4F45A

Crystal structure of human cd38 e226q mutant in complex with naadp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
253
structure length
249
Chain Sequence
b'EFWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase 1
publication title Crystal Structures of Human CD38 in Complex with NAADP and ADPRP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 80
structure length 249
sequence length 253
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4f45A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f45A02
1QLHA 1Z6ZA 2W2LD 4E5YA 3QWIA 2ZYDA 4JN6B 1KVQA 4BO0A 1IPFA 4IMRA 2I5PO 1LLQA 3DHEA 3QHAA 2JAHA 3ZWYA 1DC6A 4E0BA 3MOIA 3JCZA 4K6FA 3FRJA 1GQYA 3BXXA 4K28A 3AM3A 5AXCA 1SNYA 3JQAA 2O2SA 2CUKA 4FGWA 3BMOA 3GNTA 3VC7A 1DJQA 1D1TA 1PR9A 1KC3A 3W4IA 3W4JA 4EEXA 5JFOA 4A26A 1F0YA 1A72A 2ZTLA 2BHLA 1YB4A 3AY7A 4G2NA 2GASA 4IDCA 1NQOA 3BMNB 4GWKA 1J5PA 5G0SA 3ZV4A 5FFFA 4AJEA 5EERA 2HMWA 4BNZA 4CM9A 4ONEA 2X9NA 1YGYA 4I9NA 2YDYA 2Y67A 2GO1A 3AFNA 4LMPA 4DGSA 8LDHA 4KMSA 3QWHA 3GN1A 2DPHA 3AUTA 2JCYA 1HZZA 3GT0A 3BMQA 2CD9A 4DIBA 3WYEA 1CETA 2JD2A 2H6EA 1U3WA 2PFGA 3TOXA 3NT4A 3GEGA 1NFQA 2PH3A 1ZJZA 2D2IA 3WIEA 5TF4A 2QX7A 4BB5A 2B69A 5CEEA 3JQGA 1LBEA 4WEQA 2AE1A 5I8WA 5JCXA 1PGOA 3UCEA 5IDXA 1M6WA 4CQMA 3ABIA 4YRBA 4E13A 3ADPA 1NP3A 3WIDA 4IDDA 4J90A 1DLJA 2GCGA 2DTEA 1OI7A 2D5AA 2V65A 3OHSX 3JQ8A 3RJ5A 1YQDA 2ILTA 3PJEA 3VZQA 1QMGA 4BNTA 2OP1A 4R41A 3EMKA 1WDLA 3OIDA 3JQ6A 1FJHA 3PEFA 1YWGO 3QP9A 4FGSA 1LSJA 1LRLA 4OXYA 3RWBA 1G6KA 2VZ8A 3QIVA 1AHHA 1WPQA 2WD7B 4I9HA 3GAZA 1J49A 4F3YA 5TIIA 1U8FO 4IDFA 4CJXA 3MTJA 5L4SA 5TRTA 3V1UA 4KTVE 4A27A 1T25A 1KEWA 5F1PA 1EE9A 1XU7A 3H7AA 4K1LA 4CM5A 3W8DA 1I10A 2Y0EA 2X0IA 3GEMA 1H9AA 3EZYA 3KYBA 4R1UA 1XLTA 4NR0A 4RF2A 1LX6A 1H6BA 4YA6A 4JNKA 1KBZA 3P19A 2YHIA 1T1SA 1N1EA 2CVOA 5I9MA 2I6TA 1ZMTA 3QSGA 4CM7A 3ULKA 4XRRA 1Y8QA 4N7RA 1Y81A 3INRA 5K6AA 5BT9A 5CDTA 2Q99A 4DPLA 1DJNA 3WB9A 5GZ3A 1M67A 3JD0A 1UJMA 3EK2A 4YAEA 2IZ0A 4JJIA 1PZEA 4QX6A 5T8KC 2VUUA 5L7TA 2PGLA 1Z45A 2AG8A 1JWBB 2C20A 4J3FA 3F47A 4DLBA 1ZK3A 4MKXA 3TL3A 3DBHB 3GGOA 4PLCA 1LUAA 5F5LA 3C24A 4YBZA 3KSZO 2E6UX 1JLLA 4CM3A 2QG4A 2FSVA 5JYDA 1QSGA 2VN8A 2W98A 5TJHA 5JCJD 1LEHA 2I76A 3BTSA 1Z82A 1ZMOA 2Y05A 4Z0TA 1GEGA 3UH1A 4WCFB 4UVIA 3BHJA 3UFXA 3ZWCA 3U4HA 5KJ1A 3DL2A 3ZWNA 3GMSA 4AJKA 1K2WA 4IDBA 4D79A 3WGYA 1HSZA 3AOEC 4Y9DA 4BQRA 1Z7BA 2GR9A 3I9NA 1ADGA 3D64A 5LCXA 3TZHA 5FWNA 2DUWA 4OXKA 3GN2A 1VL6A 1AE1A 4UEOA 3JQAD 4KUEA 1C3VA 3PHJA 1HLDA 1RM0A 1ZK0A 4H15A 3GHYA 1C1DA 3PHIA 4DREA 5L95A 4FDAA 1UH5A 2EW8A 3OFSA 1GDHA 2DUUA 1ORRA 1HE5A 2IXAA 3GDFA 1B3BA 4AJ1A 4NU6A 3GNQA 2FR8A 2NV6A 2FR1A 3R3JA 3JQ9C 1DDOA 3OIGA 3SLGA 4YT2A 2I65A 3PWZA 4M55A 1E5LA 1ID1A 1E77A 1HSOA 1QRRA 1EUCA 4MOWA 2GF2A 3D4NA 5IAAA 2I67A 1LDGA 3JTMA 4AJ4A 4CM9D 1BVUA 1R15A 4NFYA 4JJGA 4J0FA 4RPJA 3WGTA 3UCFA 4XJTA 5C7OO 5I9LA 4A10A 1O94A 2C07A 1I5RA 4E6PA 3OP4A 1Y7TA 2FHSA 3VAZA 4GVXA 2UUOA 3DZBA 5GZ6A 4BNGA 4CLDA 4YRDA 1B8VA 3PQEA 2CY0A 3Q2KA 5KOIA 1VE9A 4PVDA 2PV7A 1C0IA 1LNQA 5G4KA 1ZSNA 3IKVA 5T5QA 2WEKA 1ENPA 5G0VA 3AOGA 3BMOB 5EMHA 4N5MA 4UREA 3N7UA 4OH1A 1U7HA 2SCUA 3BTVA 5DCUA 4CLRB 2Q50A 1HYEA 4W7HA 1GZ3A 2VZ9A 1GUYA 4CQMD 2B83A 2X5KO 3HFSA 1D8AA 1M66A 1W6UA 3H5AA 2NM0A 2OZPA 5IDYA 1EZ4A 2NVBA 3GMDA 4IUYA 3U0BA 4URFA 3ZNNA 3SEFA 4W99A 3ITKA 3V2HA 1G0OA 2UDPA 4FFMA 4KQXA 3F9IA 3PXXA 4Z3DA 1U5CA 2J6IA 1PGQA 4DVJA 2ZYAA 2E49A 3BA1A 4GSKA 1YL5A 2ZJ0A 4CV1A 1A7KA 3QRWA 5JAIA 4E4YA 4LMRA 1K6JA 3RBXA 4AJPA 4L4SA 2FZEA 3E8XA 1H93A 3BMQB 4IY1A 4BNVA 1LSOA 4GLOA 1N8KA 1J6UA 4M1QA 1CQJA 3HDJA 3I23A 4CQLB 4TVBA 5DBFA 3NDRA 3OM9A 1N5DA 1V3UA 2VHXA 5JAZA 3CMCO 4H7PA 4WPGA 3V2UA 4QFDA 4H16A 2AQIA 4MVJE 3C8MA 4IBOA 3IUSA 4U5QA 4B7UA 1TXGA 4DUPA 4E3ZA 2ZQYA 5G0UA 4ZU3A 4BOYA 4DL9A 4GX0A 1Y8RB 3TZKA 2PK3A 3WTCA 2VTDA 3ZZNA 4Q3AA 4YPOA 2WYWA 2I9PA 3H6KA 1A9YA 1DHTA 1NXQA 4YTEA 1TA4A 2ZK7A 2NSDA 5JC8A 3DZJA 1E6EA 5I7SA 3JQ8B 1JKJA 3NV9A 1NQ5A 5AXAA 3KEOA 5JMWA 3RFXA 1M2WA 3AUSA 3M6IA 1ZSVA 3HWRA 4RLHA 3E5RA 1XHLA 4KTTE 1I01A 3GY0A 1EDOA 2AW5A 2X86A 2Q1SA 2AQ8A 2O4UX 2IYOA 1DIBA 3NJ4A 2Q2QA 4PLTA 2P5YA 2FWMX 4QXMA 1KEUA 2GZ2A 1NPDA 4NK4A 3E82A 4BKOA 1WDMA 3RVDA 4FB5A 3OETA 1XA0A 1QYVA 5GY7A 3K31A 3LYLA 3CEAA 1BXKA 3V1TC 4QO8A 1EUZA 1BMDA 1R12A 2Y93A 1ADBA 3VDRA 3ZHXA 1SCUA 3ONFA 2HK9A 2JHFA 1JWAB 3RU7A 1YKFA 5KNLA 5HRUA 5EESA 4EDFA 5A04A 3P5SA 4KDEA 5IJZA 2FY8A 2X1HA 4J4HA 5A02A 3N58A 7ADHA 5T8KA 4CMIA 1ZZEA 4BNFA 3G3EA 3E5MA 3L4SO 1XQ1A 2EGGA 3H9GA 4II3A 4TWRA 5BR7A 3FCOA 3DBLB 1UP6A 4BUCA 1PJ3A 2BI7A 4IQ8A 5MDHA 1W73A 4PLFA 4YWJA 3WMWA 1DRVA 3HB4X 4WUVA 3MJTA 3HJAA 3DAPA 4O6VA 1M75A 4FFOA 5A1TA 5KJ6A 3DXFA 2VOJA 4KUHA 4LK3A 2DM6A 3PHHA 4CMJA 4FQ8A 1FK8A 3OBBA 3VZPA 2OL4A 4H3VA 5L51A 3EC7A 4OSPA 5EQFA 4DPMA 1B14A 2PGJA 4XB1A 3AOEA 3DZKA 4BO1A 4ND1A 3C7DB 3UW3A 4UUOA 1YQGA 4XYBA 1R6DA 3DBRA 4EBFA 4BL5A 2CSUA 3ZU4A 3FR8A 3KVOA 3MJCA 4ZVVA 2R2GA 3A06A 1O89A 1T2AA 2EKLA 5A05A 4P4NA 1CF2O 1PSDA 2J5KA 1Y9AA 2BGKA 4XR4A 4XIYA 4BKQA 3HFGA 3W8EA 