4F45A

Crystal structure of human cd38 e226q mutant in complex with naadp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
253
structure length
249
Chain Sequence
EFWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosyl cyclase 1
publication title Crystal Structures of Human CD38 in Complex with NAADP and ADPRP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 80
structure length 249
sequence length 253
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4f45A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f45A02
3C7DB 4WCFC 2GERA 1E7QA 3W6ZA 2RCYA 3KSDO 1U2DA 4R4JA 1JA9A 4WKGA 4A73A 2X86A 2DC1A 2G17A 5BSFA 1YBMA 3R0IA 2G82A 1IOLA 4FDAA 1AHIA 3BMOB 1AXEA 4HY3A 4XYLA 3U0BA 2VNAA 3QV1A 5AYVA 4BB6A 4GVLA 1J5PA 3KB6A 2P9CA 1MUUA 4Y6SA 3LT2A 4CM9A 3ZHBA 4O5OA 2HKIA 4B8WA 4PN3A 2ZK7A 2WD8A 1ZSVA 3BHMA 4BKOA 5I7SA 1ISMA 2VOEA 2VHWA 1F17A 1U4SA 1R4NB 4QO8A 1G1AA 4W7IA 4EJ6A 1YONA 3S8MA 3NTQA 4U5QA 1Y6JA 5TSDA 1F14A 4A0SA 1NBOA 4UVDA 3TSCA 1MB4A 4RL6A 1YO6A 4FC7A 1B16A 1K89A 1W0CA 1JAXA 4LK3A 1P0CA 1MG0A 1MFZA 4XIYA 4CLHA 3VTZA 3PJGA 5HBRA 5U1PA 2WTBA 3U4CA 3V1UA 3C7CB 1F0YA 4O1MA 5ITVA 5KJCA 3WWYA 3IDSA 1PL6A 1Z6ZA 2JHFA 1C1DA 2D2IA 3GNQA 2PZLA 2JD2A 1Q7GA 1H94A 4PFJA 5TF4A 3ZN2A 3I1JA 2QRJA 2J8ZA 3GFGA 5ITWA 2Z95A 9LDBA 4WGGA 3HB4X 5G4KA 1HTBA 5CHEA 3MJCA 1NM5A 4JQCA 1PJQA 4J1NA 5DP2A 1IPEA 4K9DA 4MVJP 1DC5A 1UXKA 3PRJA 4XB2A 3IJPA 1Y8RB 1DEHA 2VZ8A 3AI1A 1PJBA 2B0JA 4GGPA 1TEHA 1QSGA 3HDJA 4L74A 4X54A 5DOZA 3UAGA 5HTOA 3FBTA 4MPDA 1HEUA 3PWSA 2W2KA 3BIOA 1JDJA 1MA0A 5A05A 4CMIB 3H2SA 4HXYA 4W9NC 4GWKA 3EYWA 4WLEA 4YJGB 1QLJA 2QW8A 3SC6A 1X7DA 2JCYA 4XQEA 1LQUA 1CYDA 4R54A 5F3RA 4J2OA 2X22A 2A4KA 1E6WA 2X0RA 4TRNA 1H93A 4BO5A 4RVHA 3ZWOA 5JO0A 3DZBA 5IDWA 4I5FA 4J7UA 4N54A 1HE4A 2DAPA 5DDIP 4JJGA 4WCFB 4E33A 1EE2A 3BMOA 4BNFA 3AFMA 4OIMA 3DMTC 1EBUA 1ZW1A 1IZ9A 3JQ9A 1N7HA 1U5AA 4UUOA 4XGKA 1YVEI 1R12A 3ROKA 3K2BA 3ZGYA 3ZHZA 4M54A 2C20A 2ZB3A 2Y99A 3RBVA 2Q4EA 2NV6A 1GV0A 1R4NA 4R5HA 5BNFA 1DIBA 3ZV4A 1HDXA 1KEVA 1OOEA 4DBVO 3OEWA 4YAEA 4BO3A 3O4RA 3L77A 2Y1GA 3E9NA 3T7CA 4PVCA 2PA3A 2VHVA 4CLEA 4DQVA 1YL5A 4PG4A 2ZTLA 1M2WA 3KEOA 5DCWA 3ORFA 4PLCA 4GX5A 3H6KA 3JQBC 3QSGA 4RDIA 5EN4A 3K6JA 1YBVA 5IZCA 1T2CA 2PGDA 2D5CA 3E5RA 1P74A 4Q3DA 1PS9A 1GADO 9LDTA 1HDGO 1IPFA 2YV3A 3NX4A 2IXBA 1WDKA 4Q3AA 4E2YA 4ZICA 3QA9A 4NI5A 1T2FA 2O3SA 4GBJA 4DTIA 4OOFA 3GN2A 2VN8A 3I9OA 4FFMA 1VL0A 4L4RA 5G0UA 6ADHA 2CSUA 4WASA 1EBFA 4RLHA 3K8ZA 2B5WA 2HK8A 2P4QA 3QW2A 5DOVA 4RVSA 4XCVA 3IUSA 2YJZA 4R68A 3OQ1A 3VVBA 4KZPA 1O6ZA 3JD0A 3WIDA 2OXIA 1Y8RA 3NT2A 1XIVA 3AM4A 2NTJA 1SAYA 3RIHA 3WJ7A 3T7EA 3VZSA 3FPCA 4PLHA 5ENVA 2OP0A 3B70A 3U4DA 1X7HA 1VJTA 3JQAD 1JAYA 2BKAA 3O26A 2PD3A 1RM4A 2PGLA 1Q1NA 1NWHA 1X7GA 5FI3A 3GPIA 1ENYA 4NJMB 2AHRA 2HO5A 4HNHA 4ZD6A 3GMDA 3DZFA 2EEZA 3ONFA 4CMIA 3DBHB 3MOGA 1K5HA 4YJGA 3QE3A 4Y98A 4CM8B 3ETGA 4DQUA 5TLSA 3NT4A 4AJLA 4WEOA 2ZIZA 4D0SA 5A9TA 1FJHA 4FSHA 3ZWXA 1P1HA 2ZTVA 3JV7A 3NT5A 3B1KA 3HN2A 2Q49A 4WCFA 1S6YA 2NADA 3AY3A 1ZUD1 3JYPA 5ILGA 4DBZA 2AMFA 3LF1A 5TRTA 3WQRA 2DKNA 5AXAA 5KCZA 2EP5A 5AXDA 3U09A 1WP4A 4JJFA 3LYLA 4JBGA 3ZH2A 3DXFA 1J6UA 2O2YA 1HDYA 3UVEA 3WNQA 3BMNB 2Y1EA 4XKJA 4G2NA 5TT1A 2J3IA 4EJ0A 3IL2A 1V0JA 1AGNA 5TS3A 3OIGA 5TIIA 1E92A 3I23A 2P2SA 4KP7A 2BHLA 5EESA 3EY4A 3KHUA 4Q3EA 4YRAA 2X5OA 3IC5A 2F00A 4K6FA 5CDGA 3TFOA 3ZDFA 3PHHA 3RUEA 3I9KA 2CY0A 4EDFA 4RDHA 3UKOA 2G5CA 1N1EA 4JXKA 1CETA 1E77A 4BO6A 1F06A 5F5LA 2HMVA 5CG2A 1V3TA 4MP6A 4CR7A 1N9GB 1ULUA 3EK2A 2NLOA 2WD7B 3K92A 3Q11A 2GSDA 4GGOA 4I9UA 3TRIA 1SB8A 2GZ1A 5THQA 1ADFA 4BO8A 1WMAA 2FMUA 3KUXA 1KY5A 2WEKA 1BTOA 4MVJI 3WR5A 2HLPA 5T8KC 5AOVA 1GPJA 4OHUA 4BL5A 1WLYA 4CM4B 4D41A 1ZXBA 2ZB8A 5I7FA 3GUYA 5ENDA 4TROA 4D3DA 4LSMA 2WDZA 4W82A 3RASA 4LCJA 5KVQA 1Y5RA 2AG5A 4ZVVA 1FDTA 1JKJA 1JVSA 3GGGA 1E7MA 1V6AA 4FFPA 1OBFO 3CTMA 3OQ6A 2UYYA 4N7RA 4CM7A 4CV2A 2NTNA 2RHRA 4RO0A 2FPGA 1QMGA 4IDAA 4NJMA 3HUDA 1NYTA 4R16A 1ZMTA 2BMAA 3DBHA 2AQHA 2HMTA 4OSPA 3ZV3A 4CODB 2IE0A 4CM8A 3OA0A 1KBZA 4NK5A 1P31A 1BW9B 2O50A 5HRUA 3LDHA 4II3A 4MP3A 2PFGA 4ROSA 4W9NA 1UP4A 3GVIA 3VAZA 5A06A 3W4KA 1GCUA 4KUHA 2DU8A 4BNLA 3CZRA 3A14A 1V3UA 2DPGA 4Y67A 3U5TA 2C7GA 3RU9A 1RWBA 1Y9EA 3R6DA 4IGEA 5LDGA 1MLDA 2VQ3A 3DC2A 5IFLA 1GTMA 2AXQA 4A2CA 2B4TO 3PXXA 5KKAA 3UCFA 2AE2A 4IDBA 5IDXA 4N5MA 1NASA 4NFYA 5LCXA 5I7EA 4JK3A 4BO0A 3DMTA 3MWDB 4J9VA 1R0LA 3BMNA 1CQJA 4ND5A 2PD4A 1K6JA 4IY1A 1BXKA 3L07A 3PZBA 2X9GA 2EJWA 5H81A 1VSUA 1GUFA 1JWAB 3A1NA 4OKNA 1ZMOA 1E5QA 5KIAA 5I9MA 3D7LA 1I01A 2Y67A 3V8BA 1UDCA 4FW8A 4RGBA 3VDQA 2B69A 2PNFA 4LSWA 3PQEA 3ITKA 1E3LA 1LDBA 4IXWA 4C7JA 3EVNA 5KVCA 4ZQEA 4K26A 4KDFA 1VJ1A 3ANLA 1FDVA 1TXGA 3IOYA 3L4BC 3COSA 1LNQA 3EW7A 1ZNQO 1N9GA 1T24A 5GY7A 3JQBA 2WD7A 4PLZA 1K0UA 4NBUA 4UREA 3TFQA 1LEHA 3HDYA 3L4SO 3NDIA 5TGDA 1DFHA 1B3BA 1YGYA 2OFPA 4YTEA 1LUAA 2DVMA 1YXMA 3EZYA 3SXPA 4ALIA 1VLLA 1FXSA 1PJSA 4BOYA 4R01A 4CM4A 2VTEA 1R37A 3FTPA 5L3ZA 5JMPA 3WGYA 1PJ4A 1EUCA 1E1KA 1RM3A 4CL8A 2CVQA 4A03A 3K9QO 3C8MA 