4F45A

Crystal structure of human cd38 e226q mutant in complex with naadp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
253
structure length
249
Chain Sequence
EFWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human CD38 in Complex with NAADP and ADPRP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ADP-ribosyl cyclase 1
total genus 80
structure length 249
sequence length 253
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4f45A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f45A02
1DBVO 1P1FA 2AG8A 3L6DA 1IPFA 1SCUA 2XAAA 1DRWA 2PLAA 1DIGA 1LLDA 3JQDA 3L6OO 1VLLA 2I76A 3DQPA 2EW8A 4FOOA 1BVRA 3WB9A 4CMEC 5KVSA 1DJQA 1Q7GA 4XYLA 2B4RO 2V7PA 1CIVA 1F06A 3PYMA 1TA4A 4CM3A 2HMVA 1P9LA 5CDSA 5IZCA 3V8BA 3AUUA 2XOXA 4M8SA 4BNTA 4DL9A 1H9BA 1ADFA 1I2CA 5KWEA 2EKQA 1HYHA 5A04A 1PJSA 2Q45A 4ND1A 2CNBA 2QX7A 2PD6A 4GMFA 1BHSA 1H6CA 1J5PA 3ZHZA 1R4NB 4A73A 1JQBA 4FC7A 1DO8A 2BKAA 4RV9A 2WTBA 3INRA 4KTVE 5TT0A 3OHSX 1I2ZA 2DC1A 4IJKA 2WD8A 1BXZA 1XU9A 1E7RA 4IDEA 2DM6A 3RKUA 3Q2IA 2PGDA 3FBTA 1ZK1A 2C2YA 2D5CA 4GL4A 4ZHSA 1LSSA 4JXKA 3RUFA 3H2SA 3NGXA 3IP1A 4NNJA 4CQLA 4CM5A 2VRBA 4ZU3A 1U3VA 3ZV5A 1EUZA 2A9FA 2DBRA 3PRJA 2WWRA 4B4WA 5C37A 2Y0EA 4WLFA 2HMSA 1WLYA 4II3A 4OQYA 1HDYA 3U09A 2UVDA 3ASVA 1AGNA 4GX5A 3PHHA 3WBBA 3ZU5A 5FI3A 3EDMA 2AQKA 4CM7A 2Z1NA 3DZIA 3I9JA 2HLPA 1A71A 4LMPA 4Z0HO 5JY1A 4Q3NA 2E37A 3I83A 5G0TA 3AI1A 4BS9A 2W2KA 4F3YA 3PHLA 2ZYAA 5BT9A 3C1TA 3D4NA 3RWBA 1HL3A 4P8RA 3A9WA 3KBOA 3OICA 4UVHA 3RJ9A 1LNQA 5DCUA 1A72A 3ZH2A 3FNGA 4P4LA 2X5OA 4E12A 1MB4A 3R0IA 4LRSB 1E3JA 1G6KA 2X9VA 5EQFA 4CV2A 5T57A 3GN1A 1WDKA 1SNYA 3WBFA 1DEHA 4BNIA 4BB5A 4PCVA 2WMDA 5HTOA 3PWKA 3WSVA 4AG3A 5H83A 4UULA 4A7PA 4F6LA 4GKBA 1QMGA 2VN8A 4IDFA 4QQRA 4ZA2A 3NDRA 3WWYA 1JVBA 3H9UA 4ZQBA 5KCZA 1LJ8A 1A27A 1JKFA 1W6UA 5ITWA 1J49A 3BA1A 5IN5A 4YAIA 4G81A 2Y1DA 1U8FO 5J23A 1P77A 5JO0A 4BNYA 3QRWA 1NQOA 3JQ8A 3EK2A 4CJXA 1PGPA 1EE9A 3AM4A 2JL1A 1R6DA 3EYWA 4A0SA 1KETA 4XJSA 1PWXA 4H16A 1ZH8A 3VPSA 2GN6A 1GQYA 5ENDA 3HDYA 1YDWA 1OBFO 4XB2A 1T24A 4ZQFA 2DTXA 2YYYA 1JN0A 3GPDG 4Z9YA 2VNAA 1EEHA 3C85A 4MDHA 4NI5A 3FNHA 3NDJA 4PLHA 5HRUA 2JCVA 4XYMA 3Q3CA 1Z73A 2YJZA 4YT8A 4NR0A 8ADHA 1Y5RA 4PLPA 3M2TA 2OXIA 1QLJA 2W8ZA 3K30A 4FFOA 4P22A 4CM8A 4Y6PA 1A5ZA 2QRKA 4FPXA 1JLLA 1YVEI 4S3MA 5A9TA 5JBIA 1I3MA 5THQA 3KV3O 4ZRMA 3HZZA 5EIOA 1BDBA 3D5QA 1X0VA 3TZKA 2BRUA 3DXFA 4OKIA 2YV1A 1I0ZA 3WQSB 1VRWA 3WWZA 4DIBA 5C7OO 1CDOA 4WK6A 4EW6A 3QY9A 4WLNA 3TOZA 3IAHA 4M55A 3GN2A 4TVBA 4ZJUA 4U8GA 3G1UA 1R15A 3WQRA 5BNIA 4EEXA 2EKLA 4JBGA 4MP6A 2GZ1A 3DOCA 4CUKA 3FR8A 3H3FA 4NBWA 5MGBA 2FP4A 4W7IA 4FFRA 2W2KB 1JAXA 4I5FA 5ENVA 5A4DA 1CQIA 2ZB4A 4XB1A 4B3JA 4NFYA 2ZYGA 1YDEA 1ZO8A 3CPSA 4KWIA 1NX6A 4LN1A 4D0SA 2AXQA 3AU9A 4YQZA 4BO3A 5G0UA 3QWHA 1U7TA 2HO5A 5EL0A 1GPJA 5G0WA 3LZ6A 2R2GA 2IYPA 4Z0TA 2ZB7A 4F46A 4QSMA 3LK7A 2OL4A 4JLWA 4FW8A 4ONEA 2J3JA 2CDCA 2C54A 2X9NA 5TX7A 5EQDA 4PLZA 1ID1A 4DTIA 2O3TA 2WEKA 1ZJZA 1LDNA 3NDIA 5F1OA 1ML3A 4HFJA 2AQHA 3INTA 5DP1A 1MV8A 1NM5A 4PIVA 2P91A 1PTJA 3MTJA 2B0JA 3IDSA 3GEGA 2ZTLA 3M6IA 2AE1A 2IZ1A 5DF1A 3GVPA 3NAQA 4O6VA 1L7EA 1MP0A 3H65A 4ZQHA 3L4BA 3ZWNA 1AHHA 2VWGA 4NHEA 3PJFA 1PJLA 4U5QA 4KDEA 1U3UA 3ROPA 2PTGA 1GQQA 2AEMA 2E4AA 1HDOA 3RU7A 1X7GA 1GZ6A 2OO5A 1Y5MA 1DIBA 4BMSA 3RI3A 5JYEA 3VKUA 3FF4A 1E7SA 4E4YA 3GZ4A 4BNFA 4NFSA 2PR2A 3PHIA 4IQ0A 2C5AA 3VOSA 4IM7A 1FXSA 1OMOA 3AI3A 4PLWA 1L1FA 2Q46A 3MWDB 2J6IA 4YT2A 2IYOA 4IBOA 1LQUA 3TZCA 3OMLA 2NWQA 4XR9A 2P4HX 2QZ9A 2J3IA 1YGYA 3W4IA 1FDUA 3BTSA 1TI7A 3KETA 3MJEA 5CDGA 1HYGA 2GPTA 1HE5A 4YYZA 5JSFA 5AXBA 1ZJYA 2P68A 3PFWO 1AN9A 1LRLA 4W82A 1LXCA 1S6YA 1XLTA 3DFUA 1U5CA 1H5QA 1B8UA 5HWSA 2VYVD 2WSBA 3DAFA 3QLJA 1H9AA 1V6AA 1B3BA 4R9RA 4S1VA 1ZK0A 1R4MB 1VPDA 4PRLA 4L4RA 3WTBA 3EMKA 1LUAA 4K6CA 3KB6A 1T2EA 4HNGA 1UH5A 3NT2A 1WMAA 1IOLA 3GR6A 1GUZA 4U7WA 4CLEA 3DDNA 5A9RA 3OJEA 3E1KA 4NBVA 1YBMA 2O2SA 3NUGA 3LT4A 4ZD6A 5I7FA 3IKTA 2WD7B 3PDUA 4DUPA 4FFLA 1P1IA 3ZI0A 2O7SA 4NU6A 3MCVA 4BO2A 1A4UA 4C7KA 1T25A 2ZTUA 3GDGA 4TMFA 1QSGA 4MVJF 3PZBA 4WLUA 3TFOA 2AW5A 4KMSA 1JKIA 1U3WA 2O48X 1GY8A 5JLAA 1KOLA 3HN2A 4BO1A 1EQ2A 2GN9A 3MWEB 1PZEA 3QHAA 1RM5A 3LT1A 1DIAA 3F1LA 2Q2QA 3D3EA 2V6MA 4XQGA 5I8WA 5AQ1A 3C7AA 3FTPA 4BO9A 1R0KA 3B6ZA 1DLJA 1QORA 3KTDA 4IIVA 4KQXA 5ER6A 2RH4A 2E48A 3O26A 3TQHA 5L53A 5JMWA 3LT0A 2NTJA 1HZJA 1V35A 3DTYA 4JIGA 4BVAA 3LLSA 5KKCA 3NV9A 1U7HA 4J16A 1ZW1A 5U4QA 2D0IA 1QLHA 1XHLA 2FSSA 2RHCA 3BYZA 4EITA 2B4QA 2X0RA 3E9QA 3KUXA 1ZK4A 2IZZA 2Y67A 1HEUA 1PJCA 4YACA 3M2PA 1E3LA 1KVUA 4J4BA 3SEFA 1E7WA 4WE3A 1MXHA 1VSVA 5GY7A 4BKPA 3Q1LA 4WCFC 4PG5A 5I9LA 3RVDA 2VHWA 3DOOA 1PIWA 5IDYA 1BRMA 4E2XA 4LSMA 3IUPA 4RLSA 1J0XO 4PN3A 1AXEA 4L8VA 1E1NA 4ND3A 1A7AA 4X54A 4R1NA 3UFXA 3WMXA 1T2AA 3DBLB 3NKLA 2D1YA 4GLLA 2C59A 1OC4A 4ROSA 2C7VA 3COSA 3AFNA 1QYDA 4DC1A 3ABIA 3NGLA 1P44A 4BOYA 1I8TA 3F4LA 4NIMA 5L4SA 4MP3A 1GR0A 1H0KA 1XIVA 4PZEA 3GK3A 1BGVA 2UUOA 3R3SA 4RVSA 5T8KA 1LRKA 2ZB8A 1EBUA 3C7DB 2AA3A 1HT0A 1KEWA 4NJOA 