2W8ZA 1QV6A 1U1IA 3LC7O 1GY8A 4WLEA 4CM6A 4P38A 1BW9A 1P1JA 4D45A 3HHPA 4CPDA 4ZN6A 5CDYA 1UXIA 2B0JA 3C7CB 1GEEA 3GPIA 3ETEA 3RD5A 3G79A 3TJRA 5L7WA 1C0KA 3P2OA 3GH3A 2YFHA 4A2CA 4ROSA 4WGGA 4EYEA 4Z3KA 1U28A 4CMEA 1L7DA 2W4QA 4D3FA 1UR5A 2X8LA 5L3ZA 4PZDA 2HMTA 2G76A 3U4IA 3CZRA 1U7TA 2Y1CA 1N7HA 1ZEJA 3NGXA 2VRCA 2Y1OA 3R0IA 4DBZA 4R51A 4JP3A 1A9ZA 5KWEA 3PVZA 4IS3A 2PR2A 2EGHA 3UN1A 4BO7A 4OIMA 2JFHA 4MVJP 3L6EA 4QTZA 3IIEA 1CEQA 4PG5A 1NM5A 4RLSA 3HG7A 1EQUA 1NPTO 3LF2A 3I1JA 4A7PA 1L1FA 2VNSA 5G4KB 2HAEA 4X54A 1VJ0A 1RM3A 2B4TO 2Y0CA 2B36A 4G5HA 2OBNA 1ZIDA 4ND2A 5F21A 3JV7A 4ID9A 4LRTB 2EEZA 3DFZA 1PJ4A 3WX0A 4BO4A 4R1NA 4TROA 2EJVA 4N54A 2NVUB 3GRKA 2ZATA 3SBOA 1ISFA 5KVCA 3MJEA 4L74A 1UXKA 1ISGA 4B4OA 1DEHA 1HDCA 1ISJA 4CLEA 4Q3DA 5FF9A 1DAPA 4RF3A 4NFHA 4NZ9A 3AU8A 4J9UE 1DIAA 2C54A 3U4DA 3IKTA 2EWMA 2HDHA 5C3MA 3WSWA 1MG0A 1T1RA 4R4JA 3RC9A 3ZWPA 4J91A 2QW8A 4BGIA 3ANLA 4J16A 4M8SA 1D1SA 3WR5A 5ADHA 2YY7A 4BO5A 1JKFA 1B3RA 1TT5B 5KVSA 4J2OA 3MJ4A 4LGVA 1JAYA 1R4NB 5G0WA 1L7EA 1EBUA 2YHUA 3KV3O 5F1OA 3DZHA 4E21A 2V6MA 2Z95A 3I3OA 4RPGA 2ZTMA 1UZLA 4OXNA 1E6WA 5H81A 5B37A 3IDSA 4NQZA 4RV9A 4AICA 3I9MA 5JC1A 4K9DA 5EL0A 4BGVA 1T2DA 2FRDA 3T4XA 3H9QA 1RJWA 2OBYA 4MJLA 5TLSA 4I5EA 4S1VA 1YONA 4MIOA 2V6GA 3NDJA 4FD3A 4MVJM 5FI3A 4D43A 3RAJA 1OBFO 2H63A 3E18A 5JO9A 2ZB3A 4DC1A 5IDQA 1N1GA 5CG2A 5U9CA 1KVRA 4ZQFA 3ASUA 4NPCA 1ENZA 4GQAA 3E1KA 1KVUA 4J2HA 4IJWA 4ND3A 5DCYA 2YYYA 2PGDA 3VH1A 2GNAA 2P91A 5J23A 2O3RA 1W8DA 3I83A 5TS3A 2D59A 4DBVO 2C2YA 2FN7A 4UAGA 4P4GA 4BQPA 5DP2A 1BWSA 2VUSA 3JSAA 4J7XA 1V3VA 2DFDA 3I4FA 1WWKA 2B5WA 2HJRA 1GV0A 2DC1A 1NTOA 3ZWAA 1PGNA 2B35A 3ZW8A 4CLOB 5AXDA 2AEMA 1VLLA 2JHGA 2RIRA 3K96A 4ND4A 3WYCA 3O03A 4EJ6A 2WE8A 2E82A 3WICA 3PJDA 4R9SA 2BGMA 4W82A 3V8BA 4MP6A 2A35A 1C0PA 3QWBA 1HF3A 3LT2A 5H82A 3B1JA 3RI3A 1NQAO 4O63O 4HFMA 4KP7A 2CNBA 2V6BA 2RHRA 4A03A 4CMIB 3G17A 1KIFA 5CPBA 4L4RA 1C14A 5L45A 1X7HA 1PJTA 3PTZA 1E1LA 4GSLA 5COBA 3RCBA 3WGZA 4J4TA 1X15A 4R16A 3MTGA 5H83A 4NDNE 1BRMA 4OKIA 4IZHA 3OEYA 1O5IA 3JQCA 3PLNA 3SJUA 4RL6A 4Q3BA 4WOJA 1P1FA 4PG4A 3T7EA 5DZSA 1WDKA 4B4VA 1O95A 1F17A 5FI5A 1GZ4A 2VHVA 2WSBA 3WSVA 3ZHYA 1GADO 1DFHA 3ZN2A 4TZKA 3F5QA 1MGOA 3K73O 3MOGA 1ZO8A 1BVRA 3HADA 5A06A 4QQRA 4FOSA 4IINA 1R0SA 1GQ2A 1Q2XA 2P9GA 1ULSA 2ZTUA 3UUWA 4YQZA 1LXCA 3JD4A 2VRCD 1E3SA 3LVFO 1MX3A 3R6DA 3JYQA 4DXHA 3UICA 2Y1EA 4JGBA 5EQDA 1ZXBA 2CDAA 5G4LA 1OC2A 2EW2A 3DHYA 1NWCA 3EZLA 3PYMA 1V0JA 3H9UA 3TN7A 4GH5A 3VPSA 3ZU2A 2JKVA 4ITUA 3L4BA 2QHXA 4E32A 4EITA 4XEHA 5ITWA 5CDSA 2QYSA 1PS9A 3GLQA 1KOLA 3ITDA 3TNLA 2HRZA 3PJFA 5ES3A 1W4ZA 4J1QA 4CLHA 5DCWA 4UVDA 2JCXA 2HCTA 3PYLA 2VOEA 4RVGA 4IIVA 3QJ5A 4YAIA 4MKRA 1LSSA 2Q46A 2Z1MA 5K9ZA 4YJHA 2IYPA 4B3HA 4CM8B 1C0LA 1QORA 5A3JA 2EP7A 3OQBA 5C7LO 1ZW1A 3A14A 2R00C 1ISHA 3RUDA 4AJLA 1N2SA 1MUUA 5JY6A 5AQ1A 3E9QA 3FPCA 3COSA 1GYQA 2PZKA 2B37A 1PWXA 4PGFA 1PGPA 3NRCA 1R16A 1C1XB 4S3MA 3K8ZA 1KERA 4PLZA 4OL9A 3WGGA 3ZWVA 2GRAA 4YRAA 1IULA 3JQBC 1E3WA 1YOVB 4GPD1 1VL8A 4YAGA 2ZB8A 5HS6A 3WFJA 4JLWA 1GZ6A 3ENKA 3F4LA 1MLDA 5A9SA 1A5ZA 1X0VA 3KLMX 2EKQA 5DOZA 4PRLA 2H5LA 3SX2A 1X1EA 3C1TA 3EHEA 1EE2A 2WMDA 2X58A 4OMUA 4WASA 4UVEA 5CDGA 5HTOA 4W9NC 4YT8A 4R01A 1OAAA 2YW9A 4JXKA 3VZRA 3IL2A 3OMLA 3C1AA 3PFFA 4GVLA 4IGFA 3H4VA 1A27A 4XDYA 4RVFA 5JAMA 1K3TA 4FW8A 1WMAA 1GUZA 4OQZA 1DOHA 4CM4A 4DQXA 4E5PA 2VT2A 3Q11A 3Q1LA 4IIUA 3ZNPA 2J3HA 5L53A 1Z75A 3GK3A 2VWQA 5JLAA 4FN4A 3NDIA 1HL3A 2F1KA 5JPIA 3JYOA 2Q1TA 2W2KA 3UAGA 4RPLA 2ZCUA 4C7KA 5A5EA 2AEFA 2QIOA 1U4OA 4IDAA 3RKUA 3R3SA 4NBVA 1ZK4A 4WJZA 4DIFA 1MXHA 2B5VA 5ILGA 1JKIA 3JYLA 1P77A 1F06A 1I2BA 3N74A 2HU2A 5GZ1A 1AXGA 4FFRA 1YS4A 4Y6PA 4CMHA 1SO8A 4BMSA 1SEVA 4I8XA 3PK0A 4LSWA 1SC6A 4OHUA 1ENOA 2PTGA 3PRJA 4MPDA 4Q39A 4AJJA 3WJ7A 3CXRA 4CMAA 4D3DA 1DIGA 1BTOA 2V6FA 3Q9NA 2CMDA 1EVIA 2DBVO 1O8CA 1T4DA 2R6JA 1VSUA 2X0JA 3EDMA 2Z1NA 4XQCA 5HWSA 3JQ7B 2VUTA 3RC7A 2NU8A 5CFZA 1XDWA 4MIYA 1RWBA 3TOZA 5AVOA 3ZU3A 4ESOA 1Y6JA 2P5UA 2X9VA 2QRJA 4N18A 4CLXA 4WCDA 1YBMA 4OJNA 1N7GA 1S7CA 3GDOA 1KC1A 3FTNA 4U7WA 1R4MA 1FXSA 1E3JA 1YDEA 3M2PA 1JTVA 3KYCB 3LLSA 1YJ8A 3O8QA 3P2YA 2ZKLA 3S1LA 1CERA 4KZPA 1AGNA 2FR0A 1JA9A 3DOOA 4Q3EA 4IPTA 3DZGA 2OP0A 4TKLA 4Y67A 1FDTA 3DB2A 4LISA 4DC0A 2BFOA 2JFFA 3E9MA 4UUPA 4WOKA 4E30A 1ZNQO 2O7SA 4HFJA 2V7PA 1R0LA 1SB9A 2JD1A 1RM4A 3ONEA 4K26A 2UUPA 4QUKA 2J3KA 5GMOA 1ZCJA 1LA2A 2C7VA 4ZRNA 4ALIA 3D7LA 3OJ0A 4BNLA 3RU9A 3JYNA 4MP3A 3FN4A 3RFVA 1ADCA 2VWPA 3NYWA 2O3TA 1I3KA 3HB5X 1E7RA 1EFKA 4FJ2A 1H6DA 3H9JA 1SOVA 2FOIA 1SB8A 4WE3A 3ZGYA 2VHWA 3GFGA 1PQUA 1PJ2A 3PHLA 2BFAA 1MA0A 2TMGA 3DMTA 1KY4A 4HKTA 3V1YA 5EN4A 3TRIA 3PDJA 4RJTA 1CWUA 4L0QA 1N9GA 1A7AA 1SBYA 1X7DA 2JJYA 3Q6IA 3ZV3A 3L9XA 3WMXA 4OOEA 1PJQA 3NTRA 4DLLA 4TRNA 4XA8A 1HE2A 5IZCC 1P74A 4BKUA 2O3UA 1DC4A 5DP1A 4QECA 4DA9A 1ZJYA 4GGOA 2XF8A 2HSDA 1S6YA 1Q0HA 1UUFA 1QR6A 2RH8A 3ON5A 1AUPA 1PQWA 2H1SA 3FR7A 4MIEA 4QFCA 3PIIA 2O3JA 2YV1A 1GPDG 3ICCA 4XKJA 1JVBA 4I9UA 5ENDA 4BIIA 1R0KA 1YBVA 4OOFA 4N5NA 2UV8A 