2IEBA 1P1RA 3C7AA 3GG2A 2BI8A 4Q39A 2HJSA 3HB5X 1OFGA 4KDEA 3ZW9A 3W4JA 2J3JA 3FWZA 3VDRA 3EDMA 4D46A 1DFGA 4IBOA 4NZ9A 4YJHB 1PQUA 4UVGA 3DZKA 1VI2A 3P5SA 1T2AA 4D44A 4J91A 1YQXA 1U1IA 2UUOA 4U0JA 4LVCA 2JCXA 2D3TA 5COAA 4MVJF 5IDYA 3DTYA 3WGOA 1BW9A 3FNEA 2EKQA 2DUWA 3AUAA 1GEEA 4D43A 4BGIA 1XCBA 2OP1A 3QVXA 2W8ZA 2LDBA 4XQGA 4J6FA 4E6PA 4YR9A 1L7DA 4EGFA 4NK4A 5GZ3A 4IJWA 2DFDA 2CMDA 1GU7A 3I83A 2H63A 5L9AA 1EK6A 4Q3NA 2D0IA 2QRKA 2HDHA 2VYNA 1PQWA 3QVTA 4E5KA 3OEYA 2AEJA 4UEKA 2EW8A 4FFNA 3WMXA 4O59O 4OL9A 3GDGA 1T2EA 3ITDA 2H9IA 5IXSA 5F1KA 2BFOA 4OYRA 3NV9A 1LRLA 3DAFA 5JAIA 3OJ0A 4CQMD 1E6UA 3OJOA 3HFSA 1H6DA 3DOOA 2Y93A 3CEAA 1LLDA 3GRKA 2BELA 1C0PA 1NHGA 1H6CA 2Y1DA 2GDZA 4QX6A 5CPFA 1X0XA 5AQ1A 1VJ0A 1O9BA 2OBNA 1B8PA 1CEQA 4ND4A 2J3KA 4I9HA 2PD6A 4CMCA 4RQUA 4F45A 3PFWO 4RQTA 3IS3A 2GCGA 3LLVA 1XR3A 4J3FA 3H5NA 1SEPA 4DUPA 5BNTA 1H2BA 1YJQA 5T5QA 2PLAA 3ZV6A 4ZHSA 5DZSA 1KY4A 1LLUA 2H1SA 4RPHA 2J5RA 3HNPA 2R2GA 1DJNA 3L6EA 4GSLA 4I5GA 4ZRNA 4JX8A 1E3EA 5T8KA 3I3OA 1VE9A 4HV4A 5IJZA 1A5ZA 4EITA 4Z9YA 4WPGA 5KJ1A 3FSRA 1NVMB 1VRWA 3TOXA 3HSKA 3KVOA 4CV3A 1PJ2A 2OL4A 3WG9A 5ER6A 4YJHA 4GKBA 4KQWA 2V6BA 1LXCA 2E48A 4RORA 1ISHA 2NTVA 1BVRA 2ZB7A 4DC0A 4RZIA 4N5LA 1BDMA 4B4VA 3UOGA 5TNXA 4RJTA 1TI7A 1PS8A 4CUZA 2D4AA 1NFRA 3OP4A 4OGWA 2XOXA 4BKQA 1PJLA 4HP8A 4P38A 3K2EA 1UZMA 4ZU3A 5CPBA 2Y05A 4AJEA 2YW9A 3P2OA 3VZRA 4DLAA 1S7CA 3AU9A 3FNGA 2FN7A 5B37A 5L53A 3I9JA 4WEQA 3Q1LA 1MG5A 3GVCA 1WNTA 2B37A 3JQDA 2QX7A 3VOSA 2O3TA 3WSVA 2RHCA 4WNIA 1KVQA 3EVTA 5F21A 1E5LA 4ITUA 5IZ4A 4AJHA 2X7HA 3ZU4A 4FFLA 3DB2A 3RUDA 3ONEA 3BTOA 1Z74A 1P45A 2EJVA 1NPDA 3RUAA 1BG6A 5ICSA 4PLWA 3TN7A 1WAMA 4JP2A 1EVYA 1I24A 1LC3A 3SBOA 4PG5A 4XGNA 4L9RA 1P0FA 4F46A 1ADGA 3FN4A 5TT0A 1MXFA 4XJSA 3X2FA 3UGKA 2V6FA 2EG9A 4O6VA 2XXJA 4WNCA 5A9SB 2Q3EA 1V35A 3TDKA 3H9JA 2Y0EA 2OORA 1LRJA 2Z1NA 2WYWA 4FCCA 3E9MA 1EDOA 4P4NA 1EK5A 1GQ2A 5TJ9A 2PV7A 3JYLA 3L4BA 4J4BA 4WK6A 2O4UX 1SB9A 3GK3A 3IKTA 4D3SA 3WYBA 2PH5A 2I67A 3MWEB 1KC3A 1Q0QA 4CM3A 1DIHA 5EINA 1ISIA 2C7VA 1IHYA 5JYDA 2NQTA 1NTOA 1Z7EA 3UFXA 3SC4A 2Q4BA 1PJTA 3PHLA 3OHSX 3K31A 3PDJA 3H4VA 4E31A 4EEXA 2WYUA 3TF5A 1V8BA 1EVJA 1DO8A 3T4EA 5JCJD 4ND2A 2FZEA 2IZ1A 1E1NA 1R0SA 3ASUA 1HYEA 2QHXA 2CVZA 3GY0A 2H6EA 4KTTE 3WX0A 1ZK3A 2UAGA 4Q3BA 4ESOA 5FI5A 3F46A 1UZNA 1F12A 2HMSA 1JKIA 1VL8A 2Q50A 1VKNA 4BV9A 1PR3A 1SPXA 3DONA 5C7IO 4CUJA 3KRTA 3PIIA 4Z9XA 4ILKA 4W4TA 3ZCXA 3RUIA 2PZMA 3BHJA 4A5OA 3ZW8A 5C3MA 3PWZA 1MGOA 3RROA 1DLJA 2BGMA 3DHEA 1J0XO 3F6YA 1ZK4A 3E18A 4AVYA 3NGLA 3KBOA 2CDCA 3JQ6A 3JQAB 4NU6A 4CL3A 4ZJUA 2AE1A 3EMKA 4PRKA 1DAOA 1GYPA 3BHIA 3HZZA 2FR8A 1KS9A 1R15A 1ADCA 3MOIA 5GZ1A 1GZ4A 2P5UA 3EAGA 4YAGA 3N58A 4QXMA 3OFSA 1WZIA 1BWSA 4RVUA 3ENKA 4U0KA 3WBBA 2O3RA 3AU8A 3FNFA 4ID9A 5LC1A 3V1YA 3CUKA 5A9RA 1A4IA 3VPGA 4W7HA 3CPSA 3S2GA 3H2ZA 4J43A 4PG8A 3NDJA 4GI2A 4DYVA 3GR6A 4OMUA 2GLXA 4CV1A 3E5MA 2VHZA 4CMEA 2QG4A 3TWOA 3QVWA 3PZRA 2PWZA 1HXHA 3GG9A 4CUKA 2QZ9A 1DRVA 2ZTUA 5A9SA 1PIWA 2FWMX 4E5PA 3KOUA 2W4QA 4M1QA 4CR8A 1K3TA 2NSDA 3BMCB 2OOSA 4L4SA 1GEGA 4CQLB 4PGFA 1E3WB 4Z0TA 1NAIA 3H9UA 1U7TA 5ADHA 2WE7A 4G5HA 2C0CA 2ZYGA 1ENOA 1D1TA 3VH1A 1VKOA 3F4BA 1LRKA 1GFSA 4AL4A 3LT0A 3GA0A 4BS9A 1A9ZA 5KVSA 1I5RA 2X9NA 3DOCA 2PGJA 1XSEA 2GN6A 4YT4A 5BSEA 1I2ZA 3WJAA 2EV9A 4R3WA 2GN9A 5EIOA 3INTA 4MVJH 1GQYA 3OICA 1KEPA 4DGSA 3JYOA 3HG7A 3JQCA 4GMGA 3AM5A 1P33A 5DBIA 1QG6A 5EJ2A 1BXGB 5TQVA 2GUGA 3ETDA 2E37A 1LDNA 5HWSA 3KM0A 3S2EA 1XGKA 3S2FA 5CAEA 3PGXA 1ZK0A 1HWYA 4J9UE 3WQQA 2OZPA 2P4HX 4J2HA 4XDYA 4KQXA 4XGIA 2Q1WA 1XWFA 4XJTA 2TMGA 1HE2A 4IJVA 4MKRA 1YWGO 3CH6A 4E30A 2IRWA 4DL9A 3ROPA 4BNGA 2IODA 3INRA 4H15A 1A27A 1I2BA 3ZV5A 1L7EA 3JQAA 1D1SA 1VSVA 2CF6A 1NR7A 2ZCVA 2VUUA 1Z7BA 4U6SA 5CEJA 4DC1A 5T6BA 4RZHA 1LDYA 3WFIA 4XRGA 4AICA 1C0IA 1R66A 3JD4A 3RSHA 1O94A 3RWBA 5C37A 1YRLA 3GHHA 4FD3A 5JS6A 3VPXA 1Y8QB 3RJ5A 4A27A 3WNVA 3ZHYA 4DMMA 3JCZA 2I3AA 3FNHA 3R3SA 2ZQYA 1N2SA 2JFFA 3WTBA 4B4OA 2CDBA 2Y68A 1ONOA 1DDOA 4LW8A 5U9CA 3KYCB 4MKXA 4UAGA 1I3NA 4TKMA 1GD1O 4XDZA 3IIEA 4NJOA 1UXJA 3CIFA 4DPLA 3H7AA 3VKVA 2A92A 3PJEA 3BMCA 5L51A 4CLOB 2P68A 2RH4A 3L0DA 5G0VA 4KTVE 1Y9AA 2X23A 4CQLA 1E3WA 2VUTA 5F1OA 1GY8A 2PKQP 3STHA 5IF3A 2VHYA 1PU2A 1M6HA 2WYVA 5A3VA 1PGNA 4GL4A 5IAAA 1HRDA 4BNTA 3PJDA 3A9WA 3D4NA 3DQPA 3KYDB 4GPD1 4TMFA 1HSOA 1HT0A 2E49A 5FFFA 1XU7A 2FP4A 1DC3A 3LT4A 4OH1A 2XF8A 4MP8A 2P9EA 3PTZA 2I66A 3PQDA 1QYVA 1YB5A 4YQYA 5L40A 4GX0A 1SBYA 2C5EA 1H0KA 1ONPA 1UAYA 1BXGA 2E82A 1IYZA 3D5QA 4MVJE 4II2A 3WS7A 1EQ2A 4DPKA 3PFFA 1QP8A 5CG1A 3CMMA 4YAJA 3UICA 3ROMA 3CINA 1Z75A 3WGHA 4OAQA 4E5YA 1B15A 4TZKA 1YDEA 3AOEC 1EFLA 4WCDA 1U2GA 3RBXA 4CMHA 4Z6KA 4J49A 7MDHA 1LSUA 3Q2IA 4WOJA 3G1TA 3VZQA 3HDQA 4YEDA 3VPSA 2GR9A 4OSOA 1RPNA 4WUVA 4EYEA 2QYSA 3DMYA 2OMEA 2O3JA 4YA6A 3PHGA 4L76A 1U8FO 3GN1A 3JQGB 3TZHA 4CLXA 3FR7A 4N5NA 4P4LA 3GF4A 4FOSA 2RIRA 5C7OO 1BMDA 1P1FA 3NUGA 4KWIA 5MDHA 3RC2A 1G6KA 5EL0A 1UUFA 1Y8QA 1PR9A 3E1KA 1E7YA 2AQIA 2EGHA 4ZRMA 2ZB4A 3PI7A 4TKLA 4S3MA 1CDOA 4YT8A 