3H4VA 1N1EA 4ILKA 4L4XA 4TKMA 4XQCA 2DLDA 3HHPA 3SBOA 4EUFA 4YR9A 1D4FA 2UDPA 4IS2A 1X15A 4CUJA 1PWZA 1ZK2A 1OFGA 4BNMA 5TF4A 2IXBA 4JGBA 4ITUA 4CLHA 1ARZA 1BXKA 1PS0A 3BMOA 2WD7A 1WDLA 2AMFA 3DONA 2HCTA 3DBRA 4IDCA 4BNWA 3Q11A 1HDCA 2BFOA 3PHJA 3VAZA 3JQAA 4WJZA 3DMYA 1P3DA 1Y9EA 3OJ0A 4C7JA 1RM3A 4PVCA 3I3OA 4J2HA 3K73O 1NBOA 5A3JA 5L7YA 1T4DA 3OEWA 3GZNB 1R4MA 1N92A 1PGJA 4XCVA 3C7CB 4MIEA 4NPCA 2CSUA 1DDOA 4TQGA 5EN4A 2PK3A 1MX3A 1YXMA 1UZNA 3GVCA 5A9SA 5HM8A 3AJRA 3EAGA 2OBYA 4E5PA 1UXGA 2DTEA 5KNLA 4BGVA 1NFFA 2EERA 1M6HA 1FF9A 1HLPA 3PDJA 2O4UX 5CDUA 2NVBA 3ZWBA 4DGSA 1LSOA 3DBVO 4DPMA 2VHVA 2D59A 3PK0A 1MUUA 1I33A 3GNSA 4HX5A 2RBEA 4I9HA 1GU7A 2CVQA 4NDNE 4I9NA 4J7UA 3OFSA 4W9NC 3TZQA 4LVCA 4AJKA 1R0LA 3OETA 5H82A 4TZTA 2TMDA 4FR5A 4TRJA 2P2SA 3ZWMA 2V6FA 3H9GA 3HADA 2YFQA 4OXYA 3EVNA 2LDBA 3LC7O 1U9JA 3MJSA 4XIJA 1WZEA 5DULA 2EIHA 4I5DA 4MKZA 3ETGA 3JSAA 3VH1A 5L51A 3ZNNA 1XELA 2YUTA 1AXGA 2J5QA 2JD1A 1DC4A 2I6TA 5CG1A 5AXCA 3FCOA 5JAMA 2O7QA 2NV6A 2PFGA 5ILOA 4J43A 2J5KA 4FSHA 3RFVA 1Y8RB 3L6EA 3GLQA 1EFKA 3H2ZA 3ZU4A 1HWYA 3D4PA 1XCBA 1K5HA 2QIOA 3DHNA 2BD0A 3INGA 4Z9XA 4MINA 4XA8A 3OF2A 1T2CA 1Q0LA 2BGMA 4OAQA 3JD2A 5G0VA 3SLKA 3JQAD 3PGXA 3RBXA 4WOKA 2DBQA 2F1KA 1TLTA 1DJNA 3HB4X 3PJEA 4FC6A 4J1QA 4WLEA 3NTRA 4PZDA 5F21A 2VCYA 1YONA 3FD8A 4W7HA 5EERA 2B69A 2HJRA 3IC5A 1HE2A 4KUEA 1D7OA 4QXMA 1ULSA 2ZIZA 3TWOA 3LF2A 3LLVA 4BGIA 1DXYA 4BMVA 2JD0A 2Z5LA 1R66A 1NPDA 4D41A 1AE1A 3WMWA 4EUEA 3MEQA 4FFMA 4DRYA 1M6WA 1SEVA 3GVIA 2J3KA 3CMCO 1HE4A 4RVDA 4RF5A 1C14A 3WDSA 4FFNA 3DMTC 5L40A 1B8PA 1EUDA 4ZVVA 4CMKA 4IINA 4U0JA 1NQTA 1PS8A 4GH5A 3JQCA 3NTOA 5U9CA 1E3EA 1IHXA 3ZWOA 2WDZA 4W6ZA 1QYCA 1W8DA 2AHRA 4Q3AA 1MXFA 4J1TA 4RLHA 4QFCA 1ADGA 4I5EA 5AXAA 4LK3A 3OEYA 1E77A 4G5HA 3IMFA 4DQUA 3GGGA 3ZHXA 2Q4EA 1LDMA 1YS4A 3KO8A 2VUUA 1M76A 5IAAA 1LTHR 3WFIA 3ZU3A 4CL3A 4XZ3A 5EINA 2X22A 5TSDA 2PKQO 4FOSA 3ZW9A 2Y0CA 3W6ZA 2I65A 3FNEA 3L07A 4CLDA 3BMNA 4NQZA 4YJFB 1C0KA 4RGBA 1DC5A 3PI7A 1NNUA 3LC1O 3JYLA 4EJMA 1ISGA 3F47A 1MA0A 5KJFA 4HKTA 1EVYA 3FTNA 4PLCA 5KJEA 1GEEA 1PZHA 3F3SA 3OIDA 1KYQA 2IODA 3NTQA 5F5LA 1U8XX 4TRMA 3AUTA 2EW2A 4XKJA 4Y8VA 1PQWA 4UVDA 2DPHA 3KXDA 4XDYA 1Z75A 9LDTA 3JYPA 3FNFA 4J9VA 3VPHA 3ZHBA 1NQAO 4BB6A 2JKVA 2I66A 2NU6A 4I5GA 3GUYA 1R0SA 1HKUA 1P1HA 4I9UA 4FQ8A 1ONPA 1MG0A 4CR7A 4ALLA 4RZHA 4KTTE 3DFZA 3U0BA 1GZ4A 1DFIA 4I8XA 1X1EA 3KYCB 3UCFA 3U3XA 3WGQA 3Q9UA 5CHEA 2E6UX 2O2YA 3B70A 1T26A 4RVHA 5L9AA 4Y9DA 3WGHA 3G1TA 4D3DA 5H81A 2YQ5A 2PH5A 3V1TC 5A5FA 4HFRA 4AL4A 3FPLA 3PXXA 3LSYA 4XR4A 1R16A 3GEDA 2GERA 1ZSNA 2UAGA 3ST7A 3GUCA 4G65A 2AE2A 2EKPA 4LRTB 3VC7A 1MFZA 5COBA 4ALIA 3G3EA 1E5LA 5JCJA 3H5NA 2G5CA 4AVYA 5IFLA 4PLFA 4YJDA 4CMEA 5FI5A 2EGHA 3QSGA 5HS6A 1B14A 5IXSA 1N1GA 3BXXA 4D46A 2P5UA 1V3TA 3GEMA 2VQ3A 1VL0A 4INAA 4LW8A 1BMDA 1JWAB 4Q9NA 3TPCA 4CV1A 4CMIA 2AEFA 2B37A 4EYEA 1BSVA 2HK9A 2PZKA 4BV8A 4CL8A 2DBVO 5CP8A 5CG2A 5BSGA 2BLLA 2I9PA 3H9QA 5CPBA 4CLRA 3JQFA 4CM9A 2JCXA 4M89A 5HBRA 3SJ7A 3G49A 5T64A 3RROA 1HLDA 1DC6A 2DUUA 3PTZA 3WFJA 1KVSA 3ROKA 4DPLA 3ZWYA 1H2BA 4GVLA 3VH4A 3JYNA 2FZWA 4LCJA 1I5RA 4B79A 4FCCA 4B3HA 1PU2A 2QYSA 3U62A 3JTMA 1JA9A 1XGKA 3V2GA 3KYDA 3FRJA 3AOEC 4LVUA 4Z9FA 1ZMTA 3ANNA 5LC1A 5B4UA 5JAZA 1I3NA 2E49A 2Q49A 4UVIA 5KVCA 2Q50A 3ZV4A 1WZIA 4NU5A 4Q3EA 2X0JA 3V2HA 1VE9A 2ZJ0A 5JMPA 1C1XA 4MIYA 3GOHA 1WMBA 3QWAA 4UVGA 4BKUA 4DLLA 4F6CA 1VI2A 2ET6A 4ZRNA 1U3TA 3AI2A 3U5TA 3BMNB 5JFOA 1SPXA 1QKIA 3I4FA 1NPTO 2X1HA 3RUEA 4JCOA 5EMHA 1PS9A 3JYQA 2O3QA 2ZQZA 3OJLA 1KY4A 1NVTA 3E6AA 3PFFA 3GF4A 4K1LA 4WLVA 1QXSA 5L45A 3UN1A 1A9YA 4JN6B 5FFFA 4MKRA 4UREA 4WCDA 3DHYA 3WXBA 4IQGA 3ULKA 1DFGA 3GRPA 2HK7A 4BQPA 2BFAA 1KIFA 2TMGA 1O0SA 5I9NA 3RIHA 1SZJG 4E5NA 4YPOA 2RHRA 2GR9A 4R68A 1OOEA 1B0AA 3RFXA 4OM8A 2VUTA 3OQ1A 2O3JA 5TLSA 1MGOA 1LLCA 5JAIA 1Q7CA 1YWGO 1MC5A 2D5AA 1KC3A 1YL6A 3ON5A 3NEPX 3WJ7A 3QWBA 5T67A 3O38A 3ZN2A 2J8ZA 2EXXA 4ND2A 1ZEMA 5F1PA 5IG2A 3CTMA 3KZVA 3S2EA 1EDOA 4J1SA 3IOYA 4CQLB 1M2WA 4RF4A 2GYYA 2X23A 1K2WA 4WOJA 1U2GA 3HQ4O 5DBIA 1F17A 4RVFA 3C3XA 1MG5A 4IMPA 3QVXA 4MKXA 2I3AA 5KTKA 3TSCA 5I7VA 3GAZA 3RCBA 2Y1OA 4NJMB 1BVUA 2AQ8A 2G0TA 5B37A 3JYOA 4OOEA 3BMCA 2VZ0A 3RQSA 4XYEA 2EG9A 4E5KA 4JQCA 2VYND 1N7HA 5GMOA 4CMBA 1O95A 1Z7EA 1LC3A 2JFGA 4EGFA 2I3GA 5CFZA 4M86A 2BF7A 1PJBA 3CUKA 1AUPA 2GN4A 4O63O 3K5PA 1KC1A 1ZZEA 4R9SA 5L3ZA 2CMDA 1CQJA 4BNGA 1XDWA 5COQA 3I9KA 4P4NA 1W73A 1O5IA 3NT5A 1IUKA 3C24A 1ZIDA 1LLUA 1Q7BA 4GQAA 5CEEA 3GDFA 4ALMA 1YRLA 2P5YA 3D5TA 2RIRA 5G2OA 1R12A 3ZGYA 1O6ZA 4DVJA 4CV0A 5DCWA 1U28A 4CM1A 4Z3DA 1I01A 3A14A 3I6IA 3WX0A 1SB9A 5A03A 4IY1A 2W90A 4GAEA 3IL2A 1D1SA 3A06A 3P2OA 5A05A 3UGKA 3CZMA 4RQUA 5T5QA 4CMGA 1HSZA 1NXQA 1GYRA 2VT2A 1G0OA 1G1AA 5F5NA 5KOIA 4OYRA 1E92A 3T4EA 3DC2A 4BIIA 1YJQA 2YV3A 4LISA 3GH3A 1B2LA 2BGLA 2NVUA 1ZVMA 5L7WA 4YT4A 4ALKA 1C3VA 4IJUA 4AJ4A 1RYEA 4YRAA 3F9IA 4RPHA 5G4KA 3T4XA 3JQAB 5A02A 1SBYA 4BNXA 1ONNA 2CDAA 4EUHA 4LCEA 3K31A 1XA0A 3DBRB 5LDGA 3BMOB 4YVFA 3JQ7A 3U4DA 5JDIA 1VM6A 3LU1A 4QT0A 