2E48A 3JQAB 3IMFA 5K0ZA 2PKRA 3FHLA 1P1KA 2F00A 4Z0HO 3HN7A 1EFLA 1UDCA 3WYBA 2AA3A 3P7MA 4YR9A 5KCZA 1Q1NA 2XXBA 1PR3A 3DC2A 4FOOA 4J49A 4L76A 5LDHA 2C5AA 4IJVA 3H3JA 2X5JO 1O9BA 4L75A 1H9BA 2G82A 2HK8A 3K6JA 2AMFA 2DBZA 1IY8A 1EQ2A 2ZYGA 3HE3A 2WM3A 3FWZA 3V2GA 1GYRA 1XWFA 2C82A 3ZCXA 3KTDA 1I2ZA 5LDGA 1B2LA 1UZNA 2G17A 2PLAA 2FP4A 2DU8A 1ZK2A 1ZVMA 4EZBA 1Y5MA 2PZMA 2OORA 4YJHB 2GZ3A 2UYYA 1SOWA 4E5KA 1MG5A 4J6FA 3JQBA 1B8UA 4CODB 1T2EA 4RDHA 3UF0A 4CL8A 2HLPA 3WXBA 2O23A 1KYQA 2GUGA 1HYGA 1P1RA 1WNTA 4R3WA 4WECA 3LLVA 1K0UA 5CEFA 5DOVA 1QLJA 4HADA 1UZMA 2BRUA 1Y5RA 3LF1A 3CPSA 3JQGB 4RDIA 4Y6RA 1XELA 3HQ4O 4GMFA 4CQMB 5TT1A 3W6ZA 1NPYA 2GGSA 3W1VA 2C5EA 3OJLA 1IPEA 1YDWA 3LT1A 3Q3CA 4RCVA 3M1LA 3HN2A 4A73A 4BO3A 1M6HA 1O0SA 3F4BA 3KSDO 4IS2A 3GRPA 1VPDA 3GOHA 3FBGA 1AN9A 1ZFNA 3D3EA 1P3DA 3GZNA 5BSEA 2QZ9A 3ZH2A 1QXSA 2DKNA 2E4AA 4I08A 2X23A 3X2FA 1LDBA 3O38A 1Z73A 1PU2A 4BGUA 1PWZA 2JD0A 3RC2A 1HXHA 5KJCA 4E33A 1H6CA 2VNAA 2VTEA 1V9LA 4P4LA 3DFUA 1PJBA 2EHDA 2LDBA 3GUYA 4XRGA 2G1UA 4IGEA 4EJMA 3GQVA 3D4PA 2OFPA 2UVDA 2X0RA 3I6IA 4Q3NA 4Q9NA 2PZJA 2DAPA 5TX7A 1WLYA 1SPXA 2GSDA 5T64A 3CKYA 1R66A 1QV7A 5CP8A 3VDQA 4F45A 4TSKA 3AW9A 2NVWA 2YHIB 3JQFC 4HX5A 5F3RA 1ONPA 2J8ZA 3WGIA 3A4VA 7MDHA 2GDZA 1Y8QB 3KYDA 2D1YA 3DOJA 2P4QA 3PIDA 4BS9A 2O7QA 3IC5A 4WCFC 4DTIA 2PY6A 1XIVA 4KOAA 1BXGA 4D3SA 4BNKA 1P1IA 4BO6A 1IYZA 1BSVA 1YXMA 3G0OA 4J1TA 4WLFA 2C59A 5ER9A 4FC6A 3VPGA 1U4SA 3GR6A 4GKVA 1IZ0A 3BTUA 4XD2A 4HV4A 5DBGA 4IM7A 4PLGA 4NJMA 5BSHA 5C5IA 1V6AA 1FDSA 3WNQA 1YQXA 3KETA 2DT5A 1ZEMA 4RF4A 4J1NA 3ZHZA 2A4KA 4TVOA 2DFVA 3WQQA 2VZ0A 4RZHA 1PJCA 4GWGA 1HYHA 4QSMA 1Z74A 5CPFA 4DPKA 1I8TA 2AE2A 1QYCA 4BNIA 3WQSB 4OQYA 5TNXA 5IXSA 3MEQA 1MFZA 1YE3A 1NR7A 2D3TA 4ALJA 1H5QA 4CMCA 4ZICA 2QQ5A 3O26A 3OH8A 1TLTA 3KXDA 2H9IA 3JQ9A 4RVDA 1W0CA 2P9CA 5THQA 1NASA 1U8XX 3B20A 3H2ZA 1C1DB 4CMGA 4INAA 1YJQA 2X0NA 1NBOA 4CV3A 1ADFA 2HK7A 2C29D 2FPIA 3L07A 5IZCA 2O4CA 1DFGA 2FZWA 2ZTVA 1NWHA 3OJEA 3OSUA 3SLKA 4EUFA 5JW6A 5HS4A 3BMNA 3GVXA 4WLOA 4I1IA 4YXFA 1TVEA 3GF4A 3W8FA 1LDEA 2WE7A 3T4EA 3EGOA 1NAHA 3WWZA 4ZQGA 4IJUA 5BNIA 1CIVA 4XYLA 5HM8A 1QYDA 4YEDA 3DBVO 4R5HA 1CJCA 2G0TA 2HKIA 5ENVA 4RO0A 1XR3A 4TQGA 4PIVA 3GUCA 2RHCA 4E5NA 4EGFA 3GG9A 5DN9A 2OO5A 4KWHA 2GLXA 5F5NA 3GVPA 4EUHA 2EIHA 4Z9FA 2WYUA 3HDQA 4RVSA 2IEBA 1I36A 5JBIA 2DQ4A 2OMEA 4OSOA 4BNYA 1MC5A 5ILOA 3DR3A 5BSFA 2HMSA 4E5MA 4XX0A 2IE0A 4PFJA 1XQ6A 3ROKA 1WMBA 3MZ0A 1BDBA 3M2TA 2YQ4A 5FYDA 4NNJA 3GGPA 1F14A 2ZB7A 1BDMA 4E2WA 3RUAA 4F6LA 1P1HA 3W4KA 9LDTA 5B4VA 5U4QA 4BKRA 4ND5A 1B26A 2CZCA 5HA5A 2Z5LA 2O3SA 4HP8A 5KKCA 2OXIA 1FDWA 3DHNA 1EVJA 4TRRA 4WLNA 5I7EA 3DONA 4BMVA 5JDIC 5CAEA 1X7GA 3OA0A 3PGJA 4DQVA 3VKUA 1IHXA 5JNLA 1H94A 1P0FA 3QY9A 1D3AA 1ZH8A 3WGOA 1Q0QA 2CF6A 2JL1A 3IJPA 2DBRA 4PN3A 1WP4A 1AHIA 5G2OA 4U0JA 2WD7A 1RKXA 3D0OA 3ZU5A 3CMMA 4M89A 3B6ZA 4BB6A 3TSCA 2TMDA 3TDKA 1PJLA 5CEJA 1BGVA 2O50A 2DTXA 5DNAA 3D5QA 3U49A 3K2EA 4BMNA 3ROMA 1U2DA 3D4OA 2AXQA 1JDJA 2YDXA 1ZBQA 4NBRA 3W6UA 3ZHBA 2G5CA 1H0KA 4B8ZA 3BHIA 5JSFA 1DC3A 3F5SA 1PZFA 2VWGA 1Y9EA 3I9JA 3LSYA 2BFPA 1LC0A 1BHSA 1F12A 4RPHA 1VKNA 3L9WA 1XCBA 1UXJA 4AL4A 3EVNA 5JE8A 3K2BA 4O5OA 1ONNA 4RVUA 4YAKA 1CYDA 4XYGA 1DBVO 1E7YA 5A4DA 1MFPA 3F3SA 4R1TA 3CZMA 3LT4A 3PFWO 3QVWA 1GU7A 1ZXLA 5TSDA 4NBTA 5BSGA 4TRMA 3C85A 5L9AA 3DZIA 1YH3A 3WNVA 3VOSA 5T67A 1E3IA 4NI5A 1DHRA 5CHEA 3OQ1A 1QKIA 3KLPX 4FS3A 2VWHA 4TRJA 1R37A 1GD1O 3FNFA 2HQ1A 3FSRA 2Y0DA 3RJ9A 3DBHA 3BYZA 5IFLA 1DXYA 1GL3A 2IZZA 4CM1A 3WDSA 4J7UA 1OMOA 1E3EA 1P44A 1OOEA 3MCVA 4BHTA 4TZTA 1A4UA 1T2CA 3A9WA 4NFSA 1E1MA 1Q7GA 4TMFA 2I66A 2PH5A 4OM8A 4WCFA 3HNPA 4DMLA 3PPIA 1KVSA 3X2EA 4XCVA 2JAPA 1I33A 3ETGA 4HBGA 4LCJA 5DT9A 3TWOA 1GR0A 1YVEI 3TZQA 1LQTA 4YJGA 5KVQA 4BKPA 4IDEA 2C0CA 3AI1A 1B8PA 3AM4A 4FJ0A 1X0XA 2FMUA 1BXGB 4ZQBA 4E2XA 5I9NA 3D3WA 4YYZA 1JN0A 5JYEA 3GAFA 4AJOA 3LDHA 3RUEA 3S2GA 3PZRA 3G1UA 4PG8A 2BF7A 2NU6A 3IJRA 2HO5A 1VC2A 4FIZA 4RQUA 4XR9A 4YACA 1UDBA 2Y99A 4BV9A 3WQRA 4A0SA 2GERA 4ALMA 4KUGA 1U9JA 1E1NA 1I2CA 4CV2A 2RAFA 2XAAA 3RFTA 3Q9UA 3M1AA 2WYVA 2Q2WA 4XGNA 3GVHA 5A3VA 3DBRB 1UP7A 4MVJF 2YQ5A 5ER6A 2Q2VA 3UKOA 2CVZA 5COAA 3F1KA 4YQYA 3KM0A 1JW9B 3NTQA 1MB4A 5B4TA 1ULUA 4BNXA 1ZSYA 4JQCA 3H9EO 4ZJUA 1DFIA 1PJSA 1PL8A 1WAMA 4ALNA 4HFRA 1A4IA 4PZCA 4MKZA 4YT4A 2JFGA 3BZUA 1NVGA 2PWZA 1GPJA 3CUKA 1E7MA 1SAYA 1E7WA 2WDZA 3VH3A 2C7GA 1BW9B 2DVMA 2IEDA 2Y68A 4MINA 5AYVA 1IUKA 3B1KA 4CLRA 1FF9A 1JU9A 4HUJA 5IXYA 4UVHA 2O48X 1I3NA 4KQWA 4N5LA 4U8GA 2XOXA 4D46A 4D44A 1PIWA 3F1LA 4LSMA 3PI7A 1LLUA 1HLPA 4ZA2A 2A9FA 1P45A 3INTA 4RPKA 8ADHA 3FF4A 5DULA 2J3JA 5IN5A 1FMCA 1PZGA 2IZ1A 2JCVA 4NK5A 3SJ7A 2FSSA 3CIFA 2ZIZA 3PYXA 5BNTA 1XKQA 4RGBA 4R69A 3VVBA 5THKA 1Y1PA 4D42A 4UUMA 4JK3A 3PQFA 3LC1O 2CVQA 2Q45A 3I9LA 1SMKA 1YL7A 3NTOA 4LVUA 1DSSG 2QRKA 4BGEA 1TT7A 1HDXA 1KEPA 1IB6A 3BIOA 1D4FA 4PRKA 4CQLA 3ZNOA 1E7QA 3GVIA 1WXDA 4AJ2A 3PDUA 3TL2A 3EUWA 1U5AA 6LDHA 3OICA 4AFNA 2GN9A 3QA9A 3AUAA 1DRWA 3OEWA 3WGHA 3U3XA 4C4OA 1CQIA 2VQ3A 4LRSB 3VPXA 