5J23A 4IMPA 2R00A 3KYCA 1K6XA 4KUEA 3QWFA 4PLPA 6LDHA 4WLOA 5DT9A 1GUZA 1A71A 5A04A 3TQHA 4EI2A 1LJ8A 2UUPA 5KJFA 2BH9A 1MFPA 3ZZNA 1UP6A 1NFQA 1BGVA 4CLOA 1KVSA 1RYDA 1P77A 3BAZA 3P2YA 4CJXA 4IGFA 1YBAA 1RJWA 4DREA 1C1XB 5BR7A 1E1MA 4AJNA 4CQMB 1U3UA 1EEHA 1U3WA 4XIJA 4BNMA 3NEPX 4XA8A 2G1UA 1YQDA 4L0QA 1C0LA 3KYDA 5CFZA 4B7CA 4HKTA 3BZUA 4GLOA 4WLUA 1U3VA 3F47A 2JD0A 2YFHA 3MJEA 4AJ2A 2NU8A 3P7MA 3ZNNA 1D4FA 4F3YA 3JQ7B 3WWZA 5COQA 2BFPA 3LK7A 1X13A 2Q1UA 2X0NA 4S1VA 3BA1A 4BNXA 3DDNA 4EZBA 1YE3A 2GGSA 2QQ5A 1ENZA 2Q2VA 3ANNA 3RC7A 2YYYA 3RD5A 4BQRA 3TZQA 4YAIA 4XB1A 4BNWA 1XHLA 2C29D 4QSMA 5JLAA 1XU9A 5K6AC 4GWGA 5F5NA 2DBZA 1DB3A 1DRUA 3JYQA 2AA3A 2BLLA 3UXYA 5IG2A 1Q2XA 3I9MA 4YXFA 1BSVA 4GSKA 4L73A 1CERA 1XELA 4E0BA 5L7TA 4PG6A 3RUCA 3OSUA 3M2TA 1I3LA 3SVTA 1JTVA 4YWJA 1H9AA 4R9RA 5G2OA 1P1KA 4PG7A 1NAHA 3JQGA 3ZNOA 4YYZA 2AEFA 4BGVA 3D64A 2VWGA 4BO4A 2RAFA 3WLEA 3C1OA 3RQSA 2A35A 2BGLA 1EMDA 2UVDA 2AQKA 4BHTA 1ENPA 2J5QA 1J4AA 1Q0HA 1W4ZA 3BMQB 3DFUA 3O8QB 3OETA 5JY6A 3AW9A 1I32A 4JCOA 3OJLA 2X6TA 2PY6A 3ETEA 4PLFA 3ZWAA 3I5MA 4GLLA 3OJEA 3Q9UA 3F5QA 4PLYA 3U3XA 2YQ5A 3WGTA 1D7OA 3KSZO 2O3QA 2POQX 1PGJA 2JD1A 2O4CA 1XLTA 3PHIA 4FFOA 3Q0EA 2NU9A 3U62A 2O3UA 2HMWA 4XR9A 3ZWMA 3W1VA 4B3IA 5HM8A 2VRCD 2YDYA 2A9FA 3V1TC 3LC1O 1T2DA 3GQVA 4PIVA 3AY6A 3W8EA 1WDMA 1C1XA 2Y1OA 3PLRA 2IYPA 4CQMA 2Y0CA 4NMHA 3DAGA 1U28A 5TX7A 3ZU5A 1NX6A 5CP8A 1I10A 1ZKMA 3WOHA 3C85A 3D4PA 4LMPA 3DZJA 1DFIA 1E6EA 3O38A 3BTVA 1FMCA 4YPOA 2Z1MA 4ZN6A 4TQGA 2B35A 3RC1A 3ZWWA 1A4UA 3RFVA 5JMWA 4BV8A 1PS0A 3TOZA 4BVAA 1AE1A 1SCUA 1QR6A 3JQ7A 2FRDA 3S1LA 2D59A 3ROQA 1LX6A 4IPTA 1PL7A 1CF2O 5L7WA 3BYZA 1B0AA 1UDAA 3F9IA 4K1LA 3M1LA 1E3IA 2GZ3A 1JVBA 1TLTA 2CDAA 2VT2A 4PLVA 4CM5A 4FS3A 4EBFA 1X1EA 1Q7CA 5FYDA 2YQ4A 1OC2A 3SJ7A 4CM1A 4LGVA 4YDRA 1X1TA 2YDXA 3HDHA 2IZZA 1DAPA 1A7KA 2V6MA 3DWFA 3AFNA 1YOVB 3GLQA 3Q6IA 1UAGA 2WWRA 3AOEA 4E2WA 4R69A 2YV1A 1XDWA 1B8VA 4P8RA 3GZNB 4N18A 4OOEA 1R6DA 1O89A 1U3TA 4B4WA 1KERA 2C54A 3BTSA 3KV3O 4EUFA 2OUIA 2D1YA 3I9LA 4H16A 3VTFA 4CMEC 1XQ1A 2ZYAA 3ZI0A 2GN8A 3O8QA 3BMQA 1HDCA 3LSYA 4EUHA 4Q3CA 4UVHA 1O95A 5B12A 1QV7A 4RPJA 2NVUB 1M75A 1MC4A 3GT0A 5A5EA 4YT2A 2P91A 2I9PA 3Q2KA 4J0EA 3NJ8A 1BVUA 4MVJM 3WGQA 3D5TA 2YFQA 4MVJD 2NU7A 4RVFA 4IQ8A 5DULA 4PLTA 4BKRA 2DBQA 3JD1A 4GVXA 4JBHA 4ND1A 1LDGA 5CDSA 3IJRA 3EC7A 1FDWA 4ZQFA 5JSFA 4QEDA 3E48A 3L6OO 3WBFA 4NDNE 1N5DA 1YB1A 3Q3CA 1F8FA 1OMOA 2XPCA 3OQBA 1O5IA 3ANMA 4CM6A 1JWBB 1GV1A 4NG5A 5JAQA 4CLRB 4BO2A 4EUEA 2X8LA 3GHYA 4HBGA 4NFSA 1H6BA 1OC4A 3S55A 4ZGWA 2EWMA 5I9NA 4FB5A 5B4UA 1GZ6A 1PQPA 1C14A 2Q99A 3L9WA 3G79A 2R6JA 3ON5A 4XD2A 1WMBA 3A4VA 4QT0A 1SZJG 4INAA 4YB8A 3M1AA 1JU9A 5B1YA 1HLDA 1GYRA 4UUNA 1G0NA 2C5AA 2HK7A 3IQDB 5DBFA 1XKQA 5G0WA 4PVDA 1P44A 2HAEA 3DOJA 4WE3A 4DMLA 3E9QA 2I5PO 4MVJG 4YCAA 2X4GA 1ISJA 3PDUA 4YRDA 2PTGA 4YQZA 4YVFA 1JN0A 2O7SA 4BMVA 3F1LA 3FWNA 2YHIB 2BD0A 4U7WA 4FJ0A 2I3GA 1KYQA 1TT7A 4XYGA 4ONEA 2GF2A 1YOVA 1J49A 3ZU2A 3UH1A 4RCVA 1EUDA 3AY7A 4OQZA 5K6AA 1JQBA 3H9QA 2J3HA 2HQ1A 3CE6A 4IJUA 1ZXLA 3GZNA 2EGGA 2J5KA 1YQGA 3K96A 5JCJA 2WMDA 3ENNA 4FFRA 1Y7TA 5DCUA 1E1LA 4IQGA 4DQXA 5KJ6A 3O9ZA 4DIOA 3SJUA 1EVIA 4J90A 2BGKA 4M89A 3H5RA 3GPDG 4E3ZA 4A10A 1MV8A 2TMDA 4E5MA 3KLPX 5EQDA 5JBIA 2A94A 4DYDA 5CEEA 2B5VA 4BMSA 3P19A 3F3SA 4R51A 2NVUA 1LI4A 1BDBA 3B20A 1H2HA 1W8DA 2X9VA 5KWEA 3K30A 3KEQA 3N74A 5ES3A 4D0RA 1UR5A 4DVJA 1I33A 1N92A 2VZ0A 4Y9DA 4Y8VA 2GRAA 4HWKA 4E32A 1RYEA 3VH3A 2ZCUA 3QIVA 3GFBA 4WLNA 1HSZA 2ET6A 5I7VA 3AI2A 3PYLA 1TA4A 5GMOA 2PR2A 2AEMA 2JHGA 1N7GA 2B36A 1XA0A 3TL2A 5H83A 1KETA 1CWUA 3D1LA 4WLVA 1EUZA 3U9LA 4RVDA 4CLRA 3PP8A 1N8KA 4OKIA 3WDSA 4HFMA 5CDUA 1KOLA 1GAEO 3R3JA 2V6GA 3U49A 4TZTA 1BHSA 2EHDA 1DIAA 2VCYA 3PVZA 4M86A 3LQFA 3VC7A 4IDFA 1UXGA 1JKFA 3ONDA 3AK4A 1I2CA 2W90A 3JSAA 3PLNA 4O0LA 3RC9A 4DIFA 1V9LA 2ZKLA 3C1AA 2FHSA 2VZ9A 3QY9A 3DL2A 2Q46A 1ISFA 1F8GA 1O0SA 2FY8A 3AUTA 1IY8A 2PH3A 3INGA 4O63O 4CMAA 1DIRA 1DBVO 1TB4A 3R1IA 1KEWA 1KVTA 2VYVA 4QFDA 3EGOA 4XYMA 2B83A 5A1TA 3PHJA 2BFMA 1NVGA 1DSSG 3JQFC 3PQFA 3ZU3A 2DBVO 4D42A 4H3VA 3ICPA 3G49A 1XYGA 2GPTA 3LC2O 2YHIA 2IXAA 1DOHA 2HSDA 1UDBA 5BT9A 1NQTA 3I6QA 3QLJA 4YJFB 2EF1A 1DPGA 1E3SA 1QYWA 2JKVA 3AUSA 4ALKA 3OBBA 1GPDG 2IYOA 1WZEA 1HETA 1B3RA 4BNVA 3OIDA 4HFNA 4BO9A 2Y66A 4R1NA 1LC0A 1ZZEA 3QP9A 5L4LA 2BI7A 4IS2A 2FR0A 4XWYA 2BF7A 2NACA 5JC8A 4MIEA 2X58A 3GOHA 4BNNA 3EHEA 5CEFA 5JFOA 2R00C 3CMCO 4FJ2A 4P22A 1I0ZA 3HADA 4AJPA 2JAPA 3GNTA 4UULA 1EE9A 4JJIA 3EZLA 3GAZA 4I08A 4UEJA 5ICMA 3U4IA 1WPQA 1XEAA 4F6LA 1PTJA 4ALMA 1I3MA 4R5MA 1ORRA 4OQYA 1E3JA 5FEUA 1GUYA 2FSSA 3NTOA 4RPKA 1BXZA 1ZO8A 1RKXA 4MIYA 1RM0A 4BMNA 3CSDA 5G0TA 4BKUA 3VH4A 2GASA 3NTRA 3L9XA 4ALJA 4FQ8A 4DLBA 2ZYDA 1I30A 1TT5B 4FBGA 4J4HA 2VYVD 4GX1A 1IB6A 1R16A 4IUYA 1M76A 3JD2A 4KOAA 2O23A 2ILTA 1YDWA 1FDUA 3ADPA 5JAZA 2DBRA 4MINA 3GGOA 3QVSA 1ZFNA 4F6CA 3W4IA 1P3DA 2IEDA 4B3HA 3D3WB 3NDRA 1MC5A 2DTXA 3WSWA 4NQZA 3L6DA 2GN4A 4IS3A 3S2IA 1CQIA 3PEFA 1PZGA 1T1RA 3HWRA 3SLGA 2GYYA 1NP3A 