4F45A

Crystal structure of human cd38 e226q mutant in complex with naadp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
253
structure length
249
Chain Sequence
EFWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase 1
publication title Crystal Structures of Human CD38 in Complex with NAADP and ADPRP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 80
structure length 249
sequence length 253
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4f45A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f45A02
3DHEA 1Y6JA 1YWGO 4ZRNA 3GHHA 3JQDA 3DZIA 4Z0TA 1R0KA 4A5OA 4CM1A 3ZHXA 5TF4A 2Y93A 4BNXA 1P1RA 4A2CA 1YBMA 2O50A 1FXSA 2G0TA 3QQPA 4G2NA 3TWOA 3AU8A 1F12A 4XIYA 1I36A 2B36A 2DTEA 3WJAA 1ISIA 2I66A 1P33A 5CPBA 4LGVA 3UN1A 4CLRA 3WJ7A 3H2SA 1Y9EA 3WMXA 3PYLA 1R37A 3FTPA 1CQJA 1DC4A 2DFDA 2NACA 3WS7A 3IIEA 1CDOA 3GH3A 2TMGA 4K28A 1I2ZA 3F1LA 2JKVA 1U5AA 1UP4A 4OHUA 3A9WA 2UYYA 3M6IA 4U0JA 2YW9A 1ZXLA 4XYBA 3JQEA 4OQYA 1OC4A 2NTJA 4YTEA 2D3TA 3B20A 3ZDFA 4BB5A 4GX5A 4PLZA 4M86A 4RQUA 1HYEA 3F9IA 3VPSA 3VZQA 1GADO 3EVTA 2GN6A 4YR9A 3NDJA 4CLRB 3E82A 4IJVA 1XYGA 4PLVA 4RDHA 4EEXA 1NHGA 2ZB7A 1XKQA 1ZEJA 3MCVA 1I30A 3KTDA 1FF9A 1WPQA 3GZNA 4NJMA 3F5SA 2GRAA 3P7MA 3AUTA 4C4OA 5JCXA 4PLYA 4JJFA 2BRUA 3ADOA 2YHUA 2CD9A 4CPDA 4U0KA 1Z45A 4DUPA 2AG8A 1HE3A 1MA0A 4GGPA 4DLBA 2QHXA 1KY5A 2B69A 2W2LA 1EK5A 3A06A 5C7IO 4EJ0A 7MDHA 3UOGA 3Q2KA 1PEDA 3PHHA 2UUOA 4KZPA 2IZ1A 3GF4A 1HE4A 2I3GA 4Q3EA 4ID9A 3K8ZA 3VPXA 5A4DA 3AWDA 3L07A 4CM5A 2O3QA 1G0NA 3U62A 3INRA 2GERA 5DP1A 3EHEA 3CXRA 3ZWWA 1AXGA 1ZK1A 4Q3CA 3GZNB 1O94A 4NJMB 5JDCC 4A26A 1GQYA 1UR5A 2O2SA 1WNTA 1F14A 2Z1NA 2NLOA 5AXAA 1OZAA 2EGGA 2WEKA 1JTVA 5DBGA 3VH2A 1VJ0A 2NNLD 4UUOA 3H9EO 4NNJA 1HETA 4BNYA 4CUKA 4FJ1A 3BHIA 1IB6A 3U4CA 3G0OA 3U9LA 4YAGA 3NGLA 3HDHA 4J90A 3ENNA 3BXXA 3VKVA 1SAYA 5DCUA 3FNEA 5JE8A 1JVBA 3JYPA 4ALKA 1LEHA 3PJGA 1E1MA 3KZVA 1PS0A 4RJTA 1U7HA 2ZYAA 1ADBA 4CV2A 4PG8A 5EMHA 4DRYA 1GQ2A 2C7GA 4FPXA 1HZZA 2W8ZA 1NQ5A 3SX2A 3WTBA 1KERA 1FDUA 3F6YA 1ZMOA 4PIVA 1Z7BA 4UEKA 3H6KA 1VI2A 4MVJG 5B12A 3UUWA 3BMCA 4BGEA 1LQTA 3FD8A 1K6XA 3PI7A 3EC7A 4D0RA 3FSRA 2JJYA 1QV6A 1Q0QA 2E37A 3L4SO 4R01A 2VZ8A 4ZGWA 4RF2A 1U3VA 4RPGA 1PL6A 4EYEA 3ICCA 3DTTA 3KRTA 4WLNA 1V3UA 1T4DA 3VPHA 3HDJA 2VHYA 1E3EA 3GDGA 1B14A 1TT5B 2AA3A 1XELA 2O7QA 2VT3A 5TNXA 2DBZA 5G2OA 4W9NA 5COBA 4NBWA 1ZUD1 2P68A 4GGOA 3GPIA 3HB4X 3WSWA 3IJPA 3GN2A 3HFSA 2J3HA 5BNFA 2R00A 3BMCB 3PDUA 4HXYA 3MWDB 3PHJA 1UH5A 2DUWA 3ICPA 1KEPA 3U4HA 4E21A 3I3OA 2YQ4A 4XIJA 4IDBA 2IODA 4B7UA 2RIRA 3GNQA 5EERA 1E92A 3H5RA 1MG0A 5T67A 3UW3A 4CLOA 4IJKA 4BL5A 4J2OA 5DOVA 2FSVA 3TL2A 4HFNA 3OFSA 1WP4A 5TS3A 2B37A 4TRNA 2I67A 4BMVA 5FFFA 5JY6A 3OQ1A 4AICA 1NBOA 2WE8A 2OO5A 3NRCA 2CZCA 1I5RA 2BFOA 1DSSG 1SCUA 2QYSA 4YACA 1ZO8A 4FC7A 4L8VA 3V2UA 1PJ2A 2JCVA 3RROA 1IUKA 1T1RA 4DXHA 3WX0A 3CZMA 3U5TA 2O4CA 5T5QA 4P38A 3MJEA 2CF5A 3DWFA 1HWYA 2EF1A 1KEWA 5F1PA 4GWKA 1OI7A 3GC6A 3BTSA 1ENYA 3D5TA 1WWKA 3JQBC 3U3XA 4EI2A 2QRJA 1DJNA 3AU9A 3KVOA 2AEJA 3DZFA 1Q0HA 4ILKA 1U4OA 2DKNA 1ULSA 2F00A 4NFSA 3ROMA 4GL4A 4BO1A 1C3VA 4ALJA 1B26A 1D4FA 1KEVA 4MKZA 5JS6A 1SEPA 4I5DA 3GG9A 2NUAA 1WW8A 2HJSA 3L4BC 3HE3A 3OICA 4U8GA 5DT9A 1HDCA 1GU7A 1KVRA 4IDCA 5F21A 4YPOA 4WLEA 2IYPA 1QLJA 3WMWA 4K1LA 1EUCA 1QYXA 5ICSA 3EDMA 3VVBA 4XQGA 4RLSA 3DL2A 1X7HA 3D5QA 2NVWA 4XGIA 1PS9A 4OKNA 5AXCA 3HUDA 4KQWA 3PJEA 1SB9A 1X0VA 1VKOA 1NVTA 5GY7A 2NSDA 1E6UA 3FN4A 1IZ0A 4O6VA 1NPDA 3RASA 4BV8A 5BSHA 1PWZA 3HN2A 4XA8A 4CLHA 4WCFC 3JQCA 4R3WA 2X1HA 3PZBA 4XGNA 3D64A 4GX0A 4QFDA 2HKIA 1AUPA 3ROPA 3G79A 4BS9A 2EV9A 5JYEA 1Q2XA 1LTHR 1SEVA 4BO2A 3PK0A 1P1IA 5G4KA 3TZ6A 1D7OA 4GWGA 4WEOA 3VH1A 4Q3DA 3CIFA 3F1KA 3IP1A 4L73A 2BGKA 1BVRA 7ADHA 2OGUA 3QY9A 4TVOA 2JD0A 3I6IA 5H82A 3RVDA 1PQWA 2V7PA 3GEDA 1W8DA 3Q11A 3HADA 3H7AA 3P19A 3KM0A 3S2GA 5I7SA 3ONFA 3RCBA 3GOHA 5CDYA 4GQAA 4BNIA 4LK3A 4HP8A 3RI3A 1KEUA 1ONOA 2OP1A 5EJ2A 5G4KB 4CM7A 1EFKA 3AI2A 3H9UA 3F46A 2AEFA 3C1OA 4A73A 1FDTA 1SOVA 2HSDA 4PG6A 4J9UE 4WASA 5IN4A 3A14A 4MJLA 3UICA 3KO8A 4MVJD 4CR7A 5TRTA 1Q7CA 2GNAA 4MP6A 3LVFO 3JD0A 1Z73A 1O0SA 5F5LA 4DLAA 4OL9A 2Y1DA 1H93A 4PGFA 6ADHA 3H9QA 3MZ0A 4J4TA 5KNLA 4HFRA 2GDZA 3R6DA 4A0SA 1FDWA 4BVAA 5FEUA 2B4QA 3LU1A 1E3LA 4O63O 5KVQA 4O59O 3P2OA 2XF8A 2BI8A 2ZKLA 5L4LA 1GPJA 2ZIZA 2X0JA 3MOIA 4E30A 3K96A 2WD8A 4YVFA 1YBVA 3JD2A 4O0LA 2X5KO 4DPLA 3WYBA 2A92A 4BNZA 2VHVA 3ONDA 3I9MA 4OGWA 3SC6A 3L6DA 2HQ1A 2XAAA 4M49A 1V0JA 3BMOA 3QSGA 4MVJM 3E5RA 5KOIA 5C7OO 3DFZA 5A9SA 2C29D 2Q2VA 1BVUA 4IMRA 3BHJA 2Q2WA 4WOKA 3G49A 4L4RA 5I9NA 1IULA 1JQBA 3ADPA 1PX0A 2DFVA 2X9NA 1ZW1A 4Z9XA 5EIOA 2FSSA 4ALMA 3H8VA 4C7KA 4JGBA 3OA2A 2YFQA 4OJNA 4KQXA 3QWHA 4R1NA 1SC6A 1XLTA 4JNKA 5A5EA 2E4AA 3KSUA 3NT5A 4NZ9A 1TT7A 1OBFO 2JD2A 5ITVA 1EEHA 1Y8RA 1S7CA 4OMUA 1Z82A 1VL8A 3BMOB 1EE9A 5A06A 2X8LA 3ANMA 3GMSA 3OIDA 3PHIA 1GYQA 5A9SB 1Z7EA 1EK6A 3GGOA 4ALIA 1WAMA 1PZEA 4YAEA 2ZCVA 4Z9YA 4P4LA 4NK5A 5IDYA 3SJUA 1T26A 3AUUA 2Q4EA 1K5HA 3E03A 1ARZA 1R4NB 2HMVA 1KC3A 