2J5RA 3I4CA 3C1OA 1IOLA 3B1FA 1ARZA 2X7HA 3DWFA 3OJOA 1Y8RA 3MJSA 5JDIA 1B15A 1K6IA 1P33A 2D8AA 1UP4A 4FFLA 4D7AA 5KKAA 4CR7A 5C7IO 4YCAA 5L40A 1PGJA 2GYYA 3ZNQA 3OA2A 4GL4A 1OZAA 4HNHA 4ALLA 4B8WA 3ASVA 6ADHA 1PTJA 1TI7A 1NNUA 4QT0A 1E92A 1MP0A 2X4GA 5JXWA 3E9NA 2GN8A 2UAGA 1I24A 3QE3A 5L7YA 1EVZA 2X22A 4MO2A 4NHEA 1XG5A 4XQ9A 5TQVA 3FBTA 4LN1A 2HRBA 5LC1A 3RROA 1P0CA 2Q49A 1O6ZA 2A92A 1HKUA 4UUNA 4R68A 1ML3A 4E31A 4Y98A 3JYPA 1E5QA 1PL7A 1V3TA 4JBHA 4Y6SA 3UCXA 3UHAA 2NTJA 3DTTA 2NTNA 5A9RA 3PLRA 5IZ4A 3DAFA 3I52A 4PG6A 4IMPA 1VI2A 3L6OO 5B1YA 3MWEB 5JDCC 3CTMA 4J7CA 4MVJG 1HT0A 3NT2A 1YBAA 3JQEA 2GZ1A 4YJFA 1HDYA 3L0DA 4XZ3A 4D0SA 1UXHA 2BKAA 1ZKMA 4NH4A 3S2IA 5ITVA 3ANMA 1JVSA 3DMYA 3TFOA 4WEOA 1Q7BA 2EV9A 3JD2A 4BO9A 3TF5A 2EG9A 4FCCA 1OC4A 4CUKA 3DBLA 3DTYA 1JAXA 1E0DA 4I5DA 1F8FA 3GFBA 3H5RA 4NU5A 5TC4A 4LW8A 2PD6A 4P8RA 3QWAA 4MP8A 2VYNA 4HNGA 4XGKA 1Q0LA 4EJ0A 1PQPA 4RORA 4PLVA 1GCOA 2EXXA 1LRKA 4YDRA 3KEQA 3S2FA 1WW8A 4NBUA 1HE3A 3GG2A 3TZ6A 3VVCA 4PLWA 1K6XA 2Q1WA 4FPXA 4WNCA 5KIAA 4WKGA 3WLEA 5TJ9A 3G1TA 3GVCA 2NQTA 4L8VA 1H2BA 3WLFA 3E03A 3IUPA 4CUJA 4DRYA 2P4HX 4RVHA 2E37A 1K89A 3QVOA 3ZV5A 1T4BA 2VHZA 2BFMA 2BMAA 3KRTA 2FPPA 4PVCA 1CRWG 1LLCA 3JQDA 2NTVA 4YJGB 3OQ6A 3OECA 2AQHA 2VT3A 4MVJA 3ZWWA 3VPHA 1E7SA 1QYWA 3AWDA 1ONOA 2J5QA 1KVTA 1ISMA 3O9ZA 3D3WB 2QRLA 3GDGA 1PX0A 3AJRA 1HZJA 1GFSA 4O59O 5AXBA 3O4RA 1RYEA 3H3FA 2GN6A 3K5PA 2QZZA 1D7OA 2W90A 5B4UA 3NAQA 2Q4BA 3Q2IA 4BNNA 3GPDG 1E3LA 3C3XA 4QEDA 3ZW9A 3UXYA 2IODA 4GX1A 5IG2A 4DLAA 3I5MA 1FDUA 1RPNA 3FNHA 4BV8A 4FFNA 4G65A 1NFRA 3K30A 1EEHA 3VPFA 5ICMA 4CMEC 5TGDA 5IDWA 3U9LA 2NUAA 4ZRMA 4UULA 1IE3A 2LDXA 3I6QA 4DYVA 3WOHA 4HFNA 4HY3A 2NQ8A 4C7JA 3RUIA 4BO8A 5EPOA 3E6AA 3MJVA 1CDOA 2OOSA 3ANNA 3FNEA 2R00A 5JO0A 2IXBA 4FC7A 1V8BA 1NFFA 1EK5A 1Q7CA 1T2FA 5I8ZA 2CDBA 3WGQA 2J3IA 2PD3A 4EUEA 1GTMA 2PA3A 1BXZA 3QV1A 1DIHA 2NVUA 4CV0A 3LU1A 1PEDA 3FPLA 3L6DA 1MC4A 2OUIA 3D1LA 3PJGA 3ADOA 1U3UA 4GGPA 4RQTA 5EJ2A 3SXPA 2PKQO 4XYEA 1GCUA 1H6AA 3KZVA 2YJZA 3AK4A 4TKMA 4W7IA 4PG7A 4MVJH 1EVYA 2DTDA 3QWFA 3OF2A 1WZIA 1YB5A 4UEJA 3ZI0A 4I5GA 1MV8A 1UDAA 3QVTA 3AM5A 3NJ8A 2RH4A 3FD8A 4NMHA 2YV3A 5DBIA 3GHHA 4W9NA 1NYTA 1QYXA 1ZK1A 5U1PA 3WJAA 2XPCA 1NQTA 2CDCA 1E3WB 3EY4A 4M87A 4OKNA 4GAEA 3IAHA 3KB6A 4EW6A 1SZJG 2VCYA 4ZGWA 1TT5A 4XIJA 5A9SB 4YAJA 4NG5A 3VH2A 4OYRA 4YVFA 3UVEA 1XGKA 1R4NA 3VTFA 3HDHA 1HDRA 1KETA 1ZUD1 1B7GO 1PS0A 2NACA 5IF3A 1EUDA 3AI2A 3LT0A 4IJKA 2PD4A 3VH4A 3GGGA 1QP8A 4WLUA 3TPCA 5FEUA 4AG3A 1EBFA 1GAEO 2ZJ1A 4BNMA 2ZCVA 5JAQA 4B7CA 5KTKA 3DZFA 1LDMA 3K92A 4A5OA 4QO7A 3BHMA 4CM4B 2ET6A 2I3AA 1JQBA 4L4XA 3VTZA 1X13A 1U2GA 4ZQHA 1VM6A 1F8GA 1LRJA 2B4RO 4B3IA 2Q1UA 4O0LA 5CG1A 3IP1A 2BGLA 4AJNA 3FI9A 1PL6A 4JBIA 4O1MA 3MWDB 4E12A 4JROA 2W2KB 2BH9A 2YUTA 4IQ0A 4HXYA 1DRUA 4R3NA 5DF1A 3KO8A 4Y8VA 3RBZA 3ZWMA 1DPGA 3KOUA 5EIOA 1XYGA 4ALKA 2D4AA 2OHXA 4GX5A 3NKLA 3RUCA 5F1KA 4M86A 1VL0A 2VYND 1RYDA 1Z7EA 3LK7A 3ST7A 1VJ1A 2PZLA 4DYDA 4JBGA 1ENYA 4BNUA 3TZCA 3T7CA 3HSKA 4U6SA 4BO2A 5JDCA 2HJSA 1NHWA 1V35A 2NU9A 4NJOA 4CLOA 2HMUA 2VYVA 3RBVA 4DWVA 3BTOA 4FFPA 5DDIP 3LZ6A 5JMPA 4E2ZA 2A94A 2VHYA 3NGLA 3K9QO 3PGXA 1P9LA 1YL6A 3BMCA 4D0RA 4IXWA 2YV2A 4M49A 4B4UA 1E1KA 2AHRA 1LU9A 3GEDA 3JD3A 1R4MB 4FJ1A 2XXJA 4J9VA 3RQSA 4YJFB 3EVTA 3PWKA 3QLJA 4WLVA 1BG6A 3H65A 3O8QB 1VJTA 4DMMA 1IZ9A 3UGKA 5BNFA 2Y1DA 4MVJD 3KBOA 4F6CA 4I5FA 4Z9YA 2YFQA 4GBJA 3FTPA 1M76A 1SEPA 5HBRA 4YJDA 4LCEA 4J43A 9LDBA 1IHYA 3E48A 4UEKA 4CMBA 4LVCA 1J0XO 3AI3A 4ZQEA 3VZSA 2D0IA 1LQUA 2NWQA 1KEVA 1LI4A 4II2A 2QYTA 4U6QA 1HRDA 2WD8A 1DIRA 4PZEA 4IZIA 5I7VA 4CMKA 3S2EA 4ILKA 2PKQP 1GV1A 4L73A 2Q3EA 4FBGA 2C2XA 2HMVA 2BI8A 3GZ4A 3IS3A 5G0TA 5B12A 3HUDA 3PWSA 3IP3A 4OAQA 3WBBA 3FWNA 4M54A 4IQGA 5I7FA 1H2HA 4BNJA 4OO3A 3Q0EA 4J1SA 3VHRA 1HDZA 2EKPA 3OIFA 4D41A 1I0ZA 2GD1O 4CL3A 1N9GB 1XSEA 4EEZA 3SC4A 1OFGA 3JD1A 1ISIA 5JY1A 1XEAA 1VSVA 4Z9XA 2VRBA 4RF5A 2YZ7A 4L9RA 3WG9A 1WZEA 2FPGA 3ICPA 3KUXA 3DDNA 3TFQA 4B79A 3NEPX 1GUFA 4ZHSA 3HDYA 1LJ8A 2W2LA 3QQPA 3L4BC 3D5TA 4XB2A 3V5NA 1I3MA 4RZIA 1NR1A 2AG5A 3F46A 1LTHR 3FNGA 4CM8A 3NX4A 2RCYA 4IDGA 1E6UA 4KDFA 4GLLA 1LDYA 3U62A 1EMDA 3ZV6A 5T57A 4CUZA 3LC2O 3A28A 1DO8A 3PQDA 3CINA 4U0KA 4XGIA 4IXTA 5C37A 3RUFA 1IL0A 2DBQA 3GA0A 3ROPA 4CR8A 4DQUA 3AFMA 3DEYX 3QVSA 1C1XA 3DQPA 3GC6A 4PLHA 4UVGA 3S55A 2D5CA 1GQQA 1I3LA 2EF1A 1YOVA 4Z0PA 4YT5A 3WWYA 1U3TA 4MVJI 4B4WA 3KHUA 1HDOA 3ENNA 1X1TA 2P9EA 4GX2A 2RBEA 4BVAA 4WNIA 4AJHA 4R5MA 1A71A 2O3QA 5A9TA 4DIOA 1EDZA 5L4NA 2GPTA 2IDZA 4MDHA 3RUHA 1LDNA 2DPGA 1I32A 5A03A 3L77A 3GNSA 4GMGA 2EJWA 2WJPA 2Y1FA 3SVTA 2WWRA 4PLPA 1B0AA 4B7XA 3ZWXA 2I3GA 4FR5A 1I30A 1VKOA 4BNWA 4EI2A 1LLDA 4FSHA 1GYPA 2X6TA 1NHGA 2AQKA 4CR6A 1XU9A 4YB8A 3ZWBA 1LSUA 2P68A 3TQHA 1HTBA 5MGBA 1DC5A 1HEUA 3KSUA 3IQDB 5ICSA 3AU9A 3DO5A 3ORFA 2B4QA 1T24A 4GKBA 4KWIA 3U09A 3SC6A 1DLIA 1G0NA 1TB4A 4JX8A 3QW2A 3RIHA 3PHGA 2HUNA 3G49A 1YB1A 5COQA 1MXFA 1T26A 1UXGA 3ONDA 4AVYA 3I9OA 1B16A 3ZDFA 4OGWA 2NNLD 3HZZA 3F6YA 2PNFA 1YRLA 4GI2A 2AEJA 