3ROMA 3AOEA 2ZATA 4TSKA 3GFBA 3E18A 4DQVA 5F3RA 2EP5A 3OA2A 4CLXA 2HMTA 3DHEA 4EI2A 3C8MA 5HA5A 4IXWA 3AY7A 3QIVA 1P1JA 3KOUA 3ONDA 2OMEA 1JWBB 1NVMB 4O1MA 4DQXA 4ALJA 3U4HA 3KSUA 4KDFA 4BNNA 4GGPA 3WR5A 1Y8QB 2XXBA 3QV1A 1UR5A 1VJTA 4BNZA 4JK3A 2CDBA 1IE3A 2C07A 4KP7A 4CMHA 4PGFA 1XQ6A 1PR9A 4N7RA 2GO1A 4GI2A 3GC6A 4L4SA 3SX2A 3HG7A 1LEHA 5TNXA 2NACA 3PWSA 4PLGA 1I24A 4RVUA 3ROQA 1QP8A 2POQX 7ADHA 1UDCA 3DZKA 1NHWA 2SCUA 2FOIA 1P0CA 3OA0A 3CE6A 2R00C 4MOWA 4MVJP 3WIEA 2GZ2A 5L95A 4EJ6A 2FMUA 4E2YA 1H94A 3I9MA 4BKQA 3UKOA 4ALNA 4R16A 4OOFA 4TROA 3HDHA 4MVJA 2X4GA 2J3HA 2E82A 3GA0A 1GDHA 1LX6A 3RBZA 5JCJD 1U1IA 1DRUA 2Q99A 3H5RA 2C29D 2FR1A 4IUYA 3HWRA 4IDBA 4KQWA 3AY6A 1VSUA 2HRBA 1HF3A 3WYCA 1FDTA 5BSEA 4CM9D 4DLBA 1Y81A 3GY0A 1BXGB 5BNTA 5TRTA 4Q39A 4CLOA 3HE3A 2ZK7A 5ITVA 3FWZA 3JQBA 2V65A 1P74A 4DYVA 5TC4A 3K8ZA 1BTOA 3A28A 2GD1O 4GX2A 4YJGA 3O03A 3TF5A 3EGOA 2Y1GA 2HDHA 2WYVA 3GGOA 3D3WB 1RM0A 3ANMA 4BV9A 2PH3A 4FS3A 1NASA 4R4JA 4UUOA 4YRDA 2PGJA 1C0IA 2PY6A 1IY8A 3BZUA 3CINA 3W4KA 1O8CA 3W8FA 4DIOA 1N8KA 1GV0A 1LDYA 1I2BA 1NFQA 3H7AA 4Z6KA 2AEJA 1P1KA 2VRCD 1TB4A 2FRDA 1DSSG 2B83A 3PEFA 1F14A 3PQDA 4B4UA 6LDHA 4E3ZA 3V2UA 1OAAA 1SB8A 1Y9AA 3OM9A 3SVTA 3WYBA 5ICMA 2HAEA 3CSDA 4CM4B 2B5VA 2QZZA 1ZXBA 1H6BA 3EW7A 4RJTA 4CR8A 1C0LA 1XKQA 1N9GA 4MVJG 1VC2A 3F4BA 3ICCA 3S8MA 1ENOA 3UF0A 4FDAA 1I32A 4NJMA 1ENPA 2G1UA 4JBHA 4GKVA 5ICSA 4B8WA 2BHLA 3BMQA 5JY6A 5JAQA 3EZYA 3L9WA 3GVHA 2IZ0A 3EY4A 1I30A 3QVSA 1XWFA 3Q9NA 3VPFA 2FY8A 3UUWA 1Y7TA 3GDOA 3WOHA 3QVWA 2PD4A 5BR7A 3S2FA 3EC7A 3TFQA 4ZN6A 1EE2A 4M49A 3HFGA 4LMRA 2EF1A 3VZSA 4RORA 2RCYA 2VYNA 3QW2A 3VTFA 3OQBA 4J3FA 4AJOA 3MJCA 4CM6A 2YHIA 2G17A 1DIRA 3G79A 1QV6A 1HDZA 3ENNA 4FFPA 3FI9A 4HBGA 4HNHA 2Y99A 4W99A 4MJLA 3UW3A 1EDZA 2YHUA 3AY3A 5DT9A 2NU7A 4D45A 3GFGA 3N58A 4DMLA 1YQXA 2FR8A 2Q2WA 5JC8A 2OHXA 1XEAA 2Q1UA 3NYWA 1ZMOA 2YDYA 4RPGA 1BW9A 4IDDA 3K92A 4L74A 3R6DA 2CVOA 3WTCA 4R01A 5IDQA 3PPIA 4R5MA 2A4KA 1T4BA 5F1KA 4K26A 2CY0A 4Y98A 4YWJA 4DPKA 4W9NA 4BMNA 5C3MA 2X9GA 2H9IA 4CMCA 1ZKMA 5EJ2A 1IL0A 1I36A 1YL7A 2VZ8A 1SOWA 3ZWWA 1X13A 5JYDA 4CUZA 1X14A 5MDHA 1OI7A 1LQTA 2PZJA 4PLYA 4M1QA 1W0CA 3AK4A 2ZTMA 4TKLA 3NRCA 4TVOA 3RC7A 4H15A 3PZRA 3K2BA 1DLIA 3UCXA 1KEUA 4L9RA 1B15A 1HXHA 3WGIA 5BSHA 5KKAA 4QO8A 4Y6RA 2Y05A 3BTOA 4KUGA 1V3UA 4UUPA 2QQ5A 4U6SA 1DC3A 1KBZA 1B26A 3WG9A 3JQEA 3TZ6A 4BHTA 4J49A 3DOJA 4OMUA 4XDZA 3X2FA 2OP0A 3E9MA 1EVIA 4PFJA 4RF3A 5KVQA 4WECA 1XQ1A 2GN8A 5K0ZA 1E6EA 2Y1FA 1RKXA 4OXNA 3KHUA 1E6UA 4D42A 2X6TA 3FR7A 1PZGA 3GHHA 2NLOA 3W8DA 1NAHA 4CMIB 2EGGA 4WGGA 1UXHA 1PL7A 2X0IA 4E32A 1WXDA 4CPDA 4BKRA 4BO5A 1AHIA 4MVJM 5FYDA 4J7CA 1O94A 3TRIA 1K3TA 4DC0A 4NK5A 4M54A 1D3AA 2DT5A 4B4VA 4CV3A 4AJ1A 3RC2A 3PYLA 1M67A 5KJCA 1YB4A 2DVMA 4JP3A 5CPFA 1KY5A 1WW8A 4R69A 1KVQA 4GSKA 1NYTA 2NU9A 2Q4BA 1XG5A 3U4IA 2WE7A 2EV9A 4XQ9A 3PP8A 1MC4A 1ENZA 1UP7A 1NFRA 4UAGA 5T8KC 4RVGA 4E31A 5B4VA 3BIOA 4MVJD 1LDEA 3RUCA 3KRTA 1K6IA 3WLEA 3IJPA 1SC6A 3RUAA 4E33A 2HMUA 3W4JA 3HN7A 2GLXA 4LSWA 3ETDA 4BNUA 4NG5A 1GYPA 4Z0PA 4J7XA 1K6XA 1P33A 2C82A 2WYWA 5I9MA 4N5NA 1PJTA 4C4OA 4YDRA 1O89A 2YHIB 5I7SA 2OP1A 3WLFA 4JROA 4QFDA 3HJAA 1ULUA 3HFSA 4WASA 3BHJA 4A10A 2HRZA 1V9LA 3H9JA 1SO8A 1TXGA 3H5AA 1HDXA 4RPJA 2H6EA 3RUDA 4OGWA 4GX1A 3VH3A 1HRDA 1UAYA 3ZNOA 3JQ9A 2ZKLA 4J91A 3K96A 1OZAA 3PWZA 1T1RA 5KJ1A 2PKQP 2DFDA 1GCUA 1O9BA 1S7CA 2NQTA 4XGKA 2B36A 4YJFA 1E1LA 2ZCVA 4EDFA 2NUAA 4O5OA 4AJPA 1N9GB 4A26A 3FWNA 3FSRA 4ND5A 1TEHA 2HU2A 2GF2A 4CM4A 5JDCC 1HETA 4R1SA 3VZRA 4DBZA 2NQ8A 1HDGO 1IULA 1UZLA 3SC6A 5FF9A 4DA9A 3GRKA 4B7CA 1OC2A 2X86A 4OHUA 5JDCA 3I6QA 4IIUA 1UXKA 3JQGA 4R54A 4XYBA 2CZCA 4B7XA 3L4SO 1BW9B 4HV4A 4E2WA 1F8GA 3A1NA 4XD2A 2UV8A 2NTVA 3RJ5A 4IDGA 1EVJA 1H2HA 1GV1A 1PJ4A 2GGSA 3D3WA 3DAPA 3JQ6A 4K6FA 4R1UA 4Y6SA 2YFHA 1UAGA 4U0KA 2A92A 1WPQA 2AG5A 1HTBA 2PA3A 1JVSA 4L75A 1CJCA 2EP7A 4N5LA 3JQ9C 3QQPA 4FJ0A 4TRRA 1LSUA 1NHGA 2BI8A 3L77A 2EJVA 1ISHA 3P19A 2FPIA 4XRRA 4P38A 3PVZA 4PVDA 2EEZA 2X8LA 4IGEA 5A3VA 4BO4A 3LF1A 2H5LA 4URFA 2ZB3A 4BNKA 2Q1WA 4QECA 4EBFA 4OSOA 3ZV3A 2PKRA 2O3UA 4RO0A 1EFLA 1GQ2A 2DFVA 2QRJA 4YQYA 3I4CA 1GFSA 3N7UA 1FMCA 3VVCA 4YXFA 2Z95A 2ZQYA 3ZV6A 3WJAA 2AQIA 4D44A 3DO5A 2Y1EA 3JD3A 1R4NA 4Q3CA 1WAMA 1ZFNA 4FGSA 3V1YA 1Y8RA 3AW9A 3Q2KA 2OZPA 1Z6ZA 3PQEA 3S2GA 5IDWA 1VKOA 1LBEA 3ANLA 5L4NA 1BWSA 2JCYA 4YAJA 3RU9A 2OGUA 4UUNA 2VYVA 2I67A 4UVEA 3NT4A 3ZW8A 1H6DA 4U6QA 4WCFB 4DBVO 3OH8A 1UP4A 3VHRA 2ZTVA 4FB5A 4MVJI 4PLVA 2WYUA 3RUIA 1UDAA 3A4VA 1PR3A 4R3WA 3QVTA 3VH2A 1UZMA 3L0DA 5C7LO 3UCEA 4QO7A 1E3WB 4FJ2A 2PGLA 3KM0A 5JPIA 3UICA 2EHDA 2BFMA 1E3IA 3RKRA 3BTUA 3H8VA 2F00A 2JFHA 3WYEA 4BO8A 4RL6A 1Y6JA 5JS6A 3S1LA 3DMTA 1ZUD1 3E5MA 4O0LA 3WNVA 3WS7A 3U4CA 1F8FA 5BQFA 5LDHA 9LDBA 3V1UA 3CMMA 4YJHA 3TOXA 2X58A 3AFMA 2PZMA 3AM5A 5DBGA 4BKOA 4CMAA 4GBJA 4HXYA 4ZICA 2DU8A 4BGEA 1YOVA 1PX0A 4JX8A 1CETA 1PQPA 3NX4A 4E2ZA 1RWBA 2PD3A 5K6AA 3EHEA 4CQMD 2ZYDA 3S55A 3ADPA 4JBIA 5A1TA 4IGFA 4F45A 5JE8A 1YL5A 4D0RA 4YAGA 2ZJ1A 4ESOA 4BO7A 1LSJA 