1QYCA 1UZNA 2HLPA 1YGYA 4HNGA 4E3ZA 1LA2A 1NHWA 5L4SA 1OC2A 2WTBA 5DOZA 3HQ4O 3PPIA 1GR0A 1I2BA 3WGGA 2JHFA 3NV9A 5TQVA 5CFZA 3AOEC 1LI4A 1Y8RB 4AJEA 4R1SA 1GY8A 2IEBA 2DPGA 2X9VA 3E8XA 1ISGA 2OBNA 4OOFA 3FNHA 1DBVO 2CF6A 1E0DA 1E3IA 4JROA 5CAEA 5L45A 1H9AA 1LSUA 4KP7A 1LLDA 1KVSA 4PVCA 4TKLA 2V6GA 4WEQA 1HLPA 2NQ8A 2VRCA 1CETA 3I9JA 2CUKA 1HXHA 3TZQA 5KJ1A 3VH4A 5TX7A 4LRSB 4HFJA 3UXYA 5B4UA 3Q9NA 4LISA 3E18A 1WMBA 4QXMA 4XRGA 1TXGA 4PLTA 3ZWNA 1I10A 1EFLA 3X2EA 4Q3NA 3Q3CA 2PH5A 3SLKA 3DBHB 1XGKA 1YL7A 3PGJA 3QVOA 4Y6PA 2C5EA 4CM9D 1UZMA 2X5JO 4B3HA 5T8KA 2YHIB 4NU6A 2O3TA 3QP9A 2P2SA 4BNLA 2FR0A 4JQCA 3C7DB 5HM8A 3PWKA 1NPTO 4ZICA 4GMGA 4R68A 1ZFNA 3FBGA 3C1AA 1EVIA 3GRKA 3LLVA 2EW2A 2PKQP 3WWYA 3RU7A 4A27A 1RM3A 3ZU5A 2X22A 1GYRA 4BO5A 5TJ9A 1Y7TA 4CQMA 2Y1OA 2PY6A 3VC7A 2ZJ1A 2YDXA 1Z6ZA 3LSYA 2O4UX 5TSDA 4CV0A 1YL5A 3E9MA 1OOEA 2ZYDA 2YYYA 3AM4A 4U7WA 1Z75A 1FMCA 3O03A 1ML3A 3M2PA 1DDOA 4CMGA 4WLVA 2XXJA 3WWZA 1UXGA 4JJIA 3W8EA 3DMYA 2QG4A 1N9GA 1U1IA 4OOEA 1TEHA 3CSDA 2Q46A 3OJ0A 4I9NA 1ORRA 4IXWA 1H6BA 2CY0A 2OBYA 3EYWA 3NGXA 4IY1A 5EN4A 3TZCA 4DPKA 3EVNA 3H5AA 1GDHA 1XG5A 1KETA 4F45A 2Q99A 4PZDA 3JQAA 4UVDA 2Q1UA 2D1YA 5JW6A 1XU7A 3F47A 3W4IA 3UCFA 3W6ZA 1O89A 4NBVA 3WGTA 5TT1A 1EVZA 2BMAA 4Y67A 5B37A 4J0FA 1DFIA 2ZQZA 3JV7A 1PSDA 1XHLA 2V6FA 5HS4A 5L95A 5L4NA 3UGKA 1HZJA 1N9GB 3U09A 1F06A 3GRPA 2A35A 3B1KA 4GKVA 5ADHA 1PIWA 3GVXA 3BAZA 1KIFA 2V65A 3EZLA 4J7XA 4TWRA 4ZVVA 2Q3EA 4BKPA 2EP5A 4MO2A 1MP0A 5L51A 2G17A 4BQRA 1E1NA 1O6ZA 4A10A 1I3NA 5IF3A 2YZ7A 1HDGO 4DYVA 3GN1A 3JQAB 1ADCA 3TZKA 4DMLA 1SO8A 4CUJA 2QZ9A 3G17A 1HDOA 1HEUA 3TQHA 3WR5A 5L7YA 2FN7A 4R3NA 5LDGA 3ZHYA 1A9YA 1R6DA 4DC1A 4CMAA 2W2LD 3OECA 5MGBA 4YBZA 1ENPA 1T2FA 2JAPA 1YS4A 1SB8A 1YH3A 3N58A 4AJ4A 1ZXBA 3IP3A 1H5QA 2FPGA 3BMQA 2PGDA 4IZHA 1PZFA 3VDRA 2HO5A 3W8FA 4FW8A 4F6CA 2O48X 2AEMA 2A94A 2VNSA 4BNUA 2X86A 3KETA 1M2WA 3KHUA 4IPTA 4E13A 5IFLA 3DBLB 1C0IA 3ASUA 4INAA 4IDDA 1DIAA 3HDYA 2BGLA 4TZKA 4B8ZA 1I3LA 5A03A 4PCVA 1YQDA 2HJRA 4HY3A 1QKIA 2D2IA 1NTOA 4EGFA 1V8BA 3FWNA 2P91A 3FPCA 4XB2A 3RFXA 4DL9A 4B3IA 2O3JA 3WQQA 2PKQO 3Q2IA 2E49A 2PKRA 2Y0DA 4OQZA 1N8KA 3BMQB 3T4EA 3ZV4A 1DAOA 3V1YA 4YAKA 4CMCA 4IIUA 4R69A 1KVQA 1N7GA 1X0XA 3AFNA 4NPCA 3W1VA 2C20A 1YL6A 4R5MA 4LSMA 5DBFA 3ITKA 2I6TA 4DGSA 4ND2A 2AW5A 3PIDA 2CVZA 2I3AA 2VWQA 5HRUA 1GL3A 3PHLA 3DB2A 4EZBA 4W9NC 4ZQEA 3NAQA 4ZQBA 5JY1A 5JAQA 1PJQA 3N74A 4J1NA 5CDSA 5BNIA 5T64A 2R00C 2ZATA 3WGHA 4OSPA 2QYTA 1ISMA 1X7GA 2RHCA 3GNTA 4NBRA 2GN9A 5F5NA 4FBGA 1QRRA 4I8XA 2DM6A 5EL0A 1GAEO 2YFHA 4FCCA 3RSHA 4A7PA 4HFMA 3T4XA 4F6LA 4UVEA 9LDTA 4QECA 3AI3A 5DCYA 4J1SA 4YQYA 3JQ6A 2X5OA 5GZ6A 5K6AA 5IZCA 4R51A 3I9OA 4ND4A 4Q3BA 2Q4BA 1RJWA 2YJZA 3D0OA 4D0SA 1TA4A 2FR1A 2HRBA 4BO7A 2BHLA 5JAZA 1ZKMA 1QMGA 2IZ0A 3ZV3A 4FGSA 1NAIA 9LDBA 4RVFA 5JO0A 3P5SA 1AHIA 4NBTA 4Y8VA 4D3DA 3EAGA 5CHEA 3RJ9A 5A3JA 3TF5A 2Z1MA 1ZEMA 3FPLA 3ZU2A 4DMMA 3GGPA 1H2BA 4H7PA 4QO8A 4CMEA 3INTA 4GH5A 2TMDA 2F1KA 4D45A 5CG1A 3WGOA 3IOYA 2Y1CA 4N54A 2HMWA 2ZB8A 1B3BA 5JMWA 4OXKA 4PG4A 3RC9A 1UDAA 1I2CA 2NQTA 3VPFA 3OJOA 1A7KA 4QT0A 1G0OA 1PS8A 1QXSA 3AUSA 4BO0A 1WDMA 4DIBA 1JDJA 4AJIA 1BTOA 3O38A 4I08A 3MTJA 3VTFA 1B0AA 2DPHA 3KYCA 1YQXA 3NX4A 4WNCA 4TROA 4D46A 2O23A 4FS3A 4M87A 2GD1O 3OSUA 3IJRA 3Q0EA 4ROSA 4FFOA 1PGOA 3H4VA 1NNUA 4IXTA 4OXNA 1SMKA 1SNYA 5JFOA 3RC7A 3S1LA 2ET6A 2EXXA 3PWZA 3GPDG 2OL4A 5U1PA 4AVYA 2UVDA 4XDYA 1R16A 3T7CA 2VTDA 2PFGA 4W6ZA 2W2KA 5I7FA 4AJLA 1GV1A 4NK4A 5EPOA 1XU9A 4J43A 4UREA 3U0BA 2FP4A 1HT0A 1C1DA 1HDXA 3KYCB 3PTZA 2PV7A 4YB8A 1BXGA 1Q1NA 5EQFA 2GF2A 4PRLA 5I7VA 1LBEA 4JN6B 3MOGA 3JYQA 3KEQA 3DAPA 3QIVA 4IBOA 2EJWA 4I9HA 3VZRA 1ZK0A 2UAGA 3HHPA 3DTYA 1GZ6A 1NVGA 1W0CA 3PHGA 1CYDA 1KVUA 4UUMA 2JFFA 4EUFA 1JAYA 2W2KB 3N7UA 4CV3A 3NJ8A 1A72A 2VRBA 5KTKA 4YAJA 1H0KA 4J4HA 4FSHA 2AG5A 3B1JA 1Q0LA 3DMTA 5FI5A 3OF2A 4JIGA 4MIYA 1C1DB 2UV8A 1E1LA 4Q39A 1DRVA 3HNPA 1BXGB 4CM4A 3MTGA 4CM8A 4KTTE 3ZWXA 1JWBB 1HLDA 3GT0A 5JDIA 3KEOA 5TIIA 1YQGA 2GGSA 1KOLA 4DWVA 1LRJA 5FF9A 1I24A 1PJ3A 4EEZA 1EDOA 1DPGA 2E82A 3HWRA 2EJVA 4GKBA 4E31A 3H5NA 4E4YA 4CMIA 4F3YA 4WLUA 2PLAA 4HKTA 4W7IA 4YJGA 1JAXA 3KSDO 3MJVA 1N92A 3GGGA 4IQ8A 4RORA 2I76A 3WICA 3QJ5A 4MP8A 1MG5A 3S2EA 1DFHA 5HA5A 1ZSVA 4P4GA 4J4BA 2HK8A 5A02A 2OUIA 4CV1A 2HMTA 1LJ8A 4XQCA 4WPGA 1H9BA 4I1IA 4IDFA 4N5LA 4CM4B 4CM8B 1B16A 3GDOA 2HMUA 2Q2QA 1YRLA 3DBVO 3O26A 2FZWA 2QRKA 3IC5A 3PDJA 4CMIB 1VSUA 5EESA 1G1AA 2ZCUA 1HRDA 1MV8A 4OIMA 3M1LA 5CEFA 1BGVA 5HBRA 4DIOA 2EKQA 3LDHA 1GCUA 1LLCA 2QX7A 4U6SA 3BZUA 2OMEA 1VC2A 4ZQGA 5L3ZA 4E5MA 2JD1A 1V6AA 4QSMA 4YAIA 4UUNA 1QORA 3FTNA 1VLLA 4BHTA 4FQ8A 4XR4A 4F46A 1PGNA 2ZJ0A 3K31A 3E6AA 4CLOB 4KDEA 3OQBA 4ZU3A 5AXDA 5I8WA 2FHSA 5T6BA 1Y9AA 1MGOA 3LK7A 2W98A 3I83A 3UCXA 5ICMA 1QYVA 2X23A 3WIDA 4EUEA 4YT2A 1RPNA 1A9ZA 2EERA 1E77A 4TSKA 4BIIA 2EHDA 1M76A 2YV1A 4R9RA 4IJUA 4RPKA 1ZJYA 2P9GA 2HCTA 1BXKA 1VKNA 3O8QA 4P8RA 1XWFA 4QX6A 3EK2A 3SC4A 3PZRA 2YV2A 4JBIA 3RFTA 4OXYA 1OAAA 3OH8A 3GFBA 3QRWA 3FNGA 1DOHA 2J8ZA 2PTGA 