4ZD6A 4AJIA 2DLDA 4JP2A 4Q3CA 4J4BA 1DAOA 1AXEA 2POQX 3RASA 3S8MA 1UAGA 3ZWOA 2VYVD 1HWYA 1G1AA 3EYWA 3GZNB 2EP5A 1PS8A 2O2YA 4XQGA 1KY5A 3IOYA 3JQ7A 1J4AA 3H8VA 4JCOA 3WBFA 5T6BA 2NLOA 4J0EA 3WFIA 3STHA 1P31A 3R1IA 5L4LA 4XYMA 1RM5A 4HWKA 1YO6A 5TT0A 5K6AC 2ZQZA 2EERA 3AY6A 3DOCA 1QG6A 1X14A 3RC1A 4XJSA 3KYCA 4K6CA 2CF5A 5EINA 3BAZA 1NVMB 2X5OA 4P22A 4BNHA 1WVGA 3JQFA 1NX6A 1NVTA 4PLYA 2Y66A 3NT5A 4R9RA 2GN4A 2X9GA 4WK6A 5CDUA 2I99A 3WTBA 3PP8A 3AY3A 1HDGO 3LQFA 4XDZA 1VRWA 1NAIA 1PZHA 2BD0A 3B70A 5IN4A 4JIGA 2Y1GA 3CH6A 2CFCA 3CSDA 4NIMA 1N92A 3ROQA 4XQEA 3H2SA 3PZBA 4PCVA 3I9KA 3H5NA 1LC3A 4G81A 3VKVA 1EK6A 3CE6A 3NUGA 3A1NA 3WS7A 3KYDB 2BLLA 3RSHA 4B3JA 3QVXA 2ZB4A 1UAYA 4E2YA 4NBWA 3RKRA 3AUUA 2NADA 4W6ZA 4R54A 5JS6A 1HE4A 3U5TA 1FDVA 3ETDA 3BMCB 4XWYA 2Q4EA 2P2SA 2NU7A 4Z6KA 1K5HA 5KJEA 5AOVA 1TEHA 3EW7A 3INGA 5KJFA 5BQFA 1HETA 3UOGA 3C7AA 4NJMB 1U3VA 2BELA 4R1SA 3DAGA 5A5FA 2OGUA 1DB3A 5KVVA 3EAGA 3OJFA 2IRWA 3DMTC 5JCJA 4JJFA 4F46A 2WTBA 1KS9A 4W4TA 3U4CA
chains in the Genus database with same CATH superfamily
1Z6ZA 3OVMA 4D9IA 1GTRA 1VBFA 4J0HA 3AKZA 2FCRA 4G89A 4NCIA 3P9YA 4YJ3B 1WRBA 2A1UB 3S2SA 1QC5B 1L5WA 4DJEC 1LK7A 2FPLA 2MSWA 2RGAA 2FV8A 4TTIA 5SY9A 3KQHA 3G59A 1XALA 2FTKE 1RKQA 1DG1G 3D0KA 4GD3Q 1VTKA 5JVDB 3EPHA 1WOYA 3FRJA 4K28A 4DJ5X 3CGGA 3GDWA 3O93A 2BT4A 5BV7A 3BULA 3WO0A 1Y7IA 3HFRA 5ADVA 3BMOA 1E2GA 2ZBRA 3KZOA 1PR9A 4RFSB 1KC3A 2O2DA 4LOKA 4MHOA 3V3TA 3W4IA 3O3MB 2LD4A 4S2EA 4INJA 3TL6A 4ZOQI 5IVDA 2ECKA 2AOXA 2ZTLA 1C4XA 1QR2A 1Q14A 3QXJA 3UY4A 3AF4A 4WBXC 3RRMA 4L8FA 2CVHA 5ILQA 2UXCB 2IVZA 1J7JA 1XRJA 1GNRA 1XQYA 1NQOA 2Z8YA 3FGOA 4JSYA 2CXQA 1G8AA 4HWTA 4BZZA 4GWKA 1J5PA 5FFFA 4KHPB 1KQNA 2YV4A 4AJEA 3VNVA 4YYEA 4CKWA 2XQVA 1FFWA 1Z16A 3MWGA 3OU7A 5JWHA 4L85A 2X9NA 2Z8ZA 3EQ9A 3NP7A 4I9NA 2YDYA 3HVRA 3P94A 3IUNA 1P3JA 2Y67A 4AKEA 1ODIA 1AGRA 4DGSA 1G3UA 2YICA 4LWZA 4RFLA 3GN1A 1A2OA 2V98A 1Q84A 2JCYA 3WZLA 3FUTA 4DLUA 3GT0A 3BIJA 4B73A 1O4WA 4UHCA 4RQBA 2O05A 2CHEA 1JDZA 2WNHA 1JIXA 1K5DA 2GZRA 3GYBA 3ETNA 2VJCA 3OT4A 1Q74A 3ICEA 1WULS 1TYCA 3SHOA 1DC8A 3FKSD 2JJ8A 1R3DA 3MINB 4GOJA 1KDRA 2PH3A 3T1HB 2D2IA 3O6VA 3I8XA 5JROA 2NPFA 3PXGA 2K87A 3WK6A 3ANYB 4C0LA 4IOLA 3BSWA 5ERXA 1R6VA 1LBEA 2D0DA 5DIZA 5HCIA 4CQMA 2FF5A 3NASA 3ABIA 3K6KA 4MVXA 4UDXX 4YRBA 621PA 3ZXSA 3WIDA 3F2IA 1EKXA 2R6DA 3SJAA 4QL3A 3KB8A 1J8DA 2FUG6 3JQ8A 3H1FA 3RK4A 1GAJA 1B73A 3EQ6A 3K7EA 3VC3A 1XN4A 1U8EA 3EVDA 1XYVA 1XF1A 1YQDA 2VP6A 3EWNA 1WUKS 2CVFA 2O2CA 3PJEA 1QMGA 4BNTA 2VAMA 4R41A 3L7CA 1ZH6A 4IDHA 4ILEA 3VO8A 4O2AA 4X3PA 2BMFA 2HGZA 4OXYA 1H2RS 3RWBA 4NYIQ 3KTAB 3VU8A 4EP1A 5BV1A 1U80A 1T36B 2YN2A 2WD7B 4I9HA 4ETMA 5BUZA 1TYDE 2WFAA 1T8PA 4ZYZA 4MUEA 4ZVTA 4CEHA 1Q91A 1A9QA 1YNSA 2JARA 1VLVA 4IIGA 5AVQA 3CTPA 1U8FO 2O8CB 1V1MB 4O4HA 1G38A 1V1RB 4LDRA 1Q1AA 4WZZA 1HYBA 1ZL2A 5H1YA 5TRTA 1T25A 1KEWA 1G8KA 2ZVPX 1TMYA 3K1AA 1ACJA 1DXHA 3IAM6 4IXMA 4LVNA 2PWPA 3LW7A 1I10A 1SZPA 2GSWA 3CCCA 2CXSA 1GRVA 2W2TA 1I0IA 2Q0SA 3FDXA 2GBGA 2D2EA 4US2R 1XLTA 1L9XA 2C9MA 4A3SA 1CEYA 3AL0C 2B3DA 1KBZA 3FYTA 4IVNA 3DV9A 3ZBPA 2CVOA 2LCFA 3TDMA 4JI8B 1JJIA 3QSGA 4KMRA 3EEQA 1YC5A 3NJRA 4XRRA 3NBKA 3ULKA 3W9BA 5FUMA 5ILOA 1QVAA 1P6XA 1WDTA 5ED0A 4A92A 2JFXA 1HRKA 5K6AA 3H87A 2FW0A 4JBLA 4M0DA 3RSCA 4DA8A 4MUHA 2Q99A 4COKA 3UPUA 2XRYA 3ZE1B 3WB9A 4DPLA 2CNWD 2C9CA 2OD9A 3K72B 4KSYA 3HYNA 5LDDC 1UJMA 3NORA 1WXEA 3EK2A 4YRGA 5HZGA 3LI2A 1YFZA 4HSGA 4D5EA 5T8KC 3NGMA 2PGLA 4EUKA 1O9HA 2IHKA 5JJCA 3FUWA 3IMEA 4DG9A 3ZD7A 2GTIA 3F8WA 3DLHA 4J3FA 5DI9A 3BKXA 4UZSA 2B0CA 1LS1A 1CB0A 1LI5A 1E60A 2ZYTX 4HDNA 3HV2A 4OJKA 1KOJA 4H17A 2XIQA 3VJRA 1JLLA 3QUTA 4BTLA 3CZ4A 3T99A 4PYMA 5KU7A 3IQWA 2C7RA 2D13A 4YV1A 5JYDA 4KQKA 3LG2A 4N12A 1TE2A 2W98A 1E89A 4HZUA 2I76A 2LE0A 4BLQA 4N82A 4Z0TA 2HF2A 1A76A 2ZVDA 4CF3A 1TM7E 4U63A 1QVVA 2VFAA 3O8NA 3EOBI 5BOSA 5IM4F 1PJZA 5HKLA 1UZUA 4ISBA 4FFWA 1JFFA 1GFZA 3DBOB 2AI2A 2AXPA 4BQRA 2TSYB 3T8YA 2VF5X 1TDJA 2PL3A 2GR9A 3OZCA 4GR9A 1NW3A 1BQ4A 3BZWA 4HDMA 3D64A 3JALA 5DLYA 5LCXA 2C4UA 2DUWA 3SYKA 1T10A 2NZUG 4QIHA 1AE1A 3PQ3A 3PNSA 4U4AA 5HE9A 1C3VA 1FSGA 1PR4A 3IUQA 4Y2GA 1ZK0A 2ZVJA 3QFHA 2DB3A 4KBGA 1EG2A 1RU3A 1UH5A 3LLMA 4AJ1A 1Q57A 2AJCA 3D6VA 4WOPA 5EAIA 2FR8A 4PW0A 1W44A 1YV9A 1THGA 1DDOA 1BCRB 1Q0UA 3AF0A 3BSYA 4KODA 1KSGA 4BJ3A 4FW9A 1T35A 4MWDA 2I67A 4BMZA 4MGIR 1R15A 1T9GS 3OIUA 3QF4A 5A1JA 1QH8A 1ZGHA 2ZETA 3LXXA 3T34A 1Z6GA 1TA9A 3HCCA 2JGEA 4R84A 3EZFA 5EWMB 1BWQA 4A10A 5I9LA 1GG9A 1ZONA 2HRRA 5B53A 1I5RA 3JZMA 3OP4A 1XX6A 2M1ZA 5JPDA 2FHSA 4ZXPA 2HNBA 4GVXA 1JGTA 1PT6A 2VAVA 4BNGA 4KWTA 4CLDA 3F5DA 3WBKA 4Z49A 4A6DA 2JGIA 2GPSA 2V3WA 1FYXA 5ALFA 1QGOA 1C0IA 3JRWA 2IZ5A 4LHYA 2R96A 3PQ6A 1ZSNA 2IHTA 4NZYA 3IKVA 3M6LA 4D02A 4IIFA 4OMFG 5CM8B 1PNTA 2OO3A 3P4YA 3HC7A 2FZKA 3W2FA 4QHSA 1AUOA 1XC7A 5FPYA 1BE0A 2Q50A 3B7GA 3F5FA 1EP9A 4IOMA 1PG5A 3G2OA 4W7HA 2ZR0A 3G9TA 4CQMD 1A9RA 4FYKA 1P5RA 1JR6A 2V7XA 5F4ZA 5IU6A 2NM0A 1L7MA 3PFBA 2FJPA 2Z2JA 5C8DA 1NA5A 1QFMA 2Q7XA 1RPJA 3N8IA 4EGCB 4QG3A 3UK6A 