2Q1TA 1Q0QA 3ZZNA 8LDHA 2WM3A 4RPKA 3JQFC 5EESA 4KZPA 3ITDA 4D3SA 1SAYA 3U49A 2QHXA 1PGQA 1YB5A 3LQFA 3HDQA 1I10A 3F46A 4NMHA 4UEOA 4BL5A 1YBAA 1TT5A 1Y8QA 4JP2A 4OKNA 1YBVA 1QV7A 3JD0A 3WGYA 2YDXA 3Q6IA 5L4LA 2OOSA 1ADBA 4PG4A 4Y67A 2IEDA 1Q0HA 3PIIA 1E7QA 1IYZA 1PGOA 2YQ4A 5AXDA 3ZNQA 3MJ4A 2PV7A 4AJIA 2VUSA 5AVOA 1ONOA 3MZ0A 3FPCA 2NNLD 4CMJA 2GDZA 4A03A 4RZIA 3ZWCA 3QWFA 1NR7A 3C1AA 2ILTA 5JC1A 4L0QA 1WNTA 4UEJA 3JQ7B 1VL6A 2CF5A 3GG9A 3SC4A 3BMCB 2C2XA 4XEHA 2DKNA 2EJWA 4WPGA 4NK4A 2JD2A 4HFNA 1D8AA 1NP3A 2X5JO 4NFHA 5IXYA 3KVOA 3AOGA 5IZ4A 2NVUB 5GZ3A 1SMKA 2V6BA 1RM4A 3UHAA 3ZWAA 3E9NA 4JNKA 3WSWA 3I52A 2PWZA 3AWDA 5CDTA 4B7UA 1E7YA 1NR1A 2OUIA 2BMAA 4XIYA 3VZPA 1ENYA 3F6YA 3VVBA 1V3VA 4GWGA 1CRWG 1PL8A 4YJHB 3TJRA 5EPOA 2OBNA 4E6PA 2O50A 5CEFA 3D7LA 1CEQA 2BGKA 5C5IA 5DOZA 3O9ZA 4RPLA 1ISMA 3OJOA 1L7DA 3SLGA 3OSUA 4II2A 5GZ6A 3U9LA 4A27A 3BHIA 5DNAA 1YE3A 1LDGA 2Y66A 3MOIA 1GZ3A 1PJQA 1WDMA 3DBHA 3ENKA 4HADA 4N5MA 3I5MA 4YAEA 3TN7A 3MOGA 4AJNA 3CH6A 4J1NA 4YEDA 5IF3A 2FPGA 2JFFA 6ADHA 1N5DA 1UP6A 3B20A 1LLQA 1Y1PA 1P45A 2IXAA 4GVXA 3LYLA 3EZLA 3K9QO 3JCZA 4R41A 1NTOA 3CIFA 3GHYA 4FBGA 1CYDA 4WCFA 1E6WA 2I99A 3CEAA 1A4IA 2D4AA 3JQGB 4GLOA 1U5AA 3D1LA 5KIAA 4DREA 4J0FA 5FWNA 2CVZA 4OSPA 4RF2A 1UUFA 2WE8A 4PG6A 1JKJA 5CEJA 1MFPA 3AM3A 3FBGA 4A5OA 1ZCJA 3P2YA 4DXHA 4ZQGA 2P9EA 4YCAA 4IPTA 4P4GA 2P4QA 4QUKA 3GAFA 4YBZA 2V6GA 3DR3A 1WP4A 1DFHA 1KEVA 5B1YA 1U4OA 4B4OA 5JXWA 1I3KA 2VHYA 1KVRA 1Z82A 2W98A 2HJSA 3H6KA 2JAHA 4NBTA 4WNCA 2FR0A 2WJPA 1SOVA 2VNSA 4OH1A 5DP2A 3UH1A 4YRBA 2XF8A 3C1OA 3B1KA 4JJFA 4AICA 5K9ZA 4DIFA 2NU8A 4R5HA 3OIFA 3P5SA 1FK8A 2DTDA 2IDZA 1E1KA 4FGWA 3QWIA 3LDHA 3MTGA 4CR6A 1VKNA 3EVTA 3O8QB 3CKYA 4XQEA 3I9NA 3ZU2A 1JU9A 2R00A 1KEPA 2A94A 1VJ1A 4AJEA 2R6JA 1EZ4A 5DN9A 1Q1NA 1X1TA 1YJ8A 3L9XA 4L73A 3RC9A 1T1SA 3IP3A 2Z1MA 4B8ZA 4CLRB 4QX6A 1XYGA 1V0JA 4AJJA 4BNVA 3UXYA 3DZGA 3WNQA 4WEQA 5DBFA 1XSEA 3K2EA 1IZ0A 3GMSA 3VZQA 2JJYA 2RAFA 2J5RA 4GMGA 2PNFA 3UAGA 4NZ9A 1DOHA 7MDHA 3ASUA 3D64A 3PJGA 1QR6A 3H9EO 5HS4A 5DCYA 2FSVA 1F0YA 1E1MA 1M75A 3OP4A 1EK5A 1YQGA 2QG4A 3SJUA 2YW9A 4CODB 2O3SA 1CERA 2Q3EA 2UYYA 3WICA 3IJRA 4JJIA 3NJ8A 1W4ZA 5COAA 4E13A 2VOEA 2G82A 4D3FA 1DB3A 1TVEA 2DQ4A 3DZJA 4BNHA 2RH8A 5BNFA 3HSKA 1KVTA 3AUAA 5THKA 4BNJA 4MPDA 1C1XB 1LI4A 1V8BA 5IJZA 5KVVA 1EBFA 3KYCA 3E03A 4OJNA 5ER9A 4A2CA 4XRGA 1NVGA 1FDVA 1SEPA 5AYVA 2D2IA 4MIOA 3KYDB 2YY7A 3RSHA 5JNLA 4E30A 3W1VA 5K6AC 2FPPA 3JD4A 5U1PA 5CAEA 1LRJA 3WGGA 3EUWA 1B16A 5DDIP 5A5EA 2YV2A 4IXTA 1GYQA 2NADA 2FN7A 4O59O 2FHSA 5GZ1A 3NJ4A 2O23A 4Q3BA 1YO6A 1EUCA 1R37A 3R3JA 1QYWA 3GVXA 3KEQA 1LU9A 1WWKA 3OIGA 3DEYX 4ZQEA 4E5YA 3OBBA 4YAKA 5C7IO 4XYGA 3VPXA 1X7HA 3LT2A 3L4BC 1PQUA 4OXKA 4TZKA 2EWMA 3DZFA 1H93A 2GZ3A 3FN4A 3VKVA 3T7EA 3OECA 4HWKA 3RBVA 2D8AA 4HUJA 5LCXA 3DWFA 4L76A 3LC2O 1ISJA 2GSDA 3PLNA 4XGNA 4DYDA 1XR3A 2W2LA 2HQ1A 3WGZA 3ZWVA 2PZLA 3OJFA 3KSZO 4ND4A 4EZBA 4IMRA 4RCVA 3RFTA 2X5KO 1GPDG 4NBUA 3KYBA 3RUHA 3W6UA 1CWUA 3PQFA 1CF2O 1LDBA 3E5RA 3GMDA 3ZHYA 2OFPA 2JHFA 1J4AA 2DBZA 4J9UE 2NTNA 2GCGA 3WGOA 3PLRA 1B3RA 4HY3A 4AJ2A 3W8EA 2VT3A 1ZBQA 4AJLA 4BNLA 4CM8B 5B4TA 4G2NA 4R3NA 2JHGA 4E0BA 4D79A 4OO3A 3DAGA 3MJTA 3JQBC 3ETEA 3S2IA 3ZNPA 3V5NA 3I9OA 1PSDA 4DWVA 3F5SA 1P0FA 1DHRA 4WUVA 1GD1O 1QYXA 3STHA 1D1TA 4YB8A 4FIZA 2C0CA 1JTVA 4YT5A 3VTZA 1RJWA 2DAPA 3QE3A 1N2SA 3F5QA 3IIEA 2VHXA 2Y93A 3BAZA 4K9DA 1B8VA 3TDKA 3TL2A 3O8QA 2GRAA 3JQ8B 4NH4A 4PZCA 3G17A 4KWHA 4EJ0A 1ISIA 1IB6A 4EEZA 4Z3KA 4OQZA 3IQDB 1HSOA 2HSDA 4BUCA 4ZGWA 5JW6A 3BTVA 4UUMA 4MO2A 3HB5X 1NWHA 4K28A 4OIMA 3ZWXA 2C5EA 5ES3A 1TT7A 4I1IA 3WIDA 3I1JA 1P1RA 2NSDA 3B1FA 1YQDA 3O4RA 1DAPA 2JAPA 2GASA 4OL9A 5TJHA 3RAJA 1GCOA 3DB2A 2FWMX 3F1KA 4FD3A 2P9GA 1LC0A 3TNLA 5G4LA 1X7DA 4ID9A 3HNPA 2ZCUA 1DPGA 1K89A 4J2OA 1KS9A 4IZHA 2O3RA 4E21A 3WQQA 4GPD1 1IZ9A 3CZRA 3ONFA 4FN4A 2I5PO 1NQ5A 1GADO 5CDYA 1Z74A 4WNIA 3JD1A 4QEDA 1ADCA 2HK8A 4B3IA 3DBHB 5JDIC 2NM0A 4XJTA 2VRCA 5TGDA 3RASA 2CF6A 5BSFA 5IDXA 4N18A 1QRRA 2C20A 2IRWA 3E48A 3TZHA 4H7PA 3PYXA 4GWKA 4J0EA 1ZSVA 1M66A 5A06A 5A9SB 1ZNQO 1JW9B 3H3JA 1PEDA 1DAOA 1A7KA 3GPIA 3G0OA 1X0XA 3GT0A 4J4HA 1DHTA 3FHLA 2BH9A 3GZNA 5JO9A 1E7MA 3KEOA 3PHGA 1JDJA 1C0PA 1FDSA 5I8ZA 3R1IA 3BMQB 4RQTA 4J4TA 4HP8A 1ZXLA 4H3VA 3VDRA 2D3TA 2VWQA 3GQVA 2CUKA 3LVFO 4J6FA 5TIIA 1E3SA 4D7AA 4IJWA 5JCXA 4YTEA 3AUSA 3I9LA 4MVJE 1F12A 2IE0A 2XXJA 4RDIA 5T6BA 1C1DB 4AJHA 3E82A 4PLTA 1DIHA 2GUGA 2LDXA 2YZ7A 3QVOA 4PRKA 3ZCXA 2IEBA 4KUHA 3IS3A 1GTMA 5DOVA 3P7MA 3ICPA 3ONEA 1ZSYA 1UDBA 1N7GA 1GUYA 1PL6A 2QW8A 1YH3A 2B35A 3E8XA 1G0NA 2XPCA 3N74A 4M87A 2HUNA 3DZBA 4W4TA 3PIDA 4D43A 4YJGB 5KJ6A 3CXRA 1ISFA 1BG6A 1HYEA 2QRLA 1ORRA 1PZFA 1TT5B 4HFMA 2H63A 3HDJA 2Y68A 3B1JA 1YB1A 4CLOB 1U4SA 1IHYA 1BXGA 2X7HA 1H6AA 1EK6A 4XGIA 2O4CA 5IN4A 2Y0DA 1JAYA 3DBLA 4TWRA 1Z7BA 4WKGA 3KSDO 1HDRA 2VTDA 3DL2A 4FJ1A 2NVWA 4J90A 3RC1A 3VDQA 4IJVA 2CFCA 1UJMA 2GNAA 3AU8A 4AFNA 1MLDA 1GEGA 3MJVA 1FDWA 1K6JA 5ADHA 3IUSA 1B7GO 1NWCA 1QYVA 4QTZA 5I7EA 1NPYA 2UUPA 2C7GA 4R1TA 