4F45A

Crystal structure of human cd38 e226q mutant in complex with naadp
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
253
structure length
249
Chain Sequence
EFWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFDTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVVHVMLDGSRSKIFDKDSTFGSVQVHNLQPEKVQTLEAWVIHGGRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Human CD38 in Complex with NAADP and ADPRP
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ADP-ribosyl cyclase 1
total genus 80
structure length 249
sequence length 253
chains with identical sequence B
ec nomenclature ec 2.4.99.20: 2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02267 Rib_hydrolayse ADP-ribosyl cyclase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.82.10 Mainly Alpha Up-down Bundle ADP Ribosyl Cyclase; Chain A, domain 1 ADP Ribosyl Cyclase; Chain A, domain 1 4f45A01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4f45A02
1P0CA 1DHRA 2I6TA 2YHUA 2Y68A 2QG4A 1YDWA 2ZKLA 3FHLA 3JQBA 4UVHA 2A9FA 5IDYA 3RBZA 2VUSA 4AJLA 1A27A 1C1DA 2GGSA 3KHUA 3DOOA 5FWNA 3NEPX 3NJ8A 4XGNA 5G4KA 5L4LA 1QG6A 3L6DA 4LMPA 1P1RA 2WD8A 4MVJA 2XPCA 1ZEJA 2X0NA 3GNTA 1P9LA 1VJ1A 2FZEA 4AJJA 4QFCA 5IDQA 1D4FA 5IJZA 1HSOA 1GD1O 4WCFA 1XWFA 1P74A 3H5RA 2QRJA 3ZWOA 4GPD1 3U9LA 3E18A 5H82A 1FJHA 2DTDA 3DZFA 1GYQA 5BQFA 3PQEA 3D5TA 3F47A 5ER9A 3WIEA 3ZNPA 3Q0EA 4Q3AA 5ICMA 1ADFA 3JQFC 4XGKA 1P1HA 3OA2A 4TROA 4NJMB 5JY6A 2XF8A 4B4OA 4BNWA 1C0LA 3SC6A 2PH3A 4XYBA 3WYCA 4CMEA 1QLHA 3JD4A 3QWIA 2DPHA 1OOEA 4ZJUA 2JKVA 3GF4A 3KTDA 1R16A 3AFMA 5A3JA 3BHMA 3E8XA 1L7EA 1WPQA 4YPOA 4UVDA 3RKRA 4JNKA 1GV0A 4GI2A 2O7QA 2BFPA 5EJ2A 1YOVA 2X5KO 1PQUA 1YQDA 1NAIA 2I65A 3PXXA 5T67A 3OA0A 4RJTA 1QORA 1ID1A 5C7LO 3S55A 9LDTA 5FF9A 2B5VA 4N5LA 3QRWA 3PFFA 3WNQA 4W4TA 3RIHA 3ZCXA 4WLOA 3JQFA 1MXFA 1OI7A 4L73A 3I9NA 2RBEA 4ZQBA 6ADHA 5AXBA 2O2SA 5JC8A 2I3GA 1MLDA 1H9BA 4R3WA 1DFGA 4IJKA 5CPFA 5C5IA 4B3IA 3EVNA 1ULUA 4JROA 4P4NA 4GX0A 1BRMA 2I3AA 1IZ9A 1KEUA 2BD0A 3FF4A 4HV4A 1UP7A 4ND1A 2CD9A 3WXBA 4BNKA 1KYQA 2H1SA 1FDTA 4FGWA 4F46A 3WGIA 3FPCA 1ZW1A 4HFJA 3WG9A 4GWGA 3U3XA 5HBRA 1B3BA 2AE2A 1GQQA 4WK6A 4BNGA 4KZPA 1B15A 2DU8A 1IPEA 3S8MA 5JYDA 1WP4A 4I5FA 4W6ZA 5B1YA 4CLEA 2CY0A 3RC7A 2ZCVA 4EGFA 4DYVA 5ADHA 3V2UA 4OOEA 1HE2A 1NFFA 3TJRA 3HN2A 1WWKA 4CLDA 1EBUA 1V3TA 4Z6KA 3GZ4A 3F46A 4L4SA 1PZFA 2B5WA 4M89A 4ZA2A 4L74A 1BWSA 4B4WA 4IDFA 3GY0A 3K96A 1MG0A 4E2YA 2VTEA 3ETDA 3E82A 1BGVA 1TLTA 5FI3A 4MVJG 1PZGA 2VNSA 4BNJA 3H9GA 1P3DA 1WW8A 5DBFA 3KSDO 3AI3A 1UUFA 5JC1A 4R3NA 1E1LA 2NU6A 3X2EA 5JO0A 1LRKA 3NGXA 1MFPA 3GMDA 2NACA 3Q2IA 4LN1A 3PPIA 5HS6A 1E7SA 1H94A 3EMKA 4IDGA 5IZ4A 4UUNA 3VH2A 2J5QA 3GVXA 1JDJA 1BDMA 5IG2A 2DUUA 1I33A 4B8WA 1UJMA 4DQVA 4JP2A 3ZW9A 4AFNA 2X5JO 3TZKA 4PN3A 2FY8A 1HXHA 3HJAA 3UXYA 4GLLA 2Z95A 2HJRA 1C0IA 3GEMA 4QQRA 1PGOA 6LDHA 2FN7A 3WGQA 4K6FA 4CMKA 1CIVA 1DOHA 2A35A 3HFSA 4BGIA 1KY5A 4L4RA 4NBUA 4XYLA 1O5IA 4IGFA 1YRLA 3WICA 1PTJA 4IZIA 4BMSA 4CQMA 1DXYA 3I6IA 3KETA 3E5MA 2C20A 4NFSA 4U5QA 3IJPA 4M8SA 2YV2A 3GPDG 3B1KA 3OIFA 4QECA 2QQ5A 3CINA 2B83A 5DCWA 1O89A 3UUWA 1HF3A 1SEVA 2NQ8A 1JN0A 2PNFA 1DO8A 4G81A 1VLLA 5ER6A 4IDCA 2A4KA 5AQ1A 3JQ6A 3GR6A 1VKOA 1TA4A 3AU8A 1HE3A 2O4CA 3OECA 3E9QA 2Q1WA 5AXCA 2XAAA 2R2GA 3C1AA 3BMCA 4OOFA 3LC7O 2EP7A 4BO7A 4R5MA 3C1OA 5JCJD 2NV6A 3EY4A 1V3UA 4KWHA 2UAGA 4GH5A 1NPTO 3AI1A 3PTZA 2VOJA 4MO2A 4OO3A 5I9NA 3PK0A 4CODB 3EW7A 4FFLA 1W0CA 4TKLA 3OM9A 4J90A 4B7UA 3RUFA 4DC1A 4ZD6A 2GZ3A 3R6DA 4CQLB 3D64A 4OQZA 2O3JA 4RGBA 1PL6A 1Y8QA 5HA5A 3PWZA 2IZ1A 1P1JA 4O59O 4HY3A 2FR1A 5KCZA 4MIEA 2DC1A 4WLEA 4MVJP 5ENVA 1A4IA 5L7TA 1BSVA 1N1GA 1P0FA 2B4TO 4LCJA 5K6AA 1CERA 1GUFA 1RKXA 2JFHA 3WR5A 4YT8A 2EJWA 3NTRA 4XRRA 1BXKA 2HMTA 1EQUA 3EZLA 1DIGA 2ZTLA 1V0JA 1NNUA 4E5NA 5LDHA 2HMVA 1PZEA 3QP9A 1XQ6A 4FGSA 3PZRA 1HRDA 4O1MA 3WGTA 3OJEA 5T6BA 4A2CA 4YRAA 3P2YA 5ENDA 1Y1PA 4CM9A 3V5NA 4DBVO 1G0OA 5A1TA 4UVGA 4CR8A 4FQ8A 