4BNHA 1V9LA 4K9DA 4MP3A 3H65A 3LF2A 1MB4A 1VL0A 4BKOA 1VSVA 4B8WA 4ZJUA 5A9TA 1U2GA 2VNAA 3FR8A 4Y6RA 4YEDA 2R2GA 4I9UA 1F8GA 3TPCA 4MVJE 1BW9A 1U28A 4RO0A 1O9BA 3RUAA 3DO5A 3O8QB 2H63A 1VL6A 2VUUA 2Y1FA 1U5CA 1YXMA 3TNLA 2E48A 4E5YA 1HDRA 1JW9B 3GNSA 3KSZO 4TQGA 2ZTVA 2QIOA 1N2SA 1P1JA 3AFMA 3HJAA 2BF7A 4M55A 3I5MA 3BTOA 5T8KC 2Q50A 3ZNPA 3RBZA 2NM0A 4DQVA 3E48A 1UDBA 4QUKA 1MFPA 5EINA 1SZJG 4LMRA 2AE1A 4KWHA 1MXFA 5IXSA 2A4KA 4MOWA 5MDHA 3VH3A 3K30A 1AGNA 1BW9B 1YO6A 1OFGA 4FDAA 1XEAA 4WE3A 4B4OA 1ZNQO 3KV3O 5C3MA 2VRCD 3JQGA 1UXIA 5AYVA 1YDWA 4BO4A 3VTZA 2NU8A 4E2WA 5TGDA 1DRWA 3QWFA 2B35A 2Y99A 1EVJA 1U4SA 2GSDA 4UUPA 1DEHA 5ER6A 3E1KA 5KCZA 1ZK4A 3WGIA 4LW8A 3MJSA 4L76A 1HTBA 4ND3A 3TRIA 3TDKA 2H5LA 3L0DA 3GVPA 4IQGA 1S6YA 1IY8A 3D4PA 4G81A 1LUAA 3SEFA 3HSKA 1J5PA 1P74A 1XCBA 5AQ1A 3DHYA 1B3RA 4CUZA 2NTVA 4I5GA 4RLHA 3IUPA 1PJCA 2HU2A 3JQGB 5K0ZA 4N7RA 1BSVA 2NU6A 3I23A 3GA0A 3GVCA 4XGKA 1EZ4A 5DN9A 4B4UA 4NR0A 5IJZA 1PWXA 4IMPA 2HDHA 3W6UA 4R5HA 3WNQA 5TT0A 2B4RO 1WXDA 4CQMD 1C0PA 1JKFA 3OJFA 3DAFA 3RWBA 1KS9A 5B4VA 3RFVA 2B0JA 2O3RA 3H3FA 4ALNA 3PLRA 3V8BA 4CL3A 4QEDA 1U7TA 2PGJA 1I32A 1GD1O 1X7DA 4FFMA 2GO1A 1GUZA 3WGZA 4J3FA 4WCDA 3ZV5A 1B8PA 1ZH8A 1YB1A 1P45A 5THKA 1U8FO 4HWKA 1H2HA 5IDQA 3ZI0A 4NFHA 3GUYA 1ISFA 2XOXA 4CODB 5G0VA 3GEGA 2POQX 3UVEA 1NX6A 4JP2A 1TVEA 1WZIA 3JQAD 5KKCA 1J6UA 3NTQA 5L9AA 2IYOA 3DOJA 3DXFA 3DONA 2C0CA 1ZSYA 2Y1GA 2O3SA 3NDIA 2VT2A 4R1TA 3W8DA 5BR7A 4B7CA 5FWNA 3GY0A 4GX1A 2GYYA 2HK7A 3UH1A 4D43A 3LLSA 2GN4A 3KLMX 3RC2A 2PNFA 3RKRA 3NUGA 3KB6A 4CLDA 3C1TA 4IIVA 2EWMA 3QVXA 2PD4A 2EGHA 5C37A 2PZMA 2D0IA 3RUIA 2EP7A 2HRZA 1NYTA 3W4KA 4WOJA 4H16A 3RAJA 1K0UA 4KTVE 1QV7A 3PFWO 3L77A 3HZZA 1R12A 1NXQA 5B1YA 5K9ZA 2DVMA 3NEPX 4GLOA 3RBVA 1K6IA 4LMPA 4TVBA 4YRAA 4C7JA 3BYZA 1FJHA 4E6PA 3U4IA 4BGUA 4OH1A 2CVOA 5ER9A 3K73O 4PLPA 1HSZA 1XIVA 3PIIA 4YYZA 4IJWA 1P3DA 3DZBA 3V1TC 1N7HA 1TI7A 2PZLA 5A5FA 3FRJA 4LN1A 5L7WA 1BG6A 1VPDA 4MINA 4ALLA 1LRLA 2B4TO 4UULA 2IEDA 1GCOA 4D41A 5JCJA 2QW8A 3IUSA 3WBFA 3EZYA 3IL2A 3IS3A 3PJFA 4BKRA 1NR1A 1IYZA 4JP3A 4LCEA 4FB5A 3LT1A 2R6JA 3MEQA 1LX6A 1UUFA 2GZ3A 3SXPA 2X4GA 1V3VA 3GLQA 1E3WA 1XR3A 3DOOA 1F17A 3KUXA 4EUHA 2D5CA 3JCZA 3ZGYA 1P0CA 4FJ0A 3RUEA 1BDMA 4URFA 5AOVA 5TC4A 5JYDA 4B4VA 3HFGA 4HNHA 4K6FA 1LU9A 2AQKA 3OA0A 1ZK3A 1YB5A 1PJBA 1F0YA 3WYCA 1XSEA 4DIFA 3O9ZA 1E7YA 1VRWA 2CDBA 2I99A 3VOSA 4MPDA 4AJOA 5U9CA 4YJFA 1ZMTA 1E7RA 4WNIA 1MC4A 3OEYA 1C14A 3CEAA 3OBBA 3S55A 3INGA 1A5ZA 5I7EA 4E12A 1JN0A 5DNAA 5K6AC 5IZCC 4IS3A 4BUCA 3ZNOA 3TSCA 4FFLA 1FDSA 2X0IA 1MX3A 5LDHA 2Q1SA 5JMPA 1T25A 3QW2A 1UAGA 1Y8QA 2BH9A 4XDZA 2IZZA 3KYDA 1PZHA 5G4LA 1CJCA 1H6DA 4RF4A 1Q7BA 3JYLA 1D1SA 1KVTA 1HL3A 2BD0A 1N5DA 4CMKA 3RU9A 4RPJA 4WK6A 1F8FA 2IE0A 5LCXA 2QQ5A 3F3SA 1CF2O 4II3A 4YJFB 4BKQA 1R15A 3VKUA 1A4IA 4CMEC 4CQMB 1Y81A 2J5QA 2LDXA 4QFCA 1ZCJA 1H94A 3V1UA 4LCJA 2UDPA 4O1MA 3WGYA 4DREA 3ZH2A 4FC6A 3MWEB 2DTDA 1LSOA 1NPYA 1YE3A 3E5MA 3ANNA 1M75A 5DF1A 3NT2A 5H83A 1SPXA 1YVEI 3W4JA 5JSFA 2OFPA 1T1SA 4GLLA 4L9RA 2WDZA 3KYDB 2Y67A 4I5FA 4AJHA 4UEOA 2C5AA 1DHRA 4AJ2A 4DBZA 1ULUA 4JLWA 1DC3A 3ON5A 4BO9A 3AM3A 4PG5A 3H3JA 4AL4A 1DXYA 3TOXA 3CZRA 3QV1A 3GAFA 4RF3A 1PQUA 1IL0A 1U9JA 3D4NA 4IGEA 3RQSA 1R0SA 5DULA 4AFNA 5IDWA 1PTJA 4YRBA 3ZZNA 4BO3A 4GMFA 1AHHA 2YV3A 3ZWPA 4H15A 3E9QA 2JHGA 4B7XA 4HUJA 1G6KA 2GZ1A 1CIVA 2H1SA 2VQ3A 1N1GA 2WM3A 2VWGA 1NASA 1Y1PA 3OMLA 4AJNA 1PL7A 5TLSA 4YQZA 3WTCA 4PVDA 4AG3A 2OOSA 1EQUA 2QZZA 2GZ2A 3NKLA 1A27A 1UXHA 1DHTA 1QYDA 1WLYA 3AK4A 3G1UA 4PZEA 4DLLA 1B8VA 3DBRA 1E5QA 3UFXA 3I1JA 1ADGA 2BLLA 2P9CA 3GR6A 4O5OA 2LDBA 2VWPA 3WXBA 4BMNA 5CEJA 1EDZA 3H9JA 1UP7A 3G3EA 1D1TA 3R1IA 4BMSA 2PGLA 5JAIA 2VN8A 3ZWCA 4ZD6A 3VZPA 1RYEA 3WNVA 3WYEA 2CSUA 3E9NA 2PZKA 5A1TA 3I9KA 1LNQA 3QVWA 1KY4A 5AVOA 3DR3A 2AQIA 4XYGA 3DMTC 4ITUA 4UAGA 4FIZA 3VZSA 5HWSA 3C3XA 3H9GA 4DBVO 4XB1A 2NU9A 2NWQA 3I9NA 4XYMA 1VJTA 3DBRB 5JDIC 5KVSA 4HADA 2X0NA 4IDGA 4QO7A 1ZSNA 2G1UA 4NHEA 3JQFA 4ONEA 4OM8A 2BFMA 4XJTA 2ZB3A 3JTMA 1YONA 4G65A 3PFFA 5B4TA 4II2A 1RKXA 3ZWOA 3CH6A 2J3KA 3D4OA 2W4QA 4DQXA 2WYWA 5F1KA 3I9LA 4UVIA 4RVGA 3TFOA 4YJDA 4Y98A 4XJSA 1A7AA 3TFQA 1DO8A 1AXEA 1P77A 3PWSA 2RHRA 1LDMA 3JQ9A 4L74A 1FK8A 3VHRA 1LC3A 1ONPA 2DBVO 4J9VA 3QWAA 3GHYA 1TLTA 1LC0A 3DAGA 5IXYA 4XR9A 2EG9A 1NQTA 2FMUA 2X6TA 3ZWYA 4XX0A 2EKLA 2HK9A 2C2YA 1I3KA 4BKUA 1HF3A 2G76A 4YA6A 4E2XA 5ILOA 2BKAA 3BTUA 4BQPA 3JQ8A 1YJQA 3ORFA 4I5EA 1LLQA 2IXAA 1QLHA 3TN7A 3R3JA 1NQOA 5KVCA 2P9EA 4D3SA 5BNTA 3MJ4A 3CPSA 3L9XA 3WSVA 2FPIA 3FF4A 1BDBA 1NVMB 2DBRA 3CE6A 4JJGA 5A9RA 2VHZA 3K6JA 4RVHA 3V5NA 3U4DA 2CFCA 4LSWA 4BNJA 5JXWA 4JBHA 3GUCA 1Y5MA 4D3FA 3IKVA 4J7UA 5A05A 1W4ZA 2IXBA 3PEFA 1D3AA 3WDSA 4WUVA 5JO9A 1W6UA 3ZHZA 1IPFA 1YKFA 2Y0EA 3FR7A 1K89A 4WLFA 3O4RA 5FYDA 3A4VA 3JQ8B 3MJCA 1ZK2A 2C07A 3EMKA 1X14A 1B7GO 2FOIA 1DIHA 4J0EA 1IOLA 4HV4A 5KJCA 4TRJA 3TZHA 4EITA 4DTIA 4Q9NA 1B2LA 3WFIA 4RCVA 1IPEA 1GUFA 4XWYA 4CMJA 3RUFA 1XDWA 2W90A 4CR8A 4BGIA 1U2DA 5KJFA 1PU2A 1JA9A 8ADHA 5L40A 2GCGA 