 1YL5A 1WW3A 4J0JA 5FHQA 2YWHA 1JA9A 1GP2A 5J2UB 3RIEA 1ISSA 3LY7A 2IIBA 1GAEO 1N9GA 3MB8A 1O3YA 2WIAA 1NVKA 3IQZA 3PT9A 4NBLA 1DAMA 2R6R1 3A1WA 3FWZA 1Z2DA 4GQBA 3EEOA 1RPZA 2VQSA 5AK6A 3A70A 3STUA 3GFPA 4LC1A 4OFBA 3QEJA 4V2IA 5JANA 4CODB 2ZRFA 2R8YA 2HSGA 3E9MA 3FAZA 3MMSA 4NCHA 3ZHUA 4DG9A 4J16C 4R2MA 4M9ZA 3LDHA 2QXUA 4Y9TA 3DB2A 3PPXA 2CB0A 4CHTA 2X3YA 4LC0A 3FUTA 4R3WA 2E48A 2XAUA 3KAJA 4ZWNA 4HEA1 1L3CA 4B33A 1KETA 4DCUA 1A27A 2IY9A 1OWMA 2VATA 5I7VA 5EJ2A 2Q3FA 5ITSA 3P0FA 1WIWA 5MF6A 4COOA 1ECBA 3IE0A 3WQQA 5A0TA 2I3DA 2QSYA 2R85A 1T5TA 5C3MA 2VYCA 4MQUA 3RUHA 1NUPA 4N03A 1SXJC 3FGZA 2PWBA 3OX3A 5HRCA 4LX0A 2QUHA 2DE0X 3I01M 3LHFA 4KPUA 3TE6A 1P7YA 1ZWKA 4DLAA 1BCSA 1R5BA 5TF0A 4PSVA 1WETA 1G5IA 1DX4A 3S81A 1E2LA 2NT4A 1U4NA 2YY6A 3FM9A 4JUFA 3U80A 3RVJA 4B2YA 3D2LA 1SXQA 2ZE8A 4RD3A 3DBRB 1LBHA 4J9VA 1MEOA 4GXNA 4MO2A 3L4BA 4XASA 2QV0A 3QPAA 4HWRA 3L84A 3HH8A 5FPKA 4JI4B 3KZNA 2RJNA 1UWVA 3NHAA 2O9JA 3NNNA 4X6YA 3OO0A 3G0CA 2Q4OA 2YZKA 3KQMA 2R6JA 2BP7B 4ETMA 1UC5B 4O1IA 1EUDA 2C04A 4CKZA 3LA6A 1M0EA 1G2IA 2I4RA 3EWIA 4QYIA 3VO1A 5KPDA 1GUBA 1Z29A 4K1XA 4KPGA 5JNVA 3FMGA 3KX2A 4QLAA 4LJ9A 4YDRA 1SVNA 5DNEA 1U28A 4C29A 4M9UA 1PVDA 1W8IA 3ZCXA 4HRXA 1KFBB 2VF7A 4QSMA 2P2SA 4FI3F 3D64A 4A4DA 4W9NC 3P7MA 1YGPA 1JDZA 1R6AA 4NWIA 1WCIA 2JHPA 2DBZA 4RXMA 1T8UA 2BRUA 4URVR 1JYFA 1KO5A 1NQAO 1TQ6A 5ALDA 4BJ1A 4DDVA 1YK1A 2FLKA 1TPYA 3CMMA 3ND8A 4UFOA 4C14A 4AP6A 3H2GA 3FIJA 5CURA 5T3YA 2VSFA 3JAKB 1UJ5A 3CYFA 3G59A 4MKHA 1EDDA 1JDUA 3ZDFA 5LLTA 3QBTA 1ECJA 3EEFA 3K9QO 1MVNA 1KZ1A 2FETA 4N5LA 1RHUA 1K6IA 5DF1A 4LDRA 3P2YA 3R6DA 4HDKA 2C84A 4Z99A 3SYKA 1AD2A 1NJGA 3VTAA 5JXIA 3JYNA 4EB6A 1NBWB 1C0IA 1YIOA 3U9TA 2JEOA 2ZE5A 3D2AA 4TQGA 4BX9A 4QHYA 2QVLA 1TUIA 4UHEA 1B26A 4IV8A 4WUVA 3VR3A 2GM3A 4XPIB 3JYQA 2NO9A 2VDKB 1ULTA 