3DB2A 3Q11A 3INTA 4ZRMA 4IMRA 3HFGA 4CUZA 2CNBA 1U3TA 3JD0A 2Y1GA 4XGIA 4H3VA 1ONPA 3KYDB 3LDHA 1BXGB 3BYZA 4L75A 3WNVA 4CUKA 5A9RA 3RFTA 1SEPA 3DZIA 1Q1NA 3DOCA 3N74A 8ADHA 3T4XA 3TSCA 2NU8A 3AUTA 8LDHA 2AEFA 4G65A 1JKIA 3C7CB 4J4BA 4K28A 2WJPA 4KQXA 4BO3A 3P19A 5CEFA 4BNVA 3W6ZA 3WTCA 4BNFA 1DRUA 2NLOA 1FDUA 2C0CA 1I2ZA 3HB4X 2ZTVA 1AN9A 4RPGA 2PGDA 2PZMA 5A9TA 5EERA 3VH1A 4FFMA 4RZIA 3O03A 2X0RA 4J91A 1H9AA 2CMDA 2YFQA 3NKLA 3GGGA 3O8QA 4BUCA 1VL8A 4CM8B 3STHA 4RDIA 2V6GA 3BTOA 4YJFB 5JDIC 3ST7A 3U4HA 1DFHA 5L45A 1OBFO 3OQ1A 4ZGWA 3EK2A 3AM3A 1MA0A 1WDMA 4BNLA 4HX5A 4PG7A 3JD1A 1P1FA 4E33A 3ZWXA 3DAGA 3NDRA 5TS3A 4BNMA 4AJ1A 3W8EA 1DLJA 1PJ4A 5ICSA 3QQPA 4E5PA 3WX0A 3EHEA 4BMVA 2I66A 2BELA 5BSHA 2Q99A 5ILGA 1ZXLA 3SLGA 1BVUA 1PGNA 2RH8A 3K8ZA 3RU9A 3K2BA 3GMSA 3LT2A 3RJ5A 1X13A 3OF2A 4IIVA 3F9IA 3ROMA 3UF0A 1F12A 2DQ4A 2C5EA 1B0AA 2EXXA 3WSWA 5BT9A 1DIRA 3DMYA 4HFMA 4IM7A 1KIFA 4MVJF 5I7SA 3FPLA 1EUZA 3GT0A 1S7CA 3GA0A 1SOVA 1CETA 4ONEA 2GASA 4BOYA 5TIIA 1IHXA 3AOEA 4XX0A 4L8VA 5JDCA 4GBJA 2OL4A 1E3JA 3GLQA 1J0XO 3R3SA 4ND2A 5CDGA 1HDOA 2AHRA 4E5YA 3GOHA 3ICCA 3LZ6A 3VC7A 2IXBA 3QVSA 2AA3A 3VTFA 1LC0A 3DHEA 3WGZA 1U9JA 1PZHA 4U6QA 2J3IA 5LC1A 5FYDA 2IDZA 4YYZA 4LGVA 1VL0A 5T8KA 3C24A 1F17A 2J3KA 3ETGA 3OJLA 5T5QA 1VRWA 1ADCA 2WEKA 1UDAA 1GCOA 2BGMA 2HU2A 3DHNA 3ZN2A 2AE1A 3FNEA 1BVRA 1X0XA 5CG1A 3DC2A 5KWEA 4CLRB 1M6WA 1X7HA 2W2LD 1N7GA 3CUKA 3ZGYA 4J16A 2OORA 4NIMA 4M1QA 2P9EA 2PD3A 1PJTA 2HDHA 3G49A 4CM6A 2GN8A 1JVBA 4WEOA 5EN4A 3F5SA 4BO4A 4BV9A 4BS9A 4E2XA 5A3VA 3NYWA 2BI8A 3E5RA 3QY9A 3H9EO 2FSSA 1HLPA 1XQ1A 2VWQA 4BO9A 2P5YA 1E5QA 4OSOA 2HK7A 1V9LA 1R4NB 2OBYA 4D3DA 5IXYA 4BKUA 3AI2A 2E6UX 1AXEA 3WSVA 2I9PA 5U4QA 1Q7BA 4LW8A 2EERA 1U8FO 4EW6A 4KWIA 1KEPA 2DTXA 3RASA 4I9NA 5F5LA 3RQSA 2NSDA 3WJAA 1M76A 1K0UA 3H2ZA 1TT5B 1UZNA 4NHEA 2C2YA 5JNLA 2PH5A 2C5AA 3H9QA 2B35A 3KOUA 4LSMA 5AYVA 3I3OA 4BO0A 1DC4A 3JCZA 5DN9A 2QIOA 3HDJA 2EKPA 3V2GA 3V1UA 3BHIA 4JQCA 4PLZA 1PJSA 1QP8A 2EEZA 2PA3A 4MDHA 1NWCA 4W7HA 3LLVA 5GZ3A 4CM9D 1N1EA 2O50A 4GMFA 5DNAA 1RJWA 3E6AA 2UDPA 1HSZA 4IQ0A 1TT5A 4WCFB 4E6PA 3C7AA 1YQXA 3GDGA 3CZRA 3WJ7A 4PRKA 2GLXA 4DPLA 4DREA 4IINA 1A9YA 1JA9A 4FOSA 4UAGA 3TL2A 2OFPA 5IN4A 4I08A 4AJPA 1N92A 1ZIDA 3RAJA 4XIYA 3WOHA 3ICPA 2AEJA 4OL9A 2DBQA 2O48X 1BTOA 3KSZO 3H6KA 4ND3A 5A04A 1VI2A 2D59A 3ANNA 3RU7A 4Q9NA 3E9MA 3QV1A 1NVGA 1EQ2A 2CFCA 4UUMA 1RYEA 4FSHA 4N18A 3W1VA 4WJZA 1YB4A 1DAOA 1TVEA 4R68A 4YDRA 3LT1A 3PP8A 1HDCA 4R01A 1LXCA 2CVQA 3UHAA 2EGGA 1MP0A 3W4IA 4BB5A 2B69A 4I5DA 3QWBA 1QYDA 1F8FA 3KVOA 3IKTA 3RCBA 3PJGA 4Y8VA 3RI3A 1LDYA 1ZK3A 4TWRA 4R16A 1Q0LA 1OZAA 4KMSA 2EV9A 3IIEA 1XSEA 4OXKA 2DLDA 3GZNA 1HDYA 3CTMA 3OJOA 1Y8QB 1BDBA 2YY7A 3UKOA 4XEHA 1R0SA 1P33A 5C3MA 1MC4A 1IL0A 1YE3A 4L9RA 5EQDA 5G0VA 4Q3EA 3WDSA 1SC6A 3X2FA 3DZBA 1PS8A 1YXMA 1YL7A 1NBOA 1ZUD1 2QZZA 5IF3A 1HTBA 1HETA 3DAPA 3TZCA 1YB1A 3LC2O 1AE1A 2PZKA 5EL0A 1GQ2A 2WD7A 3NX4A 4JCOA 3RROA 1ADBA 3VH4A 3GN2A 2C29D 4UULA 1IYZA 1VM6A 2GERA 4CV1A 3SX2A 3DTYA 1FK8A 4BKQA 3PFWO 1UXKA 2F1KA 2FPGA 4YAKA 2FR8A 1M6HA 2GD1O 1HDZA 3PEFA 4UEJA 3Q3CA 4I8XA 2O3RA 2I5PO 1E6EA 1I24A 2GO1A 2NADA 4HKTA 5ITVA 5KJ1A 5MGBA 2HQ1A 3H7AA 1E0DA 1ENPA 4PG5A 2YFHA 3VPXA 2NVWA 4YJHB 1V6AA 2DBVO 4MIYA 4GLOA 1A9ZA 5ILOA 1DSSG 1UAGA 3IUSA 2VRCD 3H4VA 3NJ4A 4OHUA 1Z73A 4EUFA 4N5NA 4RPJA 4FJ0A 2JCXA 2NTJA 3PDUA 3AU9A 3NDIA 3GN1A 5HRUA 1F0YA 1QMGA 2BKAA 4R1TA 1LBEA 5I7FA 1P1KA 3DEYX 3IL2A 3WGYA 3H9UA 3DZGA 2JAHA 1NHWA 3LSYA 4WECA 4EI2A 4AJIA 3G79A 5T64A 5KVVA 4UEKA 2JHFA 5L95A 5I8WA 2VN8A 4FBGA 2X6TA 3JQGB 1WNTA 2PGLA 1UP4A 2A92A 3JQAD 4PVDA 3GVCA 3W8FA 1DB3A 2POQX 1GU7A 1BMDA 2EF1A 4FJ2A 4B7CA 1ZK1A 3IP1A 2RH4A 2ZYDA 2NNLD 1O95A 3TOXA 5K9ZA 3ETEA 2Q4EA 4NMHA 4TRRA 3G1UA 4A73A 1T2DA 2IEDA 3ONEA 2CZCA 2NU9A 1JWBB 1KVQA 1SNYA 2O3QA 2OP0A 2NQTA 4E2ZA 3OEYA 4FFRA 1EFLA 4JGBA 3I4CA 4IDEA 1NWHA 1MUUA 1DJNA 1X1EA 1GY8A 1EEHA 1NR7A 4CUJA 1PU2A 2BFOA 1NP3A 4KUHA 3ABIA 3CIFA 3IS3A 4Z0TA 