1U7HA 3X2EA 4JIGA 3E03A 4P4GA 3TL3A 4HFRA 1ZVMA 1NPTO 3KTDA 3VZPA 2HU2A 1NFFA 2DQ4A 1ZBQA 2Q45A 3B1FA 1NPYA 2VWPA 3GGPA 1DC4A 4BKPA 1K2WA 3DTTA 3HHPA 3H8VA 2QYTA 4CM9D 3TJRA 3JQ8B 1V3VA 3DBRB 3EUWA 2DTDA 4FOOA 1D8AA 3FF4A 2GZ2A 1UH5A 4IXTA 3FI9A 1NQOA 4CV0A 1B26A 2PZJA 1SOVA 1B2LA 2JCVA 1G0OA 1PGQA 4TVOA 1T26A 1I36A 1YL6A 4J7XA 4RV9A 4UUMA 1U5CA 3ZNPA 3GEDA 5H82A 3GRPA 4CMGA 4I5DA 2OBYA 4YJFA 1I8TA 3LZ6A 3TPCA 3D3EA 4OXKA 4Q9NA 4BNKA 4ALNA 1WDLA 4WJZA 2C59A 3KXDA 5EMHA 3UUWA 1Y81A 1PEDA 2VNSA 4LMRA 4W6ZA 3ST7A 3M2PA 1VC2A 3MJ4A 2HRZA 4IMRA 4YT5A 4RF5A 5TJHA 1EDZA 4I5EA 2VTDA 4E21A 4MOWA 1LSSA 2DTEA 4E2XA 2YZ7A 2EW2A 2VWQA 3UF0A 1UXIA 3B6ZA 3PYXA 5JDIC 3K73O 4WOKA 4NBWA 4A26A 3UCXA 2VUSA 5DNAA 4BNUA 3MJTA 4YRBA 3W8FA 2Q2QA 3GEGA 4OXYA 2O48X 4XEHA 2I76A 1HF3A 3OECA 4E13A 1LDMA 3JYNA 4L4XA 5IN4A 1IL0A 3KYBA 2JFHA 4PZDA 1Z82A 3ZNQA 4GAEA 4NHEA 1AN9A 3QJ5A 5THKA 5C5IA 2DT5A 1YJ8A 1VM6A 1TT5A 2PK3A 3KLMX 3PGJA 4GX2A 4NBTA 4Y6RA 4AJIA 2GO1A 4Z9FA 4FIZA 2NWQA 5JCXA 4R9SA 3H9GA 4AJJA 2Z5LA 1GYQA 5L45A 4PRLA 1ZEMA 3IP3A 3D3WA 4J1TA 2OO5A 2P5YA 2Y1FA 2VT3A 2H5LA 4XQCA 1B14A 3OMLA 5BSGA 2X0IA 5IXYA 1HKUA 1LQTA 3DZGA 3BTUA 1QV6A 1C3VA 2QZZA 4JP3A 2VRBA 4BNJA 4LRTB 3CZMA 4L75A 4JN6B 5FWNA 3E6AA 2Y1CA 2X1HA 1OZAA 4OM8A 1SO8A 2ZJ1A 3JQ8A 3DBRA 5JC1A 3WYEA 5BNIA 2WSBA 3DHYA 3WTCA 1UP7A 3DO5A 2Q2WA 4HUJA 5A4DA 1QYDA 3O03A 1FK8A 4JNKA 3PK0A 5C7LO 3QWIA 1LLQA 1VPDA 3H65A 2BFAA 4TWRA 1O8CA 1A7AA 3ULKA 1EZ4A 3H5AA 2X5KO 4AG3A 4HADA 4CMBA 8ADHA 4I9NA 1LA2A 2D5AA 3AM3A 1PZEA 4BNHA 5JDCA 4AFNA 4BQPA 8LDHA 1IZ0A 5JXWA 3FHLA 4D79A 1QORA 3JQFA 4I1IA 4LN1A 4URFA 5A02A 1A72A 1AXGA 5EQFA 4ZQBA 1HLPA 1NXQA 3WGIA 1HDZA 2HUNA 4TSKA 2X5JO 4BGEA 1H6AA 2YUTA 3OM9A 3TZCA 3UHAA 1PZHA 5B4TA 4NNJA 3G17A 2CZCA 3NRCA 4B3JA 3KZVA 3D4OA 1Y1PA 1HDOA 4YBZA 1QKIA 3WMWA 2NM0A 2JJYA 3I4CA 3MCVA 2NU6A 4QECA 2QRLA 2YHUA 5KNLA 3MTGA 1IUKA 1ZSNA 3GUCA 5U4QA 3I4FA 5IN5A 2P9GA 4K6CA 4MIOA 3VPHA 5K9ZA 1X0VA 1P9LA 3TZ6A 3UN1A 1R0KA 1YS4A 4IDEA 1BRMA 3NKLA 2IDZA 3GVPA 2G76A 3LF2A 3GC6A 2CD9A 1GR0A 2QIOA 3B1JA 1SC6A 4RPGA 3HJAA 1EVZA 1M6WA 3RBZA 2EXXA 4IDDA 5KKCA 4XYBA 4Z0HO 1PX0A 1PJCA 4B4UA 5HS6A 5ER9A 1EFKA 4XRRA 1P1JA 5JO9A 4M8SA 4IIVA 4RF2A 1YL7A 2E6UX 4KUGA 1ISGA 2NVWA 3HFGA 1AUPA 3OH8A 2D8AA 1PWXA 1DXYA 4LCEA 4DIBA 5JW6A 4J0FA 4RVGA 3T4XA 2AG8A 3SLKA 3U4HA 2Y0DA 3KSUA 2PKQO 4ZA2A 3IMFA 4E4YA 3NYWA 4C4OA 4ND3A 2XAAA 1Q7BA 3D0OA 3RUFA 2C2XA 2NNLD 5IDQA 2CFCA 5K0ZA 1MX3A 1AHHA 4UVEA 4G81A 2SCUA 4IQ0A 4GMFA 4ZQGA 3QWAA 1TVEA 1MP0A 2VRCA 2VHXA 3FBGA 3WGGA 4QUKA 1VL6A 1IE3A 1SOWA 2ZQZA 3G3EA 5COBA 4BO7A 4IDGA 2NVBA 2IZ0A 1PJ3A 1GDHA 2PKRA 4FC6A 1WW8A 3GDOA 3WFJA 4DLLA 3C1TA 2FSVA 4D45A 1HYGA 5JPIA 4J16A 4R3NA 1W73A 5ILOA 3ASVA 1NR1A 3OIFA 3C24A 1LU9A 3KO8A 4OJNA 3QVOA 4E12A 1QYXA 4XQ9A 3V5NA 1ID1A 3DZHA 3GZ4A 3ZWYA 4CR6A 3GVHA 5I9LA 1X14A 1PGOA 4FPXA 4RPLA 5T64A 1E7RA 1T4DA 4RF3A 4U8GA 4QTZA 4XYEA 5L7YA 4IZHA 4ALLA 1OI7A 2UDPA 1HL3A 2VOJA 1CJCA 4Z3DA 2FOIA 3PYMA 3GEMA 4YAKA 2C82A 3IAHA 1KEUA 1OAAA 4GQAA 1PWZA 1HE5A 1NWCA 4BIIA 4B7UA 1ONNA 3TNLA 4ZQHA 4DA9A 1QXSA 2V65A 4YACA 1JW9B 1UZLA 2DUUA 1NNUA 5JNLA 5JDIA 4DWVA 2JAHA 1DC6A 1M66A 1L1FA 4FGSA 2ZTMA 3QQPA 1PL8A 2WJPA 4TRRA 3FRJA 2ZATA 1HZJA 3WLFA 4BNYA 3I6IA 1DIGA 3E82A 3C3XA 2CUKA 1GL3A 2DPHA 3V2UA 3DEYX 3WB9A 5L4SA 4FGWA 4BNIA 3H3JA 5JY1A 1UJMA 1ADBA 4MJLA 4JBIA 4CMKA 1T1SA 4CMJA 3I9NA 2NQ8A 2EIHA 2GD1O 2W2LA 3LC7O 3A06A 3IP1A 2Q1SA 2HMUA 4AJ1A 3WIEA 4MVJA 3ABIA 2PZKA 1U9JA 1UXHA 1WXDA 4L8VA 5CDTA 4XX0A 4FN4A 5GZ6A 3QWHA 4NU5A 4BB5A 4I8XA 1HDRA 1SNYA 1EQUA 3H3FA 4YJDA 4J4TA 3V2HA 4DPMA 4QQRA 4HFJA 4E2ZA 4QFCA 1LLCA 4XZ3A 4A7PA 2F1KA 2O2SA 4NBRA 3I52A 3PJFA 3RCBA 5DF1A 1NHWA 1E7SA 2JL1A 1X15A 4IDCA 1KC1A 5T67A 1MXHA 4IJKA 1CRWG 4JLWA 4C7KA 1PSDA 3DFZA 1M67A 4W99A 4CLDA 3AWDA 4R1SA 4MKZA 4M49A 3VH2A 3OA2A 4BO1A 3JQEA 2HJRA 1QLHA 5DBGA 1B8UA 4TRJA 4H7PA 1GQQA 2HK9A 5BSHA 4DXHA 1LSOA 3MEQA 1LBEA 1Z73A 4BNZA 3GDFA 1ZSYA 5L4NA 3N7UA 2I6TA 3NAQA 3H9EO 2DFVA 2YY7A 4JROA 3Q9NA 3QRWA 1E0DA 3GNSA 4IIUA 1FF9A 3ICCA 4R1UA 5G0SA 3JTMA 2W2LD 5KVVA 1DLIA 4PCVA 4FR5A 2CVOA 4AJ4A 1HE3A 2J6IA 2WM3A 4JGBA 4NPCA 4UUPA 4B8ZA 3V2GA 4EW6A 1HYHA 2Q1TA 5DN9A 3PPIA 3WGZA 4Z3KA 2AQ8A 3SEFA 1YH3A 1Y5MA 2G0TA 5F1PA 2WE8A 2I99A 1DHRA 2B4RO 4LRSB 4AJKA 3F4LA 5DCYA 4D7AA 5A5FA 3VHRA 5B4VA 4K28A 3GH3A 3GVXA 4DRYA 1IHXA 1U4OA 3DBLB 3W6UA 3AI3A 1ZK1A 3BXXA 1ZJZA 3RFXA 2DM6A 1HZZA 2NUAA 3K5PA 4B79A 3MTJA 4FJ1A 2OHXA 3QWBA 5LDHA 1LDEA 1R4MB 5I8WA 3DBVO 1QRRA 4XR4A 4G65A 4PZCA 4PZEA 1A9YA 4R1TA 3GAFA 4GH5A 1CIVA 5G4LA 3F1KA 4LVUA 3UW3A 3ZWPA 3WQSB 1B7GO 1WWKA 5JE8A 1IULA 1DJQA 3PWKA 3WXBA 5A03A 1GCOA 2VWHA 1H9BA 3MJVA 2BRUA 3G0OA 4HNGA 4M55A 3WYCA 4AJOA 1NVTA 4HX5A 1LSJA 3DZIA 1K6IA 2B4QA 3RAJA 3RKRA 3RKUA 2EERA 4NIMA 5JAMA 2I65A 1SMKA 4EJMA 3ADOA 3FCOA 4BUCA 4U6QA 3HQ4O 5HA5A 2C07A 2YV2A 1YB4A 3NGXA 4R41A 1SEVA 2HCTA 1LTHR 5BQFA 1JLLA 2VYND 4KWHA 2RH8A 1KVUA 1E7WA 1ZCJA 5A3JA 2GNAA 1ZEJA 4J1QA 4D3FA 4TVBA 7ADHA 1P1IA 2ZJ0A 3FD8A 4LISA 1ML3A 3OJFA 1YKFA 1ZK2A 3CXRA 