1AKMA 1Y80A 3CY6A 3HUFA 3KKZA 2CBGA 4LTDA 1Z4NA 4Q37A 4DSOA 1WDKA 4IRUB 3D1LA 4BTLA 2I2CA 1N6RA 1UBJS 1TGVA 4ZO8A 4BQNA 4IGKA 1GPLA 1N6NA 3GMTA 4HT3B 3O8RA 1KTVA 8ATCA 1NU6A 1N34B 3B9PA 4HH0A 2C2OA 1VMKA 3RUAA 3QWFA 1B41A 1HY3A 1JEJA 1PE0A 2FW8A 2W7TA 4TL7A 1ISHA 1BGWA 1JJVA 3SU8A 2QL7A 3TZKA 1W0JD 1XRMA 2SECE 2I6SA 1HGXA 1SOMA 1J0BA 2AJCA 2MYTA 3GVXA 1DEHA 2WTEA 4L4RA 1ZINA 5MN4A 1YQ9A 3EZFA 1S7CA 2WAXA 3R5TA 2CNDA 5T4HA 4EYOA 1MB9A 2X0KA 3TQIA 1OAOA 4QTZA 1EWKA 2B2CA 3QFTA 5LLDA 1TT5A 3EVEA 2WWXA 2WABA 2OB1A 1L4LA 3PHLA 3QFHA 3HP7A 2RAFA 3PCTA 1YQXA 3IMFA 3G0BA 4MRNA 2ZOSA 3SS9X 1JE1A 5BN1A 3U7HB 4Q3CA 1RMYA 1J25A 4KMSA 3AHIA 4UOZA 1ZM2A 4JBWA 2GN2A 1EE9A 1ZIPA 1OGIA 4NKRA 4RQAA 5CVJA 4AMUA 4BKPA 1KDPA 2EFJA 4ZXPA 4HDSA 2MMGA 4JX8A 4KWIA 1L4BA 1IN6A 2XVMA 5DHFA 3KKEA 3SF8A 5JQGB 2IHNA 1RHKA 5H81A 1MENA 1GTZA 1E1NA 3LQ1A 4KBFA 2Z2YA 3UMFA 2XCSB 4GKJB 2CMDA 1F48A 3C2QA 2EXXA 1X87A 3G8AA 3EAFA 3GEBA 4YAJA 4OL0A 4D74A 2WQZA 5IM4F 3DO6A 3U4QA 2EGGA 2QUAA 4TTVA 2XITA 3N2LA 4DA0A 3T3NA 2RH5A 1WEHA 2BT4A 3M6MD 3KPVA 3AEXA 3I12A 4UPVA 4HYEA 4LN1A 4KTTE 2VVTA 5CT8A 1A1VA 3BB1A 3GA0A 3IV9A 3JQQA 4EHLA 4YJ3F 3GQBA 1J2TA 4BFXA 2P1DA 2KHZA 2Y1DA 3U48A 1O4WA 2HRZA 4I1UA 2J31A 4PHHA 3W7VA 1JA0A 1ZLYA 2FSHA 3UYKA 1UMDA 3MMNA 4PC6A 3VR4H 3QJYA 3RNOA 5LMUB 2YX1A 2H7YA 1VIYA 4XB6B 2WSSD 3N0XA 3PI6A 4QDUA 4I4TF 3LLCA 5DOVA 5FL3A 3UV7A 3AVVA 1DBRA 3CUSA 1FXWA 3OZIA 4S3MA 2C98A 2OUKA 1P39A 4YRBA 3SC4A 1XRNA 4OY3A 5IF9A 2EU8A 4NU0A 3UHOA 1KNQA 4Q9DA 3E7DA 4FSDA 3AVYA 3K20A 2FW0A 3ZDBA 2ZS9A 5L51A 1I1OA 1OFIA 3TCXB 5AI8A 2MTBA 4K9LA 4GUAA 4PLPA 2JCVA 5THKA 3D3WA 2Q1XA 1KEEB 1T43A 4B2IA 4BKOA 2MSEB 2P67A 4IIYA 3KQOA 4UCQA 1ACJA 5ALFA 1Z83A 2FEMA 2V8BA 4F97A 2Y1KA 3BDIA 1GTRA 1PR6A 2OGTA 4XX0B 2GAFA 2DUNA 1PW7A 2IUYA 2RCNA 4EHIA 3ULKA 5IT4A 