4TKMA 1CERA 1EMDA 3QA9A 2YDYA 4PZCA 3WLFA 2PWZA 3X2FA 5JNLA 1PJSA 5AXBA 3STHA 3UCEA 1UXJA 2OXIA 3FBTA 3BMNA 2YQ5A 1UP6A 4CLEA 4FN4A 3GVIA 1P31A 2G5CA 3D7LA 1X1EA 1PR9A 4OAQA 5L7TA 1VJ1A 2RAFA 2HUNA 2DTXA 1GZ3A 1PJLA 3BA1A 2EEZA 2EKPA 5CPFA 1PJ4A 1X13A 8LDHA 5DDIP 4CLXA 5LC1A 4XYLA 1T2DA 2Q45A 1LSSA 4MDHA 2OP0A 4FOSA 2C54A 1E1KA 4IUYA 1QG6A 2P5UA 2VYNA 1GFSA 2WD7A 4IDAA 3DZGA 3ZV6A 1YB4A 4DYDA 3K92A 3B1FA 4ZQHA 5HTOA 4QQRA 2ZTMA 3SJ7A 4KDFA 2FY8A 1B15A 3BMNB 4Z6KA 1RM4A 1V35A 1T2CA 3AM5A 4XKJA 2GR9A 3B6ZA 1ISJA 2O3UA 2J5RA 4GVLA 4L0QA 1GUYA 3S2IA 3DOCA 5JC8A 4CQLA 4NMHA 1TT5A 2VOJA 2C59A 3NTOA 2J3IA 2XXBA 4MIOA 2C7VA 3DZJA 5T57A 4CR6A 4FFRA 1BMDA 4EJ6A 4E5PA 4YT4A 1R4MA 4IS2A 5JBIA 1A4UA 3I6QA 3I4CA 1LDYA 1JKJA 2WD7B 1DC6A 4OO3A 1E5LA 4J6FA 3ZWVA 1MLDA 4TMFA 2RCYA 3R0IA 3FWZA 2ILTA 4Z3KA 3VPGA 1IE3A 4BNNA 1M6WA 2C2XA 2P4HX 3PYXA 4D7AA 5GZ1A 2D4AA 1JKIA 4R4JA 1UJMA 1LDEA 3OM9A 1YDEA 2B5VA 2C82A 1P9LA 3K2EA 2B5WA 4N5NA 2XPCA 4IQ0A 4RF5A 4CQLB 1NP3A 1WVGA 3RC1A 4B4WA 1VE9A 4PLCA 1DIGA 5ITWA 4YT5A 1DB3A 4YDRA 3D3WA 1E3JA 2DC1A 3NTRA 1I01A 2NV6A 2V6MA 5G0SA 3WOHA 4GPD1 2RH4A 1R4MB 4M8SA 2PR2A 3ZW9A 5COQA 4BNMA 3L6OO 3DZKA 4NJOA 4YJGB 3Q9UA 1DIRA 3UKOA 1IHYA 4FOOA 1HDYA 4HX5A 3ASVA 2UUPA 3QVTA 4Y9DA 2J3JA 4L75A 1CEQA 1X1TA 4ZRMA 2QRLA 3C85A 5A04A 3RUDA 4XRRA 4RPHA 2G82A 5CDUA 4E5NA 5DZSA 2D59A 3D1LA 1T24A 2JL1A 4KMSA 1H6AA 3ITDA 1V3TA 2J6IA 3D3WB 3H2ZA 1DJQA 1ID1A 4KUHA 4ESOA 1J4AA 2OHXA 5C7LO 3PLNA 5HS6A 3TJRA 4ZA2A 5ES3A 2HMSA 2WE7A 4AJKA 4N18A 5ILGA 1CQIA 1JU9A 3LF1A 3EGOA 4XCVA 3KXDA 1WZEA 4JCOA 3BTVA 4YJHA 2VUSA 4R9SA 4WGGA 1CWUA 4RZHA 5I9LA 1LQUA 1YBAA 1O95A 4ZQFA 4JX8A 4MVJI 4DVJA 5IG2A 1CRWG 3C24A 3IQDB 3NJ4A 4Z3DA 5ENVA 1DAPA 3WG9A 5BSGA 3DQPA 3OJEA 1ENZA 1OMOA 5CEEA 3HB5X 2X0RA 4X54A 3PJDA 2ZYGA 1T2EA 3PQFA 4J1QA 5J23A 1WDKA 3GQVA 4RPLA 4CM6A 2IDZA 1I33A 5JLAA 2D8AA 1HE5A 1BRMA 2VWHA 3RKUA 3RJ5A 5JDCA 4RZIA 4FJ2A 4YJHB 2BFAA 4PN3A 3JQ7A 1BXZA 2RBEA 3TL3A 1J0XO 4NDNE 3UF0A 1Y5RA 5F3RA 4YWJA 4KUEA 1N1EA 1E7QA 3OP4A 1ZVMA 4NU5A 1IZ9A 4BO6A 4J7CA 3AOGA 4AJ1A 1RM5A 1DRUA 4LVCA 4PRKA 5IZ4A 4RQTA 2JFHA 3AY3A 4E2YA 1E6EA 5FI3A 2CDAA 4U6QA 2DUUA 3ZNQA 3HN7A 3PQDA 5BSEA 2P4QA 4IGFA 3GVHA 3ETGA 4S1VA 1WMAA 3LT2A 2CMDA 1GPDG 3KLPX 1P44A 3GEMA 3CUKA 2V6BA 3JQ7B 5I8ZA 3V2GA 1C0KA 3JYOA 3F4BA 3A28A 4RVSA 1EBUA 1M66A 3JD1A 2RH8A 3D3EA 1PZGA 3IDSA 3LQFA 1GQQA 3M1AA 3ONEA 3LC1O 3NT4A 4M54A 1PGPA 5G0TA 1L1FA 3PP8A 4GI2A 4EW6A 4BNFA 4D79A 3JSAA 5JCJD 2ZK7A 3LYLA 2WJPA 2P5YA 3B70A 4XQ9A 3T7EA 3U49A 2I9PA 2FPPA 2Y05A 4QTZA 1RM0A 4BO8A 5DBIA 3MJTA 2PD3A 3G1TA 1ZBQA 2OORA 3EY4A 4TZTA 3SLGA 1QYWA 1PQPA 2O7SA 4Q3AA 1U3UA 1YOVA 3ROKA 1QR6A 2YUTA 4DA9A 3OIGA 3LZ6A 1RYDA 4NG5A 1LRKA 1L7DA 2SCUA 5JC1A 1Z74A 3PQEA 4MKRA 4D42A 2DAPA 5KJ6A 4FD3A 4YXFA 3OHSX 5G0UA 3ZWBA 3DDNA 1TB4A 1PR3A 1PJTA 2A9FA 1IHXA 3AY6A 3DEYX 3CINA 4WKGA 2Q1TA 4TRMA 1BHSA 3ZNNA 3ETEA 5BSFA 5IN5A 3WIEA 1NFFA 1LDNA 5C5IA 1UZLA 3FHLA 4M1QA 3KBOA 2I65A 5IDXA 1HYGA 4EBFA 3RBXA 4MVJH 1NFRA 4PLWA 3WQRA 2DU8A 2Y66A 4NH4A 5JPIA 1YOVB 2GPTA 3OETA 1LDBA 4E33A 3ZU4A 3ROQA 2NTNA 3AW9A 4KWIA 3K2BA 4GBJA 3JD3A 5GMOA 5CDTA 2WMDA 4JK3A 4BNGA 4FFNA 2NVBA 3C7AA 3ETDA 1NFQA 1DLJA 5IAAA 1FDVA 5BQFA 1NQAO 3CTMA 1EE2A 3FI9A 4PFJA 4Y6SA 1SBYA 2VCYA 2B83A 2VTEA 3GK3A 4U5QA 1R4NA 4RVDA 3QWIA 4Z0HO 3WLEA 1E7MA 2AMFA 3OIFA 4UVGA 4CMHA 1ZIDA 1BWSA 3CKYA 3AJRA 2WYUA 2JFGA 4NQZA 2WWRA 3COSA 3QWBA 1JVSA 2GASA 3KYBA 4BB6A 3IMFA 4L4SA 2AXQA 2EIHA 3S2FA 2EW8A 1DC5A 1E6WA 3WQSB 3JYNA 3JQBA 1PGJA 2CDCA 6LDHA 1GTMA 3ZWAA 1R66A 4CM3A 4EDFA 3I52A 3DC2A 5CDGA 4XZ3A 1W73A 4FFPA 4J2HA 3CMMA 4NBUA 4JXKA 2BI7A 3WGQA 2GN8A 3BIOA 1GV0A 3HDQA 3K9QO 2NU7A 2PK3A 4IINA 3F4LA 3GMDA 2WSBA 3RUHA 3ULKA 3L6EA 4P4NA 3L4BA 3VVCA 1GZ4A 2VZ0A 4ND5A 3LC2O 2O2YA 2VUTA 2ZQYA 2HAEA 4XYEA 4ZHSA 1H6CA 3A1NA 3Q1LA 3UHAA 4B79A 4A03A 1GEGA 3ANLA 4E5KA 2NVUA 2VYVD 3GFGA 3DBHA 3WFJA 3QLJA 5A3VA 3AUAA 5KWEA 3L9WA 2J5KA 2YHIA 4BNWA 3BHMA 1E7WA 2GLXA 2DLDA 3P2YA 4W99A 1ZZEA 2PD6A 2I5PO 4WCFA 3JQFC 5EQDA 1SOWA 2X7HA 3I4FA 4GSLA 2VHWA 1UAYA 4W4TA 4K26A 1JWAB 4DQUA 1P1KA 1EUZA 1O8CA 4GSKA 1AN9A 1P1FA 3PVZA 4MVJA 4BV9A 1LXCA 2FRDA 3C8MA 3NYWA 4EJMA 2GUGA 2YY7A 1K2WA 4NI5A 4S3MA 5U4QA 1C0LA 2Z95A 3GDFA 4BNKA 1HDZA 2Z5LA 3AI1A 1T2AA 3DHNA 3PYMA 4RL6A 4BNVA 1D8AA 1HKUA 3IAHA 4J16A 3JQ9C 4JBGA 2X9GA 4RGBA 4WLOA 4MKXA 2NVUB 1UDCA 1MFZA 2ZTUA 4OKIA 2BFPA 3ENKA 3LT4A 4R16A 4W7HA 1M6HA 3LT0A 1ONNA 4P22A 2AHRA 4K6CA 4G5HA 2DT5A 1L7EA 4PLFA 4PLHA 1B8UA 1GEEA 4WCFB 1P1HA 1NR7A 2AE2A 4GX2A 5JAMA 4OYRA 3FCOA 1K6JA 2Q49A 2FR8A 1K3TA 3GZ4A 1E3WB 2IRWA 4LRTB 1KBZA 2JAHA 4MIEA 2CNBA 1LLUA 3AY7A 3ZW8A 4PLGA 4D44A 4UVHA 1UXKA 3OEWA 2VHXA 1X15A 3IKTA 3KOUA 2H6EA 3WBBA 3ZCXA 1EUDA 3ZHBA 4HBGA 4CL8A 3PGXA 1YJ8A 2BGMA 4M89A 1M67A 4ZN6A 1E7SA 1MXHA 4E0BA 5DP2A 3LC7O 3OJLA 3R3SA 4NFYA 5KVVA 1HSOA 4KUGA 3V2HA 1KYQA 4BOYA 1Q7GA 1E3SA 5DCWA 3TOZA 4AJPA 3GG2A 3SBOA 3GAZA 5THQA 4LVUA 2Y0CA 1QSGA 3EW7A 3ST7A 4IZIA 2Y1EA 4OSOA 3ZN2A 1ENOA 1RWBA 1PL8A 4N5MA 5KKAA 4YCAA 4RDIA 1Y8QB 4YT8A 