2CUKA 3FWZA 4B7XA 2PK3A 4RZHA 4DLLA 3WTBA 3C85A 5JAQA 4E30A 3H9JA 2VYVD 3QJ5A 2GDZA 3HG7A 3AUAA 5CDSA 2BFMA 1KETA 3K2EA 3KYCB 4IZHA 1W4ZA 3WGOA 3GDFA 3JQ8B 4R5HA 2G82A 4WLUA 1C14A 3KXDA 5B12A 1Z45A 1SBYA 4IDBA 1T26A 1YL5A 2O3TA 3IOYA 1R6DA 5BSEA 5DBIA 3GRPA 5DZSA 2FSVA 2ZCUA 4LVUA 1XR3A 4EJ6A 1ZJZA 3BMQB 5TRTA 1ZFNA 3HNPA 2I76A 1ORRA 2J3HA 1R12A 3CMCO 3WYEA 4MVJE 2OP1A 5F1KA 1Y5MA 2YHIA 5GZ6A 1K5HA 4GKBA 1XLTA 1ZEMA 7MDHA 3ZI0A 4AJHA 1CEQA 3GAFA 4MVJD 2DM6A 5TF4A 2XOXA 1T2FA 1GADO 2VHVA 5L51A 4RVDA 5G2OA 3S1LA 1XEAA 4XQGA 1I3KA 5L7WA 4KUGA 1T24A 2GF2A 3IUPA 2HAEA 3F3SA 4X54A 4R54A 4RPLA 3RUCA 1LJ8A 5FEUA 5KJ6A 2QHXA 1DJQA 4YT2A 1C1XA 3INGA 3KYCA 4NPCA 5KVSA 4ALJA 4CMEC 5HM8A 3FBTA 4LCEA 1NPYA 5IXSA 2YV1A 5FI5A 3TF5A 1DIBA 1KOLA 4ZRNA 4DLAA 4PG4A 3RUDA 3RD5A 1C3VA 4BHTA 3K9QO 1ENOA 2Q45A 4O5OA 3BTSA 3GG9A 2QRKA 2X7HA 2ZJ0A 1FF9A 1GZ3A 2J3JA 1YDEA 4LSWA 2ZJ1A 3IJRA 2G17A 1EE9A 3GHHA 4C4OA 2BH9A 2Q2WA 4DIOA 1C0PA 2B0JA 2G0TA 2ZB8A 3DBRB 4D43A 3EC7A 1W6UA 3Q9NA 3OH8A 4P38A 1NM5A 4BNTA 4R1NA 3RUHA 3WIDA 1P44A 3AY3A 4FDAA 5A06A 4PLPA 4WOKA 2PZJA 1WZEA 3NTQA 3MWDB 1E6WA 1U1IA 4BNHA 3HHPA 2CDAA 2AQIA 3TZ6A 1M66A 2W2KA 1HZZA 5L3ZA 2GN6A 3K73O 1WLYA 1NAHA 1O0SA 1UXHA 3S2FA 1IULA 4BNYA 5G0SA 3DMTA 3HSKA 3JD3A 3MJTA 4BNUA 3ZWWA 1Q7CA 2XXBA 3QVTA 3GGPA 3DBLB 3UOGA 3UVEA 2D8AA 4A5OA 1WMBA 5U9CA 1WDLA 4IGEA 3QA9A 4OGWA 4ESOA 3ORFA 4OJNA 1G6KA 5G0WA 4Y6PA 4DRYA 4DPMA 1O9BA 3O26A 4NJMA 5AVOA 2X5OA 5CDUA 2O3UA 4B8ZA 1CYDA 1XYGA 5KKAA 1O94A 2QZ9A 4OQYA 3VOSA 2UV8A 4PLVA 3ENKA 4C7JA 1YJQA 5JSFA 3NT4A 1KC1A 3I1JA 2AG5A 4RVGA 4AJEA 2PR2A 1EFKA 2Q1SA 3ON5A 4WEQA 4E0BA 2RHCA 2Y1FA 3O9ZA 3UICA 5C7OO 1NR1A 4D42A 1EZ4A 4BO6A 2CVZA 1BHSA 1ENZA 2GR9A 3KUXA 1NQAO 4YAJA 3T4EA 2YW9A 2FZWA 4CV0A 2YJZA 1YB5A 1UDBA 4DWVA 5TJHA 1ONNA 3SVTA 3F6YA 1LSSA 3QIVA 4RF2A 2HMUA 2J6IA 1IB6A 1S6YA 5DT9A 5IFLA 1X7DA 2DBZA 5TJ9A 1VSUA 3ZU3A 3WMWA 1R4MA 2Q2VA 5DOZA 3MJEA 3MCVA 4YAGA 3IC5A 1Y8RA 2BMAA 2YDXA 1UP6A 4BO1A 1T2EA 3VVCA 5CG2A 5L4NA 5KTKA 2OXIA 3QHAA 1U7TA 3AJRA 2Y99A 1NFRA 3R0IA 3KSUA 4QO7A 4R69A 2O4UX 1GQYA 3PDJA 3TNLA 3VPSA 4BIIA 4OSPA 2CSUA 2VHYA 3BZUA 4WPGA 4AJNA 2GRAA 2X58A 3M2PA 2EW2A 3O4RA 3DZJA 1HDRA 4C7KA 4W82A 4OKNA 3MTGA 4W9NC 5IZCA 2O3SA 3N7UA 1U5AA 2R00A 3GEGA 3HWRA 1XKQA 5TC4A 3RC2A 4JLWA 2AXQA 2Q46A 2Y67A 4U8GA 4DIFA 3H65A 4DA9A 1LLCA 1V8BA 4LISA 4PLGA 4UVEA 2SCUA 4J1SA 5JBIA 1G0NA 2FWMX 2YUTA 3KB6A 3M6IA 2B37A 2WD7B 2FPIA 3L4SO 2P4QA 2IRWA 1GDHA 4CJXA 1PJLA 4MIOA 1EUDA 1W8DA 1DIHA 2ILTA 5DBGA 1HLDA 1U5CA 5JFOA 4K1LA 1YVEI 1QV7A 1JW9B 3VDRA 3JQGA 3FNGA 3ZHZA 4U0KA 2AQHA 5A5EA 4RCVA 1Y81A 3ONDA 2JHGA 3UGKA 4E4YA 4J2OA 4OAQA 2G5CA 2PV7A 4OYRA 4GSKA 3U49A 4XQEA 4W9NA 4TVBA 5A9SA 2C59A 1P77A 2R00C 2P9CA 2NWQA 1UR5A 4J7XA 1LSJA 1XU7A 2H63A 3WWZA 1QYVA 1T2CA 3LT0A 5TX7A 3CH6A 3WYBA 1Q2XA 1LDMA 1Q0HA 4FR5A 4G2NA 2NVBA 1LLDA 1LA2A 2FPPA 1QV6A 3T7CA 1AHIA 1DHTA 3PLRA 4DYDA 4XQ9A 1LDGA 4DGSA 3EDMA 1B7GO 3JQ9C 3I9LA 5AXDA 1SOWA 1VE9A 4R1SA 3FN4A 3ZHYA 3A06A 5L4SA 2DTEA 2JD2A 2GNAA 1E3LA 3HQ4O 1KVSA 4PLHA 3ZWNA 4NI5A 3OIDA 3ADPA 1N7HA 3D3WB 3RKUA 3MOGA 2Y05A 3DO5A 3SBOA 3QVOA 1QYWA 2HLPA 3PJEA 2OZPA 3WQRA 4IXWA 5L53A 4JBHA 4LMRA 1VC2A 3K31A 1RM0A 2AQKA 1EVJA 1RWBA 4I9HA 4O63O 3KEOA 4I1IA 3FD8A 1PL8A 3B20A 1LRJA 4Q3NA 1N9GA 3U4DA 1LSUA 1J49A 3NUGA 5JXWA 2IE0A 3ZH2A 3L4BA 3U0BA 2WMDA 2DKNA 2ZB7A 1B16A 4XJTA 4XQCA 3UW3A 1KEWA 4CMBA 4D79A 4GGOA 5KJFA 2WDZA 4J2HA 2AQ8A 4ALKA 4XIJA 1OFGA 4QT0A 2ET6A 3DFZA 4B3JA 3AUSA 3KRTA 4Q3CA 4J1NA 4XWYA 4OXYA 2A94A 4ROSA 4OH1A 3G1TA 1Y9AA 1G1AA 3OP4A 4D3SA 2YZ7A 1MGOA 3WFJA 1KC3A 2VT2A 3OFSA 5A02A 4YR9A 5H81A 4YB8A 3ZWBA 1EVIA 4IDDA 4GX2A 1Z6ZA 4J9UE 5COAA 5KOIA 1A7KA 5JLAA 1LC3A 1GL3A 2G76A 1Q7GA 5I8ZA 2VUUA 5JMWA 5EESA 4WKGA 1ONOA 2ZTUA 1GFSA 1J5PA 1ZJYA 2E48A 3B70A 5F1PA 4J4TA 4EBFA 2QYSA 3ZU4A 1PX0A 3BMNB 3WWYA 4WUVA 5KVCA 2F00A 3TFOA 5JY1A 3R3JA 3ANLA 4GAEA 2GYYA 3ZHXA 3AOEC 2VWHA 1XA0A 1P45A 1LUAA 4J4HA 3D1LA 2C54A 4W7IA 2EG9A 1QRRA 