3IR7A 3WSTA 1FQJA 6LDHA 2NNWB 5EHZA 5EMLA 3D43A 2G7ZA 3MJSA 3N7TA 4DLUA 3SQOA 1YC2A 2CV2A 1UOEA 2PVPA 2BKEA 2PJZA 4BQIA 1GPH1 4YCCA 4ETNA 1H1LB 1R0RE 3CM0A 4JIMA 2Y1FA 2ISCA 4H3SA 1GAQA 2OGSA 2Z8YM 4HNRA 1UM9B 1MPXA 2NO0A 3HEBA 4DGQA 4MCIA 3B2QA 4WNAA 1XWIA 1GPJA 1RWVA 3GBVA 1QP7A 4UM9D 3GLHA 4U2BA 2BIFA 3VZDA 3DQPA 3NYRA 4UAJA 4BVLA 3JZAA 4PE5B 1U2RA 2GZMA 4O4LF 4C2TA 3VU8A 2BV3A 5JNUA 1XMJA 1UBSB 4HS9A 4ZJUA 3S8YA 1C1XB 1D1PA 2KJQA 1GQYA 2QZSA 1QQTA 2VHVA 4MS1A 4MULA 5JMPA 4BVHA 1UDBA 1FQOA 4ZPXA 3LHSA 3I28A 5JZSA 3U17A 5JQGF 3DLCA 2CXUA 5I7FA 2XRMA 4DV0B 2BPOA 2J6HA 4Q12A 5F4BA 2Q4DA 1NXQA 3RJMA 2NV0A 4AS3A 1T25A 2A7XA 3AP1A 2YV4A 4YRFA 2VCEA 5DYYA 2ASVA 1WZNA 2BR5A 2IK8A 3HPQA 4KX5A 5K3OA 1H4VB 4C2UA 3CNBA 1IIBA 5JD4A 3FF4A 3GH3A 3E4CA 2I8LA 4H0CA 3UMJA 3ZDCA 1GL7A 4BNXA 3KALA 3DE1X 3AEQA 4OXRA 2JG3A 4KR2A 1F60A 2CXTA 4XIIA 3VR5H 4EGSA 4G4JA 1PS8A 4TYNA 1QZ3A 5DN9A 4E5PA 4R4JA 3FKSA 3AERA 2XOKD 4AWAA 3C48A 2GASA 3NVAA 4OB6A 1QKIA 2YWJA 1KE1A 1Z45A 3HNOA 1BXZA 2EQAA 3CCCA 3MWEB 4XIYA 6ABPA 1JGTA 2BHNA 2RHHA 3ZOZA 2W2VA 2UAGA 2WBLC 1E3JA 1PJ8A 2HTFA 3LOQA 2OCYC 4KHZA 3DDUA 3L92A 3P27A 4Q9IA 1TMKA 4YRZA 3OFNA 4YP0A 3Q9UA 3AF2A 5I8PA 1EFCA 1S3GA 2WB4A 4YJFB 4D44A 5K0LA 3V7YA 2W2NA 3NP7A 4RDCA 3L0CA 4BXOB 4RFLA 3DT9A 4BJ3A 1C7IA 3CLSC 3EGOA 3NB0A 4I14A 3FOCA 2ZQ5A 2GJSA 3MTJA 2B4YA 3UT6A 1Z8NA 1IZZA 3LYHA 4JEMA 2Q3HA 1AKUA 1WL8A 3IE1A 4K9DA 1G0NA 2CEKA 5BW8A 4ZVVA 2PM8A 3IO5A 1ZHFA 3JWIA 4PNHA 1BXRB 1T10A 2PZLA 4FJ0A 2AOUB 2JIMA 5DSTA 2H16A 1K3FA 2H1CA 3TLJA 3NRJA 4QOIA 2V3VA 3RTCA 4MQBA 2UZ1B 1YKGA 5GJVC 1ESNA 4HTFA 3SHOA 4CIDA 1F3LA 1PU2A 1VI6A 3WJ2A 1XPOA 5DRTA 2EJCA 2MSKA 3OFVA 4UMVA 5JRJA 2AV6A 3ZX5A 3LX6A 3DFMA 4YUVA 3BWXA 3M6VA 4ZO4A 3BFJA 1XLTA 4BQEA 1R6DA 2VUTA 3U1BA 3UTCA 1JR4A 1P60A 1YS2X 2WM2A 3KXIA 4I50A 4GBMA 