3V2HA 1KH2A 4M1KA 2H1CA 3EDYA 1HK7A 2AFIA 4FFMA 5P21A 4F0JA 1Z4PX 3F9IA 3ESBA 4Z3DA 4DDMA 3EX7C 3GRVA 1PGQA 1QP4A 3A8TA 1NE7A 3OE4A 1C8KA 2YWXA 1V37A 3V4SA 3A6JA 2C4KA 4GM0A 2C2ZA 3QRWA 2NUTA 4E4YA 4N9QA 2CN1A 4AJPA 3E7XA 4LZAA 3ZDXB 5FBVB 2IYNA 3BMQB 4IY1A 3GI1A 2C31A 2R6ZA 1LSOA 3AUJB 4GLOA 1K4KA 4XIFA 1U3CA 1M2JA 1YMVA 3AJ9A 4QODA 4EB3A 5G4KA 2F1JA 4TVBA 1D5CA 5DBFA 4BWVA 1W7AA 4CFYA 3RBAA 5HZMA 4O4IA 5D7NA 2VHXA 4ROTA 3E27A 5C51B 2NO6A 4X1YB 3REOA 1D04A 3D02A 3N8HA 2AQIA 4MVJE 5B6JA 4KLZA 3GJRA 1XZLA 4G01B 4PFQA 4U5QA 3PQ2A 3T1QA 1TXGA 3M5DA 1CQIB 5EP2A 2NT4A 3WGJA 2XCTB 4BOYA 3KJGA 2MDTA 3PGVA 4MZXA 4N7JA 2FEKA 4WZBE 4BFSA 3VU1A 3R3WA 3ZZNA 3E3LA 4Q3AA 3D6JA 2JRCA 1TUEA 1N2GA 2C2WA 1A9YA 4YTEA 5KEIA 1PDVA 3QEOA 3DZJA 1U02A 2L0XA 4JQSA 3RS4A 4HUQB 2ZE5A 1I3CA 4G97A 4U9IS 5BN3A 1RQ7A 1GPWB 1SR8A 4GP6A 1TJ3A 4Q18A 4RM3A 2V54A 4RLHA 1T8WA 1U0FA 1BC5A 3E5RA 1UMKA 4K9NA 3A4NA 2I1LA 1IXZA 2J4FA 3IB6A 4KTTE 4ZI5A 4JGGA 3GY0A 4PC3A 2PBZA 3MC1A 4Y2PA 4IICA 1DMSA 2Z6AA 3KNZA 1D0SA 1D9ZA 1ZM7A 3IO3A 4LHWA 4WH0A 2GCIA 1YFJA 3Q6NA 2FHPA 4ITVA 1K27A 1NVEA 1YZGA 2FWMX 1N2HA 5AW5A 1KEUA 3IEXA 4X85A 4NK4A 1XJQA 3H5WA 4DAOA 1XMVA 1OQAA 1DEOA 2FWPA 3UKDA 1QPGA 3E82A 2QWXA 1WDMA 2X14A 2WQ6A 2IU6A 3HJFA 3GUUA 4DIKA 1VHDA 1XN1A 2I7VA 3DMFA 1IHUA 1R6AA 2KYRA 1NXVA 4WCVA 5GY7A 4FB5A 4NYJQ 2QTBA 3CEAA 4K9MA 3LTNC 2P8JA 1T8UA 2CFSA 3FDIA 2VHEA 2ZULA 3R0QA 4WERA 4RWEA 4LTDA 1ADBA 3VDRA 5KQLA 5KOHB 3ONVA 3ONFA 3U60B 1YCGA 2Q6LA 2WIAA 1ZVVA 3EXFB 4ZPXA 5KNLA 1UK7A 3EZGA 4ZOLB 3OUUA 3ZXIA 3P5SA 4IH9A 2W4IA 5IJZA 2GD2A 3UAXA 2X1HA 4O2BA 1GAXA 2VDRB 7ADHA 1ESNA 1A69A 1BO6A 1IHDA 2R5FA 3G6KA 4CMIA 2X1VA 3E5MA 4QUHA 1XQ1A 4D0LB 5HP4A 1L8OA 2X5NA 3I64A 4QEZA 5EHNA 4PSCA 4X95A 3QJGA 3RVNA 2JDIA 5IH3A 2I34A 4WXRA 1JAIA 1W76A 5BR7A 1UP6A 2HV9A 4QQKA 2HSZA 2JIOA 1KARA 3V4ZA 4C2UA 1ISRA 3C8HA 1M1ZA 4HSEA 3WMWA 4WUVA 4YGXB 1YS1X 4J8PA 3ZZTA 4O6VA 5ELXA 1M75A 4KLCA 4DMKA 5KJ6A 4KUHA 3DT8A 1OF1A 2SHKA 2YIMA 4PANA 2DM6A 2H1WA 4AZ3A 1TD1A 3B51X 1FK8A 2DSNA 1D2EA 2P9TA 1I4OA 2DHCA 3IVCA 1U8CB 2P65A 4K9RA 4UKDA 5L51A 4DPMA 5EQFA 4E1AA 1B14A 1IU9A 4GLBA 3AOEA 5HUHA 5EMJA 3LKZA 3C7DB 4TT8A 3WA7A 1QGED 4UUOA 4XYBA 3UQYS 3DBRA 3W3AA 4EBFA 3V4FA 2CSUA 3CF0A 3ZU4A 5FBRB 1IJFA 3JASA 4QJBA 4DM4A 4ZVVA 1C5KA 2WWHA 4NARA 5AVWA 1SOAA 3WMEA 4DFDA 4M0KA 2EKZA 2VHTA 3G9ZA 3WB0A 5JI2E 3G9UA 3UJPA 3TGLA 2ZRQA 3U9SA 2XODA 1T2AA 2OBMA 3TUZC 1DE0A 2GJSA 1XMJA 1PE0A 3GZJA 4IR7A 1QE5A 1U3GA 2X1LA 3DHVA 2FPPB 3P26A 1FX0A 4FSXA 4BMDA 1JG1A 1Y9AA 1YIAA 3HB7A 5T4FA 3AEKB 1KMHA 1AQ6A 3MMZA 1FBNA 1PNRA 5EG5A 4DAEA 3LC7O 3K6SB 4XW2A 4EG4A 1U2ZA 1DT3A 4H1VA 3TE6A 1VMAA 1GPMA 2V5AA 1B6SA 4P38A 1P1JA 3O94A 2ACEA 5DNVA 4TTTS 4KYVA 3HHPA 2ZPAA 4PQEA 5JNSA 1ZYUA 3ISTA 3U3MA 3I2HA 2IX9A 4PCUA 2WP8J 3ETEA 3RU2A 2BZSA 4AN1A 2MYPA 4YP6A 3TJRA 4KRGA 1DO0A 3P2OA 2PJRA 4MQFB 3K9FC 2JVJA 1HO3A 4Q21A 2IXGA 2R3SA 2WHPA 1Q20A 1FU8A 1U28A 2DP4E 1L7DA 3ANTA 4V0NA 1I9GA 1LZKA 1UR5A 1XB2A 4JMPA 2HMTA 4LZOA 3D6TB 1C2YA 3IAUA 4NPAA 1U7TA 2Y1CA 2ZJZA 1G8HA 1L6IA 3V55A 4MITA 2FWJA 4DBZA 1M8KA 4DCJA 4JP3A 5KWEA 2HCBA 3TRDA 4IS3A 2J6HA 3DOHA 3I1YA 3NHKA 3OESA 3Q1KA 1P5FA 1R4AA 4Q9IA 5JYCA 4PCAA 4PPGA 4XX1A 3L6EA 5LLSA 4BASA 2P27A 2G04A 1I7PA 3HXKA 3DJYA 3PNQA 4B75A 3WL8A 3QF7A 3VC1A 4OK6A 5FV7A 3IDQA 4ES6A 1EQUA 1NPTO 3HNRA 3LF2A 3I1JA 2G09A 4CZ2A 1J0EA 3E2MA 4O4HF 2V0NA 3EDOA 5EE1A 3I0MA 4WX2B 1RWKA 3DYBA 4PEVA 4JEMA 3WLOA 2OENG 3PTAA 2H9YA 2OQVA 4B35A 4TMZA 3W6NA 1J2UA 4XWWA 4LRTB 4LYYA 4HRVA 4WMLA 3DKKA 5DNYB 2WKPA 4TROA 3N0WA 2C03A 1N5MA 3AMVA 4N54A 2VDKB 5TPZA 2JGKA 4BRWA 3GRKA 4DV3B 1WA5A 3I32A 2ZATA 3A2LA 5KVCA 3OHPA 2RGEA 2J7KA 1INLA 1QOZA 1SHJA 5GM2A 1T5SA 4Q4JA 1DAKA 1UXKA 1ISGA 2X1MA 2I2BA 4MJ7A 5E1DA 1C41A 1HDCA 1X1QA 4CLEA 5K8VA 2LW7A 1W5FA 2HNAA 4V1CB 3OKFA 2Q1YA 4RF3A 4NZ9A 2PGIA 1XT6A 1DIAA 3U3OA 1F4LA 3PUHA 2VDUE 3NVMB 2OB1A 5IT0A 3GJQA 1VIVA 4BWGA 3A2KA 2HDHA 4KO2S 3DLIA 1YJBA 3D0QA 2ECQA 1MG0A 4R4JA 4J91A 4BRSA 4XDHA 1U6JA 4F1WA 3ANLA 1VQ1A 3N8GA 1YCDA 4UXIA 3WR5A 2VUHB 3DDUA 1P72A 5ADHA 4ZTUB 2G06A 2N9UA 3ESCA 1ECBA 5KVSA 2H2AA 1Q95A 3MJ4A 3WYAA 1W4LA 4LGVA 3WVNA 2BI4A 221PA 1JR3A 4KR0A 2IK8A 1K75A 1V8FA 4R2KA 5JPCA 2BFEA 1VYUA 1QIDA 2PCJA 3B36A 1UKZA 4UEWA 4W63A 4EA8A 3Q15C 5L3SA 1EUDB 2PRJA 5B37A 4BKMA 2HQSA 3F78A 3IDSA 4NQZA 1OWPA 1XTRA 4P98A 4HLUC 3T4XA 4CG0A 4GT1A 1IY9A 1WW2A 4BPRA 5IS2A 3BKWA 4AYTA 3V97A 4YX9A 1X1SA 2K7ZA 2ODAA 4NF2A 3RTGA 5TLSA 5E7JA 2BR4A 2BDEA 2FSHA 1USKA 5E4JA 1VJDA 4MVJM 4AF8A 3IT1A 4DMFA 3RAJA 1OBFO 2X7XA 1B8OA 2ZB3A 1UDXA 2XIJA 2PO7A 5KQSA 3QOFA 3O8OA 5EKXA 3AVYA 3HP4A 3AEUB 4P83A 4NPCA 4WQMA 1ENZA 2H2DA 4ZIRA 4J2HA 2JDID 2D2FA 1XDGA 1NC3A 3WZMA 5DCYA 2YYYA 4EECA 1WHTA 3P2IA 1CUCA 1H0SA 2P91A 4G0ZA 4KVFA 4R2JA 1W8DA 2R6CA 2FW9A 4EYSA 2GVZC 2C2YA 2PFSA 2P6UA 3PGMA 3KXPA 1P5JA 1S8OA 3LUGA 2WT9A 4P4GA 5E6SA 3GFFA 3CH4B 2PXXA 2XMBA 5FPSA 1FEZA 2IXDA 3PC8A 2PXHA 2OEPA 3TZEA 4AP6A 1O1YA 2DFDA 2F43B 3IV6A 1KXJA 1OH7A 2DC1A 3O4GA 4Z7QB 3ZWAA 1Z2DA 4F4UA 3FJYA 1TQ2A 5EIXA 4CLOB 