2BELA 1BDMA 5G0SA 1ZEJA 4WLOA 1EQUA 1Z45A 2X0NA 4KOAA 1K0UA 1XU7A 4XX0A 4N54A 3IKVA 3UVEA 2DUWA 1GL3A 2B5WA 3PJDA 4JJGA 4YA6A 3Q0EA 5TQVA 1PJ2A 2VTEA 2Q1SA 1E5QA 4XWYA 3VPGA 5B12A 3SXPA 1UXJA 3ITKA 3GNTA 3X2EA 4UEKA 1E3WA 3HUDA 3ORFA 2VZ9A 3QJ5A 1GUFA 2A35A 3QP9A 4R51A 1UXIA 4I08A 3QA9A 1VL8A 2Q2VA 2W4QA 4CQMA 4CQMB 5AOVA 3WGTA 1EMDA 3ZDFA 2FZEA 3BHMA 5IZCC 1FJHA 3DZHA 1DRVA 1VJ0A 3UOGA 3ZWPA 1U2DA 1EVZA 4BO0A 1PGNA 2B4TO 4DMMA 5L7TA 2VWPA 2P9CA 2VWHA 1WVGA 1NAIA 4PG8A 5ILGA 3DTTA 3T7CA 2CD9A 5FEUA 2DPGA 4RDHA 1C1DA 3GGPA 4GX0A 1GAEO 2W2LD 2HKIA 2VHZA 3M1AA 1YKFA 1Q2XA 4Q3DA 1RPNA 2BI7A 4BQRA 3D0OA 5TS3A 1P31A 1PJ3A 2OORA 3I23A 5G4KB 3RD5A 4DLAA 1LA2A 3PGJA 4TRNA 1QG6A 2QYTA 3KLMX 2VOJA 1KERA 2H1SA 4IDAA 4WEOA 4E5MA 4GGOA 3M1LA 4IZIA 1A9ZA 4PG7A 1IPEA 4GSLA 1YOVB 1I3LA 1HE3A 4MVJH 1RYDA 4MP8A 4BO6A 3ADOA 4LGVA 5DZSA 1ZK3A 2Y1CA 1T2DA 3JV7A 3KLPX 1T2FA 4IQ8A 3OQ6A 4BGUA 3GNQA 2BFPA 1J6UA 3GG2A 2HMWA 1HZZA 5TJ9A 4IS3A 5TT1A 3TL3A 1E0DA 4NBRA 3K6JA 3D4OA 2G76A
chains in the Genus database with same CATH superfamily
2Q7OE 1BU8A 2Y0PA 1P1FA 2AG8A 4ZOAA 3KHSA 1ZHOA 1LZKA 1DRWA 1G8GA 2PLAA 5T4EA 1KRWA 3JQDA 5CB8A 2EBUA 1R50A 2EW8A 2AXEA 2VUIB 4XM0A 1N9ZA 3ONNA 1NVVR 3RADC 3OFJA 4QT4A 5LOVA 2PUWA 1OSNA 1WBJB 2JJ2D 3R3UA 1U2DC 1ABEA 5J9FA 4LJKA 1GVHA 5CGQB 1DBQA 5CDSA 1IBMB 2IIVA 4Y2TA 1PF7E 3AUUA 2XOXA 4M8SA 3HRIA 1JPNA 2QRGA 4DL9A 5KQSA 2BP7B 4A6EA 2PDAA 2FLWA 1REQA 5TMEA 1K2VN 1HYHA 3ZDDA 1A9PA 4TS9A 4XWWA 1DU4A 2JJ1D 2Q45A 2PUFA 3VHXA 4R8SA 1NIJA 1ORTA 2XJ4A 5J1SB 4MHTA 1QQ5A 5K8LA 1Q1GA 1EJBA 1Y9JA 3U4QB 1UADA 2VT6A 4KDCA 1A9XB 1AUVA 4L6IA 1GGEA 2GJSA 4X7BA 1H6CA 5GTDA 4GOND 3MFQA 2CZQA 4I55F 5CB0A 5HKOA 2H2HA 3NHPA 3TI7A 3PC8C 4GPBA 3IAS1 4LIPD 2WTBA 1NMSA 1EK0A 3EB9A 3EQ9A 3H5IA 1EVQA 2Y1XA 3INRA 5A71A 3KSAC 2X7JA 1BXZA 1PJRA 1XU9A 2FQ1A 2NUBA 2Z2KA 3KUCA 4IDEA 4PR0A 2PX8A 4B34A 4M38A 4C03A 4EB6A 5KDDA 5MN5A 1I6WA 4JXXA 3LUDA 1VKHA 4JBWA 4XOIA 1K08A 2WPNA 3OG9A 4BBJA 1WB4A 2FG6C 1N2ZA 3D81A 4LY6A 4JXKA 4MAMA 1HFWA 3O74A 4XDGA 2VRBA 4EF4A 2F8LA 4ZU3A 2Q3BA 2O2HA 2ZI4A 5IC6A 3ELUA 4DLPA 2GFIA 3B7WA 3R6WA 1EUZA 2XMRA 4Y9TA 2DBRA 5FWYA 5HGJA 1YV9A 5KC8A 3CF4A 1FU7A 2ODWA 1J09A 2Y0EA 5KNCH 1T2VA 4B4KA 2SECE 4WLFA 4WXEA 3UJ8A 2VF8A 1HDYA 4TTSA 1QTQA 1N32B 1JIXA 1HUQA 4LG1A 1HY3A 2XLBA 3PHHA 4FBLA 5DHSA 3D7KA 5ALKA 2IHKA 2AQKA 2O1XA 2Z1NA 5FI3A 4HZUB 4CM7A 3RC8A 3ILSA 2RGUA 1UBCA 3NETA 1A71A 4PPGA 4LMPA 3DDOA 3TOSA 5B7PA 5CBPB 4Y2QA 1B23P 4NYJQ 2XR1A 3LUFA 3I83A 2NGRA 4BAUA 4R81A 3VNQA 3Q0TA 1ZCZA 2V8BA 3AI1A 4LOKA 4TMYA 1Z07A 4YCSA 1XK6A 2OC4A 3C1TA 3FRHA 1ECJA 4WFQA 4RETA 1JALA 3CWCA 3D4NA 5E7JA 4AG6A 1ACMA 1X2BA 1DAIA 2H8GA 2FWPA 3BXEA 2VNIA 4I4TB 4V2UA 5BVGA 5FA5A 3K0CA 3FNGA 3HI6A 3I58A 4P4LA 4UXIA 4RTNA 4E12A 1M2OB 1E3JA 1KJYA 2GN2A 2X9VA 2B92A 3DVSX 3AYZB 4X62B 4PFSA 4YJKA 3C74A 3D8HA 4TXHA 2XYVA 1MNAA 3IMKA 2JJ1A 3QEMB 1TK2A 1XAGA 1ADYA 3ZE7A 1LV8A 4Q4LA 1Q3TA 1G8PA 1QUEA 2N75A 3L8HA 5I9TA 1SUPA 3KQOA 4FE3A 4MS3A 3IQEA 2IU0A 4MYRA 1T36B 1JVBA 1NNI1 3OX1A 4ZQBA 4XWAA 2QN8A 2XUKA 4DV3B 3TEMA 1ESDA 3GLGA 3EPJA 1CQPA 1TM1E 5JIBA 3GXBA 1MABB 1JKFA 1Z12A 3FTDA 3S68A 2KX7A 3H9BA 3ZXYA 2FFRA 1VGQA 4FT4A 2VA9A 4IIJB 2AJCA 1G5TA 2D54A 4G81A 5AJXA 3ZUGA 1U8FO 3RIGA 5JO0A 4MJ3A 4BNYA 2F1HA 2IIPA 4H6XA 1M73E 4E7PA 1TAGA 4PICA 5JU6A 4X20A 2OD2A 5ESWA 5EWLA 2G40A 2JL1A 1R6DA 3IA2A 1JQ3A 1PWXA 3BZWA 4BMYA 1ZH8A 2TRSB 5AVWA 2EHJA 1GQYA 1V8OA 2GN6A 2L2QA 1YDWA 3HDGA 5ENDA 4ZQFA 1T24A 2EQAA 2DTXA 3KEMA 2YYYA 5GONB 5HZMA 1AGPA 5DYIA 5KSZA 2WZCA 4IIJA 4POOA 5C4MA 1V8PA 2PWYA 5EHXA 4MDHA 3MCAA 2QMQA 4GU5A 4XYMA 2G1PA 4HDMB 2COUA 3NW9A 1XZFA 1Z73A 2YJZA 4YT8A 1PZXA 4NR0A 2XDQA 3KR2A 2H11A 1AKMA 4CM8A 1JDNA 3AYXB 4FPXA 1GR1A 1MO5A 2V7QD 4S3MA 2L17A 1I3MA 3O0DA 5CITA 4GIBA 4KLCA 3KV3O 4J29A 2P9FA 2HA6A 3H0EA 4W8HA 5EZYB 1RXWA 1ZOLA 1AKWA 1HG1A 4KXNA 1ZHHA 1UIRA 1X0VA 3TZKA 1KMHA 1QG2A 1U0JA 3I30X 4DR1B 2H7CA 1I0ZA 2BKUA 1VRWA 1UOEA 2XHZA 3EEYA 4D9IA 2BCEA 1QMPA 4M37A 1EGAA 3NYQA 2RCNA 3TOZA 4AQDA 4LOHA 4DEVA 2OE2A 3GN2A 1NRXA 5I9BA 3JWPA 2P9JA 3N7AA 4U8GA 2WM9B 4MV5A 4YJ2B 1V11B 4KVZA 2QMOA 5BNIA 4D5GA 3VKGA 4CKWB 3FOZA 3HBMA 1Q0UA 3JZFA 3LWNA 3QU2A 3VAAA 3DOCA 5BVHA 4I99A 1XCGB 5BOSB 1CZKA 2CLIB 2D13A 2FP4A 2ZVJA 4XGRA 4MLPA 2JLUA 2W2KB 1JAXA 5HG0A 4P36A 5EE0A 4TWZA 5LP6C 5A4DA 1OJ7A 3PD0A 2VDOB 2CLCX 2GM5A 2ZB4A 1M7GA 3N75A 4G5FA 4O4JA 4PHGA 4TSFA 4E09A 2ZIEA 2ZYGA 4R2IA 2GJ8A 3K70D 2ACEA 1E3DA 1KSHA 4KWIA 2Z4SA 3PUVA 4LN1A 3T7TA 2AXQA 4AYXA 4L95C 1EUCB 1C30B 1QANA 1R8JA 5CCBA 1U7TA 1GPJA 1SXHA 3LZ6A 4EYKA 5KSWB 2ZB7A 2AUMA 4JB3A 3SKVA 1WUKS 4ZOEA 5B58C 3LIIA 2QVBA 2GB4A 2G9QA 1R00A 1AZTA 1RRPA 2DFLA 1FZQA 5I3CA 4OHMA 3VYVA 1DG9A 2IHZA 2BLNA 3IBGA 3DVAA 3G5MA 4DM3A 4IH9A 2JHPA 1I4WA 1BGWA 3QU7A 5CX4A 3KQTA 3WZMA 5LMNB 3NDIA 5F1OA 2NIPA 4K0KB 3EODA 1J7JA 2QLFA 3INTA 2O2CA 1MV8A 2BM0A 4R8RA 3WGKA 3NG1A 2V96A 2E4YA 4PIVA 5B3LA 5REQA 1I3OA 1U2QA 2W43A 1VI6A 3HCCA 4N5HX 3KQLA 3GEGA 2PX5A 4GZ5A 4MRNA 5ALUA 4WINA 4DCGA 4EI7A 3LTNC 3EEFA 3SS7X 1W4AA 1L7EA 