2F62A 1IVYA 3FCCA 1K9VF 4J2TA 3BJIC 1PX2A 3NEPX 1KYWA 2OXCA 3IPXA 3SWWA 4XCQA 4TXLA 5JSKA 2VYVA 3M6IA 2PRSA 5E9AA 4L95C 3ZIAD 3Q7TA 4FXOA 4IIJF 4IJUA 1PDOA 2Q1UA 4U3JA 3VTZA 3WJ7A 3KRTA 4Z3OA 3CH6A 3H2SA 2GN0A 1P1CA 1UXJA 1PDVA 1XYGA 4BPRA 3AW9A 3Q3IA 1RVV1 4AMBA 1GPMA 1TM2A 3C6XA 3CURA 3IJ5A 1QTIA 2EP8A 3QU9A 5EYPB 1LSSA 3T34A 5HR5A 3AG5A 4ZGGA 5E7QA 3C4JA 2BEJA 4EMTA 1V7ZA 5C1IA 5C4GB 1OBCA 3V00A 2BUCA 3PXGA 1J4AA 4WY2A 4BEVA 2UUPA 1EFPB 1JIJA 5DSZA 5EN4A 3O03A 2NTNA 4YQYA 1VJ0A 5BNTA 3SVLA 5FBLB 3WBFA 3TFOA 1KI6A 1U5BA 2PGIA 4XYLA 4BLWA 3VZCA 2Z09A 3BKWA 1W2HA 1O96A 5LCXA 4DIUA 3KYBA 3RBZA 1CU1A 4DMCA 2KLBA 2IE8A 2H00A 1MV5A 1RRCA 1ENYA 1JSRA 4LY6A 3KD2A 4QAQA 2JHAA 3AILA 2P8JA 1PSWA 2WJVA 5ILGA 4IHJA 2G4VA 3ON5A 1ZESA 3N59A 3OJLA 1QRAA 1RC1A 4UAUA 4N0QA 2GPTA 4PZDA 4D46A 2NU6A 1XKLA 2PQ0A 4V0ME 3VR2D 3HB7A 1C8LA 4B4KA 4RJIA 2JARA 1RD4A 4TSFD 2QN8A 2F67A 4A73A 1AGXA 3C24A 3IS3A 2Q99A 3G9QA 1H4SA 4MB2A 4JOCA 2XUZA 4DJDC 4BFYA 4H1UA 4BFTA 4B4DA 3FWHA 3D6MA 1V3UA 4DJ5X 2I29A 3NP9A 1A9RA 4FYHA 2NTYC 4FB4A 4K9OA 4BE7B 2O8BB 5EE5B 4AMGA 3H5OA 1GPUA 1XAHA 4IY1A 2CSXA 2ZJOA 1N2CA 1NR1A 4LG1A 2HPHA 3CUUA 1JU3A 5K5EA 4N5MA 2C9YA 4D25A 3B7GA 5FNVA 2QLJA 4OHRA 4A15A 3H5TA 4KWEA 1HE2A 1XBTA 3O90A 1EK6A 1FDIA 1TYEB 4WLVA 3HLKA 3LQQA 4YIKA 3ZHXA 1SUSA 1EP9A 2I4MA 3BERA 2RGGA 4J1TC 3ZDYB 3GJ0A 3MOIA 3TLBA 2B78A 5BV7A 1QRSA 5CB4A 4EJ2A 1Q2XA 2YIMA 3NC1C 1IFXA 1X7ZB 1XO1A 2O2DA 3ESXA 1RU3A 3HB5X 5A5FA 2ACVA 3QGMA 4J7AA 1M2NA 4NCKA 1KJYA 1SCKA 2BF4A 2IXDA 4P3KA 3R0ZA 5FBQB 2VT3A 5DYNA 2NVUB 4MWBA 3RABA 4CM9D 1Y5RA 2XEXA 4MB0A 1BWSA 1EM8B 4ZREA 4P2BA 4FFBB 3UFXB 1Y3FE 1K8ZB 3G68A 1WJGA 3GJRA 3IQXA 4OBXA 1CF9A 1H6BA 1RLMA 4G0OA 4J16A 3Q0IA 3PQ4A 4FVTA 2VT6A 4TS1A 2JJ2D 4H1WA 3C1AA 1P9WA 3DOUA 4XJVA 5AKGA 3H0KA 1E2JA 4FGUA 2PXXA 1PJ4A 4ANFA 