5AXDA 3DGFC 1PP4A 2AEMA 3EBOA 3IEIA 1VRCA 2JHGA 3K96A 4KAFA 4NE9A 5FBLB 3TLKA 3WYCA 4V3BA 4EJ6A 2V1UA 3WICA 1EHIA 3KHTA 3W3AD 1JSRA 4D3ZA 4EO4A 1JKXA 4E07A 1EG7A 1JF8A 4C4SA 5K3BA 1C7QA 4W82A 2XYQA 1FLVA 3QWBA 3B1JA 1UKAA 2RKOA 4CT0A 4YQFA 4X1IA 5CXUA 2FAXA 4HFMA 6NULA 5ICGA 3IE1A 2CYCA 421PA 2GNPA 2V6BA 5JZ9A 2RHRA 2JFVA 1D6SA 3FDJA 5CPBA 4EMBA 1VSQA 1KEKA 5F5XA 1PJTA 2PYZA 3G2PA 3I2JA 4GUDA 5G1OA 3KZCA 3QLUC 3WGZA 5DSXA 2DZDA 1TW3A 4GS5A 4TLMB 5BSFA 1JEYB 5D5HA 1GSHA 3CNLA 3PR1A 4A23A 2PBFA 5IYZB 3PLNA 1COWD 1SUPA 3E0QA 4RL6A 4WOJA 4NCBA 1LW6E 1U0TA 2QTCA 1FUYB 5DZSA 2QEQA 1NNLA 5KMGB 1ZVKA 4B4VA 2Z6UA 2CBXA 1GZ4A 2WSBA 4DXDA 2J3MA 3AV0B 3F5QA 1MGOA 1NV9A 4UBOA 5ALRA 1NUAA 3RG8A 3HADA 3RHFA 3TW6A 2W6NA 3VZCA 4B74A 2PO5A 4FOSA 3WA6A 4YH1A 1VI5A 1R0SA 1CY7A 1JAHA 1Q2XA 1XAIA 2ZTUA 3BH7A 3UUWA 3VHQA 4DEVA 3IOCA 3JD4A 3LVFO 1E3SA 3Q3GE 3GBSA 4F38A 1H2FA 5E3JA 3JYQA 4LFCB 3HYRA 5B58C 2CDAA 4JBXA 4YMUA 5G4LA 2EW2A 3IAS1 3COVA 2VAXA 1NWCA 5DNDA 1ZN2A 3T5DA 4B3CA 1RXIA 5B3LA 3UAOA 4RUKA 2Q9UA 1FDOA 1WB9A 1V0JA 2Z4RA 3VPSA 3ZU2A 3H18A 5TDHA 4E32A 1T1EA 3NXSA 1NT2A 1E5TA 1OAOC 1VI6A 3UYLA 1J0AA 1PS9A 3GLQA 121PA 1SCDA 5JYBA 1U5BA 2HRZA 2IX3A 2FPGB 3O92A 4J1QA 4KG7A 3U19A 1KPIA 4JKYA 1JB9A 5GVRA 4IIVA 3QJ5A 2PM8A 3DW1X 4NG4A 5G1NA 4MPPA 4EIWA 3CONA 3HJUA 3RAGA 4AKSA 1LSSA 4BLPA 2Q46A 4JSRA 3QX9A 5AVKA 7AT1A 3SR4A 4Q7EA 3WKBA 5JFTA 4KV7A 2DY1A 5TPZD 1SUBA 5CH3A 2IYPA 1SVSA 2G7MC 3A9SA 1FFSA 4CM8B 2W58A 3GLKA 4MA5A 2LCQA 2ECFA 3F7MA 2EP7A 4ZARA 4BTEA 1ZW1A 1NOIA 2R00C 4QRDA 5C7LO 4YCNA 1N2SA 1MUUA 1XQWA 2VJDA 3FG9A 3C8ZA 4K9SA 4JDPA 3Q7TA 4YLEA 2P0EA 4D92A 4DQKA 5AQ1A 5BRAA 3W77A 3N8KA 4M36A 2BLNA 1L4LA 2PZKA 4H7EA 2QE6A 2W2QA 1T8RA 5DSTA 1PWXA 4E94A 1UBFA 2OHGA 2X4DA 4PQGA 4S3MA 1JHOA 3W2EA 1N1MA 5AHRA 3KDPA 4RZ3A 5IJ9A 5JFGA 3H3XA 3OOHA 3WGGA 3ZWVA 4YRAA 2ZR8A 5J2UB 3JQBC 2BKEA 2AOWA 4H7FA 4S0XA 3DD1A 2BEJA 1GA4A 5HS6A 4JLBA 4KE6A 4G0MA 1M2NA 1GZ6A 4JLWA 1E2QA 2Y1WA 1XZJA 3F4LA 5CDFE 4Z4HA 1SHLA 1X0VA 3EFHA 5FV4A 2EKQA 5DOZA 2VHQA 4PRLA 2H5LA 4M88A 1JR3D 4ETNA 4DW8A 2V0CA 2IIQA 5J1SB 2I3BA 3LFTA 4YT8A 2C99A 1GNTA 2WAYA 4AF6A 5BMVB 3C5CA 1MOZA 1RLTA 4JXKA 1X70A 4RGVA 2PLWA 3I2IA 3SM3A 3GX1A 3NHAA 2ZT6A 4CG2A 1JAZA 4IGFA 2ERCA 2V7TA 3S29A 3WRWA 5JAMA 1E6LA 1K3TA 3EZNA 4V24A 2AI3A 1G9XA 1GRRA 3K9GA 2VQDA 1GDDA 1EDDA 3K2QA 5GONA 4P82A 1Y48E 4KI0A 4W5JA 3V4OA 3RDPA 3F96A 3WHPA 4WBNA 5ALVA 3Q11A 4RTLA 5JH7A 1GDTA 5EC8A 5IPFA 5ES4B 3AVOA 4FZJA 1ZL0A 1K92A 2CLSA 2X19A 5I7UA 2EOAA 4FN4A 1HL3A 4DV6B 1OB2A 1X74A 2M98A 2XB4A 1XNRB 3O8BA 4BJ5A 1K0FA 2I71A 4B17A 5A5EA 1BEUB 4CE6A 3B8EA 3D3KA 1U4OA 3RADC 1OROA 1NBEA 3R3SA 1ZK4A 4NBVA 5FL7A 3TMKA 4DIFA 4HLCA 1JZTA 4C5CA 2ATEA 1YKGA 2W6CX 5ILGA 1ZN8A 2C61A 3E3OA 4DV0B 1F06A 4H7DA 2WMNB 5EVJA 1G5PA 1GM5A 2GBCA 3H19A 4X60A 2OTCA 2HFKA 1H66A 1XJ5A 2D5BA 3GT4A 4I8XA 4LSWA 4U3JA 1TAUA 4HQNA 5A6SA 1G17A 4FXPA 3DO8A 4MW0A 3DEIA 3GNLA 4MPDA 4Q39A 4E14A 2QGNA 1JTFA 1P2TA 1U04A 1QANA 2Y71A 3I04A 4YROA 3FUUA 2DBVO 1T4DA 1V25A 2R6JA 3VDXA 1NGSA 4Y2QA 5JCZA 3HTXA 3JQ7B 1L7NA 4DOMA 2QL5A 2R66A 3B78A 3CW9A 3D3QA 3F71A 1MN6A 4PX2A 3EGDA 4Q9HA 5AVOA 2C04A 3TOZA 3ZU3A 4Q4LA 4ESOA 1Y6JA 2P5UA 1H65A 2ASVA 2BMDA 1VLZA 3QVGA 1S7CA 3QKUA 4GPEA 3F90A 3B85A 3VDMA 1YCFA 1FXSA 3IERA 1YDEA 2DHRA 1PYDA 5EE5B 1JTVA 1RI1A 3KYCB 5FWAA 4FHCA 5AJWA 1NDHA 3P2YA 1B0UA 2QD2A 3FYSA 3K0CC 4EJSB 4MR9B 1MX9A 1NYRA 2ZJYA 2PXCA 1AGNA 2FR0A 3HKBA 2XYVA 3DOOA 4J2TA 4Q3EA 4Q37A 3DZGA 1UPUA 2OP0A 4OBXA 3NS7A 1FDTA 3DB2A 4TKLA 4Y67A 4DCMA 2JEYA 4TYPA 2GPNA 2R7AA 3C6XA 4E30A 1CS4C 5EE3A 2I0FA 1R0LA 1WEHA 1GGEA 2JD1A 2X2FA 3IIJA 4NVRA 3ONEA 3QBDA 3WB2A 5L3QA 5HJ5A 4EPTA 1ZCJA 4ZRNA 3QTBA 3V6MA 2A59A 4ALIA 1KI9A 1EP3B 1YNOA 3D7LA 3OJ0A 3ELUA 4KW7A 4MS4A 4BNLA 4CTMA 1J24A 2GX6A 3K70C 3VSCA 2VWPA 3O47A 1C7FA 1P2FA 3N5KA 2FSPA 2HX1A 4JXZA 2FWNA 1HX7A 2IHUA 2OECA 2PN1A 2ZIGA 3IXMA 1GNVA 2DKOA 4PPNA 1Q5PA 5KC8A 1EFKA 4FDTA 1H6DA 4FJ2A 5AKHA 1ZCBA 5C5CA 4WE3A 3LFUA 1W4BA 3LVQE 2FLWA 1WX1A 2IYRA 3DEAA 3GFGA 1PJ2A 3QYAA 1V7ZA 2QM3A 3UMMA 3LGXA 4MMYB 3AHGA 1KY4A 2JLRA 4HKTA 3WDLA 1BCSB 3H0EA 4M8NE 3FY4A 4RJTA 1Y3AA 3B1VA 5FHQA 1QZ3A 1A7AA 4KCGA 2E2WA 3CRW1 2JJYA 3NHJA 1IZYA 3BC1A 3JZIA 3A26A 3WQBA 3L5OA 3ZV3A 2EWWA 3KVRA 1PL0A 1PR1A 2QP3A 2IV3A 4B3FX 2E89A 4KXVA 5LYJB 3L6UA 1XZ8A 3FZQA 1QJCA 4BKUA 2O3UA 1BA3A 4DARA 3HBFA 3HEMA 3P1JA 5HM6A 4QECA 4DA9A 2DCUA 2XF8A 3HV0A 1S6YA 3FTEA 1AK2A 1ZNZA 3NYRA 3ON5A 1AMNA 1AUPA 1KJ8A 3VHXA 4BLWA 4MW5A 3AM1A 3FR7A 1WZ2A 4QFCA 3GLTA 5HOQA 1MO2A 2NTEA 1QHSA 2J41A 3P0IA 4AJ9A 1XDDA 1KBQA 2O3JA 1J42A 1DAMA 3IBGA 2YWEA 4XKJA 3ICCA 3BWEA 4DNOA 5TMDA 1MZVA 4BIIA 3ENZA 3HO8A 4OOFA 1MO4A 3TVTA 1ODLA 1JDSA 2R68A 3IMFA 1F8XA 1LS6A 2PLNA 2F00A 3QXGA 3HN7A 4OFBA 4FGUA 1E2IA 1F51E 1RRKA 5JCOA 3DAHA 3B7WA 3CLUC 1QIJA 1KK2A 1NI5A 3KT6A 1TEVA 2QDXA 1XVLA 4PTLA 2QR3A 3C3WA 2NQ2C 5T6MA 5A0TA 4LYEA 3AVTA 2ZUTA 5NLLA 2W6IA 3LQ4A 2C5AA 4ZAVA 1XQVA 4IJVA 2EZUA 5FA5A 2PGAA 4L75A 4RNCA 4Y0NA 5F9MA 5BWNA 1XPJA 2P5SA 4OTZA 3ZR4B 1N34B 2Q4DA 3F6RA 5CNIA 