3NDRA 2WYVA 4E2ZA 1ISHA 1U3WA 1XA0A 4FR5A 2D5AA 4IM7A 2VZ9A 4WJZA 3ZU3A 4BGVA 1MC5A 2X58A 4R41A 3QVSA 3ABIA 3RUCA 1J49A 1I0ZA 4RVUA 1LDGA 4MVJP 1KC1A 2JCYA 4ND1A 4L4XA 1GYPA 1PGQA 1XQ6A 1R0LA 3SVTA 3UAGA 4GVXA 4YRDA 3DZHA 3Q6IA 4TRRA 1U8XX 3M2TA 5GZ3A 4FGWA 4B3JA 1O5IA 3QE3A 1WDLA 4DC0A 2VYVA 2CVQA 4IDEA 3ZWMA 4PG7A 2BELA 2H9IA 5KJEA 1NM5A 2DQ4A 4XD2A 1NWCA 2FWMX 1DIBA 3CMCO 3EUWA 3RIHA 4H3VA 5F1OA 4J49A 1JLLA 3RD5A 1NWHA 3OQ6A 1XQ1A 2AQ8A 4XEHA 3DBLA 1T4BA 2E6UX 3WB9A 4R1UA 3K5PA 4E32A 4BNTA 4CMBA 3PXXA 3VAZA 4J1TA 1C1XA 5I9MA 5L53A 1A71A 3FNFA 2ZTLA 1EQ2A 4MVJF 2AQHA 4NIMA 3AOEA 5TJHA 3JD4A 3PRJA 4CM9A 1I8TA 2FZEA 5COAA 1MUUA 2VOEA 1I3MA 1U3TA 1ADFA 1EVYA 1LSJA 5CP8A 5KIAA 3VDQA 5G0WA 1NAHA 5CG2A 3F5QA 2DBQA 4DPMA 2NADA 4Z0PA 1HYHA 5H81A 2OZPA 5ENDA 2Y68A 2ZB4A 4CJXA 3C7CB 1VM6A 1AE1A 2PH3A 3DFUA 2PA3A 3HG7A 2Q1WA 4W82A 4AJJA 4UEJA 4GAEA 1DLIA 2JCXA 4KOAA 4RV9A 3S8MA 1EBFA 4WECA 4XQEA 1ZJZA 4J91A 1C1XB 1DFGA 5BT9A 4R54A 1QP8A 2VYND 1HE2A 1P0FA 4Z9FA 2PZJA 3QHAA
chains in the Genus database with same CATH superfamily
3JVUA 4ZRNA 1YWGO 4DQLA 5AI6A 3GHHA 3KK0A 4WBSA 2EJBA 2C0PA 3O9VA 4MS3A 1DMSA 4R8VA 4A5OA 4B2YA 4I6JA 2JLBA 3AG5A 3DFMA 4P93A 4TT8A 3ZHXA 1A8QA 2Y93A 2FSIA 1WUHS 2P4EA 2RFLA 2YOFA 5BOVA 2H2AA 1YBMA 3EXFB 3CZ9A 3KHSA 4MV7A 1P80A 4ZI2A 3QQPA 2TRSB 2VPZA 1F12A 1Z38A 4XIYA 1COZA 3EPPA 3AM1A 1TA9A 1U9CA 2R84A 2XB2A 2B36A 2GYVA 3WJAA 5A6VA 2H7XA 3PFKA 1ISIA 3AKEA 1THTA 3CJQA 5EE9A 1BVYF 2WC1A 2JA2A 2YINC 2I6SA 2FHPA 4W5RA 3H2SA 2BJHA 3THWA 1FOEB 2ID4A 3ZQ6A 1NNSA 1W30A 4REQB 4JL6A 4LK2A 1R37A 5C4GB 4UZEA 1CQJA 4J2TA 3VZBA 1WKBA 3R5XA 3IIEA 2FWPA 1CDOA 1KI4A 4K28A 5JRDS 2D1TA 3PFBA 3HVJA 4JLUA 3ZHUA 2JKVA 1U5AA 5CVTA 5LZ4A 1U3CA 1ZJ5A 1VPVA 2C97A 5AKIA 1NJGA 2CLHB 2JGJA 3LWZA 3ZGLA 4LF8B 3CJRA 4TV8B 2JI6A 4AP5A 4RTSA 3IT2A 3AVPA 4OQYA 3ZDFA 2IY7A 2CB9A 4M46A 1R5BA 4M86A 1HYEA 1V1MB 3EWSA 3F9IA 3VPSA 2IT1A 4X41A 1JFLA 1DAKA 3H9QA 1GADO 4H1WA 4H0CA 4YR9A 3NDJA 4N03A 4QUHA 4IJVA 2ERYA 5EI5A 5C1PA 1NJFA 1TIBA 1Y6FA 2HV9A 4PLVA 3R9XB 4QSHA 3DP7A 4QEZA 4TUYB 1NHGA 5GV8A 1E1DA 2ZB7A 4BP1A 4YJ2B 2D6FA 2C42A 4DCTA 5CA0B 1VXOA 1FF9A 1WPQA 2AXEA 5IWCA 2HF7A 1DWOA 2JCGA 5E4TA 5JJ5A 3KQNA 3JAWB 1O6GA 5EC8A 2IBSA 2HMYB 3O1LA 4KYTA 3QKSA 1TM2A 1Z45A 3P20A 4N0MA 1L4YA 2EIXA 4GZ6A 4KXXA 4R8LA 1UK8A 4LX0A 3G1WA 4DUPA 5C7YA 1JAZA 1MA0A 1QFZA 2D1FA 4C0WA 2QHXA 1Z2NX 4HC4A 1JLSA 3LWDA 2W2LA 3QV2A 4IWYA 1GPYA 1EK5A 2WFLB 1FA9A 4P33A 5C7IO 4RKYA 1C9YA 4KYUA 5JCZA 3PWTA 3ODPA 1WA5A 3WNZA 3PHHA 4DWOA 4P3YA 2IZ1A 2W8BB 1HE4A 2I3GA 3CUSA 4FHFA 4Q3EA 3WL6A 1IQPA 1KFCB 1VZ3A 2WK1A 2FK8A 1K7CA 1R1DA 3GUUA 4CM5A 4R8KA 2O3QA 4WUTA 3FLBA 2NPIA 3I5UA 2DERA 1IEVA 3R3YA 3EHEA 5ALUA 3SZ3A 1AXGA 1ZK1A 2FZCA 3LUGA 1RXVA 4NJMB 1NL3A 4F1KA 2IGTA 1ZCFA 3DEFA 5JDCC 1E4OA 3DO6A 3RWOA 3QF4B 4PWZA 1F14A 2XQFA 1W29A 3CZAA 2CNLA 5DXFA 3Q85A 3PJRA 2Z1NA 2H1CA 2G08A 2EGGA 5DBGA 4U7JA 2OD2A 2NNLD 4XIFA 5EG5A 3H8JA 4NNJA 2GBFA 3GJTA 3TJMA 4DJEC 4DR5B 5JJLA 1L4FA 4A6DA 1U1EA 2XCIA 2B8EA 2RD2A 2LW7A 3G0OA 3SICE 4LHEA 3JX9A 5JPDA 1BA2A 3FJ1A 1DJOA 3HDHA 1R6VA 3ENNA 3R75A 4BV3A 4D3YA 2ZLBA 4NCBA 1XMSA 3M1IA 5DCUA 3FNQA 5C8YF 1G5IA 3SCZA 5FDFA 4MARA 4PC2A 4RBNA 1KYZA 3KC2A 1E1MA 4ANFA 1UK6A 2CZQA 4UM5A 5DHAA 1ULTA 2JZNA 1JALA 3UIEA 2VPQA 1FTNA 1O08A 2WWHA 1GQ2A 5EMHA 5HF6A 4FPXA 5TQ0A 4HAVA 5BW8A 1HFKA 2W8ZA 3MAAC 1NQ5A 4R1LA 3SX2A 1JXOA 1PNVA 5H9VA 1MU0A 1V11A 4EL0A 3ZCPA 2EJTA 3WGUA 4BMDA 4KFCA 1E8MA 1I4EB 3G23A 4KFUA 1DEOA 1NOKA 1P73A 3EEFA 4QA9A 4DV7B 1Q3TA 2GEKA 1G7TA 4R1PA 1Z7BA 3FPHA 3IOCA 3AI7A 3NBFA 2BKEA 4IIJB 2VIIA 3H6KA 4MVJG 4BFUA 5K05A 4JOQA 3H2IA 2PMCA 5BPFA 3UB4A 1UMBA 3WLRA 3OOJA 4BGEA 3PEUA 1LQTA 1Q22A 4C4SA 4LWPA 2C00A 4AKSA 1YS7A 3IQEA 3V97A 3T5PA 4DBLE 1QV6A 1Q0QA 1X7ZB 3L4SO 4AUKA 4D4KA 5C32A 4C06A 2VZ8A 3S8EA 4D9CA 1PEAA 1T1IA 1U3VA 2FCRA 2ZWVA 4R6XA 1BJRE 1D03A 1V3UA 3SSOA 2WIAA 3OC0A 3W8RA 1JR2A 2TECE 4P81A 4QVKA 3HDJA 2G06A 1E3MA 2FUG6 4HQLA 1GU0A 1QH8B 1TADA 3URMA 4AYXA 1O8BA 1TT5B 1P8JA 2AA3A 4HLUA 421PA 4W9MC 2QL6A 5G2OA 5JI2E 2PKEA 2QPOA 2WPNA 3HB4X 3HFSA 3U4QB 2J3HA 2PXAA 2FH5B 2IDKA 3GRUA 4HXYA 1RXSA 1YB7A 2J59A 5F77A 2QA5A 3KJHA 2Q6TA 2XB9A 1I9CA 3MRVA 2YQ4A 3MF4A 4HS4A 4FFDA 5BN5B 1KOJA 3ZCSA 5K0NA 3VPCA 5T6MA 4CETA 5GM2A 4F93B 1OZ0A 2WKWA 5JZMA 5T67A 4OB8A 4FYIA 2FYTA 1WABA 4BL5A 1JDBB 4J2OA 1GNQA 4LRWA 4X8MA 3BGIA 2V74B 1Q83A 1YZKA 3QKRB 5KMGB 2B37A 4KK4A 2I67A 4KX5A 1SCNE 1UIRA 1GVNB 2PBZA 2WNIA 4ZZIA 6CHYA 3ER9A 4TMKA 2GN1A 4NDAA 1DADA 2BFOA 4ZCTA 2QYSA 1GZ5A 5HKBA 3SDBA 1VQ1A 2Z5VA 4YACA 4XWWA 1ZO8A 2XZOA 3QOXA 1XTZA 1PJ2A 2KBEA 1E2EA 2REOA 2XVZA 3RROA 1CNFA 4B6SA 1IUKA 1T1RA 3I09A 1M74A 4DXHA 4E30A 2F8TA 2R87A 2V6JA 3U5TA 2X9QA 1FX0A 2VAVA 4P38A 3MJEA 5T5QA 3K9HA 1GP2A 1G55A 2RIPA 4XW2A 3VSEA 1P7CA 2OHVA 5F1PA 4GWKA 4Q93A 1QTIA 5JASA 1OI7A 5K3SA 1KP9A 4EO4A 1R74A 3BTSA 4BX0A 1ENYA 4MI9A 3D5TA 3OZBA 1M0SA 2Q3CA 3H16A 3OQMA 3JQBC 3HA5A 2BL4A 4EI2A 3AU9A 4JV5B 1C3OB 2WWFA 4NYIQ 4ON9A 3O82A 1WCWA 4JXJA 3FRIA 3NOQA 4GM0A 1Q0HA 4M88A 4N01A 