3NJ4A 4Y6PA 3RI3A 3SX2A 3IUPA 3WICA 2CF5A 3ZWBA 4OO3A 2E4AA 3AUUA 2AW5A 3JD3A 2EKLA 4UEOA 3JQ9C 2FZWA 4OXNA 3OF2A 1NQAO 3ZWCA 3MJSA 4M87A 3VPFA 2X0JA 3VKUA 1ZJYA 1C0KA 3FPLA 2EKPA 1T25A 2RBEA 1FDSA 3F5SA 4WECA 2DLDA 1KIFA 4IM7A 3MZ0A 1D3AA 3FTNA 5AVOA 5I8ZA 2LDXA 4NFHA 1Q0LA 1RM5A 3RUHA 3W8DA 1PGPA 3DR3A 3G1UA 4PLGA 4WLFA 5EPOA 3LU1A 3ZHXA 3KETA 1U8XX 2OGUA 3LT1A 3LVFO 5TC4A 5DP1A 1XG5A 3HN7A 4J1SA 2FR1A 2CNBA 1DHTA 3RVDA 1N1GA 5FF9A 5KTKA 5IZCC 3DAPA 3HE3A 4KMSA 3RU7A 5JYEA 1W6UA 3LLSA 5AXCA 1T4BA 3DBLA 3FR8A 1NQ5A 3PIDA 1C1DB 2EP7A 3DHNA 5CDYA 1R4MA 2W98A 1DRWA 2XXBA 1ZH8A 4IZIA 5HS4A 5EERA 3AOGA 3VVCA 4BGUA 5KOIA 2C2YA 1ZIDA 4MO2A 4CPDA 1ULSA 5G4KB 4NR0A 2HRBA 5T57A 3RFTA 3RJ9A 5MGBA 1H5QA 3AJRA 4NBVA 4QO7A 4NH4A 3A28A 5L95A 2JFGA 1WVGA 4Z0PA 1QYCA 3M6IA 4B7XA 2UV8A 3ZWVA 2FPPA 2FPIA 1XQ6A 3IKVA 1GZ3A 4RLSA 1KVRA 3UCEA 1Z45A 5AXBA 4RF4A 5JDCC 2W2KB 4EEZA 4GKVA 3QHAA 5KJEA 1I3KA 3CKYA 2O7QA 1PZFA 3TZKA 4TRMA 2V7PA 3GMSA 4E5NA 3ZWNA 4IINA 4UVIA 4MDHA 3E8XA 4J7CA 1ARZA
chains in the Genus database with same CATH superfamily
2NZ2A 5IUNC 2WSMA 1NUTA 2A9QA 2H2DA 1U2DA 1BEUB 1FY2A 4HQFA 2NU8B 2ODPA 3T1VA 2OQRA 2QM0A 2PCJA 1ILEA 1IIRA 3MAAC 3C70A 2QN9A 3R7LA 1GGNA 4NXNB 1HT1E 3SJAA 1RC0A 2IY8A 5BNZA 3OTOB 2C9ZA 1O5TA 1GCGA 4XYLA 1PNVA 1MMFB 3OKCA 4DDWA 1JHOA 5CA0F 1J5PA 4IILA 1MQAA 1T34A 4CM9A 2MYTA 1E63A 3EOZA 3OZDA 2EW1A 2ZK7A 2DHCA 1KYWA 1ZSVA 3JY6A 5JWRA 2QJTA 2LRHA 1ISMA 3NYQA 3QUQA 4EMUA 1YVPA 3CRW1 3Q7PA 1J7JA 5EHXA 1G1AA 4W7IA 2IHJA 2UZ0A 2YHSA 3HXLA 1ZUNB 2MINA 2H5JA 4R8LA 4U5QA 3L7IA 1ZGHA 3SYRA 4OGKA 5TSDA 1F14A 3PUKA 2GD0A 3AONB 2H7YA 3SQWA 3OPYA 3KEMA 2OHFA 5SICE 3E0XA 3REQB 1K89A 5LBTA 4L15A 3CSSA 4UM8B 2W6MA 4LK3A 1D2GA 1P0CA 2X7XA 5J58A 4CLHA 4RMJA 5DYGA 1EX1A 2INGX 4HPWA 1RBQA 4PXYA 5U1PA 3T38A 3ABRB 1F0YA 3HJGA 1HLGA 1RJ9B 4NX2A 5ITVA 4CFYA 3VFDA 2ERYA 3H86A 3DV0B 2YOFA 1C1DA 3GNQA 2XRFA 1VMEA 4OHRA 2ZWVA 1Q7GA 4LYJA 1F5NA 1RP7A 2BEUB 4RV5A 3ZN2A 2RGBA 3I58A 2KB0A 1PQYA 3CPJB 2J8ZA 3MRVA 4FBMA 2HWKA 4IP0A 5KVAA 1H0SA 5JHGB 1YFLA 1VHWA 5AJVB 1PSZA 1TW2A 4KQFA 1M1UA 3DC7A 5JNWA 4PHTA 2J3QA 3DV9A 1U8AA 1XZJA 1NM5A 4KFUA 5DP2A 1Y1SA 2PGOA 1ZI9A 3OX2A 1DC5A 5JNUA 1PUXA 1VB3A 4IFBA 3OPXA 1OU0A 3KVVA 1L1QA 4GGPA 2NZUG 3RTEA 1GGKA 1BKDR 2QX6A 3NBUA 3HDJA 4MYUA 1JTFA 5HTOA 1SHKA 2PZAA 3GT7A 4FFVA 1OSNA 1KI1A 3GFSA 3WJ1A 3ROEA 1JDJA 4UHHA 5LXTF 4CDNA 1EP2B 4TMVA 5C0OE 3HCAA 3M6AA 4M0FA 1B73A 1XTKA 3MINB 4GWKA 2QW8A 1FFWA 4AUMA 2IK8A 1N2CE 3K15A 1O4VA 4TLEA 5DBOA 4XQEA 3AB3A 2IH5A 1LQUA 1L9XA 4QYSA 3AZQA 3LX4A 4IEIA 3UAVA 1EXMA 4ZCQA 3KJHA 1JB9A 1E6WA 1C29B 3PC8A 5AVVA 2R79A 1NU6A 2QNRA 3ZWOA 3TE7A 2OCLA 3DZBA 5HUQA 2OEPA 2WG1A 4DRZA 5BV7A 2AFVA 4JJGA 5DDIP 1FTNA 3KQOA 2EQBA 4YP9A 1R10A 1RHUA 3BG5A 5AHKA 3QTLA 3OO0A 4BNFA 3AFMA 3D6VA 4QRDA 3DMTC 1EBUA 1ZW1A 2EBFX 3A05A 2LIPA 3BSWA 3QFCA 4M0CA 1N7HA 1QCZA 3GRAA 4L7QA 1YVEI 2CLCX 1R12A 2V6IA 4XGKA 4EHAA 1GCIA 1T5OA 3K2BA 4BKMA 1N5MA 3D0KA 1JZSA 4M54A 1RMTA 4MWSA 1E2HA 1FYDA 2IBMA 4AF6A 4E94A 2QGNA 4MLPA 3KSBC 2PMEA 3RBVA 2QRPA 2NV6A 5CFNA 1USVA 1AO0A 3ZTTA 3S40A 1RTTA 3KKMA 5C53B 3K0CC 3OZAA 4WXHA 4Y6QA 3UO8B 3CX4A 5C8DA 1Y9DA 4JQZA 3ZV4A 1HDXA 1KEVA 3LA8A 3P4YA 5DX0A 2FPUA 5HGJA 1XKTA 2UZ3A 2Q07A 1ZGJA 4DBVO 2PT9A 1RW4A 4LNAA 1K5GA 4PSVA 2DCMA 4DR2B 1SBZA 2QTTA 2Q8PA 2UVPB 5KS2A 2C99A 3JZFA 4DQVA 4ZANA 3NHAA 4X1YA 4DJ5X 1DBQA 1M2WA 1P6XA 3HXTA 2BEJA 4GX5A 4MTCA 3H6KA 3KFXA 2O9JA 5ESRA 2KS6A 2VH1A 2OKGA 1T2CA 2PGDA 1R6BX 1NN3A 3E5RA 1BN6A 1M34B 2JJ2A 2JZCA 4GKAA 9LDTA 2G1PA 3A6ZA 1IPFA 2V7GA 3ZZ0A 1P4JA 3ZOZA 3AV0B 3DFMA 4K8RB 1PR0A 1XD2B 4O1HA 4DY6A 3QA9A 4HN2A 4RD1A 4JU9A 2ASEA 3ESRA 3GN2A 5ADUS 4OM7A 3U39A 3HA7A 1DE0A 1OJ7A 1G1MA 5JARA 4JI6B 4HXGA 4O2AF 2B5WA 2AYYA 2AK3A 3JVEA 1YR8A 5KAMA 3KKKA 2HK8A 4P4SB 3WL7A 4JUBA 5DOVA 2P35A 2YFKA 4JODA 4XCVA 3IUSA 4V24A 1FUEA 1NJFA 1E1CB 2W6ID 2XUQA 1XCOA 4UASA 2OXIA 4O4IB 2PBRA 5E2AA 1UBEA 2XZPA 3OLQA 4K6MA 3AM4A 3SNHA 2OZLB 1SG9A 4ADSG 4C5BA 1JKJB 3D9QX 1UKVY 4PLHA 1ZISA 3B70A 3K53A 5TEVA 3CEJA 3U4DA 3H87A 3UPUA 1VJTA 3ZTYA 2YINC 4JEMA 2BKAA 3O26A 2PD3A 1QK5A 5FPTA 2DLNA 2P9HA 1X7GA 4I9GA 5FI3A 4OLHA 1BS9A 1CUZA 3KT8A 2GPYA 4ZD6A 3DZFA 1VE6A 1MRZA 1XTZA 2BGJA 1CUEA 2WF5A 4WACA 6AT1A 3ZCTA 5FPKA 1JS1X 3OF3A 4M6WB 2OO7A 4CM8B 1LPNA 4WXEA 2J0VA 1P62B 4YAUA 3ZVNA 3T9CA 3I04A 1RCFA 1UM9B 2NV2B 2Y92A 3NT4A 1Q0ZA 3DMFA 2Q6OA 1B0UA 4LOHA 4WEOA 3AVPA 2PZ8A 5A9TA 2D7DA 1VPWA 1YRBA 4DCJA 2NZJA 3AVOA 2IYWA 3MMZA 3ISTA 3NT5A 1EVKA 3OCWA 5ALTA 4B48A 2EU8A 3O74A 3WK5A 4IXDA 2NADA 2Q62A 3Q3EA 3ZJ4A 1G5QA 3QBJA 2DKNA 3CG4A 2ACKA 2O14A 3LC0A 1X6VA 4JUIA 4DB2A 1KSJA 4FZ5A 4ZT5A 2OY0A 5AXDA 1WP4A 2JJ1D 3U09A 3LYLA 3R7NA 2UU9B 4A2WA 4C7XA 2G71A 1OXBB 3I2HA 2O2YA 2HU7A 1TQ8A 2AK2A 4Q34A 2WY2D 1GPLA 3QNUA 1QHHB 1CQJB 2RGAA 3KTAB 4IIEA 3S2UA 5J3JA 1IU9A 5B3LA 3L1JA 3FRHA 3GUZA 4ASUA 2I2FA 3HWWA 2QTNA 4QRIA 2Q5JA 1E92A 1VCNA 5TS3A 4HDCA 1GAXA 2V0CA 3LUFA 4UU1A 3ILXA 4WXMA 5DIFA 5EESA 2WK1A 4CTNA 2BE9A 5HSGA 1S8NA 3W2TA 3WY9A 3ZXUB 3DL4A 5JU6A 3ND9A 5J5AA 1EG7A 