4QTZA 2YYYA 4A0SA 1TT7A 4HBGA 2D1YA 1JQBA 1JLLA 3GHYA 1CWUA 3W4JA 1PIWA 1KVRA 2DFDA 2E82A 1SB8A 4P4GA 1OC2A 2VZ0A 1ZMOA 3LYLA 5F5NA 1LU9A 1Z82A 4RF5A 2D3TA 1R0LA 2VNAA 3KBOA 4MPDA 4CPDA 4ALMA 1KBZA 4CQMB 2PFGA 4JXKA 5JMPA 2QYTA 1I01A 3DWFA 2GN4A 2NU7A 4M86A 5G4KB 1H6DA 2C82A 4FCCA 4XR9A 4Y6SA 4FS3A 3IQDB 5DDIP 3KV3O 1L7DA 1CRWG 3NRCA 3UH1A 2BFAA 2C7GA 1VJ0A 3FNFA 3ZV6A 3I23A 3LF2A 5DULA 2ZYGA 3GDOA 2FP4A 2B4QA 3NDJA 1RM5A 2VZ9A 4JX8A 3RUEA 4K6CA 3JYNA 3AM4A 1DFIA 4MP8A 4YWJA 5JYEA 2AW5A 4H7PA 4IIUA 4XYMA 1ISIA 2NM0A 1E3SA 3WGHA 2Q3EA 2W8ZA 4Z3DA 4AICA 1PJCA 1PJ3A 3IKVA 2WWRA 2P2SA 3GEDA 4JIGA 4EITA 4XRGA 4QEDA 1UAYA 3F5QA 4JJIA 1ISGA 4XKJA 1ZVMA 1DPGA 1ZSYA 3E03A 2IYOA 2CVOA 4E32A 4YTEA 1GPDG 3A1NA 2OHXA 4RPHA 1QKIA 1BG6A 4XR4A 1HL3A 1WDKA 2FRDA 4JJFA 4JK3A 1X7GA 4N54A 4WLFA 4ZQHA 1YONA 4BQRA 4FB5A 1I30A 4IBOA 4RVSA 4Z9XA 1N5DA 3WQQA 2X4GA 3ITKA 4F6CA 3ZV5A 3GUYA 4DQUA 2VOEA 2O7SA 3W8DA 4OMUA 1BW9B 1JWAB 1DC3A 1RM3A 3MOIA 4U6SA 5TNXA 1JKFA 3KLPX 3ZU2A 3PHHA 4J1QA 3U4IA 3JYLA 1AUPA 3OETA 2GPTA 1EDOA 2ZATA 1X15A 3PZBA 3GRKA 3HDQA 1LI4A 1NASA 5COQA 4FD3A 4NDNE 4O6VA 1LEHA 5CP8A 1J6UA 1PGJA 5KVQA 4J7UA 4ZHSA 4BO8A 2GSDA 3F1LA 2CF5A 4BV8A 1WVGA 1U28A 1IY8A 1K2WA 4MVJM 4EJ0A 4B3HA 2QX7A 4ND5A 4CLOA 3OSUA 4NU6A 5JCJA 5BR7A 4YQYA 4H15A 3CXRA 5B4UA 3AM5A 1YBVA 2JD0A 2AMFA 3GUCA 4RQUA 2E37A 5EQFA 4CM3A 2V7PA 1HE5A 3JQAA 2Z1NA 4RL6A 3D4OA 1LSOA 4J6FA 1HYGA 3I5MA 3PQFA 3G0OA 1DIAA 4K26A 4S3MA 4RO0A 2CDCA 3OJ0A 3LF1A 1EK5A 4PLCA 2WM3A 5F3RA 2UUPA 4AJ2A 1R0KA 3BAZA 4M54A 1Z75A 5J23A 2WYWA 3LLSA 5A9SB 4J7CA 1GR0A 1WZIA 4A26A 2GUGA 1HE4A 5BSFA 4WOJA 3WLEA 1I5RA 2QW8A 1VL6A 3HDHA 4GWKA 3TZQA 3VDQA 2Y0DA 4YRBA 2PGJA 3S2EA 1KVUA 3M1AA 1D3AA 2BLLA 3PYMA 1GAEO 2EWMA 3DQPA 5HS4A 1I36A 1NVMB 3ROPA 1LQUA 3K30A 5GMOA 1PJBA 2Z1MA 5JS6A 1NYTA 2TMDA 1E7YA 2IYPA 1NHGA 1W73A 1TXGA 4NH4A 5L9AA 1HYEA 3TPCA 1E3IA 3VZSA 4WNIA 1XU9A 3WMXA 4IJWA 2OMEA 3GFBA 5LDGA 3RSHA 1AXGA 2VTDA 4HFRA 3ZWYA 1SAYA 3B1FA 4IMPA 5F1OA 3JSAA 3CZMA 4RVHA 1B14A 3ZHBA 3LC1O 4PG8A 4DUPA 1T25A 1PSDA 2VUTA 2OBNA 2Y1CA 4NK4A 5I7VA 3PHJA 4YA6A 3VKVA 5DCUA 4Y9DA 4D7AA 5C7IO 1XGKA 3VPFA 5IZCC 1K6IA 1YWGO 3SC4A 2Q1UA 1YBMA 1EBFA 5B4TA 4ALNA 2IXAA 4BKOA 1HT0A 3VZQA 4DBZA 4DLBA 4NBRA 4FIZA 1KVTA 5DCYA 4MKZA 2Y0CA 4A7PA 3PHLA 1H2HA 1UXJA 1ZK0A 1NQ5A 4BKPA 3UCEA 4DC0A 5JCXA 4P8RA 1PQWA 2V6BA 3QWFA 1F14A 4FW8A 4TKMA 1EVZA 4QUKA 2IODA 3D0OA 3DOJA 2I67A 5KIAA 2EP5A 1X0VA 4DXHA 4GVXA 4QSMA 4XA8A 3R1IA 2Q49A 4U0JA 1NXQA 3FR7A 1K89A 1V3VA 3Q6IA 4XYEA 4WE3A 3H3JA 3GGOA 3RJ9A 2JJYA 4YQZA 5BNFA 3DMTC 3KEQA 4CV2A 3E9NA 2HK9A 3N58A 3V8BA 4R4JA 2VYND 5A05A 3MJ4A 4RDHA 4TZKA 1ZCJA 2D4AA 1MX3A 3HADA 3BMNA 3IAHA 5JAMA 3FRJA 5BNTA 3NT5A 4QXMA 3AY7A 1NPDA 2HRZA 2P91A 3MJSA 4MVJI 3JQ9A 1X14A 3ANMA 4URFA 4RORA 3MWEB 1GYRA 4HADA 1JVSA 4ALIA 5IDXA 3D7LA 4CMIB 4M49A 4MP6A 1PQPA 2Y1DA 3PLNA 2EIHA 4I9UA 2XXJA 5TQVA 3D4NA 3PJDA 1LX6A 3DBVO 2GN9A 5DOVA 3T7EA 5L40A 2JL1A 2D5CA 4MJLA 4ZQEA 5JO9A 4HWKA 2JFFA 3ITDA 2D0IA 2V6FA 2VYVA 2PD6A 3CKYA 1IUKA 2IEBA 1KY4A 3U62A 3ENNA 1I10A 3GNQA 3GVPA 3A14A 4S1VA 3ADOA 5G0TA 1HWYA 4YACA 2NTNA 1ML3A 1WXDA 4WNCA 4O0LA 4UUPA 2VRBA 1QLJA 2B4RO 3VZRA 4PGFA 4YJDA 1YKFA 3PHIA 4NBWA 3TWOA 2OO5A 3O38A 2TMGA 3OICA 4FC7A 1FDSA 3JQ7A 1PGQA 3H2SA 4YJFA 5DP1A 1UH5A 3UAGA 4NK5A 1P31A 4PZDA 4WLVA 5AOVA 1GUZA 4CM1A 2VZ8A 1YGYA 1CJCA 2DT5A 3OQ6A 4OKIA 4YJGA 1U4OA 1E7QA 5ITWA 4NZ9A 4YAEA 5G0UA 3OMLA 1H93A 1OC4A 4JBGA 5K6AC 2GZ1A 3GQVA 3OJFA 4FN4A 4PLFA 2HKIA 1B8VA 3BMQA 1D1TA 2W2KB 4Z3KA 1ISFA 3AUUA 4NBTA 4CMHA 4EUHA 2P4HX 2X1HA 3I83A 4Z9YA 4ID9A 4TRJA 3I6QA 1TB4A 4AJKA 3GH3A 4DL9A 4TRNA 3EAGA 4WLNA 4HXYA 4CMAA 3VAZA 3JYQA 3QVXA 4RLSA 2VHWA 5KNLA 2OUIA 3DBRA 1FDVA 3I9KA 1N2SA 3JQCA 2Q1TA 3ONFA 4JN6B 4ZICA 4CLRA 4A03A 4BO2A 2EKLA 2J5KA 4IDAA 4IQGA 4RF4A 3JQBC 2PKRA 3PIDA 4Z0PA 2Y93A 1T1SA 2OOSA 4L76A 1YOVB 1PR9A 4FC6A 5BSGA 3Q2KA 4YT5A 1WMAA 1IE3A 3HN7A 3Q1LA 4FFPA 3SJ7A 4BNIA 2D2IA 5IDWA 1RM4A 4AL4A 1EDZA 