4RKQA 4ILKA 1Y3BE 2E4XA 3NTLA 1HUQA 2DKNA 2HEIA 2VNKA 2XUAA 3ROMA 4H1TA 2M98A 2JGEA 4GL4A 3EWNA 3K0KA 4MV8A 1LTQA 3SSNA 1C3VA 1XXHE 1D4FA 2XYVA 3ENVA 2BPOA 3O75A 5DM2A 5LXTF 1H8ED 2CXHA 2D5BA 3DS8A 4URVR 1ORWA 2WMNB 4WN9B 3I2HA 1BMFA 1SEPA 2YVQA 1JPNA 1ZJJA 2NUAA 5DHPA 3L4BC 3OICA 4U8GA 1Z33A 1BZYA 1GU7A 4H1UA 3KQHA 4HEA1 1J8FA 1P39A 4AZSA 4D25A 4AQ7A 5F21A 1NLMA 2YH2A 4H9GA 1DV2A 2IYPA 1QLJA 4LYYA 1C4OA 3OZAA 4WLEA 2FI1A 1RE0A 4TL7A 3WK9A 4BBAA 4BLSA 4HAZA 4H18A 4ZT3A 1TMKA 3FFTA 4XQGA 4ZCMA 2CHGA 3AR5A 3MBIA 4XGIA 1IXYA 4AY6A 2JBWA 1QFXA 1GLNA 3T7DA 4OKNA 2ACKA 1DIOB 1KDZA 2JZCA 2VQSA 2EBUA 3HUDA 1WR8A 2GCOA 3PJEA 1GGKA 1XEFA 1YZFA 1VKOA 2ZJZA 1NVTA 1RIFA 1K8RA 4MJXA 3P2EA 2VPYA 4O6VA 4TSFD 5BSHA 1BH6A 1YS1X 3JQCA 3OQNA 4WCVA 1ABBA 3ZLUA 1VG9B 5DLPA 2JLZA 1E9AA 5CLFA 3ZS8A 4BIMA 4UTVA 3I01M 3FNIA 1V4VA 1BHO1 4LF7B 2O8DB 5HDBB 1J07A 1BX3A 1J2YA 3B36A 3KWLA 3PK0A 5CGQB 5AK4A 1P1IA 3ZDQA 5EHXA 5AW1A 2HDOA 3RS3A 3NIGB 2OLKA 3NHMA 1GGVA 1L8XA 4WEOA 2H4HA 3VH1A 1G8GA 3TLZA 4GE3A 1RJFA 1QF9A 2MSNA 2VP0A 3E3MA 3EGWA 3RSGA 1BVRA 4LJ7A 1DQPA 3REQB 2JD0A 1EAYA 5IFKA 3K70D 4TKVA 2C5SA 2ZB2A 5FBRB 2XMSA 3L6BA 3RVDA 4KFTA 1PQWA 3TAUA 5BQ3A 3A1WA 3GEDA 5L6LB 3CC8A 3Q11A 2LKDA 1POXA 2G70A 3NG1A 3WKAA 4G56A 3I8XA 3S2GA 3D6HA 4DNXA 4AAYA 4IHJF 1NMXA 3ZVRA 4JQSA 3R0XA 2IQ5A 1USGA 1N2EA 5EHZA 1NXSA 2QSZA 3KR9A 1HQDA 4G5XA 4G8CA 1R3UA 4GU5A 4HP8A 1TZMA 1GGEA 3HA7A 4LDPA 4RLQA 4R40A 5ALTA 5DYTA 3R9IA 3ZE2B 3KWJA 4PX2A 2IOYA 3LOUA 3RVSA 1EFKA 4B2PA 3IKMB 4F12A 6AT1A 3ES9A 5M2QA 4A73A 3C1OA 1JH8A 2EKZA 5H16A 3KT3A 1D07A 3DWIA 5JMTA 3CPEA 1VA5A 3LVFO 1KP2A 4PZLA 1P5RA 3H8SA 3M49A 4DLAA 4EJSB 4OL9A 3CRQA 2C4HA 1U9ZA 1F0PA 1M34E 1QGUA 2I4NA 1U0HC 2FSUA 1L5ZA 2GDZA 2QRVB 3DQQA 4BVAA 3IAAA 5FEUA 4EKYA 3DT8A 4KIJA 3MD9A 1BYUA 1XRSB 2TS1A 5KVQA 4O59O 2FPRA 1U1CA 4BMYA 2BI8A 4RETA 5L4LA 3M4NA 2VNJA 1SCBA 2ZIZA 4U7DA 4RFSA 4YCBA 1I7SB 1J8YF 2WWYA 3RTBA 3K6RA 1YBVA 3OJWA 4CT0A 1T8UA 4KN8A 2JGNA 4PR0A 4RADA 1FTQA 3BJEA 3QU2A 4BNZA 4YV0A 2VHVA 4O4IF 3I9MA 1L8AA 2AOTA 4PYNA 2REQA 4OU4A 4LJ6A 4TMZA 1Z56C 4L3OA 2ECQA 2XAAA 2ZRAA 1OLXA 1V0JA 3NWEA 4ZXFA 4D9EA 4MVJM 3HFJA 3E5RA 1WHSA 5KOIA 5C7OO 1Z5PA 1MC1A 3VKFA 3BWDD 5A9SA 1EH5A 1UL1X 2CHVA 1CVRA 1T0IA 3EG9A 3KJNA 4IMRA 2IZ7A 2Q2WA 3SNHA 1TF5A 2HWUA 1PFUA 4WOKA 5E3HA 1EU1A 1JQBA 2Z4RA 1QOZA 3U17A 4AMZA 5A5GA 3DV2A 2Q6LA 3ADPA 2DFVA 2X9NA 5B6JA 3D8HA 5EIOA 3TSYA 1UPXA 2QTAA 3CVWA 3U7EB 4K9KA 4QGHA 3Q88A 1FXWA 4KQXA 2EZUA 3QWHA 2GBIA 4UDXX 2MINB 2R6AA 2W6PA 4E5UA 1V7QA 2RG1A 3I1IA 3VR3A 4HH4A 3KSUA 2K6GA 4L78A 3V55A 3AEYA 3NT5A 3IO5A 1MPXA 4NZ9A 5LL6P 2EL7A 3GIWA 4HN2A 3OOHA 2ZRPA 4RD1A 3WGKA 1S2MA 3NBAA 1EEHA 1Y8RA 3EODA 2B94A 2HNBA 4GL2A 3IPAA 3PQ3A 4RL4A 4I1VA 1EE9A 5A06A 3AINA 5BQ5A 2WJAA 2A6PA 3EXEA 4LDAA 5I7UA 2ZYRA 1VCIA 3V8NA 4LYAA 1QQTA 1PZEA 2ZRQA 2CJWB 3NIFB 1VCHA 4YAEA 2Z6QA 3ELYA 4P4LA 3KJXA 5DK4A 1CY7A 1FUEA 5SZJA 3TW8B 3GLGB 2JLCA 4YONB 5IDYA 1T26A 3ZXSA 5AM3A 1DG3A 1FVFA 1MMFB 2BONA 5KQMA 1YZ3A 4WFQA 1T5BA 4XXHA 3KALA 4Y2HA 1UZNA 1DBRA 1YGYA 2PBRA 2R8YA 3KPYA 2CHEA 4F9EA 3ENZA 3HQ4O 4U00A 1Z8FA 2G5PA 4UNQA 2XWBF 4GVPA 1O77A 5JHHB 3LPNA 5TQVA 4MDYA 4R7ZA 3TQSA 3GGJA 4RXMA 4YLYA 4ATNA 2YJ5A 1QQAA 1PDWA 1PUIA 4M0DA 2PTHA 4N65A 2XGOA 2IEBA 4FWBA 1GG5A 1KO4A 1U8AA 2XUPA 3N2IA 4EYSA 5IU6A 1E3IA 4Y1FA 1UKCA 2F1IA 1LSUA 4KP7A 2QTCA 3EOBI 4PVCA 3DXXA 2P9BA 3OKPA 4QRDA 2VRCA 2OA0A 1UODA 7GPBA 4Y1GA 2CUKA 1HXHA 5KJ1A 5FNVA 1U2PA 5ALQA 4RKFA 3QX7A 3UXYA 5B4UA 3Q9NA 5ITZA 3WLOA 3LGSA 3SYMA 4XRGA 1GT91 3W2IA 4EY3A 5EFOA 5K0GA 2J9FA 3ZWNA 1B73A 2O8CA 2LGJA 4V0OA 3X2EA 1XK6A 4Q3NA 2PH5A 3JARB 1SUWA 3DBHB 4DV3B 1NN1A 3BGVA 4MK4A 3FE2A 4DLRA 3PX7A 5HE9A 1CJBA 5E1BA 4X5OA 2O3TA 1J8VA 2HWWA 1U7XA 3GRYA 3RS9A 5CAEB 3P94A 1S4QA 4EHDA 1E79A 1XEWY 5NULA 3V1LA 5HM8A 3CRRA 3E05A 2AFVA 1L5WA 1NPTO 2O20A 4ZICA 1GWNA 3PXCX 3E7XA 1XDZA 3QPAA 4JYCA 1XROA 4R68A 2V3VA 1E61A 3K3PA 5DNVA 3AYXB 1N8SA 5DHSA 1IWPB 3RU7A 5ULLA 1RM3A 4ZCIA 3C87A 3VUEA 3ZU5A 3DEHA 5JUWA 4L1KA 2WF9A 1EDEA 3ICVA 4JR1A 2I4TA 1P9RA 4UFNA 5TJ9A 3UC5A 5CTAA 5J2TF 2OLJA 3HVUA 1ODTC 2XOEA 4H3KB 1PR2A 2Y1OA 2ZJ1A 3EHDA 3LW8A 4JEHA 2YDXA 3R7NA 3CR7A 3LSYA 2L17A 5FPQA 1XTVA 4D9KA 4GOND 1V7CA 2LV8A 3BWMA 4KMMA 2Q3HA 2H4JA 2R97A 3AM4A 3O3OB 5HFAA 1Z75A 1AO0A 1FMCA 3QF7A 1MOQA 1P3JA 4EKNB 3T38A 3RQIA 3R3VA 2XXJA 4P7JA 3W8EA 3DMPA 3JVIA 5KSWB 1N9GA 4MR9B 4UTNA 1VMAA 2GK4A 1AKUA 1D09A 2PRZA 2Q46A 2UYQA 2OM2A 4I9NA 3O5AA 4J0QA 5IVHA 1MVOA 2CY0A 2FW8A 4IR7A 4HDCA 2OBYA 2X9LA 1SQGA 4IY1A 4R0NA 2JIBA 5E3IA 3W05A 4BVFA 4ZDWA 1J9ZA 4JI3B 4DPKA 4I2NA 2VR1A 3FCYA 1KETA 3HY3A 4FMBB 2PRSA 4YV1A 1A2OA 1TLLA 1N33B 2ANCA 4XB6B 2HDNB 3VYRB 1N2XA 3WGVA 1KRXA 2WTEA 1FRVA 3D7SA 2BRUC 2IEGA 4WY5A 1LPOA 4BPRA 3IHWA 3ND6A 4FDMA 3W6ZA 1MDBA 1CB0A 4D9BA 1SA0A 1P9OA 3O92A 3Q0IA 1Y8CA 5L3SA 1WNFA 2UVPB 2A5FA 3KUKA 4PYOA 5LP6C 5TE9A 1WMFA 5CA0F 4J0FA 2ZQZA 3JV7A 1XHLA 2DWPA 1RCTE 3DJYA 3UBMA 3X1JA 1E4YA 2II6A 3U09A 1F06A 2A35A 2B1RA 3X3HA 5CYFA 4A6EA 3COYA 3FMGA 3GVXA 5ADHA 1N32B 3BAZA 1XNQB 