4B6OA 1RRGA 1G63A 1PYGA 3EVGA 4GE0A 4PYRA 2FN4A 5IUKC 3HE3A 4CKWB 5KYTA 2WM3A 4FM9A 1GYRA 1XWFA 4M1SA 3H2KA 3V8PA 1QIGA 3QELA 4ZJYA 5B30A 4TXMA 16PKA 3IX7A 1I2ZA 2DHQA 4X94A 3D4IA 4I1RA 5LDGA 2C7BA 2IS6A 1EWYA 2H7CA 2Z4SA 3X1XA 1UZNA 2G17A 2PLAA 4DMGA 1ZVMA 3AIOA 1C2TA 2OORA 4JB8A 1ISPA 4X8HA 2NZ8A 2JKZA 5AJZA 4PCLA 3CRRA 4GXRA 3NDPA 2OV3A 5DW3A 1MG5A 3M6XA 4RLFA 4HRYA 4EOGA 1U7PA 5A5VA 3GAAA 4CCWA 1B8UA 4LJ6A 1ANKA 4OQXA 1JEOA 3LUDA 5E95A 1AQJA 2O23A 3KTFA 5FXMA 1I0LA 2GUGA 2ZE8A 5GP1A 2IS1A 3TKAA 3R8CA 3LLVA 5ESWA 2Q5CA 1K0UA 3LYAA 3QVJA 3KCNA 4INZA 3O4JA 1QLJA 3BWYA 4RY9A 3WKDA 3WY9A 3BIXA 2Q6TA 3EEFA 3T52A 1OFIA 3HM9A 3L82B 2NSJA 4BEJA 4Y6RA 2ISSD 5FL7D 1R1DA 2WSLA 1NJSA 2Q6OA 1N6OA 1OJ7A 2XZTA 5TT1A 3W6ZA 2GGSA 4CQMB 4DCPA 3W1VA 2C5EA 3RHSA 1IPEA 9ATCA 5CNJA 3RNOA 3I4LA 2XWBF 4TTAA 3Q3CA 3KSBC 5F3WB 4OUDA 1I3OA 1RTTA 1YRWA 2O1WA 2QN1A 5J59A 1O0SA 4ZEOA 2FPSA 3U5ZB 3CKKA 3U16A 3IVXA 1XLWA 3KSDO 2TMKA 4IS2A 4UTXA 5HSGA 2PUTA 5IKEA 3GOHA 1AKUA 5J4LA 1KRWA 5EKUA 3DLPX 2V8BA 2G4CA 4XE5A 3RVMA 5AM4A 3UZUA 3OPVA 2HWKA 1WV1A 3ZW7A 4O2AB 3AV3A 3OC6A 4YJ2B 5CVEA 2WFZA 4DF3A 1B6GA 3A11A 1XNQB 3X2FA 3ETJA 1RAIA 2UYQA 2ZIWB 1IDOA 4RJLA 1NNEA 2VJLA 1ZI9A 2XCUA 1Z73A 5AI9A 5AVXA 2A0XA 1W5TA 4CEHB 4N4AA 2OFOA 2EBFX 2JD0A 1HXHA 4GNKA 3VKWA 2JB9A 2VTEA 4W5RA 3BXPA 1V9LA 4ZAYA 4P4LA 4UDNA 4BNDB 3QQ5A 2XVZA 3SXUA 3ILSA 4YLYA 2RGXA 3WP1B 4B76A 1B6TA 3CUUA 3EODA 4HAIA 2CZQA 3GQVA 1UOOA 1WZUA 1ZC3A 2X0RA 3DEZA 5K45A 3I5XA 1L5VA 1B42A 1Z2CA 4DKJA 1Z13A 3PUWA 2PMWB 3VJLA 1K5GA 1SPXA 4TMYA 1IVSA 4B7AA 5C5EA 1O4VA 1OVGA 4QM6A 5CP8A 1DXOA 4EJSC 1VG0B 5IJ0A 1DL5A 3JQFC 3A04A 1ONPA 5LPNA 3MAJA 1NVDA 4EI7A 2GDZA 3IEVA 2XZDA 3HB1A 4RJ2A 4J76A 4BATA 2C2BA 2QMUA 2VDJA 4LRYA 4HLDA 3AJDA 4MAMA 3U4QA 1CQXA 1JHPA 4DTIA 4FFSA 2PY6A 4JBYA 3STXA 4ME6A 2WM8A 4DTCA 5CFMA 4KOAA 3U7JA 2WJGA 4CEJB 3QXCA 2RKWA 3UEOA 3WGUA 4BO6A 1EUQA 2FWRA 3L40A 1BSVA 2PKEA 4J1TA 1R9MA 2I3ZA 1E20A 1TL7C 3D6HA 3VPGA 4UJ3A 3GR6A 5DTJA 4EWLA 5K05A 3ZJTA 4I50A 3ZZ1A 4ZMRA 2CLFB 2JAOA 2R62A 3P0HA 3MT9A 1SKBA 4XD2A 1ICEA 1H1DA 5DBGA 4HV4A 2XCIA 4IM7A 2GF9A 4PLGA 3OIYA 4CIVA 4HDNB 1SRQA 1WR8A 3HHEA 2DPMA 3UW1A 2C77A 3FVWA 3KQWA 1VGQA 5HF8A 1JLLB 4WKNA 1YQXA 5LZ4A 3KETA 1LH0A 2HK6A 1ZEMA 1A8SA 3QEMA 4S1PA 4J1NA 5F1YA 2CLKB 4IDQA 1G20A 1KP2A 3ZHZA 2DFVA 4RU1A 3RJMA 4HZUB 4D9MA 3O8DA 4B46A 1JDVA 1Z74A 2J9XB 3LCUA 2EJUA 5HILA 4CG1A 1GZSA 4GUAA 2HY7A 4EHIA 5TNXA 5IXSA 1ZIPA 3AUFA 4UASA 1ZNYA 3MEQA 3STTA 2B7CA 4HAZA 3UMRA 2C7PA 3SZRA 2QTVA 3D4LA 3U4GA 2B4YA 4LIPD 4CL2A 4R05A 4EKYA 3D8SA 4NAHA 3R9IA 4HDMB 4OYHA 5EUMA 1J07A 3JALB 4AP5A 3IEMA 2F7SA 4DLXA 1TLTA 1Q2UA 2XA2A 2YZMA 4MP6A 4FMDF 4NICA 3RYIA 3ZHQA 4EHHA 4MWTA 2W2PA 5THQA 1NASA 1T43A 4RMJA 4GZ6A 4LZNA 1XFDA 3S28A 3BL5A 4RSHA 2CYBA 2VSXA 1BE1A 1OXKB 3LUFA 1P2DA 4HDOB 4INAA 2YH2A 3HVUA 4JZYA 4D74A 2Q3BA 2NVOA 1GNSA 2R4TA 7GPBA 4C0KA 2HK7A 2FPIA 3LVRE 4GIBA 5IZCA 4CI0B 1R5BA 2W6ID 3AG5A 4MDYA 2WJJA 2AUTA 2Q62A 3BN3A 5JW6A 2IPNA 4YXFA 2GJKA 5B3JC 1LDEA 3IIIA 4PYKA 1NNI1 1AURA 3RJZA 1O7JA 4FYIA 4LYAA 4ZQGA 1PFUA 2OB2A 3GJ8A 3QF4B 5D84A 1QH8B 1V5WA 3DBVO 3ODPA 4UCXA 1RWVA 2IOFA 2VSQA 3A70A 3CF6R 1CJCA 4JLNA 5KSOA 5ENVA 4RO0A 3V46A 4BZQA 4TQGA 1OFHA 1FE8A 3GUCA 4HN2A 3GG9A 4B6FA 3PA6A 3QUCA 2KJQA 4LQ4A 4NFLA 2YWCA 4RVSA 4LMAA 2QMYA 3SMVA 1SJ9A 5ERGB 3SVLA 1I36A 2ECOA 2OMEA 2WKWA 4BX2A 2DFLA 3H6GA 1WEKA 2HMSA 2WSMA 3Q7QA 1NW6A 1BS2A 3L8ZA 4E5MA 4F6RB 2DX7A 1UFQA 2IE0A 4WHMA 1C9DB 1VMEA 3DTNA 5D6NA 3ROKA 1I7LA 4KQCA 3MZ0A 2Z3WA 3T5CA 3QVKA 3K16A 4AWXA 2GHRA 2AV6A 4FFBA 3BX1A 4LK2A 3W5SA 1IN6A 2ZB7A 4MYUA 3R9KA 4E2WA 2RGYA 3ECAA 3I76A 2I3DA 2I4MA 5CURA 4NONA 3RB8A 3PX3A 1AC5A 5GJWC 1AB6A 2ZWAA 5U4QA 4I1UA 4TL6A 3EG9A 1EXVA 4BKRA 1JFLA 2R1VB 3G9QA 3SS7X 2CZCA 5HF6A 2Z5LA 2O3SA 2VQSA 4O2LA 3DDWA 5E9JA 2NN3C 5FLKA 2GHIA 2AFIB 2G3YA 1SUCA 2L17A 2QM0A 4O4LF 3DHNA 4QXAA 4KSCA 5KTOA 3DONA 4BMVA 1RP7A 5JDIC 3UMJA 1X7GA 1WUJS 4DQVA 4D3YA 2C95A 3VKUA 4LJ5A 2JVKA 2NUTB 1D3AA 4RK4A 5H4GA 2CF6A 2PZAA 3W7AA 4NAVA 1GUAA 3AW8A 3EW9A 3LBYA 2C1ZA 4ER7A 2ZJ4A 1V1JA 2W9XA 2CMHA 1QHFA 5G2OA 1ZMRA 4FDUA 5EQJB 3NIBA 3U26A 1ZD3A 2JIZA 3PWTA 3ZU5A 1U0SY 4M89A 4ZJZA 1GIAA 1Y1RA 1CYEA 3AB7A 5BW6B 1C9KA 2V45A 1Z26A 1L7XA 3IA7A 2O50A 1CUHA 1M8JA 1W1UA 2DTXA 1UBEA 4O4IB 5LZ2A 1XK7A 1FB5A 1CULC 2ZRFA 2ZW9A 2FXVA 3PA8A 3S2YA 2YXLA 4D1YA 3ROMA 1U2DA 3D4OA 1KZ4A 5FORA 2GM4A 2AXQA 1JDJA 2YDXA 3R74A 4JR2A 1YFKA 5D00A 2AFHA 3F5SA 2ERXA 2QD1A 1PZFA 5BQ5A 4HTAA 4DJFC 1J90A 4MS1A 1Y9EA 2BFPA 2NPIA 1LC0A 2OV6A 5DISB 1U2TA 4D4IA 1BHSA 3CX4A 1F12A 3R0VA 1VKNA 1WHSA 3LUAA 3PICA 1LNZA 1ULZA 2R4QA 4GEGA 4HN4B 4YXWA 1RRFA 1OTXA 1YA4A 2R8PA 5A0FA 5DXJA 1DTEA 3MMXA 2Q6IA 1D7AA 3RSOA 4O5OA 1B0ZA 1MEOA 1PSWA 1XK6A 3PE6A 3T9CA 4B40A 5BN3B 1YR2A 1CYDA 1SC3A 3GELA 1JG3A 1P5HA 1JQLB 4G8CA 5A4DA 4Y2YA 2JCGA 2R7KA 1ZXLA 2RGCA 4M53A 3IBTA 2EYQA 4TRMA 1Z5ZA 4I55F 4TTSA 3UMBA 5JS8A 5CCXA 1Z6XA 3KR0A 3UGQA 4CG3A 3V42A 1TPYA 3SFTA 4LBWA 4EF6A 3OQ1A 3KLPX 3I12A 2Q5LA 5EIBD 3VFDA 4LF8B 4OHOA 4MGKR 2HQ1A 4RY2A