1MP0A 2H0RA 3ZDBA 4ZQHA 3NC0C 1UDXA 4ZHQB 1EIZA 5FUQA 3BIFA 2HSGA 1D09A 2GEJA 2YBEA 1XZ8A 4B85A 3G7UA 4KDEA 4OJYA 3V55A 1H2WA 1KJ9A 2O1EA 2PTGA 4YP6A 1GQQA 2G83A 2XYQA 3NYIA 4DGQA 3C7KA 1SKBA 2IH5A 4BMSA 1H22A 4CF7A 3PL5A 3RI3A 2W6JD 2WSYB 5JYEA 2NUTA 4HH0A 3HCAA 3OZCA 1QIMA 4ZK2A 4E4YA 2N1BA 2G07A 2PR2A 1C4KA 4KN5A 3TW0A 4ZCRA 1TU0A 5JPDA 2CT8A 1VECA 2AOTB 1WABA 3VSEA 1FFEA 2BV3A 1GL6A 1FXSA 4IM7A 5AVKA 4YUYA 3KV1A 1L1FA 3EIEA 5AI9A 1KKUA 1B2RA 5FNZA 2BBWA 3T54A 2Q21A 3OMLA 3O2JA 4XR9A 2P4HX 5C0OE 1YGYA 3CNNA 1FDUA 4F7WA 4P3OA 3HCEA 5JBQA 1HYGA 3I0ZA 4PNHA 5JSFA 4YMTA 3LPLA 4FYKA 3H5VA 2FN4A 3CNLA 3G1WA 4W82A 3PKJA 2J6CA 2XEDA 1LXCA 3FPHA 1U5BB 2ZWIA 3X1DA 3WAKA 2N47A 5IHPA 1K68A 3DFUA 1JSLA 1JPUA 3IQWA 1Y1KE 2H7XA 4OPMA 1UMKA 4RS3A 3BWMA 3ZDYB 2GMWA 5HK9A 2DR0A 2VYVD 1W5EA 1DBIA 1H9AA 1JEQB 2OZVA 2ZRPA 4LKOA 4BUZA 2XKJE 1TPZA 3LDAA 3TUZC 2XZLA 2BFCA 3OIUA 2P0AA 1MTOA 1WF6A 3WADA 5CCEA 2WSSA 5AHKA 3G2IA 4TT8A 4ABYA 1TQ6A 2GKOA 3I8SA 3UM9A 4GVPA 3DDNA 3OJEA 3RRNA 1EM6A 4P32A 3E1KA 4NBVA 3MAAC 3VV2A 3ZDEA 2RK4A 2DHQA 3KBBA 3NUGA 4JI8B 1SVUA 2ZIAA 1SQ5A 3LY7A 4ZD6A 1CS0B 3IKTA 4UDYX 1ODFA 4DUPA 4HX2A 1P1IA 4EK9A 3G89A 3ZI0A 4U7PB 3RGWS 1A9XA 3P26A 2O7SA 1YIDA 2BDTA 3F7OA 3MCVA 4ZPJA 3F5MA 1RTKA 1ND6A 4HXEB 1QPZA 5HSGA 4RTJA 4TMFA 4MVJF 1T6XA 2PZEA 4IXMA 2OZEA 2ZT5A 3NPMA 3T9BA 3RABA 2AW5A 1OZ0A 1C5KA 2HPVA 3PEVA 3ZIAD 2D2XA 1GY8A 4HZIA 4IXDA 4YC7A 4G1FA 1KOLA 4BMOB 3HN2A 1J0CA 4O2LA 2FJUA 2P0EA 2ZEJA 4B32A 1HFKA 2RD2A 4XQGA 4C4XA 3EVFA 3FOAA 2GPYA 4MULA 4TS4A 3C7AA 1IY9A 1SCUB 3FTPA 3W79A 1JJVA 1R0KA 3PUYA 2O05A 3QBJA 3G2QA 1ZGCA 4IIVA 1CU1A 1K9SA 2ONCA 5DVZA 4BQSA 4DG9A 4GNRA 5L53A 3A26A 2E4UA 2AZ4A 3IT2A 4L6AA 1H2RS 4BVAA 4FE7A 4COKA 3J80A 5DNCA 2CE7A 2D0IA 1VSBA 2GOYA 4GP6A 3V4RA 4QYXA 1OFUX 1CR0A 1JHPA 1N6NA 2X0RA 3BFJA 3E9QA 4P7FA 3ORQA 1PV4A 2NXNA 3OUZA 3HNOA 1ZK4A 2IZZA 2Y67A 3KOYA 1HEUA 2NN3C 2EVWX 4JQOA 4PPNA 2GF0A 1F2DA 4IYJA 3M2PA 2B61A 1NW8A 1KVUA 1USUA 3AUKA 4J4BA 5FBQB 3T5PA 1RJGA 3DC7A 3ZYZA 2WIKA 4S05A 1K88A 2QSYA 3DM5A 3K9BA 3P0JA 3O8LA 3DOOA 1G8YA 3KQYA 2VXCA 4PWZA 2PLFA 1WQ3A 5IDYA 5JD5A 4K2AA 3V6MA 1J0XO 2IEGA 2COKA 2QX4A 1YCHA 3LNTA 4L8VA 4A6DA 1XRRA 3PB3A 4AY2A 4BX8A 1TYAE 4JT2A 2GA8A 1ML4A 3QELA 3RGGA 3WMXA 4GLLA 2D1YA 2C59A 1TCAA 2W42A 2UU9B 3M82A 1GQOA 1T91A 3NO4A 2FKAA 4KQ9A 4FWBA 3F2IA 1YFJA 4DC1A 4S35A 1O97C 3DNFA 5E8RA 3BORA 1M6EX 2WFMA 2R97A 2NZYA 4NDAA 4PZAA 2G8LA 1V1RA 3Q3IA 4GI5A 4PWYA 5CW1A 4N5IX 2P79A 2E1PA 2UUOA 4QTUB 4RVSA 2XE7A 3SQWA 2ADOA 5BWBA 1EBUA 3UV6A 2CJFA 1HT0A 4NJOA 2X6QA 5ETJA 4TKVB 1XF1A 2QDKA 2JKYA 2HXSA 2ZR7A 1YF3A 1TYZA 3LWBA 5HEKA 1N1EA 4KLAA 4QPZA 1C41A 2CLDX 3NIGB 4L4XA 3THSA 1U80A 2DLDA 5B3JA 3SBOA 3T7IA 4EWLA 1D4FA 2UDPA 3SE0A 1IBSA 1OFUA 1RZUA 5HNKA 1U2PA 5ALYA 4BNMA 4F5YA 1RRMA 2OBBA 2YYAA 4LTNA 1ZJWA 3E9EA 4CLHA 1I0IA 4P7GA 5ALEA 5TPZD 3BMOA 2AMFA 1P60A 2D2EA 2HCTA 2W6QA 4LMAA 3L04A 3Q11A 1ULAA 1N0UA 1EX7A 1MQ8B 3NAZA 3ORRA 4B6FA 3PCRB 1KDOA 3DOFA 4DCNA 1P3DA 1B0PA 1ZD4A 2OBLA 3EEBA 4GR5A 4C30A 5CBPA 4TUYF 3K73O 3AP2A 3LUJA 3QXHA 2OO5C 3GZNB 1NMXA 1Y3AA 2PJZA 5AVQA 1PGJA 2PGOA 2V4MA 5JH7F 2GZDA 2XBMA 3MTQA 2VJNA 1DL5A 4M88A 2XWPA 1CE8A 3ICEA 4ZARA 3SSNA 5A9SA 1Q15A 4CTJA 3ZVMA 2IDMA 4C7MA 3K1ZA 3H0KA 4EENA 3WWEA 1OPRA 4KE8A 3BXGA 1NFFA 3TKAA 3MS7A 3ZY3A 3C3YA 2JH9A 3PDJA 1E0KA 2O4UX 2E5FA 2NVBA 3KTFA 5JQWA 3ZWBA 1LSOA 1QPGA 4B3XA 2VHVA 2BEUA 5E2IA 5EIEA 1XZJA 3CR7A 1S9DA 1C9DB 2EGUA 3CCBA 2WYHA 5LYJF 1Z6QA 1I33A 4MEBA 1PFQA 3FUWA 3VR5D 1XZDA 3TZQA 4EG0A 1GRQA 3PNPA 3OETA 4I4NA 4BFZA 2R44A 1JEEA 2P2SA 3BEDA 2Q6IA 3OE5A 3HADA 1C9MA 2YFQA 4S0ZA 1TJ4A 2LDBA 3LC7O 3JRXA 4RK0A 1GPH1 3SSAA 4PYKA 3OVMA 2EIHA 4FE4A 4I5DA 4MKZA 3VH1A 1N36B 4EVIA 1RJFA 1LGYA 2BJWA 1AXGA 2YUTA 4DUZB 4BXOB 3UHOA 2A3RA 3I05A 4CHTA 5BUZA 1LWNA 1KJQA 4G0NA 1M8GA 5CG1A 3RG8A 5DBOA 2NV6A 3OZXA 5DWVA 2XCLA 4R1LA 5FPHA 1ZOSA 4MI9A 4L57A 1KEEB 2M2IA 4FSHA 3WO0A 3UXHA 1Y8RB 5LP6A 3FLAA 3H2ZA 4F84A 5HF8A 1XCBA 4EM6A 2QIOA 3R5KA 4PCLA 4Z9XA 3T1QA 3FGOA 1T2CA 1Q17A 2BGMA 4HWRA 1NXPA 5DISB 3SLKA 1Q6ZA 2BSXA 2F1KA 1LV7A 3HB4X 2AF4C 1HL7A 3PJEA 5C5DA 2GAOA 5BN5A 1KMNA 5F21A 3ZZ0A 3FD8A 5EERA 4KPYA 2HJRA 2WUWE 1QHFA 4LC1A 2JI7A 4GF5A 5E9WA 4YMUA 2ZIZA 3KELA 3AEKB 3R2JA 3LF2A 3LLVA 2IEYA 3QX9A 4II7A 2F3PA 3SX0A 3WRXA 3QI7A 2JD0A 4JVMA 4BMVA 2HIGA 2MMCA 4D3ZA 1R66A 1W35A 4FSXA 3ZCVA 1M2VB 4PO3X 5AVSA 1LI5A 4RH3A 5J4VA 4YMGA 5AI6A 1M6WA 3EC2A 5EY5B 3C45A 2AX3A 5C8XA 1VG1A 1Z8DA 3ZBPA 3ZQ4A 4I1UA 1YQUA 4RF5A 3F6BX 4XFKA 4F6RA 3TW8A 5BRAA 2BDEA 1FLNA 1JYEA 1YKGA 3HKBA 4YBRA 2Q8PA 4R8MA 3UENA 4KRXA 1BA2A 1I4OA 1XTSA 1PS8A 3L7DA 3N2NA 1L4UA 3UJ6A 5FLYA 3Q5EA 3ZWOA 4W6ZA 1Z36A 2X8AA 1XD2B 1I2DA 1QGUA 1OX4A 3AVYA 4URHA 4JT4A 1QHYA 2I1VB 2IUFA 1ZP6A 5AXAA 3OEYA 3EZ9A 3IMFA 5CH5A 5C4GB 2WTNA 3C7TA 2BMDA 3H2GA 4CW7A 3PDCA 4AN1A 1CS4C 2OO7A 1LDMA 1P2GA 3B9PA 1M76A 2QN1A 1KMHB 2V74B 1APBA 3PNLA 1GN9A 2WRZA 4Q1VA 5EINA 5K2MA 4ENVA 3AP3A 4NCIA 3W6ZA 4NCNA 3FNEA 4CLDA 4O3MA 4NQZA 2VAWA 3ZC3A 5AI0A 5KWJA 1CB0A 6ABPA 3P9QA 4EY5A 