1VJTA 2P68A 2Q50A 4KP7A 4MVJH 5AXAA 3LVFO 4DPKA 1AHHA 3CMMA 4P22A 3GC6A 1T4DA 1E3EA 1LLQA 4L4XA 4WCFC 1H2BA 2H5LA 1VSVA 4XDYA 2X8LA 3BTUA 4E2WA 1JU9A 5JDIA 4PZCA 1D1SA 3DBHB 2Y1EA 2UVDA 3HE3A 3RWBA 2VT3A 2C7VA 3V2HA 1ISHA 3JQDA 4LVCA 4MP3A 4XJSA 3B1JA 4J1TA 1GV1A 1OMOA 3ZV3A 3VHRA 3H8VA 5HWSA 2NTVA 2WE7A 4J43A 4BGVA 1FMCA 4DMLA 3P7MA 2X23A 1YL6A 3IMFA 1NFQA 2HUNA 4CLHA 1C1XB 2C2XA 2E49A 4YXFA 3I52A 1C0KA 4BB6A 1GCUA 2ZB4A 4AG3A 3P2OA 4NNJA 3EZYA 2C07A 3RUIA 3F1KA 4ZN6A 4CM4B 1E77A 2JCYA 2Q4BA 3L9WA 2RAFA 2HMSA 2X9VA 1HYHA 3PWKA 4YCAA 1J4AA 4MINA 1R66A 3C7DB 4Q3DA 4R51A 1CF2O 3QSGA 2PY6A 4D45A 5IAAA 2RHRA 3W4KA 3U4CA 3RBVA 5CPBA 3C3XA 5COBA 2ZB3A 3WBFA 5CDTA 3JQAB 4ZU3A 1HEUA 2ZQYA 4CM4A 1U2GA 3UCFA 4BVAA 3FTNA 4CQMD 1DC6A 3KLMX 5CEJA 1ZSVA 4HNHA 1UZMA 2B36A 4R41A 3RVDA 1WAMA 3TN7A 1DC5A 5GY7A 2HO5A 2WSBA 4BNXA 4NFYA 3C1TA 4YEDA 3VPHA 2H9IA 3SJUA 1N9GB 5I9MA 1YQGA 3LK7A 4U7WA 2EKQA 4YJGB 1NTOA 1U2DA 3ZWCA 3INRA 1O8CA 1DRWA 1SB9A 2BGLA 1I8TA 3U09A 1DAPA 3WBBA 4UVIA 3KYDA 3L6EA 5K0ZA 1ZK4A 1BXGA 1ZSNA 4E5MA 1XCBA 2BGKA 1RYDA 3QWAA 1IPFA 4PLWA 5EINA 2W4QA 1KERA 5F21A 5THKA 5CDYA 3BTVA 1E1KA 1U8XX 4PLYA 4CMGA 5TLSA 4YRDA 1Y9EA 1H0KA 1LLUA 2Y0EA 1MV8A 4RF3A 4G5HA 1DEHA 1EMDA 4WCDA 3JYPA 1GPJA 1QXSA 4PIVA 1U4SA 5IN5A 3WGGA 1QR6A 4JBIA 2V6MA 2ZIZA 1E3WB 5A5FA 4XCVA 3LT4A 2PLAA 3PHGA 1SZJG 3D4PA 1U7HA 1KS9A 1U3VA 4EYEA 4J0FA 1YBAA 2ZK7A 2ZYAA 2HK8A 1DDOA 2AEMA 3VPGA 4PG6A 4A27A 3AOGA 2EGHA 3ZNNA 4GKVA 1ZO8A 1PJ2A 2V65A 4OXNA 1ULSA 1VPDA 3KM0A 3M2TA 4Y98A 4XB1A 4TQGA 1UXIA 4CR7A 4AJ4A 1NX6A 1GUYA 3UCXA 3JD2A 4NBVA 3IDSA 1I2BA 5TGDA 5KKCA 5G4LA 4Z9FA 1JTVA 3L07A 4B4UA 2G1UA 1SCUA 1SPXA 1D8AA 2GCGA 5B37A 3G17A 3PRJA 1NVTA 3ROKA 3MEQA 3EVTA 3NV9A 3F4BA 2I99A 2DPGA 5KJEA 5CFZA 4RQTA 3GAZA 4CQLA 4CMIA 3DZKA 3MJVA 2YQ5A 3HDYA 3K92A 3PJFA 1QYXA 1D7OA 2VHXA 4KUEA 4UUOA 4DIBA 2VWPA 3ZWVA 1UDCA 3PIIA 2E4AA 1U3WA 2P9GA 1E3WA 3GPIA 2J5RA 3COSA 3JQ7B 4K9DA 3SEFA 4BGUA 4PZEA 3K5PA 4XD2A 5A4DA 3GK3A 1EE2A 4MKXA 1Z7BA 3L77A 3ZNOA 3CSDA 1LNQA 1PL7A 5I7EA 4E31A 4CL3A 4EDFA 2EW8A 3GVIA 2X9GA 1HDGO 3CE6A 4PCVA 4I5EA 2JD1A 3GG2A 2FOIA 3I9OA 2NUAA 2WTBA 3AY6A 1F06A 3OBBA 4RVFA 2YV3A 4IXTA 1E7RA 4CLXA 2DUWA 4CM8A 1LTHR 1YS4A 1E6UA 2HSDA 3OEWA 3PI7A 2VRCA 4FFNA 4N7RA 4KDEA 3D3EA 3L4BC 3ROQA 1EK6A 3VTZA 1B8UA 3FNHA 3QVWA 5JAIA 2ZTMA 3BA1A 1UXGA 3FSRA 4CV3A 3ASUA 1B2LA 4BL5A 3TOZA 4ITUA 4RVUA 1HDXA 4BO5A 3L9XA 3V1TC 1DLIA 3GZNB 4MKRA 4ZVVA 1U3UA 1EUCA 1SO8A 3ZWAA 4F45A 4NR0A 3S2GA 1FXSA 1E1MA 3WLFA 3DAFA 4NQZA 2IZZA 4QFDA 1P1IA 4Y67A 1R4NA 2DBRA 2HRBA 1IZ0A 2VWGA 4JJGA 4II2A 2Y66A 4CR6A 3CEAA 3E48A 4HP8A 1I32A 1I3MA 4EZBA 2PWZA 2W98A 4TZTA 1ZBQA 2D5AA 3NTOA 3EYWA 3JQ8A 3Q9UA 5T57A 3HB5X 4ZQGA 2DVMA 1ADGA 3BMOB 1BXZA 2LDBA 4J9VA 4M55A 1K6JA 3NGLA 1LDNA 1QSGA 1Y8RB 1XG5A 4Y6RA 3DL2A 4INAA 4BNZA 5CAEA 4IUYA 3ZZNA 2CF6A 4NG5A 1PWXA 4WASA 4D0RA 2BRUA 3PQDA 3ZV4A 1Q0QA 1H6CA 3MTJA 3OIGA 3EUWA 1A71A 4CMJA 3VH3A 4XB2A 1H6BA 4FPXA 3SLKA 4EEZA 3U5TA 3OQBA 3OHSX 2FMUA 3AFNA 3IP3A 3L0DA 1ZNQO 1PS0A 4IS3A 4NU5A 4W99A 1DRVA 4YT4A 1R37A 3H5NA 1CDOA 3SXPA 3VKUA 2H6EA 4RLHA 4NJOA 3DBHA 1KEVA 3BHJA 1B26A 3FCOA 3KYBA 1JKJA 2X22A 3PWSA 4M87A 3ZNQA 5EIOA 5EMHA 2Z5LA 5DF1A 1K3TA 5TT1A 4Q39A 1ZH8A 3TQHA 3MJCA 2O23A 5EPOA 9LDBA 2DFVA 1HZJA 2CDBA 2UYYA 2WYVA 3TL3A 2HJSA 4A10A 3RFXA 1PS9A 3FI9A 3ASVA 2R6JA 3RC1A 1X1TA 1XDWA 3BIOA 3GFGA 3GVHA 3H3FA 4KQWA 3DHYA 1T2AA 1F8GA 2FHSA 3PGXA 1ZK2A 1LDBA 3QWHA 4J49A 4CL8A 2EHDA 4II3A 1H6AA 2DAPA 4DVJA 2EJVA 1H5QA 4NFHA 1T4BA 2PTGA 1MXHA 2QRLA 2VHZA 4CMCA 1Z7EA 3NT2A 2JFGA 4JP3A 1DBVO 1E1NA 3DDNA 4TRMA 3VZPA 1T1RA 5THQA 4J3FA 5JE8A 3AWDA 2JCVA 1IHYA 3L6OO 1YO6A 5B4VA 4KDFA 4PLTA 4CM7A 3TZHA 2JAPA 4L0QA 1ISJA 5BNIA 1FDWA 4BQPA 3DFUA 1ZXBA 2LDXA 4KTTE 1XELA 3WB9A 5FFFA 1BW9A 3HUDA 4XDZA 5CHEA 2PZLA 3V1YA 5ES3A 1Y7TA 3DBLA 1GEEA 2HCTA 4F3YA 1PEDA 3G3EA 1EVYA 5T8KC 1V35A 3CPSA 3DR3A 1JAXA 4IQ8A 4YVFA 5GZ1A 1ARZA 1NQOA 1GYPA 4FOOA 3JYOA 5DP2A 4FJ1A 1NQTA 1UZLA 