3V6MA 2HREA 1M6VA 1ZA1A 5CDGA 3DXXA 3CEPB 2OILA 3R9IA 4EDFA 4XW2A 2G28A 4ZOAA 4BASA 5U4XA 2G5CA 1N1EA 4NU8X 1SHJA 4M0LA 3K0SA 5AHOA 1KQFA 4N4AA 4F84A 5ISMA 2Q6KA 3PDIA 5CG2A 3D4BA 1NMQA 1Q74A 1V3TA 4JYBA 4KBGA 3ORYA 1T2NA 4P3OA 1YU6A 3SQMA 4PW0A 1ULUA 3Q11A 2B1JA 3S5UA 4I9UA 2LV8A 1C3JA 3RBAA 4Q7LA 1FFCA 4M0DA 4DCGA 1BWQA 1FFGA 1SUPA 2FLVA 1ZQ9A 2AR9A 4TTJA 1B6TA 1I4EB 3TRIA 1NE2A 1XK7A 1MNQA 6YASA 3F73A 1FMTA 4BO8A 4C7MA 2AN3A 1L7QA 3QYFA 1KY5A 1LX7A 4KRGA 2IU0A 2M32A 3V4LA 2HLPA 5T8KC 3WR5A 1KY3A 4I46A 1UK9A 4R2JA 4ZOEA 4D41A 5I7FA 2MSCB 3GUYA 1OWOA 2P0AA 5FO0A 3S28A 2AMLA 1MAAA 3WDMA 3P0JA 5CB8A 4F2DA 3DZDA 1RWXA 3G9XA 5H3LA 2V7EA 3O8NA 5KVQA 1Z7WA 2AG5A 3S0JA 3RC3A 1PK7A 2ZAGA 1A3CA 2JI7A 3GGGA 4HNRA 4LHYA 4RK0A 4WN9B 5EJGA 5EJAA 4B83A 3GT3A 3CTMA 5HQJA 2UYYA 2EX1A 1ORWA 3FZNA 3QKRA 3C6KA 4RTOA 5TV2A 4CM7A 4RIHA 4YQEA 1XZIA 2FPGA 2XMGA 3C3DA 3WNCA 1IVNA 3G2MA 4IDAA 3WYFA 3OZSA 2WJ3A 2X76A 2QB5A 2BMAA 1ESEA 2AQHA 2ZFUA 2HMTA 2NGRA 3UJ7A 4EECA 5FWDA 4H7IA 2O5RA 1L4UA 1XTJA 2OV3A 2RONA 2SECE 4N1AA 4NK5A 4TT8A 1CB7A 3EZ9A 4EQ6B 3PNLA 4URXR 3LDHA 5HXAA 1YR1A 3TVYA 3I0NA 1AGRA 3G8CA 3IV9A 4PYIA 4TQUS 5KTPA 4EKGA 1GCUA 2P5SA 4KUHA 4BNLA 1CEEA 2DPGA 2OLJA 3U5TA 2C7GA 5HPYB 1Z5PA 1EVEA 3CX7A 3NETA 5LDGA 1R8JA 5G40A 4NXMB 2AXQA 3G2PA 2P27A 2B4TO 3N2GA 3BAFA 4UATA 2AE2A 2XB4A 3HKCB 5LCXA 4JK3A 2EZUA 1GU0A 1WXIA 1A97A 1JR2A 2IYLD 1EXDA 2YN0A 2GF9A 4IY1A 4BJ1A 2F62A 3GJZA 3M2PA 3L07A 4LDZA 4BFXA 2X9GA 2EJWA 5H81A 3ZE9A 2G9NA 1E32A 1GUFA 2PRIA 4NY1A 1VHLA 2JCBA 4QOSA 1ZMOA 1THZA 2GXUA 4F8EA 3UANA 2JH9A 2QJOA 1VPVA 1XDDA 4OQDA 5F4BA 3N8GA 4ZCTA 2RAPA 5ESWA 5CXUA 2Y67A 2CB9A 3P94A 3ZY2A 4HATA 1F8XA 3COZA 4LOKA 2VQ6A 4RY2A 5BPHA 3PQEA 2OQVA 3PX7A 3ND5A 2R1VA 4XSVA 3P9QA 5FOQA 4GSYA 5KVCA 2OV4A 4ZQEA 2PUVA 2YMQA 4LCBA 3I37X 5K8IA 1JIKA 1KRWA 1E20A 1MO6A 3JQBA 3VGJA 1RLTA 3HU1A 1JG4A 3HDYA 3NANA 4MJ7A 3LUBA 1B3BA 1H42A 3KWMA 1LUAA 4Q82A 4AAYA 4F2WA 1TTQB 1H3FA 3GLGB 3D6FA 3D2BA 4AUEA 3NHMA 5C9ZA 3RARA 2NV0A 2VTEA 3FTPA 3O92A 4IGKA 1ZIXA 2XE6A 4JL5A 1M74A 5L3ZA 3UWMA 5K6RA 2PPVA 5JISA 3OZGA 1D2MA 1PJ4A 4RC9A 3DDOA 4TTIA 4EPVA 7MHTA 1RM3A 5BMVB 2CVQA 1TK2A 3SDSA 4OFWA 4MRNA 4UNNA 3IVGA 2Q3FA 3C8MA 2JRLA 4FILA 3ZCRA 1AV7A 5EYPA 3D8NA 3ZW9A 4QM7A 3W4JA 2B6HA 4D46A 1DFGA 2H65A 1OIWA 4G9BA 4IBOA 4MRPA 4F4JA 3IEMA 2O8DB 2W6PA 3I4LA 3DZKA 4ITVA 4BBAA 4JB8A 1U2SA 1MRNA 1VI2A 3KKZA 4R6XA 1ZUHA 2C98A 2NZWA 4J91A 1YQXA 2IPXA 2VSYA 3DXYA 4YX9A 5H4GA 1YS7A 1H69A 2EKDA 4Q19A 2JCXA 1JEYA 5COAA 4HUQA 2IIBA 1DEKA 5GPBA 4ZDJA 3DTYA 3OWHA 3AKDA 3QPDA 4M53A 3E3MA 1QFJA 1GUBA 3OBIA 2OBMA 1DCTA 2BLNA 2O07A 4S24A 2PR7A 2X42A 2LDBA 2XA2A 2DF8A 3L40A 1EZ1A 2PT7A 2R6ZA 4IVNA 1L7DA 4LWOA 4G2TA 3T9BA 3TO5A 4IJWA 4EGFA 4PFQA 5IAOA 1YCHA 4KSCA 5FL3A 4PPNA 4E15A 2L42A 4FUQA 3UMMA 1GU7A 7REQB 2E21A 2H7XA 1EK6A 3ZS8A 4D9JA 2QRKA 3G6KA 2ZULA 2ONKA 4FMBB 2HDHA 3CNOA 5B1EA 4F4FA 3BFVA 5FA6A 3QVTA 2BR3A 2R68A 3DDSA 4S1PA 1NW7A 3UMCA 4CKYA 1JZQA 3OD5A 3Q9SA 2IEYA 2DKFA 3BEDA 3QYJA 3WNBA 4BPRA 3ITDA 3WC4A 2H9IA 5IXSA 2HXYA 4CKBA 4QDUA 4DKXA 1QHIA 3U9TA 3KSMA 3DAFA 3R3VA 4NE2A 1NN5A 2Q9AA 4DSZA 5JAIA 4AXBA 1AK9A 1HM5A 3UB2A 4CQMD 3LAWA 5CFLA 1BE1A 5E9WA 1IFXA 3DMPA 1PT9A 3CEAA 3IV6A 3IB6A 3LKBA 3LDGA 1PNRA 1N6HA 1PFUA 3BN3A 2BELA 3N2EA 1C0PA 1ZAKA 4AY2A 2PUBA 2ERXA 2ONYA 5KYYA 2VCHA 4EG8A 2AWOA 1O97C 2VF5X 1ZNZA 1VJ0A 2P2ZA 2W2XA 3H0CA 1V26A 2OBNA 4PSDA 4N5HX 3PT5A 2R86A 3UAWA 3PX2A 3TSYA 2ZZNA 4MGIR 5KQRA 1POXA 4I9HA 2PD6A 3WLIA 4DXDA 2R11A 3KEGA 5F23A 1W19A 4I1VA 2NZVG 4HTAA 5BORA 4RQTA 1IB0A 3UJBA 4HNTA 1G4HA 2QN2A 1W5EA 1W94A 4OGLA 3H99A 2ZBDA 3IS3A 5FIUA 2GPBA 5JJCA 1OH6A 3AVYA 1RWNA 2AOTA 1QH0A 1VTKA 2IXGA 2DQSA 4L50A 4ZHSA 1FC0A 1UKYA 2CW5A 1KY4A 3G8AA 1BKYA 2H1SA 3I32A 2J5RA 3HNPA 3L6EA 4RPHA 5EKDA 4EL0A 2IS2A 2R9VA 5BV0A 1PW7A 2AOXA 4BY9E 4U6NA 3N5KA 2VTBB 3UFXB 4AO7A 1A5ZA 4HYEA 4EITA 3AR6A 1V9SA 2KQUA 4Z9YA 4WPGA 3QX3A 5KJ1A 2X8JA 4X1IB 1NVMB 2GPAA 2CFOA 1K88A 3WG9A 4BZXA 4B44A 4GKBA 4OCZA 4MV0A 2V6BA 1LXCA 1W36B 2IVZA 4US0R 1OPRA 3IUBA 1U6KA 2E48A 5F73A 2NTVA 2ZB7A 1RWKA 3SGLA 2DEUA 4DC0A 3N59A 4RZIA 4B4VA 2G4LA 1X70A 3UOGA 4QU5A 6ABPA 3LI2A 4NYJR 1B1CA 4PO3X 1EJ6A 4QQ8A 2D4AA 1NFRA 2PRYA 1PR2A 3E70C 2XOXA 3LBHA 3QY0A 4QPNA 1PJLA 3U56A 4QOFA 1XZDA 3ZY4A 5FUBA 4H3HB 1Z2OX 2VQSA 4NEHB 2XUJA 4M7OA 4Q05A 5IYZB 3VZRA 4JSRA 1RHRA 1S7CA 1VKJA 3FNGA 2FN7A 2XQFA 4V1CA 5L53A 3I9JA 2H4WA 4L08A 3Q1LA 1MG5A 3EIQA 3VBEA 3NBAA 1QMPA 3PWTA 1FJGB 2C4WA 1C8KA 4G5OA 3VHXB 5HUJA 5CIYA 4L4ZA 2POCA 1O94C 2BV3A 4N0MA 3T15A 4KACA 4PYJA 1NW8A 2QORA 4A2QA 1QQBA 2KMLA 4HX9A 3DF9A 4X71A 3I76A 1BAPA 4FFLA 4C14A 4K9QA 1NQUA 3C0KA 3RUDA 4DE5A 4D3YA 1GTVA 4UM9D 3L8GA 3PC3A 4RYLA 4BLWA 3PKZA 2XVAA 1Z6AA 3SJCA 3OM8A 2BKXA 3QUBA 3S2ZA 2NXWA 1NLYA 3L8DA 5M34A 3EVCA 3X1WA 2ZIXB 3A32A 5ICFA 1JDZA 2JBWA 1O6FA 2FJPA 4JP2A 2C57A 2PEZA 4NENA 3RS9A 3DWIA 5EOVA 1DTWA 2HQSA 3Q5GA 4PG5A 3RB8A 5A4FS 3ZQUA 1IUOA 2NXEA 4YR7A 5EHQA 3E9RA 1ABFA 4MW6A 1JHPA 3A7DA 3QUCA 4D6PA 3WV4A 3DYVA 4RNDB 1CB0A 4WXPA 3X2FA 2RKWA 