3USZA 2VP2A 1Q1AA 1W5SA 3CO0S 4RGBA 5D1NA 3C1UA 4LHWA 3I62A 1HT2E 2ONZA 1TEXA 1QFZA 4M1KA 4EJMA 2HU5A 4X97A 2NXJA 2P1ZA 3K9CA 4CNQA 1QG4A 2M6LA 3DDZX 2I3ZA 3NIFB 1R0RE 5KJEA 2UUCB 3EXG2 4ZI3A 2HBQA 1UEIA 2XCUA 3EC1A 3MWGA 1JG2A 4JLBA 1TEZA 1GEEA 1JUDA 1PZHA 4A8TA 2WJVA 5M29A 1HURA 2I33A 4S1WA 3NEYA 3QVLA 4ABTA 4TXJA 2MSWA 2JFBA 4TRMA 5BRNA 4CETA 5B64A 4XKJA 4F91B 2Q0SA 2H1HA 3ZOZA 4MLDA 4MWBA 4BZPA 1KBOA 4ZO7A 4A2QA 1IJKA 5HF9A 4BPBA 2RHDA 5AQEA 2Q5HA 4XDYA 3PKIA 4D2IA 1WXXA 5L6MB 4JEHA 1PYOA 2E9SA 1Z5WA 2DUJA 4BB6A 2IZ5A 2JKVA 5IXJA 3PR2B 4BVFA 1DWPA 1HKUA 2DFPA 1WV0A 5EEGA 4I9UA 3RNLA 1V5FA 2VR1A 2DQSA 4LXYA 1ONPA 4NYMR 4UW9A 2G9RA 4ALLA 4DZRA 1GUAA 1M2NA 4KMRA 4DDUA 5BV1A 3ZGZA 2RB4A 1GZ4A 1VCIA 2MSKA 1ZLYA 1JEYA 1XJ5A 3N6XA 3WGQA 5CHEA 1U4NA 1OH5A 3B70A 3NTUA 1W76A 4Y9DA 1MDBA 4UCXA 1XLVA 2AKEA 4CDRA 1XD8A 3JQQA 2J3QA 2PL3A 1LBHA 2QTVB 2YQ5A 5A5FA 3KWMA 4HFRA 4LRQA 3FPLA 4OAOA 4XR4A 3HXKA 5LD2C 4EGQA 1IBKB 3GEDA 2UAGA 2HF7A 3NCHA 1TQ8A 2AMVA 2WSIA 3E70C 2MU1A 1MPTA 3VDNB 2EKPA 1JVNA 1UWKA 4LRTB 1IVNA 2UVPA 4QDOA 5COBA 3KZ1E 4L85A 4OX9Y 3AR5A 5BVGB 3O8NA 2OECA 3FKJA 1H2FA 4YRKA 1OTYA 1E5LA 4AVYA 4DJEC 2BFEA 4PLFA 1FQWA 2GVNA 1GNLA 2PAFA 2FN3A 3TRDA 4CMEA 2HF9A 2X77A 3E9ZA 2P5UA 3GEMA 2R60A 2ZS8A 3R5JA 4HDMA 2P3OA 3AILA 3UMCA 4CV1A 4XVQA 4R1PA 2QMEA 2AEFA 2B37A 1BSVA 4DS3A 4KYTA 1DKUA 1NJSA 4CL8A 5BSGA 3EQ7A 4KXYA 1RHRA 3OCJA 3H9QA 5ECGC 5CLFA 1IZYA 1JQKA 2D4HA 4CM9A 3WB2A 5HBRA 3SJ7A 1MO6A 1UK9A 1ZS9A 1HLDA 3PC6A 3M8KA 2JVJA 2PKEA 3FCCA 4GVLA 2FZWA 4LCJA 4HWPA 2AIRA 4C9BA 2REBA 1JZTA 2QI9C 2HNBA 3KUKA 3U62A 1JA9A 2CNDA 5H4GA 2X0EA 2C2BA 1MDFA 1Y5IA 3FRJA 3HB1A 3UHPA 3ICQB 2P1RA 1UMDA 4Z9FA 1ZMTA 3ILVA 4PR3A 4GXNA 3CHYA 1NSTA 3E22B 1TADA 4CQJA 2C4HA 3F98A 4HAZA 5JAZA 3GCGA 3ZV4A 4DJAA 4LXQA 4DLUA 4U3JB 1GG2A 2X0JA 2R2AA 3V2HA 1O97D 2WPDA 5FA6A 3S3TA 3PDWA 1LK5A 4MIYA 3ZY6A 4YV2A 2VJMA 4IHJF 1VI2A 1ZL0A 4F8JA 3AI2A 2AH5A 3OPVA 2VPQA 3BMNB 5KTMA 1KTIA 1QKIA 1QS0A 1R8QA 2PX6A 3LPMA 3L05A 3PGLA 1DZ3A 3D54D 9GPBA 4JCOA 5EMHA 3G0HA 1OWNA 2ZUWA 3QA3E 1PS9A 1BIFA 3JYQA 3RVMA 2ZQZA 3OJLA 4O4HF 1FVHA 2PO5A 2D2VA 5EJMA 4H1WA 3UZUA 1UOPA 5LXTA 1L6RA 1NW7A 4MR8A 4TOIA 4WLVA 4G41A 5EAIA 4YHHB 1QXSA 2WT8A 2RHMA 5TQ2B 3TIVA 5E3HA 4DAEA 1TF2A 3BK2A 4A8HA 5C4IA 2QOEA 1X1CA 1FFBA 4ARSA 1EFUA 1IJFA 1NZFA 3BXHA 3QF4A 2F3UA 4IQGA 1EJ0A 5DNYB 4BQPA 4D02A 8MHTA 1RPTA 1W5TA 1S3GA 2TMGA 3T94A 5LP6F 1PEAA 4MQ6A 4YRLA 2J7PA 4E3WA 2GCOA 5LJLA 1Y4UA 2QVGA 2ONKA 3D6HA 4R68A 3EFHA 4Q7EA 3TAXA 1B0AA 2O5VA 3RFXA 4ZCPA 1W4CA 5LJIA 2JIRA 4J3NA 2IC5A 1CUEA 3IV7A 4P3YA 4WW0A 1LLCA 2ZT8A 1Q7CA 2QIPA 1MC5A 2D5AA 3OAAD 4RS4A 3ON5A 2REQA 3WJ7A 2BL4A 4BMXA 3UUEA 3VDXA 1LS6A 4G2TA 1CR4A 1X7ZB 3O38A 5T67A 2J8ZA 4PCAA 4RHYA 2A9JA 2ZI6A 5DASA 3R3ZA 1ZRMA 1EQAA 4TMKA 3CTMA 5L8VA 3KKEA 3SOZA 1VBNA 1EDOA 4XWKA 2C5SA 3V32A 4WMLA 4ZHQF 3D8TA 2GZSA 2GYYA 4EGJA 4MW7A 4OGFA 4Q5IA 1U2GA 2ZETA 2QUAA 1NF9A 4GI7A 3UWPA 2XMBA 2QLLA 1F17A 1ZM7A 5DBIA 5IYZF 1OI3A 3LGAA 1MG5A 2W6ZA 1IZ7A 4LYFA 4BJHB 4B3SB 1MB9A 4N48A 2BT4A 3FWPA 2A57A 1EM8B 3H1FA 3KR9A 3M4JA 3NANA 4NJMB 4NZPA 1KEKA 4J2TA 1TUIA 4FTWA 3WGJA 4HGZA 1ETHA 3GRRA 4OXXA 1ZAKA 1JH9A 2UZ1A 2VZ0A 3RQSA 4XYEA 2AFHA 2RG7A 5IVIA 4GS5A 1KY2A 4I4IA 5L3RA 1LC3A 5EHZA 1VE7A 4QGHA 4C4AA 4TVSA 2V58A 2RDMA 4MUJA 5CFZA 5K0JA 1J0AA 1V5GA 2FG7C 4IXNA 3W2FA 3B2EA 4KW7A 4D74A 4AWAA 1QP7A 4Z9BA 1ZZEA 4HAIA 1CEXA 5DSXA 5F7JA 1AMOA 5EIAA 4R9SA 2GXAA 1E59A 5K1ZA 4BNGA 1XDWA 4F06A 2J5XA 4FYVA 1KSJA 1O5IA 1W73A 4KE6A 3C24A 5DNDA 5CM2Z 4GE0A 5HJEA 3V7YA 4MQMA 1IVSA 4RHXA 4P84A 2RG1A 1G4UR 3JAMA 4BQEA 5CIQA 3LFTA 4D81A 1UEJA 2J7PD 4NOKA 3ZGYA 4A3SA 4P93A 2BSQA 1U8YA 5DCWA 5TMPA 4QBIA 1N6RA 4FR0A 4EB3A 2G1JA 3A14A 2VP6A 4QWMA 1T9GS 3I6IA 1ZR2A 1X86B 4KQKA 1SB9A 3KXPA 5A03A 1U2ZA 2Z5FA 2AN5A 5A0TA 2W6MA 3GLSA 4AG5A 1A9QA 2ECKA 3CO5A 3MYRA 3UGKA 2C5BA 5T5QA 2OC9A 5A4IS 2ZJ8A 3BE8A 2LR0A 3VI3B 1G1AA 1GOTA 1FYDA 2HCBA 2MMGA 3BRQA 4WN9B 4EJFA 3AQIA 3AP1A 3NEAA 5EWJB 4MQFA 1ECBA 4BIIA 2PQ2A 4LISA 4Q05A 3RVJA 2QUBA 3E2PA 2NV2B 4KH0A 4Y2YA 1ZVMA 5HX7A 4X6LA 3U7QA 2GDJA 5IT0A 4YRAA 1RYEA 5HF6A 1NL3A 3GZTB 1JJIA 1QVWA 5EMLA 4BNXA 2WF8A 2WHYA 1B0ZA 5EXEA 4EUHA 4ZODA 2RGNA 4Q24A 5LDGA 3TQFA 4YVFA 5AKEA 3EWIA 3JQ7A 3U4DA 1VM6A 3RYIB 3TBFA 5IJ0A 3MQ2A 3ZY5A 2ZATA 4HVTA 4RTRA 5LNK1 5DW3A 1PP4A 2PZGA 2WJJA 3UJ3X 2HTEA 2JI9A 4GMHA 3E18A 4UUAA 4F3KA 4MUGA 2BGTA 3OCCA 3SQDA 3W2HA 5HA5A 5A1JA 3AY7A 1P5JA 1SU6A 2D5LA 3LY5A 1P1JA 3PNKA 4N7BA 4EYOA 5KBYA 2CL7X 5H3HA 3S6JA 1PKEA 1V5IA 2J9ZB 3FMGA 4DUGA 2OMEA 3PQCA 3I9V1 4DSZA 1P0MA 4XSGA 4DA7A 2WIBA 2GEUA 1ZWLA 2BR4A 1Q83A 3HCPA 4XB6B 3WR5A 2NZUG 1UJNA 2CDBA 1TUBA 2XF2A 1U0OC 3NKVA 1KEZA 3O73A 4QUDA 5M7EA 4YDSA 4Z7NB 2OXCA 1DCTA 2XMCA 4HAYA 4N7RA 5IT5A 2ZT6A 1GTZA 1KIAA 3O8CA 4D4KA 3GC6A 4ZANA 1OYVA 1Q44A 1GTJ1 4LY9A 4IO0A 2NACA 5K0LA 4UTXA 3STYA 2JJQA 5DRYA 7ADHA 2AV6A 3DZKA 4NZMA 3FHCB 1TCVA 1P0CA 1QO0A 2R00C 3ILHA 2H29A 2OZLB 3PPYA 1IY0A 1NOIA 4FI3F 2ZJAA 3PHBE 4Q16A 1H94A 3WVNA 2I4LA 1UBKS 4A23A 1VHLA 4R16A 3LFHA 2GBGA 