3QENA 4WTOA 2CZCA 1EFLA 2BFOA 8LDHA 1IM5A 1M34A 2IHVA 3WFIA 1L9XA 4LC9A 3ELUA 4PU0A 5E6RA 1JLLB 5M2QA 3RYFA 3P5BA 2BDUA 3T5BA 1NN3A 2JJ8A 4OGKA 1JNXX 3IP1A 4RTOA 2RGYA 3P52A 2WFLB 5G53C 1XR3A 2VNIA 3QV1A 5HFNA 1ULSA 4D9JA 3L43A 3QYAA 1MO4A 2B4TO 3FR7A 4JL6A 4UCFA 3OIYA 3A11A 1RIIA 3I5XA 1Z75A 4HFMA 3BQ9A 1KY2A 1LZLA 1NI5A 1Y6QA 2D1FA 1M7GA 3BXGA 3FRIA 1SXJB 4KG7A 5CMLA 1JXQA 3AR8A 1PNRA 3DTNA 4FNMA 4N7MA 2DKNA 1S8OA 2ZSEA 3F67A 1VTKA 1XTUA 4G5RA 5CGQB 3ZCRA 2IH4A 1QBGA 1G3UA 3FNHA 4TYMA 2F59A 1TO6A 5IABA 1WWKA 2REQA 1W2WB 1CUJA 2ZYHA 4P5PA 2DFVA 3DKRA 4EY6A 1YR9A 2FPLA 1IQ0A 3I1IA 3ND6A 4P3PA 3AKCA 3HLTA 2P5YA 4N9QA 4BNVA 5T7BA 4KQXA 3K0CA 3ACCA 4B40A 3ME5A 1H05A 3K4PA 3NOQA 1TCBA 1V16B 4P3XA 1PR2A 2FG6C 2C5HA 1SAYA 3VPHA 3PPYA 1EVEA 2WKRA 5K3BA 4EB8A 4KXVA 1FUEA 1M83A 1ZAKA 1YZLA 2PD6A 5EY5B 1R6BX 5A7HA 5K0CA 3TM5A 4NV3A 3ADKA 3FOFC 3E5NA 5MFZA 2ALJA 4UUNA 4TV9B 1WXEA 2E55A 2VFAA 1C7RA 1WZIA 1G63A 1Y7TA 5CVVA 2GJAA 4FFPA 2GO1A 2YVQA 1RXCA 3G2HA 3WMXA 1D2RA 3O84A 5FBRB 3ADDA 5KX5F 1DG3A 3GJSA 2ADMA 3BWMA 3LBYA 4GEGA 4ARCA 1EFVB 3HCFA 3HDVA 4JLNA 1CLUA 3RIXA 1ADYA 5DM70 1M8GA 4RTNA 1NBIA 4OGGA 4BX2A 1VDMA 3OO1A 3TGWA 3AM4A 3G1TA 4AULA 5KJ6A 1D7AA 4IKPA 2YWCA 2COUA 1RYFA 3MCAA 4XM1A 1NBMD 2XA1A 1A1SA 5B3JC 2CW5A 3NT4A 5A4MS 2RGXA 4GPD1 4UEKA 1J90A 1NVBA 1DV1A 1O9GA 5T3UA 5L3VA 1NP3A 4XKJA 1L4EA 4KTVE 1YMUA 1KZYC 1U2PA 4LJ6A 4TKZA 5FA8A 4E13A 3WB0A 3IAAA 3JZMA 3PEEA 2GN1A 3QJ5A 2QJTA 4K5QA 4W8OA 5IEBA 1VL1A 4H6PA 5FBVB 1NY5A 4TMYA 2JIZA 2H2GA 3Q3CA 2XBMA 5JCPA 2WYIA 1JZSA 1BCRA 3DAHA 3LRXA 3KYDB 4JBIA 2PVCA 1DIGA 4Z9YA 3Q3HA 1JR2A 3DZDA 1ZRNA 2BM9A 5CA0A 4BAGA 4NTZA 1JQBA 4FHDA 4OOEA 2G9NA 1SKMA 2NP7A 3TO5A 2JGMA 2QM8A 4I8IA 5LZ7A 1U9JA 2WINI 3EVCA 4NX2A 2D1TA 4NFLA 2P65A 4BVKA 4DLKA 1JQJC 2H2FA 2GSDA 3ZJYA 5CJPA 1T5LA 2ZIGA 