4TVOA 5LCXA 4OIMA 5L7YA 1MC5A 1B3RA 3S2IA 3RFVA 3WQSB 3GNSA 3PYXA 5JW6A 1N8KA 1M67A 2YHIB 4HFNA 3JTMA 4LRSB 1CQIA 4IS2A 3ULKA 4CLOB 1E92A 2PD4A 1A72A 3BXXA 3DONA 4B79A 1SMKA 3ZW8A 2Q2QA 3TFQA 5JDCC 5TSDA 2IZ0A 2X9NA 2W2LA 3PGJA 4D46A 4E5KA 4BGEA 4RV9A 1Z74A 1MFZA 1PR3A 3FBGA 1Y5RA 5JPIA 3F4LA 4YBZA 4P4LA 5HTOA 4LK3A 4H16A 3JQEA 3RC9A 2UUOA 1LRLA 1Y6JA 2RCYA 3C8MA 4R9RA 1E7WA 1TEHA 7ADHA 1LDEA 1A4UA 1LQTA 1ISMA 2VYNA 1A5ZA 3HZZA 1A7AA 4BMNA 5KJCA 3QLJA 1K6XA 5CEEA 3AK4A 3LQFA 1MG5A 3D5QA 4GVLA 1PGPA 2W90A 1GZ4A 4BKRA 1M2WA 2AG8A 4OM8A 4E21A 2X0IA 3A9WA 2PKQO 3I4FA 2P5UA 3K6JA 4ILKA 3JV7A 1I3LA 3FTPA 4ALLA 4GX1A 1E7MA 4R9SA 3B6ZA 2ZQZA 4HUJA 1R4MB 4AVYA 1MB4A 1O6ZA 1TI7A 4EUEA 3I9JA 1GZ6A 4IPTA 1PJQA 1B8PA 3DZHA 4UEOA 4XZ3A 4IJVA 4DMMA 4DTIA 3MZ0A 4E12A 2PKQP 1ZMTA 3AW9A 4TSKA 1YJ8A 4FFOA 2HMWA 5A03A 2OGUA 4IJUA 3UFXA 1QYCA 1ENYA 4YJHA 3P5SA 4I5GA 5H83A 3WFIA 2GZ2A 2NVUA 1XIVA 5I9LA 3E1KA 3LU1A 4XYGA 3ZU5A 3A28A 3PVZA 3TRIA 4ZQFA 3A4VA 1ZZEA 4IY1A 5C37A 1JAYA 4N5MA 2J8ZA 3M1LA 2O2YA 4QO8A 1CQJA 5TT0A 2X86A 3EGOA 2Y1OA 1IOLA 1ZKMA 1R15A 3KZVA 2YQ4A 4LRTB 3FWNA 4D0SA 3NAQA 4KOAA 4E3ZA 4RPKA 4PRLA 3W6UA 4EJMA 1RPNA 4MOWA 3RUAA 2BHLA 4HNGA 3BMOA 3QE3A 4UREA 4GL4A 3WS7A 3DTTA 4BNNA 4R1UA 1HKUA 4TMFA 4PFJA 2BI7A 4CM5A 1E5LA 4ND4A 2WE8A 4Q3BA 1I3NA 1AGNA 1GEGA 2WYUA 1I0ZA 4WGGA 3KO8A 3QW2A 4D3FA 1XHLA 4AJOA 4KTVE 4D44A 5MDHA 2YDYA 4YAIA 2VCYA 1OAAA 4B4VA 2VQ3A 3ZWMA 4GX5A 4Z0HO 4GGPA 3H5AA 1YH3A 4F6LA 5U1PA 2FR0A 2BF7A 4GQAA 4GSLA 4QX6A 3D3WA 3ZWPA 2NVUB 3ZDFA 3BMCB 3UN1A 3VVBA 5JAZA 1VKNA 1GTMA 1I2CA 1C1DB 3I9MA 3TDKA 1M75A 1PWZA 4J0EA 4PVCA 4EEXA 4D41A 4E13A 4DQXA 2RIRA 2X0JA 3FR8A 3RBXA 3PYLA 4GMGA 1L1FA 3O8QB 3DXFA
chains in the Genus database with same CATH superfamily
3URKA 4EY5A 2YHUA 3EVCA 4A92A 4V1CA 2XEDA 2JARA 3VVLA 3NFRA 1RCUA 2ZRHA 3IEUA 4HWGA 4UVHA 5TQ2A 3RBZA 5IDYA 3SI7A 3S7ZA 1A27A 1C1DA 4TKUA 3VHXA 1CIJA 3LCRA 5GJWC 4NENA 5FWNA 4HDRA 3PS9A 3QVUA 3NJ8A 4QYIB 4ZOLA 1VB3A 3MQFA 2ID7A 5L4LA 1QG6A 1RYFA 2GEBA 1FC0A 1ZOOA 4CG3A 4LMPA 4L5YA 5EUBA 1HT2E 1ZUNA 1I7NA 1PTKA 5D6OA 4I9FA 5I45A 3R75A 1GR1A 3P52A 4CCYB 3GNTA 4F72A 1C7EA 1VJ1A 4F9TA 4QFCA 5IDQA 2WSLA 3NHMA 1HSOA 4JUCA 3PDWA 4HN2A 5CM9C 4ILEA 1OXUA 2QRJA 1EUDB 5KUTA 2Q6VA 3E18A 2X76A 4OQMA 1GG9A 5H82A 3SFVA 3TCXB 1FJHA 2DTDA 3DZFA 1PKXA 3L7IA 4RTQA 1LI5A 1T3GA 5H70A 4QLBA 2I4LA 3RJTA 4P31A 3F47A 5ER9A 5K0CA 3A58B 3Q0EA 2JBHA 3ZNPA 5CITA 3JQFC 1BCSB 2G7ZA 1THZA 4OL0A 3TIGA 3LYUA 1IZYA 1E64A 3IH5A 3UJ8A 3MS4A 5LMZA 5IM4A 2IYWA 2V59A 1C0LA 2HNAA 2Q4RA 4XWOA 3IEMA 3KAKA 3MCUA 4CMEA 4K9PA 3WK7A 4BPRA 5LYJA 1ZPDA 3TRKA 2KB0A 2XTJA 3G1WA 1OOEA 3CUSA 4ZJUA 2JKVA 5LNK1 1TRKA 3A9SA 1W36C 2BMWA 2HA3A 4DV4B 1SC4A 3M8KA 5K99A 2WPNA 3E8XA 1L7EA 3V8VA 1RPAA 2DERA 4YPOA 2PUCA 3AVOA 4JNKA 4WACA 1PZNA 1TCVA 2C4NA 2O7QA 2X5KO 3NPMA 5LZ9A 1DINA 1PQUA 1QF7A 1YQDA 3DXYA 4DWOA 3GLIA 3R7WB 1CFZA 1RRVA 3DDCA 4MI9A 5FBLB 2C8LA 1QORA 1GLVA 3G9TA 3UMVA 1P5ZB 4RGYA 1QYIA 3G9UA 3HU3A 4N5LA 1KYIA 3QRWA 3RIHA 2IGBA 1UKEA 5JHGB 1MXFA 2FX2A 1OI7A 1ZOLA 3I9NA 1KY3A 2OG1A 4L73A 4NABA 2Q9UA 1AGYA 4ZCMA 4Q7JB 6ADHA 2JATA 4HNAA 4NU0A 2O2SA 5AXBA 2FSGA 5JC8A 1CUYA 1MLDA 2B25A 4TXMA 1SVKA 5CPFA 2WV7A 4HJXA 5DHTA 1OB2A 2ZIAA 4GOOD 4Y2JA 2G5GX 4ZPJA 4JQSA 1IZ9A 1KEUA 3HBJA 3JAWA 4DLXA 3NXSA 1GLGA 1KU0A 1HOTA 3AKEA 2SICE 1UP7A 1XZKA 3WXBA 4QA9A 3H11B 4LXIA 3RTDA 1SIUA 3ABQB 3ZCVA 1KI6A 3FPCA 2CXRA 4PO1A 2KS6A 4D8XA 1F0KA 1P3JA 5HG0A 1JDBC 2QUJA 4DY4A 5HBRA 2OQIA 1GQQA 1KO7A 3HDVA 4M0UA 1OLSA 3E9RA 3R7LA 4ACBA 4NESA 1B15A 1RWWA 4OK3A 4BNGA 1BE6A 1PI3A 1H3NA 3OIWA 4LHSA 1TA9A 4H6WA 1BJTA 3THOA 5LU9A 5KTRA 4I5FA 5B1YA 4WVLA 3BIWA 2FUCA 2BCGY 3TI7A 3C7KA 3EXHB 3JVEA 2J9RA 1FP1D 2OG2A 1FYFA 4H3HB 1YDHA 3ZOZA 1OB5A 4DYVA 5ADHA 4P0PB 2PIAA 4OOEA 2PRKA 1OA1A 3E5HA 3PCRB 1VPLA 3KZOA 2P67A 5EHQA 4AZ0A 2B5WA 4HJRA 5AKGA 4ZT6A 3ASZA 2FPKA 1EUQA 1JSCA 4L74A 4IV0A 2FSHA 1FNCA 1MG0A 3TD9A 5AUPB 2VTEA 2P77A 2P30A 3L18A 3ETDA 4E5UA 