4J7XA 1L7NA 2OHHA 4QYMA 4BKPA 2EP5A 4MO2A 2V9CA 3RYIA 5CVCA 5HGXA 1HQYE 5JWOA 4A10A 3IA2A 1M54A 5MN6A 2IYSA 2MSLA 1HDGO 1N77A 1H2XA 1IDOA 1Q16A 3GN1A 1CDEA 4R71A 1ADCA 2YWBA 1O3YA 1REQB 4QICA 4YLEA 4OB6A 3IUJA 1BGWA 2PUFA 4ESVA 2GILA 2AR9A 4HHEA 3DE2X 1HEUA 3BCUA 4GQIA 4P4SA 3AF3A 4REMA 5E6UA 1JJAA 5WRFA 3TQHA 3WR5A 2GWRA 5K99A 4D8TA 1Z5WA 3OCZA 1G66A 4R3NA 4C2TA 4ZK2A 3CH5A 2XEXA 4Y9TA 1I6LA 2ZRNA 1F9EA 2BN4A 2ECOA 5AJVB 3OP1A 3ZHYA 5I4CA 2A9VA 4CDRA 1CJUC 1VYTA 2W2LD 3KB8A 3OECA 2JFPA 3LP5A 1ENPA 4GD3Q 4IO1A 3S3TA 3OZEA 4U2KA 3N28A 4BFWA 5CB4A 1GVHA 1EFRA 4DCJA 1IBRA 1ZXBA 4U1RA 1R9GA 1Q0ZA 1W85B 5C1DA 4FNMA 4HGPA 1X1QA 2PGDA 3D3NA 2FWAA 4AY4A 3VDRA 1TO2E 3P4UA 4FW8A 2FQQA 2EFGA 2H31A 4HZIA 4ZZ2A 2O48X 1EX9A 2V8OA 5C46F 4I3GA 2A94A 4P7FA 1HZZC 1I1HA 3QW4B 4D4JA 1JG6A 4ZT4A 2BMVA 3RS7A 3WMEA 4BE7B 1Z5ZA 2AD5A 4ERNA 4PC6A 3D7NA 5LZ2A 1C81A 3C1UA 3ASUA 5AI0A 1HEYA 4IDDA 2F3RA 1JFVA 1A3CA 2BGLA 4TZKA 1TO1E 2NV0A 4HEQA 3RV4A 4B8ZA 3KCNA 2QPAA 3W04A 1Y3IA 1XMXA 2QF7A 3WL3A 4PCVA 5A6SB 1QRUA 1WW3A 1NBWB 1YQDA 2HJRA 1QKIA 1V8BA 3FWNA 1A8PA 3FPCA 1P18A 3ZXUB 4NAVA 1I2AA 2O3JA 2Q2OA 4Z8XA 3HJUA 1ZN2A 3Q2IA 2E49A 3L02A 4UHKA 1U9IA 4ENSA 4YMVA 5JWRA 1CDDA 3SQDA 3T4EA 4CKCB 3QBTA 4IOLA 1RFGE 4XPIA 3ZV4A 3V1YA 3LA6A 2RJOA 3TNFA 4DG9A 1KVQA 2ZR7A 1N7GA 1QIEA 1XRMA 1EM8A 3AFNA 2C20A 4MYRA 4Q9AA 1S5PA 1YL6A 2E4ZA 2ZRLA 4R5MA 1SK8A 2VJYA 3P45A 5LYJF 4ZAZA 1DUSA 2FEOA 2H16A 4M0UA 2YN2A 3N8IA 3PIDA 4BUZA 4DCNA 4DGSA 2WZQA 2VSQA 2WW8A 1NZFA 4J29A 4IZ6A 2QMZA 2IOFA 1QX4A 1WY5A 1QVAA 1QFJA 3DB2A 4RTLA 5CFQA 4ZQBA 3T3MB 4J3JA 1PJQA 4J1NA 1KI8A 4S1PA 3WGHA 5C8YB 2A1UB 2GHIA 4EVRA 3JYHA 3QMMA 2RKBA 4R83A 1ISMA 4KACA 4DSAA 3F67A 3GNTA 1NI3A 3K9NA 4NBRA 1SUPA 2PX2A 2F17A 1V2GA 4L5AA 5B1HA 2QRZA 3VZCA 4OHVA 4FCCA 4D8XA 3IEPA 3WIVA 4A7PA 4HFMA 5CA1A 1AK1A 2DUMA 4UCWA 3AI3A 1NDHA 4J1SA 2ZEJA 3OOSA 3ZCQA 3JQ6A 4CKEA 2X5OA 5GZ6A 2G36A 2YV5A 2WVJA 5JNVA 3I9OA 1KTIA 4A8JB 2PX5A 4W5WA 4EW2A 2CJXA 1OF1A 5JCOC 4NC9A 4DMRA 1NX9A 2ZIUB 3GD5A 1H8HA 1TA4A 2HRBA 2O2DA 1PG2A 4P36A 3B2EA 9LDBA 4ZIRA 5C53B 1NAIA 4RVFA 1VJ5A 3WE7A 2GTIA 5DCLA 1VGVA 4EW1A 2VTBB 3RJ9A 3UXMA 1ZEMA 2OQIA 4DMMA 5I6DA 4NULA 2BR3A 4CQJA 1YQTA 3FOWA 4DUZB 2W2XA 3PKIA 4QO8A 7REQB 2I6XA 1NW7A 4WZAB 3S1AA 1CVLA 2OV8A 1K9VF 2VRNA 4GH5A 4D45A 3ED1A 4QU0A 3VO9A 3IOYA 4N54A 1YZNA 5AVJA 2V1UA 3AX6A 1L2TA 4OXKA 3RC9A 2DEUA 3PKZA 2GZSA 3GQBB 5KOYA 3OJOA 4EI7A 4MYCA 1T5DX 3RFUA 3LUJA 5F73A 5DN6A 1DE0A 5FUXA 4FGUA 3I92A 3ZS9A 2IH2A 5AKYA 3K1ZA 5FTWA 2W7TA 1D2MA 2SKDA 3ASYA 4L8FA 5IKMA 1MB9A 5MDHA 2ZIXA 4FKMA 2PYDA 3VTFA 4UM8B 5T7BA 3HJHA 2O23A 1JG1A 4ED9A 5B7GA 4MI1A 5HDQA 1GFZA 1XZ8A 1V43A 5AKKA 4P34A 4W7SA 2QTFA 4MYUA 3IVMA 2QPTA 4IXTA 4I6GA 1SUFA 2XT0A 4QFBA 2EZTA 2W4MA 1SMKA 3CH7A 3K94A 4LHSA 2X8JB 1OCEA 4ND8A 3ZLTA 3IV9A 1T3LA 3S1LA 2ET6A 5JQGF 1ZAYA 4UDYX 3SHOA 1J90A 5IHXA 4NP6A 1VPLA 1NLZA 2OL4A 3LQ4A 4K46A 1UANA 3MWGA 3PQ8A 4XDYA 2ZUTA 5MN5A 2ZZNA 2VTVA 2A5LA 5MGNA 2F67A 2W2KA 1O4VA 3KAPA 5LQCA 2CLLB 2AG1A 4NK4A 1AQ6A 1BN6A 1XU9A 2B1GA 4OQPA 1TZKA 1T0UA 2WFMA 2WWGA 1T4GA 4UMEA 5K3AA 4DV0B 5D51S 4RD0A 4L27A 2FP4A 3AGPA 1NUUA 1HDXA 1W34A 3HSYA 3TX6A 4NU0A 4H6WA 3QLVA 1AGYA 1Q95A 3FYTA 4YB8A 4RACA 3EX7C 2HSWA 2GFHA 4PRLA 1BMFD 1GGFA 3USES 4OMCA 3DPIA 1QS0A 1N5RA 3MCTA 1T9DA 3CUUA 5DX8A 3UT5A 2V7GA 3KEQA 3QIVA 2I8LA 2ZTHA 2OZLB 4GXQA 4B9EA 1ZK0A 3M89A 1QX3A 3CSUA 3QKUA 1GZ6A 2A0XA 4MQ5A 4QFMA 2QWXA 1M2VA 3PHGA 2F1RA 1RYMA 3O47A 1TRKA 2JFFA 3FLMA 3NTUA 3N7UA 4CV3A 3E84A 3L43A 4K9SA 1A72A 4X00A 1U0EA 1H0KA 2HIGA 4TS4A 3B82A 1P5ZB 4YAJA 3KXLA 1Q0LA 3WL7A 1U3FA 3TLGA 5IKEA 2O8BA 5I9BA 3TQCA 1KAMA 4N0QA 4JIGA 1HE8B 2LIPA 1TTPB 4MIYA 4Q39A 4NWIA 4R2IA 1QB7A 2IOFK 1PAUA 3HNPA 4MRSA 5BV7A 5DI3A 1SKMA 4CM4A 3OPYA 3R5KA 1JKXA 1OHHA 4HYTA 3GT0A 2GGSA 1KOLA 4WBNB 1SVSA 1LRJA 5JAOA 3ZD6A 1I24A 1PJ3A 2ZJ8A 5CTJA 1X1AA 2Q6IA 4DDHA 4PINA 1Z7WA 1DPGA 3I6ZA 3H5NA 3QFRA 4F3YA 4D57A 5C9ZA 4LOJA 2KJQA 4YJGA 1SBIA 4O2AA 621PA 1U0RA 1H4TA 3KSDO 1USWA 3IOEA 3AF6A 1DS6A 4LXYA 3V8RA 1T6ZA 2I76A 3EQ2A 4JX9A 1KYTA 3S2UA 4BASA 1JE0A 3QLEA 4IYRA 4FDTA 2O0LA 1XNJA 1LV8A 5HA5A 1RAEA 4R2WA 2Q5EA 4L95C 4S12A 3UB3A 2DLCX 1A9QA 5KWSA 2HK8A 1IWBB 1A88A 4HGRA 4I4CA 2PXCA 4I1IA 5CXUA 2Q9BA 1G8AA 3DBVO 2QMOA 4WQMA 1P3Y1 4C6HA 1TVMA 4KGDA 5AHRA 2WQ6A 1NJ8A 2O7VA 3Q6NA 1SUBA 1TJ5A 2VJNA 4RCYA 3P8ZA 4BU1A 1JEDA 4ZVQA 2PS9A 4GWLA 5KNCH 2ZWOA 4Z4FA 5G40A 4R6WA 1VKRA 2EFCB 3ZHQA 1K9SA 4AY2A 5REQB 1QGAA 2VYCA 3F3KA 2M6KA 3FDIA 1G1AA 1P6UA 3K8YA 4DKJA 3L8CA 5KI6A 4NMWA 3UHJA 1MV8A 3M1LA 1SCIA 4QYSA 1IHOA 1Y4SA 1LLCA 1RVV1 2QMHA 2QTNA 3E58A 4G09A 1CBUA 1FP2A 1QHHB 3DW1X 1VC2A 3PNQA 4EK9A 1JFSA 2VA8A 3HYNA 5L3ZA 3EMVA 4EB3A 1GSAA 3A4MA 2F9LA 1NP7A 3CRW1 3D2BA 4LPSA 4PSKA 5ALFA 3TTSA 2C4WA 3HKCB 2Y0PA 3FHCB 2ZTSA 3OM1A 4HRAA 4XR4A 2FGJA 1SUIA 2CMFA 1PGNA 3IT3A 4L6CA 5E6RA 2ZYHA 2Q0SA 3DUWA 5FTMA 3E6AA 1AO3A 4QEKA 3UT6A 4B48A 1C1HA 4S1OA 2QNIA 3G2KA 5T6BA 1Y9AA 3WC4A 2FE4A 4XIIA 1ZOPA 2ONZA 1QYVA 4R2HA 4H27A 1W87A 1ODLA 2NXCA 3WY9A 3LQYA 1IM8A 3A4LA 3HC7A 