1XCLA 3BE5A 3L0DA 5HCIA 1NFRA 5TQ0B 3LUPA 4O33A 3K70B 2WJ6A 3GNQA 1JEAA 2AR9A 3QNUA 2D5AA 3OMLA 2ZBGA 4DARA 1KOFA 2IZ7A 2B9VA 2EBUA 5HIJA 3ZTYA 5B6JA 1L7OA 2B83A 3MMZA 3IKJA 3GJ4A 2QMUA 5ICGA 4XVHA 4UHHA 2VPZA 3VH1A 5BSMA 4CNBA 4NECA 1T6XA 2OCPA 3IP6A 3K6JA 3WYFA 3O31A 3IGFA 1NBHA 4TMKA 2V3CC 2IHUA 3FYTA 2PH3A 2YXPX 1GM5A 2PH7A 3LUJA 4FMDB 3V1KA 1IXZA 1RI1A 4L28A 3SE0A 1JV2B 3VYRB 2V7UA 2E87A 4P6VF 3WMFA 4UBIA 1LWNA 1ZVKA 4AI6A 1XQ1A 5A5VA 2F3RA 2H6EA 3FROA 1GKLA 4ND8B 3ORFA 4HJXA 3EWAA 3ZE6A 1XZ8A 3GRAA 1FSPA 4PXSA 1NDUA 4R8MA 2ZRBA 1T1IA 2H08A 2ZUVA 1G4HA 2P4QA 1OF1A 1U3DA 1YU9A 3P97A 2AQIA 1QIFA 3QX8A 4OHXA 4P35A 4ZIRA 1RYZA 1OBFO 1XFDA 3V1YA 4Q3NA 2G4LA 5G0UA 4QOEA 2FDXA 2DTEA 4IQFA 1RC0A 1V1MA 1USKA 4J7UA 1ORDA 1XF9A 1NQ5A 5DBOA 3JQPA 3QIVA 3ZDEA 1NULA 5ICMA 3RLFA 3TQOA 2A3RA 1S1CA 3IA2A 3CINA 4JJ7A 3H4MA 3NTQA 2ODPA 4PX2A 4ER5A 2Q6VA 3LPMA 3FZQA 3AM3A 4WCDA 1C9MA 3SHQA 3U60B 5ALMA 2VF2A 4RZ3A 5K9ZA 4NFSA 4M7RA 4YMUA 2NACA 3FPAA 1BHSA 1U1CA 2Q4EA 3MINB 4GP6A 3HGMA 4M9CA 4OIMA 4YC7A 3RM3A 2CSUA 3RV4A 3T5TA 3AHHA 5AW0A 1IQRA 3HV0A 2XCOA 3IMGA 1Q5PA 2XVAA 5KWEA 4M1QA 4W7IA 4HNAB 1GEGA 4K9QA 4XIFA 4QYXA 1YT5A 1EBUA 1QGDA 2IZOA 4DM3A 2R87A 5LKRA 1ML4A 1NXWA 1TI7A 3A4YA 5FUQA 2HH9A 1ZIDA 3AC0A 3OLVA 2MCFA 2WOJA 5K6TA 1JH9A 1LF5A 1JN0A 1KC1A 1SHZA 2WZBA 3PC4A 2HFJA 4UDXX 5E6SA 4E4TA 1W0CA 1VLHA 2I2XB 3CLUC 1CP3A 4Q3LA 4QDOA 3JRWA 4O2BF 5CB6A 3JWEA 1T2VA 4G5XA 4XGKA 4CTMA 1G21A 3GT4A 2ZUBA 4Z5XA 2CLDX 3GVCA 2XAAA 1CUIA 5FL7A 3Q3VA 4YP9A 5A6VA 3WYEA 3AHEA 3OQIB 3OCCA 3MWKA 3QV2A 1N1EA 4EW2A 4ZI7F 1JIIA 1QH8B 3C7CB 4FDMA 3DHEA 1VSQA 5EI5A 3L2OB 5JS7A 5K0GA 2I65A 1ZJYA 4FYWA 1QTNA 5E1BA 2OR3A 3U31A 1KQGA 3TGPA 5LQJA 5JJ5A 3O4GA 1EJ0A 5EUQB 1BVYF 1BQ3A 4MW4A 4D02A 2FOXA 2CUZA 5DP2A 5JG7A 3P9RA 4QOFA 2OV3A 1WB6A 2O3UA 1NMQA 