1QP0A 3A9UA 3FYCA 1LK5A 3K0BA 4BLQA 5KSOA 3P0HA 4ZARA 1M2EA 2VJAA 5CT8A 3O9VA 1NYQA 1PZGA 5HKKD 2XNDD 3IE2A 1XRQA 5C32A 4QGAA 2W48A 4BNJA 3BQNB 3OZAA 4OM7A 3VOBA 3VR0A 1FZTA 2HJGA 1NP6A 5J4KA 2GTHA 4EZIA 5DBFA 4IRUB 1WD5A 3Q6MA 1T9CA 1UUFA 3LY5A 1RAEA 4EGCB 4L57A 1LRKA 1XVIA 1BH6A 2NACA 5HS6A 3FUCA 3FE2A 3HZRA 4YV2A 1S0UA 5IZ4A 3QKWA 4UUNA 5FR1A 3ZJTA 2J5QA 3QE2A 521PA 4L95C 1BDMA 2VYCA 2TMKA 1I33A 2I7TA 2XNHA 4J3NA 1UJMA 2R7LA 3UAXA 1ODSA 5PGMA 2P4SA 2FY8A 5DEIA 3UXYA 1HLFA 2Z95A 2BVNA 3Q2OA 4UUAA 3GEMA 4QOJA 1WB4A 3PTLA 3SIWA 1SOMA 3WGQA 3C3WA 4QVIA 2EGUA 2XJ9A 2F8LA 3GFOA 2Q8QA 1XNRB 3WICA 4IGFA 4KPGA 2I87A 2JGRA 4C0BA 4BMSA 1Z7GA 4BQFA 1JDPA 2H54A 3GQBB 3NIDB 4QDUA 2RGDA 2A1TR 1H8ED 2YV2A 3NS7A 4O2LA 4O8CA 4PS0A 1BFKA 4TQUS 1AMNA 5EIWA 3ES9A 3MT7A 1L7AA 2QQ5A 4F1KA 1TMYA 4GKJB 2NO4A 2IXEA 4X1IB 1DO8A 1II0A 2PNFA 1VLLA 5ER6A 1ST2A 1K8ZB 1XUOA 5AQ1A 1WE2A 2FW9A 4FKMA 4U02A 5CLQA 3ZWKA 1YKSA 4YDQA 4MV5A 1BO6A 1GTL1 2Q1WA 4EIWA 3A1TA 4OOFA 2H07A 1P19A 2NPIA 5JCJD 1EWKA 3LY7A 1VPTA 1J8QA 1TJ4A 4S1PA 1JQJC 3T3DA 2RHHA 4QBTA 2CEAA 3T1VA 3FOBA 1NPTO 3PTZA 2ZIXB 3OM1A 5SV2A 4AF7A 1YKGA 4OO3A 3L0CA 4IFTA 4EHBA 4D46A 1JH8A 1J2YA 3SN6A 3EW7A 4CL2A 3NHLA 4FFLA 2PWYA 3TPFA 3PTAA 2CJWB 1W0CA 4TKLA 1YR3A 3OM9A 1RP1A 5ARCA 4DC1A 4ZD6A 2GZ3A 2H52A 3R6DA 4CQLB 3QEAZ 4M1OA 3GGSA 2M2IA 5DHRA 5F2OA 4ZDIA 1PL6A 4LY9A 1K98A 4MPPA 4D2IA 3TSWA 1P1JA 2X4IA 4MS4A 3OT5A 4A8JC 2QR2A 3CGWA 2BGUA 4MIEA 4R8SA 3D6UA 4WLEA 5EG5A 2WQ7A 5IT5A 1ZI8A 2C5HA 4GXTA 2ERCA 2L82A 1A4IA 1DJLA 1ODIA 1Z13A 4CIDA 2I34A 1N1GA 2B4TO 1QKKA 2P6PA 3FIJA 3IAS1 2ZITA 1RKXA 1FQWA 4TS1A 1GPLA 1TAHA 3WR5A 3ZS9A 3ZXUB 4PWZA 4K6OA 4G9BA 2ILVA 1XKXA 2HMTA 1XLWA 1YI0A 3CS3A 3EZLA 4ZXFA 1XL0A 1NNUA 1JI0A 2VI5A 5BUSA 5LDHA 2Z5FA 3P9KA 4ZANA 2ZSEA 3P2IA 1IAVA 2GPAA 3PZRA 4Y3UA 3NHWA 2W00A 2QTCA 4FFDA 3TJZA 3WGTA 4DSZA 3MINA 1UQUA 4QNNA 3HXLA 4YRAA 3JASA 3RHFA 4CM9A 4TYNA 3SYNA 3AT1A 3T3NA 3T7KA 2CVFA 4I1SA 1RWOA 1YACA 2VSXA 2P7HA 3HP4A 1ONPA 4H3VA 4XGIA 1UDXA 1O7JA 5ED4A 2XGMA 4QHSA 3PQ2A 4P34A 3AERB 3H86A 3MJRA 4L75A 3B13B 3DZIA 1EPUA 1Q1NA 3DP9A 3FYDA 5GONB 2CC2A 3TEMA 5AVVA 8LDHA 1UK6A 5LLDA 2AEFA 4RHFA 5FWDA 5ESXA 4A6EA 1DELA 1X80A 3RBAA 5E2BA 1SPBS 3AF2A 1SUDA 2B30A 1V8DA 3W6ZA 4GT1A 2QZSA 3IODA 4FFVA 5ADWA 3FUVA 5EIFA 1N5KA 5ISMA 2C7PA 4LWPA 2MYPA 2YCLA 2PZMA 4EB3A 1QFJA 5A9TA 4IUBS 4US2R 2ZJZA 2E89A 4RZIA 5HZMA 2ZJYA 1ZGAA 5EE9A 2INGX 1H9AA 2CMDA 4MGHA 2ZAIA 1PDOA 3O8QA 1ZGCA 4BUCA 3STHA 4UM5A 1W29A 3BTOA 4YJFB 4PSDA 2RAVA 4P3OA 3UAZA 3WJ2A 4COKA 3RSGA 1X80B 4EARA 1BROA 3EK2A 3L8MA 3WKCA 4BNLA 3II6X 3VUFA 4HX5A 1KNQA 2HY7A 2XDWA 4PG7A 4RDCA 1KI1A 2JH8A 3JD1A 5F23A 3ZWXA 2G1AA 4F4DA 1ETHA 4AJ1A 4DLKA 4P54A 2QMZA 2P2DA 3QKSB 5ICSA 3QQPA 2ZSIA 4NZNA 3WX0A 2OOKA 2I66A 3DVSX 2W22A 4IMJB 4PHFA 4BMVA 2Q99A 3CF6R 3BXEA 1QU3A 3VJLA 1GQRA 2QYHA 5AKYA 2C83A 1KZGB 3NWPA 5LOVB 1ZH4A 2F4NA 2RH8A 3ANYB 3C45A 3LT2A 4WINA 3RJ5A 4ABYA 2V3CC 3ESBA 2XI4A 4U7JA 1OT3A 2JEZA 4MVJF 3N70A 4BNDB 1VHLA 2ZSJA 1EUZA 1S7CA 2H1LA 2WZQA 4ONEA 3OCJA 5BMVA 5I47A 5TIIA 1UKBA 4GLJA 1WTCA 4EFKA 4DM3A 2OL4A 5CDGA 1XK6A 1FQJA 1XZCA 3OZEA 2J33A 3A1FA 3R3SA 4ND2A 4CIWA 2H16A 1QPGA 2QIPA 4E5YA 1KJWA 3GOHA 4M0CA 2BV3A 3UYKA 3ICCA 2ZVJA 1EGHA 1CY6A 1FQOA 2ZYRA 2NT4A 1XDUA 4OK5A 3HJNA 1W6RA 3VTFA 1LC0A 3VYUB 1P7CA 3DHEA 3Q12A 1U2GC 1HQYE 1BX0A 2K5UA 3L41A 2V7TA 1D6MA 4D4MA 4XDHA 1DO2A 3PNBA 5DGCA 5JRDS 3O4JA 2WOJA 4M98A 2B4AA 3DCIA 3C24A 3OX1A 1F17A 1U2EA 1WUIS 2AW3A 4IDQA 3AIOA 2G08A 1VRWA 1BA2A 4RD6A 4TKZA 5F7OA 4NCAA 1N0VC 1UDAA 2VAVA 3OPYB 3WWCA 4RK1A 3TIXB 2VXCA 3CX3A 1T91A 3AHHA 5I3CA 4X3CA 3FNEA 4UHKA 1BVRA 2FGKA 3VR4A 3PDIA 5HPYB 3K0AB 2O59A 1TLFA 1SVUA 2D62A 1CUWA 4L85A 1LJLA 3FDZB 1L3IA 4TSFD 2W2PA 1VJRA 4URUR 5FEMA 1Z28A 2WQ6A 1WETA 2CK3A 3ZGYA 4M1QA 4JOCA 1WXGA 1ST3A 1CKEA 1NQWA 3CX8A 3A25A 1V1MB 2HDHA 3NH6A 3EW9A 1PR1A 1DXOA 3EVGA 3IMCA 5TB5A 1DAFA 1Z22A 4BO4A 4WEOA 3ICWA 3F5SA 4E2XA 1VE5A 1I4DD 1ZONA 2QP3A 2Y4NA 2IU6A 