4EGJA 2YIJA 2A5FA 2G1AA 2VA8A 1M2FA 2XXJA 2FK7A 3P9IA 4RDXA 3HJFA 1V35A 3TDKA 1G21B 3DG9A 1LRJA 2CHFA 2JIMA 5LQKA 3L4JA 2HY7A 2DMRA 3Q6NA 3RIEA 4DBLC 5TJ9A 5F9FA 2ZXEA 2PQMA 2P9YA 5HUHA 4MVXA 4B2LA 3DTVD 1SB9A 4BVLA 5BPFA 4IRXA 1PEKE 4U9HS 4RD2A 3AVTA 2PH5A 5HZMA 3IGFA 1ATIA 2QQGA 4RLQA 4WKOA 3FOAA 1Q0QA 3MCAA 5IC6A 1M7BA 3ZXSA 1E5TA 1H5NA 2B8JA 3TLGA 1SC1A 3CRMA 3R09A 4MUIA 5L3SB 4Z3OA 1D04A 1XJ0A 3V4VB 1ISIA 2ZBEA 4TL6A 3L1IA 2HHJA 2C7VA 4XM0A 1IHYA 3FZEA 5JYDA 1ZHHA 1NTOA 2NQTA 2V4MA 1N6RA 2R7LA 4FGZA 1G3UA 1RTKA 3NZEA 3GDHA 3QFRA 1P5ZB 5LQDA 2EL9A 3S27A 4B84A 1DXQA 5HYVA 2L17A 1YHYA 3TF5A 2IBSA 1D2RA 4OMDA 1E1YA 1V8BA 4H1WA 1YDGA 5LP6B 2E4XA 1R0SA 2JB9A 1XCPA 1AVTA 3JW8A 3PXDA 4B3XA 2WB2A 2WU1A 4UARA 1LY1A 4KTTE 2GO7A 3WX0A 1GA6A 1QV9A 1ZK3A 5CAEB 5FI5A 3X3HA 1N2HA 4LDQA 5IH3A 3JAMA 2QX9A 3F7TA 4X7BA 1F12A 1AXRA 1IHUA 3ZZTA 2QGZA 4LC1A 5GONA 1EWYA 2CXTA 4KO8A 1PR3A 2IPOA 2AFHA 5C7IO 2VF8A 3NS7A 3PIIA 4TSRA 3V97A 3RUIA 3H17A 4EHBA 5F2NA 2DSTA 5LSAA 4DR6B 2ZRMA 2BGMA 3F6YA 3E18A 2MSWA 4QDZA 4O4JA 3S8YA 3NGLA 2QY6A 2IYUA 1QFMA 4MLCA 4D98A 3JQAB 3NXKA 4CL3A 2AE1A 4AP6A 2Q28A 3EMKA 3FMPB 1I4OA 1II8B 3GEPA 4OIFA 1P81A 3DYIA 1TUEA 1QGUB 1KMQA 4UD2A 1R15A 1CUSA 2F3PA 2GKSA 4P31A 3EAGA 4YAGA 1B42A 2BEVB 3N58A 5D2CA 2G88A 4QXMA 4NC9A 4P80A 2PFKA 1XRLA 3W5CA 1HPLA 1L0BA 2XYRA 3I2JA 3OFSA 1JEAA 1BWSA 4RVUA 3ENKA 3NAMA 1SCJA 2V74B 3GEIA 4OUDB 5DI9A 2PCLA 3FNFA 5EP3A 5LC1A 3WBBA 1N6OA 3FVWA 5JAOA 1A4IA 1KP2A 1M2HA 1O96B 2QTBA 4H59A 4IO0A 3VJLA 3H2ZA 4J43A 4YHBA 2EP8A 3NIBA 4GM0A 3NDJA 4Z4IA 1E9BA 1GPKA 2ZUSA 4OMUA 3UWPA 1VDZA 4HNSA 4NESA 4RD3A 4W6QA 2XQIA 3TB4A 4EG6A 2FEMA 1JG2A 3IPLA 5HDQA 3MM4A 4I66A 2I0FA 1OX4B 3NBMA 3GG9A 3TTSA 4RTKA 5DNUA 1C3OB 2QZ9A 2DJ5A 2XYGA 3DF7A 4E5PA 2W4QA 3R75A 5AHRA 1L5GB 3OCUA 2NSDA 3EDYA 3GLTA 2GBGA 3IVCA 5HW0A 4HWRA 1GEGA 1KYIA 1E3WB 1VZ2A 2F4NA 2FH5B 3OT1A 1VP3A 2PPLA 5ADHA 2WE7A 3ZYZA 2C0CA 2JIZD 2ZYGA 3JAKB 5ULLA 1ENOA 2ZUFA 3VH1A 1RP1A 1PDWA 3ZIAD 4AS2A 1B4DA 2YICA 3FVRA 4G0ZA 4JZYA 4X3OA 5C8YA 2XBUA 2PNJA 1XRPA 3LUPA 3JVUA 2RGWA 3MWEA 2OG2A 3DPUA 4BS9A 1OH7A 4DA6A 1WMSA 2HFJA 3CJRA 2EV9A 1YBHA 4QYWA 4DA7A 1IN7A 3EBLA 1LNSA 2GA8A 1OFIA 4BX3A 3N3BC 3CCFA 3QLUC 4NCKA 1KEPA 4E1VA 3O6VA 4M21A 3A4IA 4UU7A 3FTEA 2XUGA 2AR0A 3AM5A 3QX8A 3Q72A 1X7ZB 1ISRA 1ZS9A 2AOUB 3IBFA 4Q7JB 2ZTSA 3EAFA 4IIJB 3G02A 1QG6A 4N48A 4TTQA 1BXGB 5TQVA 3HO8A 4QBTA 4Z1MA 3R9KA 3PGMA 3S2EA 1ZR2A 5ALEA 3S2FA 4B4DA 1QGAA 3PGXA 1ZK0A 4IEFB 5CA1B 3CM0A 3ZKWB 1XAGA 2H1IA 4DQKA 4F06A 1GPNA 1NVVR 3NC0C 2PG3A 1XZPA 5DE3A 4MKRA 1E96A 4UHKA 1YIDA 2X8AA 1VE7A 3H2YA 1U2ZA 1SXJD 1S3SA 1DO0A 1A27A 2XZLA 1MJGM 3ET4A 1I2BA 1ZU4A 4MAAA 1XJCA 1D1SA 1GTZA 1HFKA 1Q20A 1U5BA 1Z7YA 2IZ5A 1K63A 5LQJA 2E1PA 1USIA 3OKPA 4NBLA 5CEJA 5FD8A 1WPGA 2QLBA 1LDYA 2XCLA 1FX0B 2YQZA 1QRAA 4TV9F 4XRGA 3A6PC 3BE6A 1NUHA 3ZR4B 5IHXA 5EZ6B 1I6KA 1M8KA 5JADA 4FD3A 4RGQA 2VKTA 4UMVA 1JKXA 2E6KA 4FP9A 1Y63A 2WWYA 5IJ9A 5HIJA 3JCZA 2V3WA 2X77A 3N8DA 1QIFA 1XLTC 3KKLA 5DHTA 1QFXA 1R50A 2JFFA 3FHTA 2CDBA 3FAZA 3HZHA 4EFLA 4QDTA 4A6PA 3AFIA 4X94A 5KHOC 3UEOA 4ZVOA 2IYTA 4BP8A 4TKMA 5D01A 3HFRA 2NT3A 5DWQA 3ZW7A 1GD1O 4XDZA 2OXCA 3IIEA 1R8YA 1UXJA 1TAQA 2OV8A 4U3JA 3WWOA 8GPBA 2OCKA 3NBZC 4R0VA 4KIUA 4L51A 3PJEA 2WFLB 2C0PA 1BA3A 2CD7A 3S99A 5LNK1 4YJ3F 4RTLA 2O1SA 4UUQA 4CQLA 4QUGA 5GJWC 2XEXA 2VUTA 5F1OA 3LW8A 3OQIB 2P30A 2TS1A 5DTQA 3STHA 3EAQA 4DV3B 4OB7A 5K3FB 4JI4B 1M6HA 3JR7A 3SKXA 2Y0PA 4DM7A 1PGNA 4WDRA 3NCHA 4WESB 2VP2A 1BH2A 4BNTA 3D54D 1S8AA 3D4NA 3Q7IA 3W5DA 3N75A 3CUUA 3DQPA 3IBCA 3LPMA 2ZUEA 1HSOA 3LXRA 1MC8A 4P2GA 2H08A 1HT0A 2XB8A 1OZFA 3IOEA 2E49A 4AWXA 4BNDA 1RLOA 2YBDA 5JXWA 2WKSA 2IYVA 1U6IA 3L8HA 1N2CB 4JLOA 1K5DA 3TNDA 3RTBA 3LT4A 2O8CB 1C2TA 5FX2A 2Y0BA 2P9EA 2I66A 3DPSA 1YIOA 3PQDA 4CTMA 3ESXA 5L40A 2C92A 4GX0A 1SBYA 4TTAA 3NWBA 4ZK6A 3KBBA 1OB2A 4I1OA 3D5QA 2XXAB 5AD1A 4PZ0A 3SZRA 5EE1A 2Q9UA 4DPKA 3PFFA 3MQ2A 4EAAA 1NW6A 1EFAA 2WV9A 3U9SA 5J40A 3CMMA 3AP3A 3UICA 1MB0A 1EQAA 2KJQA 2MOKA 2Q4DA 2D8MA 2ZDHA 3B6EA 3CFYA 3CINA 4KYVA 2DHQA 3TRDA 2NXJA 4F0JA 3GO4A 2D0DA 4A9AA 4E5YA 1B15A 1HO3A 1TYZA 1YCGA 1URPA 1J8QA 1KO1A 2D5LA 3EA5A 3RBXA 1DUSA 2C5LA 2QE7D 5ITSA 3B2NA 1Z17A 4CIAA 1YCDA 3EZGA 5C1IA 2UZ1A 3ZU6A 4Q24A 1CJSA 1FQWA 3LOPA 5H16A 3T3PB 3ZHVA 2QYSA 4JWKA 4Y2GA 3MB5A 1L7BA 2Q4OA 3H4MA 1XA4A 4N39A 3E53A 5KOJA 3PLAE 1U1DA 3JQGB 1E9AA 2HX1A 2IYQA 3NP9A 2EZ4A 4P58A 4P4LA 5JI2E 1Z4JA 2YOGA 2JA1A 1KOGA 1H8EA 2IU4A 3GUVA 3T7DA 4YCMA 2RIRA 4MB2A 5B6JA 4KR3A 1BMDA 3UTDA 3ICVA 5MDHA 2O8EB 1DCKA 5EL0A 4MRMB 4G4SO 16PKA 2HLHA 3ECAA 4FUTA 4DG8A 3H5OA 2Q5FA 4NCJA 1KI8A 4ZRMA 4IIXA 5AKJA 4JP5A 5FA5A 4KGVA 3VOTA 3CZ4A 1CDOA 3AF2A 3TNFA 2ORYA 4IMPA 3DE2X 4QD3A 4URHA 2A9RA 5CM2Z 4BWGA 1E64A 1CY6A 1GPMA 2H1FA 2PMWB 3EXHC 3KYCA 3O3NB 4KUEA 4OBBA 4DQDA 5J1SB 4WLOA 1C1YA 4YRLA 5FOWA 2NU9B 1OX5A 5D1HA 3TQHA 2EOAA 2ZRDA 1TIPA 3W1EA 1Z9BA 2IE8A 3LV8A 3FFTA 1MJHA 3MTQA 3PNYA 3MYRA 3QX9A 2BH9A 3T5CA 3AG6A 4B5KA 2XYQA 1UPAA 3BX1A 1RACA 1BE8A 1KVSA 4GVPA 1IMJA 1BVYF 3P2YA 