1KC3A 1B0UA 1RR6A 3PXCX 1KHTA 5JXHA 1ZH8A 3ZCQA 1EB8A 1CY7A 2VDPB 2B99A 5H4GA 1RZRA 1HRKA 3DVLA 5CFQA 4LRYA 4OI1A 4Q4HA 3U6KA 2ECQA 2Z5FA 1UQTA 2QM0A 2X4GA 4JVSB 3EISA 1C9JA 1DKMA 3CWZA 5AHRA 3QOWA 4DSNA 5IVIA 3ESDA 4EVQA 5HXAA 4L5YA 3HJUA 2H0QA 1ADBA 1VPLA 1LLCA 5KHLB 4FB5A 2B98A 3HHPA 1UFQA 4N3NA 1I33A 2D4HA 4Z7NB 5I45A 3DP7A 2OBNA 1YZVA 1YF3A 1KI9A 5DP1A 3QBJA 3M6UA 4N41A 3ITNA 4LFBB 1SC9A 1X15A 2PH5A 3AI2A 1L4NA 3PENA 3DUWA 4IHQA 3SJ7A 3PXXA 1X3LA 1DWUA 3T1TA 1Q0HA 4TKMA 1EVIA 1M10A 5KHAA 3RS7A 5LQNA 3JAWB 4MAMA 1DOHA 2XBLA 4KL8S 4UU0A 3PWZA 2C7RA 1PJSA 3GUZA 5FJIA 2HA6A 1ZOSA 1Y98A 1IUOA 1JFFA 3O2QB 3P2MA 4G65A 3AU8A 5J23A 1E62A 4QXOA 4QO8A 4D3ZA 3FCXA 5ALTA 5CDGA 4BNZA 5K0TA 2B8EA 2EW1A 2O1EA 1AJEA 1SQ6A 3ENWA 2BJHA 2I9KA 2P6UA 1WKVA 5AVUA 2FUKA 1UBKS 1NOKA 2W4QA 4UVEA 2PAFA 1FDTA 1UKVY 1P2FA 1X7WA 4WKNA 1D07A 2H11A 3N2ZB 4UUAA 5JJLA 2I2FA 2GESA 2GEJA 4FYPA 2XJ4A 5F2KA 1O54A 1G1MA 2CC2A 2JDIA 2XUFA 1MO3A 4GZ3A 1ZD2P 4HDMB 1OIWA 3E9RA 3V4ZA 1A8HA 2GPBA 2YW2A 4AKTA 2H3HA 4BPBA 4AWXA 1J23A 2QD2A 4ZYUA 3QPWA 2UZ4A 1RP1A 4RENA 3OURA 4D4KA 3HYRA 5E9QA 4ZCIA 3GN1A 1O94A 3RS9A 3HFGA 5KTYA 1YRQA 4LYYA 4LYAA 2VZEA 4K6KA 4WFJA 1YB7A 3A7DA 4W9NA 5CA1A 5KNDA 4OLFA 1CUSA 2Z08A 3PL1A 3RU2A 3JD2A 2FMTA 3BQMB 4TN1A 1XD2B 4PPNA 2FPIA 1NIJA 1WCWA 4PZ9A 4RIEA 5HJEA 1YACA 2HDHA 1RJFA 3CLHA 3DF7A 4U7DA 2TMYA 4EBFA 4X3CA 4K81B 1G7SA 1XJCA 2ZDHA 4AZ3A 2IS6A 2HNKA 1KZ6A 2HMUA 2OFWA 3SICE 2IODA 3W4IA 5BN3A 2RHLA 1SCUA 3BMXA 2RH8A 1TDJA 1HFWA 2AEJA 1M6VA 4ES6A 1TIBA 4EMUA 5BPHA 3BTOA 3RG8A 2O48X 3MT7A 1R64A 3WL8A 4C22A 3INYA 1B8OA 1U7OA 1G8YA 3DR3A 3IEXA 1YU6A 1K8QA 3ROPA 1YO6A 1YJQA 1DO8A 2G5TA 3ABZA 4MUAA 3O4FA 2RIRA 4PG7A 2X4IA 3B5JA 4CIXA 1YJAA 4DIFA 1RLUA 1W25A 1XDSA 3PD0A 4NYJQ 4WN3A 1JEYA 4H17A 3IALA 4BS9A 3LXRA 3ANLA 1Y9EA 3JQ7A 4FNOA 