3QE4A 4HMOA 5KBYA 3BWBA 3E1GA 1E77A 3ZXIA 1CUWA 1UBFA 5CMLA 5B1EA 2XZLA 3LRPA 3E9EA 1Y1RA 4A6XA 1TJYA 2XGSA 1WPRA 3TCKA 3WK8A 3UATA 3ZDYB 1NYLA 1NBAA 4Y2VA 2P9GA 2HCTA 1TK2A 3ORQA 1ZRMA 1M7BA 2XOKA 4F3KA 1ORHA 5KREA 3C5CA 4RH0A 1YVPA 1DJMA 4C0BA 3IEMA 2I33A 3EVAA 1NI4B 1ATZA 1RRFA 4U9HS 5IYZB 1BO6A 4ARCA 1H3FA 3SC4A 2JLWA 3RFTA 3R5HA 3KUCA 4OXYA 1BD4A 1NXPA 3NAMA 5LPNA 3GFBA 2Y1XA 3DH0A 3VR3D 4DA4A 3BB3A 1Z06A 2E6KA 4RABA 3ZCUA 2J8ZA 2PTGA 1KDRA 3K0AB 3FYDA 1VL0A 2W00A 3FHTA 3P9NA 4TTVA 4F9FA 4ZJUA 3V4RA 5A9TA 1Y5LA 2V58A 5IPFA 3VKHA 3AKDA 3FR8A 4IIXA 4U2FA 1E89A 1RR6A 2R2GA 1FRZA 1Q15A 2HJWA 2O54A 2BBSA 5HE8A 3VU1A 2KM1A 1BW9A 4XSGA 3LMKA 2PU5A 3LQ1A 4JSRA 1CS0A 3ICEA 2EX0A 1ECCA 2JBHA 1VL6A 3DAYA 1CR2A 1SIBE 1U5CA 1YXMA 2QTBA 3TNLA 5B7PA 1K7YA 2OXRA 1C8KA 4MPTA 1NUTA 1ZUNA 2A59A 3B78A 4QU9A 5KNBH 4RK6A 1ECPA 1GKYA 2IPXA 1SC9A 2FSGA 3KIPA 4Q1DA 2J87A 1TKCA 2PZFA 2HSJA 1JS1X 4Q1EA 1KH3A 1SCDA 1QG0A 1WX1A 1Z2EA 2WSMA 3PC8C 2WIBA 4H4CA 4LY0A 4R7GA 2AK3A 3IB6A 1CEEA 1W44A 1ORVA 2TYSB 3ABSB 3FRHA 1NNEA 1MFPA 5CJPA 1PR1A 1VLQA 3IA7A 4KWHA 3AEUA 3DNFA 2OAEA 1Y7LA 3TE7A 2NZJA 3K30A 1AGNA 2AX4A 1EJ6A 2YUIA 4FDAA 1XEAA 3IFSA 3SNKA 1J8DA 2X7XA 3EBOA 4PR3A 1MV5A 2VRCD 3JQGA 5C3MA 3OVMA 4KQCA 1BXRA 1YDWA 3R7FA 1CLEA 4G6ZA 3FVQA 1GFIA 1HORA 1Q12A 3QELA 4UNNA 3SU8A 3VTZA 5JS8A 2ABWA 1GRRA 3NBKA 2B35A 5LZ9A 2AS0A 2ACVA 1DUIA 2CXOA 2R8EA 3M6VA 2P5TB 3FFWA 3M3PA 4OP3A 3IELA 5ER6A 2PGOA 4ZI7B 4L76A 2L19A 3TUZC 3CEHA 1TAQA 3LBFA 3TDKA 3OM8A 3TVYA 1KI1A 3BRWA 4ZP1A 2WQ7A 1S6YA 4WFKA 2HIHA 2FF7A 1LUAA 2VSOA 3SEFA 3ETHA 4LY9A 2LPMA 1L9KA 4D8YA 1SVNA 2XQGA 1JHMA 3LWNA 5DTQA 5AQ1A 1B3RA 2ZBRA 4US2R 5JXIA 4B81A 3SIXA 2NTVA 2BEWB 4I5GA 4BNDA 2VDWB 3QUQA 5EFZA 1NVAA 1PJCA 3LDUA 2EBHX 2OPBA 1KDVA 3D3JA 5D3MB 5K0ZA 1ZI8A 3A11A 1AC5A 1G16A 2DQKA 2NU8B 4DY6A 1E9FA 3H97A 3EMDA 2DY1A 1PFYA 1FW6A 3GA0A 2HLNA 1XDSA 3H2GA 2DPXA 1QNFA 2J48A 5BURA 5HIMA 5TT0A 4JHLA 3VGJA 2B4RO 3DEAA 5IH3A 1GL7A 3DTVA 1WXDA 4BB9A 1JKFA 3IVXA 4JB8A 2H18A 4R1QA 2RGNC 2IPMA 4PRYA 3RWBA 2PFKA 5B64A 5I47A 5HIJA 2NZXA 2E5LB 4LZNA 2O2IA 2C8LA 5SYNA 3HJFA 1OH5A 3INNA 4CL3A 1KZGB 2O2JA 4B31A 1YTUA 4MW1A 1P4AA 4B75A 4CR7A 5AVXA 1GUZA 2PUJA 2BGUA 3DFFA 4HRVA 2Y1KA 4YY3B 2IYTA 4DJJA 3ZV5A 1T1GA 2F8LA 2OOKA 1QH9A 4OXXA 1J22A 3U0VA 2JGDB 5AMXA 1Y1SA 4W1SA 4Z86A 1JQDA 4R8MA 5J2TB 4ZO9A 5FB3A 1Z28A 1FVXA 4YN3A 3HR4A 1USIA 1JEEA 1SCAA 1H2HA 2YHAA 1QDLB 3IB3A 3SFTA 3HBLA 1SKYE 3UVEA 4DCPA 1NN0A 4JP2A 4YRNA 4L3WA 2V6IA 3TMAA 5KKCA 1RADA 5L9AA 3C14C 5F1YA 3DXFA 5SY4A 1QM5A 2EWVA 3DONA 4QQFA 3OOWA 4RA6A 3CZ4A 4E7OA 1ZSYA 3W8DA 1XYYA 1RHKA 1V9CA 3F7OA 4OB7A 5AVUA 3GY0A 4LV5B 1E2JA 2GYYA 5EUQB 4K8RB 4AURA 4EG8A 5FAKA 1LBIA 3P97A 5J5CA 3VO8A 3MOSA 2XXAB 4G37A 3RKRA 1G18A 1DDGA 1NULA 2JFVA 4IIVA 5TDHA 3C3MA 4B47A 4YRPA 2ZAYA 3CLRC 2D0IA 1HLGA 5D85A 3DVRX 4PX9A 1NU6A 2PJUA 2E4YA 2ZYVX 4H16A 4Q21A 1K0UA 5KU7A 1QV7A 3GRRA 4O2RA 3HZZA 4BLPA 3T3OA 1R12A 4MUEA 1KSFX 2I7VA 2DVMA 1RAFA 5B1YA 5K9ZA 2H5IA 4GLOA 4IGAA 4YH1A 2HQRA 4PBRA 5BVGA 3UAXA 1IJBA 1FJHA 2JKZA 3L04A 3U4IA 2CMHA 3VNUA 3M1YA 2GJSA 4JU9A 4ZHQB 4QHSA 5A0VA 2XCTB 5M3BA 4MX8A 2PS1A 3LRXA 1P3DA 4IJWA 1TQ6A 1B6RA 3MQFA 2Q4DA 4JT2A 3FRJA 3GLIA 4HDSB 2JEZA 3HB9A 1RVDA 1Q0TA 4MINA 4V1CB 5K45A 1ZOOA 2B4TO 4L6AA 3TZBA 4D41A 3CTPA 4Q3LA 5G41A 1ZA2A 3HRKA 1KGDA 2PZ8A 3IS3A 1VJCA 1AD2A 1V25A 2RHOA 2FQWA 1KO5A 1FB5A 1UKZA 3TQTA 3LPLA 4JP3A 3SJAA 4FB5A 1CUAA 1LX6A 4JLJA 4JT9A 1YA8A 2IYNA 4Y2GA 1WG8A 2BWJA 2J5BA 4LFBB 1E3WA 2QJRA 4ETMA 1F17A 3KUXA 2VDKB 4L85A 3A1TA 3MRXA 4LF9B 4FJ0A 3RF7A 2ZJ7A 4MYHA 5DRYA 3MXOA 2YVUA 4B4VA 1QYIA 1N3BA 1CVIA 1B4DA 1LU9A 4GXTA 1H1LB 5GONF 4YMWA 1EGHA 4NF2A 4JC4A 1VPTA 1ZK3A 1GXSB 3K09A 2PEZA 5HZHA 3AVTA 2WAYA 4XH9B 3UAOA 1XSEA 2PZBA 3MBOA 1Y80A 2YHSA 2ZUDA 1JFFB 5AKEA 4ZTBA 5KYKA 2IYVA 4YJFA 2EYQA 4WNIA 3T9FA 2F1OA 4HUQA 5JVDA 2CYBA 1CNEA 1DU4A 4KQ6A 4Z4HA 1UADA 2I22A 1E9SA 2IEZA 5I7EA 2ZFUA 1JN0A 1QC5A 2NXNA 2V5AA 5DNDA 4BP3A 4BUCA 3QBEA 1KHTA 3KBBA 4PSVA 3U39A 1FDSA 3PNLA 3IUQA 4KLNA 1NLFA 3ZJUA 2BBTA 2MTBA 5JMPA 1S01A 2VS1A 3JWIA 1KDTA 4HVTA 5FULA 5CB4F 1Y8QA 4XDZA 1DTWB 2IZZA 3A25A 3NNSA 3OZTA 5G4LA 2WUVA 2RGRA 1VLMA 3N53A 4N6NA 4RF4A 1Q7BA 4CKWA 5DLYA 1D1SA 4FLEA 1IUNA 4CKBA 3W2FA 3P9YA 3LFTA 1N5DA 5CW2A 1P2GA 5EXPA 3LY9A 1XVUA 4DG5A 2LVBA 3RU9A 1HYQA 2D4HA 1F8FA 1U8UA 3MBKA 5BPHA 2YY5A 3RJMA 1T1JA 1CF2O 1RAHA 4L08A 2WJVA 1OKKA 2R1UA 3F8SA 2LDXA 3HXLA 4CMEC 4CQMB 2J3MA 1XRPA 1GKUB 1H94A 3FDZB 1ZD2P 2JVKA 5DTIA 4FFVA 3QVMA 3C3JA 1QK3A 1XPJA 3I53A 4H77A 2ZYTX 1L5KA 4IKEA 5FHRA 3ZH2A 4FC6A 3WGYA 4DREA 5LQRA 4GI7A 3EG5A 4ZJZA 1LSOA 1NPYA 4L3VA 2FTKE 3RAFC 3E5MA 2YZMA 5D87A 3EQZA 1M75A 1YAHA 5H83A 4C2UA 5ALDA 5AVYA 1FMTA 5D7NA 2HF2A 2C4NA 1RWNA 1E66A 1K8ZB 3AY0A 3HKDA 4BDTA 3R23A 4MV9A 3FUUA 4X85A 2XVXA 5JOQA 3PL5A 2DWCA 3T06B 2LZ0A 5AVKA 1H8HD 3OTIA 3QGMA 3WSTA 1M2HA 1DC3A 1U98A 1LBSA 3FKQA 4BO9A 4YV7A 2P3LA 3AM3A 3R5FA 5L3QB 1QE3A 3F4KA 1E0AA 2DH6A 1VL5A 2QZJA 4L16A 1ZIXA 2PBLA 3H5IA 3TOXA 4LOKA 4IVRA 4RF3A 3GAFA 2PGNA 1PQUA