3O8CA 2QI9F 1LI7A 4I55B 4WY5A 1RJWA 1TFUA 5EXSA 5AVSA 1ZH2A 5CUQA 1JJ7A 1PSWA 1E1MA 1LF5A 1PI3A 2FXIA 2NO0A 2P6MA 3H1PA 1U3UA 4YFYA 4ZALA 1EEHA 3ISJA 1WSBA 1PG5A 2X6QA 3EXFB 4FHFA 5T4FA 2WFMA 2G1UA 2AF4C 4MW5A 2YJ4A 4JC0A 1EXNA 1RLIA 2Z3WA 3KYDA 3LDFA 2RCNA 2CKMA 3I2FA 4B7CA 5ESXA 1HKHA 1DJMA 1RVDA 1CT9A 3DOFA 3ZDDA 1ZRNA 4PF1A 3B3GA 4NV3A 4MPJA 3LFHA 1U3VA 1X9IA 4PY2A 1I4WA 3P2EA 3TI9A 4JI5B 3V32A 2HTEA 4DUGA 4EMTA 1J2TA 4Q7EA 4ZV4A 2NU8A 3ACCA 4XI9A 5JVDA 1D4FA 3V9PA 1J2RA 3GLSA 3KDSE 2FFQA 3RVJA 4ZHQF 4GM1A 2Q1UA 3W8RA 4BNXA 4IJQA 3DDNA 4RY9A 4UXHA 4XD7A 2IHZA 3NHLA 2GGSA 4YASA 1ENZA 3ANNA 5DRYA 4BQRA 5AJYA 3H2IA 3R5SA 1I14A 4QSMA 3ETCA 4LYEA 4HB0A 1T6ZA 3NHSA 5C4GB 4D9GA 3WYAA 1Z26A 2CXXA 4COKA 2DBZA 3UT5B 4C4ZA 4DNOA 1DRUA 2OBBA 4KBYA 5LMUB 3OZXA 2BLLA 2LVBA 5JAUA 3FHCB 4E5SA 3QH4A 1BSVA 4UBMA 3RLFA 4YPVA 1XELA 4XUDA 5KU7A 5L3QB 1NV9A 3FFAA 5AMXA 4B71A 5L7TA 4PG6A 3Q7SA 3FCXA 3L02A 1I3LA 2HPHA 1CE8B 2TMYA 1JTVA 3GFTA 2X1MA 4MUJA 4Y1FA 2M6RA 4YWJA 5G2OA 1P1KA 1NAHA 3LX8A 4RGYA 1C8VB 4EJSC 5MN4A 1CJBA 4PFKA 2LBPA 2AMYA 3D64A 4BB0A 4B74A 4BO4A 1W0JA 3VO1A 4EAQA 4G5YA 3WLEA 2OHGA 5KCMA 5SYAA 5KHAA 3SD7A 5IM4F 1E2GA 4GBMA 2PS3A 3RQSA 2M6KA 2PJUA 1ORHA 1QTRA 3DDUA 4G26A 3SFTA 1DQYA 3RF7A 4F4HA 3AM1A 3DWEX 2VJMA 4FYVA 2IUEA 3GV0A 5F51A 2A30A 3PD7A 4ARSA 5JY6A 1MCZA 2D1QA 5FWYA 4MW7A 2IY9A 5IS2A 4E03A 3CLTC 4PLFA 1RQNA 2A86A 3V1LA 3GRVA 1ZIYA 4TN5A 1GTL1 3GJQA 1S7GA 5ETJA 3KWLA 4M8IA 4PC3A 3KSZO 5AVTA 4ZFNA 2X0KA 4BB9A 4FFOA 4B3SB 4RSHA 3K9HA 5GQSA 1POWA 1BYIA 2R44A 2JFOA 1UBCA 1O6CA 1FXUA 4X1KA 4OLBA 5IEJA 4G5XA 1U90A 3W1VA 3BWMA 4AROA 4CF5A 1F7UA 2YDYA 2VJKA 3L18A 4Y2YA 3LC1O 5AKXA 3G5UA 2WM9B 5C3UA 4I1PA 3TG2A 2WU0A 2WF8A 5BT8A 5CFMA 4YO7A 2Y1OA 3ICWA 2ZBPA 1H0HA 3OUTA 4IF6A 4K2HA 5C2JB 5C46F 3PLRA 3MMSA 3K0EA 4NECA 1ADJA 2Y0CA 3U4MA 2CEKA 1HQYE 1U28A 5TX7A 2J0QA 4DLRA 4R0MA 1GVHA 2YNMA 2QENA 4PZYA 1YJCA 2J7PD 1P9WA 3S6JA 3D4PA 4JT9A 5ICEA 1XJWA 4KU4A 4X45A 4Z4CA 1GO2A 4S1WA 1ORTA 4YPOA 2V7BA 3AR2A 2Z1MA 4O2RA 4TQGA 2AYZA 3E9CA 3K9WA 3R24A 4TTRA 4BV8A 2I7VA 1MORA 1AA6A 4PXAA 1AE1A 1LPAB 2H2GA 3BKXA 1SCUA 3DVLA 3O2SB 3NOXA 1UC9A 5JS8A 2G3YA 3SKYA 1WCV1 3BD6A 1ZMXA 1CF2O 3COYA 2ZS9A 4IPTA 5FNZA 5IBRA 3KE9A 1QFZA 5I7UA 1UFQA 5AW3A 3C6MA 3VUEA 1SG6A 1ZH4A 1E3IA 1EIZA 1JVBA 1TLTA 1GLVA 1PWYE 1FVXA 2B21A 2GZ3A 3A8TA 3JWPA 1BFKA 4D6YA 2RGGA 3P2IA 1TQDA 2ZUTA 4EUSA 1E4EA 1NBEA 1OC2A 2JFNA 4RHXA 2I6FA 3SJ7A 4CM1A 5GIOE 1U0TA 3H11A 1X1TA 2YDXA 5F4ZA 2IZZA 1IBMB 2CYBA 2PJRA 4NATA 1UDXA 1YE8A 4A92A 2V6MA 4HDRA 2K7ZA 5CBPB 1I0LA 2JNWA 4ND8B 1Q6YA 5BW6B 1YOVB 5JPCA 3GLIE 1NRXA 2WKWA 3Q41A 5JTTA 3FKSD 4CF4A 3Q6IA 3TW6A 5HKOA 3QMWA 2WWRA 2BEWB 1ZNWA 2JANA 3AOEA 5CIWA 3MGAA 4DCSA 1M83A 4KJXA 4G8DA 4DW8A 2YV1A 1W0KA 1B8VA 4P8RA 3GP3A 5FKJA 4HQRA 1MA3A 4H17A 4ZWNA 4D4GA 4M76B 4O3FA 4HK4A 1O89A 1PLKA 4JENA 4B4WA 2X9QA 3L7AA 2ZE6A 2R4QA 3BTSA 1WZUA 4DAEA 1ONSA 4NBNA 4EUFA 3W6OA 2BM1A 1ECBA 2BGWA 3I9LA 2WVGA 4K1XA 4Z51A 1LTQA 2L19A 1T0UA 5A2GA 3K70C 1XQ1A 4QXAA 3ZI0A 4XAQA 3N6VA 5FOSA 1OV6A 3ORSA 4BZQA 4RGVA 3EGDA 1NU8A 3AFOA 3BMQA 2H1HA 4UVHA 3IQFA 1O95A 5B12A 4JELA 2C9CA 2C58A 4IXMA 1PZNA 2BDEA 3PVCA 2EFDB 4LF5B 4YT2A 4UFPA 2I9PA 4J0EA 3NJ8A 1BVUA 5A7GA 4YBRA 3AHDA 4HGRA 3S81A 3L1KA 2HD4A 3LUKA 3W6PA 3WHLA 4EGSA 4EHLA 2CXOA 2X14A 2XDQB 1MAUA 1T1GA 3RT7A 1YUMA 4ZQFA 3IP5A 4KW7A 3H8SA 1VRVA 3VQTA 3JRXA 2EX0A 2FAXA 2SICE 4PBRA 3T9EA 4CKEB 1I5OA 4Y6LA 4FYIA 1ZP6A 2C95A 2XCOA 4KDRA 2XE8A 2R48A 2PUHA 2GVDC 4XPIB 1O5IA 5AJZA 3ZDZB 3CR7A 2AJ8A 3EEFA 4NMMA 3Q7EA 1Z12A 3IHWA 3W5IA 3ZD9A 1GTRA 4EUEA 3N0VA 4ESVA 4H1HA 4W5NA 1M7GA 2ZYTX 3K05A 4HBGA 4NFSA 3RGGA 4NQRA 1OC4A 3F7NA 4FNOA 1JBEA 1VA4A 3D8HA 1Y1TA 1DQPA 3BFPA 2Q99A 1YRWA 3KJZA 1WBBA 1C3LA 1VBNA 3AVUA 1WMBA 3A4VA 4UZSA 3HCOA 5B2FA 2G83A 4LQ4A 4OF4A 3L7KA 4INAA 4YB8A 2R8YA 2P65A 1A7UA 1Z3CA 3LVBA 1PK9A 3QUAA 4QUIA 5ALSA 5HG0A 4UUNA 3WRYC 4E7PA 5J4HA 1QPZA 3PCTA 3Q8XB 3V4OA 4EYGA 5GJVC 5GOTA 1JLKA 2HIGA 1JI0A 3IQGX 4RTNA 5FV7A 4EJFA 1ZDMA 1H2YA 1H4TA 1V11B 3DDCA 3E9QA 5TMEA 2TSYB 1XEXA 4DIEA 3D8SA 4W8OA 5TDHA 5CA0B 4ND7A 3NDPA 4MVJG 4WBXC 3WRXC 4ZAYA 1KXJA 2ZSFA 1UWCA 5LP6A 5J2UA 1U2RA 1JN0A 2C77A 2O7SA 2B0CA 2R8ZA 3F1LA 3KB2A 2NP6A 2BGRA 2VP6A 3AESB 3ESCA 2YHIB 2BD0A 4PAOA 4OXQA 3CCCA 4FEAA 2PVCA 4FJ0A 4MUAA 4ENPA 3NHBA 1ST3A 1JAHA 1TT7A 5DLQC 1DAKA 3I05A 2BFCA 3KNZA 1T9CA 2XGSA 2YWDA 1EUDA 2JLRA 1S4MA 5AT1A 1TVMA 2HQ1A 3CE6A 3OC6A 4U9IS 1R64A 4IJUA 3UXHA 5BR1A 3FMOB 1N3LA 6GPBA 1VG1A 1VXRA 3D81A 3UJ8A 4J3NA 2WMDA 3V48A 2XGJA 1Y7TA 5AUNB 4NAUA 1E1LA 3TW4A 5JH7F 3NHJA 4MYTA 4F92B 1NI4A 1XRSB 2ANBA 2BGKA 2GJ9A 3HZOA 3O8OB 1MV8A 3JARB 2EJTA 2R7KA 3C45A 4HZUB 5FLKA 3EPJA 5EQDA 1KDRA 1ZICA 2A94A 1YVDA 4KO2S 5AJXA 2CUZA 3A1SA 1Y4AE 4E08A 3F3SA 4BV2A 1K8QA 5EHZA 3JVDA 4E5UA 1TJ5A 2J3DA 3H05A 3VR3A 3ZE8A 4FE3A 5KWEA 2J32A 3N74A 5LUBA 2G9QA 4GDFA 4HEA1 1A88A 4UFOA 3MMXA 3TH5A 3UZUA 4DVJA 4ZIRB 4Y9DA 4YN3A 5IKEA 1XNRB 2GRAA 3C5HA 2F43A 1T0PA 2P4SA 1D0SA 3BGSA 1MAWA 4HL6A 4MRAA 4QJ4A 4ZV9A 3VH3A 1Z63A 2WF6A 2CKDA