3IV6A 4R2MA 4ZMRA 2YS6A 2PLWA 3UAVA 4MVJA 2X4GA 2J3HA 4MB2A 3S99A 3UH0A 5AW0A 1Z7GA 1K7XB 5JCJD 4FMCB 2ZXFA 4BNDA 2Q2OA 4IDQA 3EZ7A 3M33A 3P4XA 1CV2A 1CRLA 3S7ZA 4DKXA 2C9ZA 4M76B 1RBQA 5IJ9A 4NULA 2C29D 4LXTA 1M7HA 2Q07A 2W2OA 2MSDB 2WJ3A 4H7JA 3Q5DA 3DGEC 3STVA 2KMLA 3A2MA 2A8YA 3HWRA 4TSFD 1Q0ZA 5FTWA 4IDBA 1FQKA 4N3BA 4KQWA 1MZVA 3MJRA 4ENRA 4KPGA 3GJYA 1E1RA 3WYCA 1FDTA 1PO7A 5E7QA 2B6HA 3ZE1B 1Y81A 2H65A 1BXGB 2PO7A 5TRTA 1FVXA 1EA7A 4IQFA 1XB2A 1MOQA 3A36A 3HE3A 3NB0A 1T43A 3FWZA 2F4NA 3JQBA 2GUWA 4M4SA 2OSVA 3EVBA 4CGZA 2GI4A 5JJBA 1RRVA 1W4BA 2RKWA 2ZJFA 1KMIY 3TQSA 3ZIUA 4ZJYA 3N0WA 1UBJS 4LOAA 2ZAYA 3KQUA 4CIDA 2H4FA 5H9VA 3N8IA 2YZ2A 5DT2A 1RM0A 4BV9A 3B53X 2PH3A 3LWDA 3ZD8A 5TY0A 1B00A 1T13A 3EGVA 1ZONA 4OSEA 4YRDA 2K4MA 3BZUA 3CINA 3UTCA 3W4KA 3W8FA 4LGCA 3FYSA 4MRPA 2QU7A 1I2BA 5T4BA 3CZPA 1XEXA 2FA9A 2GTHA 4YUWA 1VP3A 1CNEA 2EG5A 1T0HB 1VKZA 1BJRE 3UWDA 5JPCA 4B4UA 5LQMA 3LYAA 1OAAA 1SB8A 1XTUA 5LXTB 5EVJA 2I8CA 3ROEA 4B0OA 3C6BA 2G72A 4KXXA 4CM4B 2B5VA 2FJ0A 1KARA 1ZD5A 1ZXBA 3EW7A 4RJTA 1TD9A 3AESB 3FHJA 1BD4A 2C92A 4MLZA 4A0GA 4A4DA 4DV6B 4NL4H 4EO7A 2QTZA 3V7UA 3WNDA 1V5WA 3VR2A 1PWEA 3UF0A 4FDAA 2R8YA 2GYWA 2W0MA 3DV0B 3KLOA 4Y3UA 3T35A 1Z5VA 2AK3A 3EZFA 4FUQA 3T4PA 1DV1A 3TGWA 5KYTA 2V97A 3BMQA 5JY6A 1DKMA 2VBCA 3TIGA 3L46A 3L9WA 3G9QA 4OQQA 3SEQA 3ZHOA 2GBFA 2BZ0A 3QVSA 2HWKA 5H7XA 5ITZA 3UJNA 2G7ZA 3GDOA 3KSRA 4Q19A 4L1KA 3WOHA 4KRFA 2I4NA 3PIRA 1UFQA 5BR7A 2IU3A 1Z6GA 2JGLA 3IOBA 4FS8A 2Q27A 4FFWA 1KBQA 4M1OA 5AWFC 3WO1A 1BQEA 1EZ1A 4CT5A 5CB4F 4RORA 1X7ZA 1U81A 2QTLA 5F23A 4HDOB 3VTFA 3ZE2B 1XL0A 4AP9A 1YS7A 1FSZA 4AJOA 4DKJA 3MJCA 3QOFA 4CM6A 3GA7A 4GPEA 1WSDA 2BW0A 1ZLXA 2DT8A 1M34B 1RZ3A 1TAQA 3VSDA 1QU3A 5M5BA 1CPYA 3RODA 5FA8A 4FFDA 3LWZA 4HZGA 5AM3A 1T8YA 1HDZA 4HNHA 4C29A 2G80A 4W99A 4MJLA 4MUAA 1UPBA 3UW3A 3AY3A 2FW8A 1EX1A 1PFUA 2PS1A 4XVHA 4E4RA 2NU7A 4D45A 3N58A 4DMLA 2D0PB 2BYTA 2AJDA 2IQIA 3D8BA 2FP4B 1ZMOA 1NYLA 5D87A 3RK0A 3GELA 1JG3A 5IK2A 2O20A 3K92A 2EFCB 2CVOA 1J07A 2ZSJA 3WTCA 1OLUB 1GGFA 4G5YA 3CVYA 2P2NA 4UCFA 2AR0A 3SMVA 1CUFA 2CY0A 4K26A 3GOQA 2PU7A 2BVNA 1CY7A 2F2TA 2WG2A 4Y98A 4M0EA 1A8SA 4BMDA 1E6CA 3CLTC 4W9NA 1TO2E 4DPKA 3OHMA 1W36B 4BWVA 3VYTB 2H9IA 1ZNXA 2QT1A 2Q9UA 4KK4A 1ZKMA 1Y7HA 1Z0JA 4FHZA 1NKVA 3CF2A 3NVMB 2ZUTA 1KJNA 1Z06A 2OPBA 2VZ8A 1A8QA 1U65A 1UPFA 4OP3A 4UXHA 3ZWWA 1X13A 2OFOA 1H4VB 4RY2A 1IVYA 1NC1A 2OKCA 1T5HX 3Q5GA 4TN5A 5FOTA 3KALA 3AK4A 2WVAA 2X2OA 2ZTMA 4OXQA 3X1XA 3DE7X 4OI4A 4LF9B 2NZXA 2YVKA 1W9MA 4DCOA 3RU2A 4DDTA 2XVXA 2F9LA 3RC7A 2P2LA 3PZRA 3K2BA 5FBHA 1DLIA 3CUYA 5I4BA 2JJ8A 2WILA 1B15A 1G8MA 4E15A 1HXHA 3WGIA 2J9YB 3WYAA 3I04A 1J39A 2QTNA 1V16A 3JWIA 4ETMA 1KI8A 5B7GA 2YMLA 3T9CA 2Y05A 1ICIA 3BTOA 4KUGA 5JQGA 1NXTA 3VGJA 4U6SA 3D6JA 1F3LA 1UBEA 4MLCA 4BVHA 1B26A 4H08A 3KQMA 2I34A 3M9LA 2A1IA 2JGJA 2W71A 2EFHB 3TZ6A 4BHTA 4C4ZA 1JLKA 4J49A 5GPBA 1EVIA 3QYFA 4PFJA 4RF3A 1WMFA 4ZI7A 1NVWQ 2IX3A 5HBGA 2BUBA 4ZCSA 4U63A 4D42A 2UXCB 2GEKA 2V9ZA 3FR7A 3LBNA 4KQFA 5BSKA 2ON6A 1O2DA 3GHHA 2NLOA 1YZTA 1AKRA 4QICA 1P2BA 3MT7A 2YCBA 3L7AA 2OYCA 3OLCX 4ZOBA 1H3NA 2X1VA 2X0IA 4E32A 3L4KA 2PMDA 1DWOA 1P6UA 1WXDA 4KH1A 1FSPA 5DLPA 3W2IA 3NBMA 4DE5A 4ZXFA 4YRMA 5AVRA 1FEZA 1XMIA 3PUHA 1NJ2A 2I62A 5J5VA 4R98A 1T4CA 2GHRA 3L84A 1HTTA 1QIFA 3GGCA 2DT5A 4CV3A 3QK7A 3RG2A 3QE2A 1O6BA 3P20A 5KJCA 2RHHA 5B3JC 3DEKA 4CCAA 3OZBA 1RLTA 1KY5A 1Y42X 4HQFA 5K8VA 2Q3CA 3BC1A 2UYCA 4PRYA 3D3QA 2ZZNA 2ZB2A 1JHUA 2AS0A 2XMZA 3RANA 1U1EA 1FOEB 1NYTA 2A84A 3TRHA 5IKEA 2YKGA 1DKNA 5IAEA 1KO1A 2V1XA 3U4IA 4FDVA 1UDRA 2RSLA 4KI0A 3DCNA 3PP8A 2OUKA 3LXRA 4N6NA 4NJEA 4O8ZA 1SWWA 4X94A 4E31A 3W06A 4DV7B 1VLHA 2ZCJA 4P08A 3WDKA 4AYTA 3IJPA 3EG9A 1IN8A 1U6JA 2HMUA 3JX9A 2GLXA 2GLTA 4WT7A 4EG3A 4LSWA 2E5LB 3E3LA 2YWHA 2IHNA 4UHCA 4FQ7A 4NHOA 3UJDA 5E9QA 4Z0PA 1WBDA 2EX1A 1YNOA 2F8MA 1P33A 2C82A 1BGXT 3NVKI 3QUBA 3C3DA 1Z83A 2IYAA 1QH1B 1W47A 1O89A 2YHIB 3UJPA 1K0FA 1TRHA 1ECFA 3VO8A 4QQKA 2LIVA 3OY7A 2D1FA 4A10A 3HFSA 3BWDD 4X63A 5J2TF 2QB5A 1WU7A 3LFUA 2ZSIA 1JLMA 4BEVA 3H9JA 4PQEA 5I4CA 1O54A 4EJSC 2OCPA 2OGTA 2OV3A 3DEJA 3H5AA 4P2BA 4HDRA 2GO7A 4DLZA 4V0SA 1HDXA 1QCDA 3DL7A 3HRKA 4RPJA 5LBIA 1SELA 3NOXA 2NU8B 2JFPA 3RUDA 2V0NA 4UHFA 4GX1A 1HRDA 3I0NA 5BN5B 4ZOLA 3ZNOA 4C0AC 4CG1A 4G9GA 4BV2A 3Q7QA 4NENB 2AOWA 2JA2A 4YV7A 2XCSB 3BGSA 3C6QA 1XNJA 3BJRA 3AR9A 3WLPA 1I14A 2WVHA 3WLRA 4DM7A 1WXHA 1E1LA 4X45A 5IUJC 4RAQA 1M2GA 1X9IA 4LC0A 3LQYA 5CT9A 4DWOA 3FSRA 1HQKA 4Q9AA 1MPXA 2R8BA 1XHEA 3L02A 2GF2A 1OLOA 3DDCA 2VH1A 3Q15C 4IEFB 1Z4QA 4RD4A 4CM4A 2ZSHA 3M5CA 4YNBA 4DBZA 4TYWA 1NATA 2RI6A 3TW6A 1HDGO 3DMHA 4X9XA 5C8YA 5FR2A 4DA9A 4NRDA 4H0NA 3WDLA 1JQJC 2J4CA 2HIHA 3TVYA 3ER8A 1G5RA 2HO4A 1SCAA 4JJZA 1UXKA 4NBKA 2PQ6A 3KKQA 3VO1A 2W2XA 1MEEA 5C5CA 1QF6A 3LX6A 3PFGA 4RESA 4HV4A 5K05A 3HA7A 2HSZA 4XD2A 2POCA 2BGWA 1D03A 1ZOOA 4IDGA 1H2HA 1PJ4A 2QTMA 1NF2A 3ZQ6A 2FF7A 1JBKA 1CUJA 1UAGA 4OI1A 3SEAA 1WPQA 3HKBB 2PBLA 4YCMA 2WFAA 3BGIA 5BXYA 3KVNA 4D99A 4ZAXA 5JH7A 4FJ0A 3FB1A 4NS4A 3WDMA