4MIEA 3OOJA 3UGKA 4PIMA 4B4UA 5FO1A 4DBZA 4M8SA 1ZSVA 2YN4A 3BSFA 4K2HA 1G8PA 1BGVA 4IVPA 4Y0NA 4I9GA 3I61A 4BGDA 4OREX 4YDQA 1K27A 5LUBA 2NOAA 4D41A 3ZLTA 1J5PA 2B7CA 9MHTA 2QPTA 2JFZA 3L4SO 3JW8A 4NYMR 4INPA 2EAUA 1SJ9A 4QX6A 3SLRA 1ZDMA 4L76A 2CHUA 2PNFA 1O9HA 3OLQA 2XVZA 2DHDA 4JP3A 2HV9A 1W36D 3FUXA 2WWIA 4P4LA 3SYLA 2VG8A 2QG6A 4UOEA 4D5GA 1FTGA 1G0OA 2PHZA 3P1JA 4IDOA 4XWOA 1ZK0A 6PFKA 1VL0A 3QUTA 4J9UE 1Q21A 3F3MA 3LSTA 5LZ2A 3PHHA 3QY0A 5CNMA 2QRHA 5EUMA 4BNDA 4ZDKA 3KSAC 4U7GA 1DEXA 1R0YA 3KQSA 4HOYA 3W6NA 4C7MA 3ZKWB 1CRWG 1WRBA 3EVDA 2OM2A 1G5HA 1TMGE 1J7KA 3ICEA 4JYCA 3ABQB 3N76A 3ENNA 1FLDA 1EDZA 1V9SA 2KQUA 3ENQA 3ITEA 3JQAA 4X6XA 4WBNF 4CIWA 5EP3A 1L5LA 1J07A 2OG2A 5E8JA 5FUMA 4JP5A 3WZ2A 3COVA 4J4TA 1L7RA 4I8DA 2PBRA 4LY3A 4UMDA 4HGNA 2AZMA 4YRRA 2ZR8A 1E6EA 2GD2A 2MR6A 2OHIA 3B52X 3CX8A 4GZ6A 4EFNA 3KB6A 2QZJA 4XB1A 2AFHB 2UVPB 2IV3A 2X7JA 3RUDA 1Y9DA 3OCWA 1LSUA 3TVYA 1SVKA 3G9XA 3VC3A 2RI0A 3UQZA 4BCBA 4C4AA 4IVQA 3QOFA 1COWD 4FCCA 3GHHA 3H4VA 2I8CA 4P54A 4R0VA 3ZLUA 3TI9A 1PGNA 3EG9A 3OPMA 1RXYA 3L04A 1SEVA 4RZIA 5D86A 1U80A 3KKLA 3A06A 3MJRA 1U8ZA 1N5RA 4MARA 2QRZA 1V4BA 3R3SA 3DMTC 4QFMA 5FOXA 3VUEA 3H9JA 2QTRA 3I01A 1MA0A 4IXDA 5G40A 4ZZ2A 1H42A 2CVHA 1ZBQA 2JK1A 3KOOA 3SJAA 2WTUA 2D59A 1HT0A 1E1CA 2OORA 5HIIA 1ZI8A 1J09A 3ZYCA 1JDVA 1PT7A 4EO4A 3DWGA 1ZW6A 1QDEA 4ZOLA 5F3DA 2Y68A 3VZQA 4YJDA 4Q4JA 1PS9A 3HYSA 4W1RA 5DBGA 3T8YA 2ZG6A 4G1CA 2BE9A 3E9NA 4XOUA 3BZBA 2LKDA 3PUYA 2V7QA 2K5UA 6Q21A 4WCVA 2ZUUA 4H7KA 3V5NA 4U39A 4DIEA 3PXUA 1CVIA 3ZQJA 3U4HA 1O5OA 1DV2A 1JG1A 4HWTA 4NS4A 3W6UA 4YMWA 1REQA 1NUSA 1P6UA 4LJAA 5BSGA 2M1ZA 2GVZC 1R0SA 3T1OA 3CZMA 1CJVC 5CXSA 4BN5A 1NXSA 2BM0A 1ODKA 2PMDA 1GTMA 3I76A 1KDRA 4E5UA 3OEWA 4AQ7A 2JIPA 1CQIB 2OCBA 1OJ7A 1DHRA 1SKAA 1WSDA 2WQ6A 4LGMA 3TLAA 1GN9A 2COKA