4YO8A 2O8DB 2FHPA 1XQ1A 5E8RA 4UBKA 2JBAB 5FHRA 5GP1A 2FMHA 3HJTA 1OYOA 3LXMA 4I1PA 4B45A 4HWRA 4W8HA 5IS2A 4OSOA 4J0HA 2GZDA 4UJ3A 2HK7A 1HT3A 3OFNA 1V9LA 3QEMB 5JRJA 1RBQA 5KDDA 5CW2A 3A3YA 1ZHFA 4IFEA 2GJ8A 3NCHA 4F0JA 3EULA 1KKLA 4KBYA 4UCFA 2C5LA 3D54D 3GP3A 3NATA 4QXPA 4EI8A 2ZDQA 2C5BA 3K53A 2BFDB 5H3LA 3QVLA 2ZTSA 3OHPA 4XCXA 5U4QA 4GL2A 4KWIA 5FBZA 4EW1A 1AZSC 2DECA 1F51E 5F5LA 1UEIA 3W8NA 1M76A 1PQ4A 4Z7JA 2HADA 1UZNA 3Q7EA 5LA6F 2V8OA 3GCXA 2C2YA 4P2BA 4F2HA 3MHTA 1CEYA 1NOKA 2CNOA 3EQ2A 4ND8B 5FPHA 1KRWA 5CXUA 2C5AA 3CXUA 1HM5A 3KOUA 4WV3A 3M6AA 3I3OA 2BSQA 1DC4A 2KW5A 5DN9A 2J46A 3V1UA 3FCYA 3VSDA 4WFJA 4IOMA 3BHIA 3VISA 1PVOA 3QEKA 3JYHA 2C7QA 2R5WA 4LEIA 3KEFA 4J03A 2PA3A 4D92A 3QOXA 5HUHA 1GG5A 5HIIA 2O50A 5BV0A 1GL9B 2YC4C 2IUFA 3W7BA 4LPSA 2DJ5A 5BVHB 1DXQA 2XOEA 1HSZA 2W2VA 1E66A 4NNPA 4WCFB 4E6PA 4F4JA 3NHAA 3M34A 1F4LA 1YQXA 1JFTA 2JI9A 3UT5A 4POAA 3A3NA 1ANKA 4YRKA 1ODLA 2GLXA 2HJVA 2WYIA 3DE2X 1P2FA 4I6GA 4PO8A 2PQ2A 5F33A 4DREA 1ZHOA 6AT1A 3MJHA 4UAGA 3HMKA 1IBRA 1X1BA 4TXJA 3PSHA 3FKSA 3QKRA 5KTPA 1L3BA 1WW2A 1ZIDA 2ZSBA 5G02A 1EGMB 3CKMA 4QPDA 4YN3A 2BEKA 4XIYA 5TY0A 3HTXA 1T4MA 4GBGA 4EB8A 4B2IA 1IOZA 1E79D 5H0IA 4IKEA 3K1AA 3M1IA 5I9IA 4M22A 3H6KA 3P2JA 3S8EA 2GARA 1X7WB 4ND3A 1TF2A 3ANNA 3DR5A 2J3EA 2C2GA 3QV1A 1NVGA 4JVOA 4N7BA 1JIIA 5HK9A 4OHWA 1JR3E 1I1QB 4R2MA 1J8YF 3OZTA 4G23A 3RVQA 3WO1A 1MGPA 2GN0A 4RK7A 3ZY3A 4M9SA 3LDGA 3UHAA 1MP0A 2N47A 3CPJB 5REQB 4H7FA 4BB5A 1EVLA 1YB7A 4ZEWA 4X94A 1OI3A 1F8FA 1XKTA 2G9RA 3FRHA 3KVOA 3MTEA 4EYOA 4IIHA 2ZG6A 4AW9A 4MYDA 1YVRA 5CUQA 5FORA 3RI3A 3ZH9B 2FN8A 5L3SA 3QLTA 1NVUQ 4IV5A 5CNMA 3HEAA 1QQ5A 4D8VA 1OZAA 5JADA 2KPOA 4OXKA 1XSEA 4O4JF 5IYZF 5TPZD 1KZ7B 2ERXA 3WYDA 3GZNA 1WOYA 1Y5LA 2PXCA 4GW3A 3W6UA 2DCUA 3CTMA 5E3JA 2YOHA 1KKUA 3L7NA 2RGNC 5REQA 2YWBA 3OZXA 4XEHA 1R0SA 4WA8A 4KWCA 1QQBA 1IL0A 1NA5A 1YE3A 5EQDA 3JVVA 4QXRA 2PKXA 1S8FA 1QFXA 2Q7XA 4XLLA 5CR9A 5K51A 3AX6A 1PS8A 1CHDA 1W34A 1YXMA 1ZS9A 2G83A 1YL7A 2I2FA 2ODWA 3LCUA 4G56A 3HO8A 4UARA 3ZKWB 4RAQA 4WDRA 4IZOA 3RVJA 1YB1A 4KGDA 2YJ5A 4KFCA 3ZGNA 4K3VA 3SJZA 1ZISA 4DSUA 5L6MB 3P0JA 3Q4GA 3D2BA 1LS1A 3VR5A 5B64A 3ZGLA 4UULA 1ECCA 3CE9A 3LVQE 2GERA 4RY8A 1I7SB 2ZW9A 1Z38A 1L0BA 3CV3A 2ANCA 3M49A 4BKQA 4TYYA 3ZTTA 5FX2A 3QNWA 4NRDA 1ZRMA 1W2WB 4DLSA 4YAKA 5K0LA 3K6KA 1CQZA 1M6HA 2V0NA 3Q3CA 1JDZA 4PPFA 2GWHA 3NVAA 1E6EA 4TWAA 3IBSA 1Q2UA 1ZC4A 4DCTA 2XT6A 2A88A 4RA6B 2GN1A 4UM8B 2HQ1A 3PDCA 1QH1B 1SD2A 3BWMA 1KFBB 3A27A 2CN1A 4QXQA 1N5MA 5ILOA 1DSSG 1ZCAA 2KQUA 3NJ4A 4OHUA 3S2ZA 4AX8A 1ZD9A 2I1LA 3I4LA 5AHOA 1Z63A 1RJDA 5FA8A 3P9NA 1X9HA 5HDBB 1V5FA 1T6NA 2C5FA 2JCXA 1MT3A 2JAXA 2WHPB 1N0WA 3I92A 3NNNA 1EVQA 4ZQIA 1COWD 5HRUA 3E22A 5D85A 5ANRB 2FN3A 4O4IF 3S1SA 2OD7A 1P1KA 2AVDA 2EG5A 2QL7A 1TMKA 3DE3X 4HLDA 4Y0NA 3WGYA 1XP8A 4HQNA 4YLYA 2JAHA 1MB3A 2R96A 4JNCA 3KTAB 1RC8A 3NHRA 1KMNA 2BEWB 2I9KA 5DYWA 2VPPA 5KVVA 4AIIA 1S3GA 1QHHA 2JHFA 2N1BA 3N87A 4P83A 2I78A 5BN5B 3PXGA 4FBGA 2A92A 4JUIA 4XVUA 3W8FA 2H1RA 2POQX 1BMDA 3EISA 1VBKA 2EF1A 5K0TA 4PPNA 3CVJA 3DVAA 4H4CA 4JI5B 3BIJA 1DQRA 3E2MA 4PYKA 4P4SA 2Q7DA 5IXJA 3I3SR 5K9ZA 1ZVVA 3F9RA 5F52A 3AMVA 1BWPA 1EP1B 1F9EA 2RB5A 1FP2A 1T6XA 2ODEA 3BULA 1NTRA 3IJ5A 2SKEA 1QK5A 5FADA 4X64B 3ZJ4A 4KYIB 1QBGA 1LBQA 4JT8A 1WY7A 4A8JA 3PUXA 2D5LA 4Q1BA 1VPVA 4Q93A 1KDYA 4B32A 1N6PA 1OV6A 3VM6A 2DMRA 4UBNA 1QVAA 4JELA 5EE1A 1NWHA 1UEXC 3B6EA 5ELMA 3TB6A 1DJNA 1J8FA 2G7MC 1X1EA 5FTJA 4MUFA 3UB4A 4TWIA 4CUJA 4DR5B 5DLPA 5A0TA 1SN7A 2BM1A 2H2GA 3ZWQA 4I50B 3WDMA 3K16A 3EUFA 3ABIA 4LTNA 1ACLA 2Q62A 3IS3A 1SBZA 2CUKA 5FA5A 1H1DA 1F38A 4Z0TA 3FWZA 3V7YA 5KTOA 4B7XA 3W9YA 4AG6A 4JKIA 3L43A 2NSYA 2FVYA 5F77A 4E30A 1B8NA 3E1GA 3L1HA 1NX9A 1ZA1A 3HG7A 5AO9A 4YR7A 4HXFB 3TX2A 2VVTA 2CCJA 2I2AA 1XVUA 1PK8A 2WNIA 2Z04A 2W0MA 2ZBQA 3BGIA 4GI1A 4LECA 3G8AA 3W1EA 3WGOA 4WOBA 4B3RB 1YA8A 5BWNA 4WLUA 1C14A 4INPA 3UAOA 1J70A 1EKXA 4HD8A 1XQYA 3OBIA 4MEAA 3NBMA 4LBYA 2CNLA 1HTTA 5DW0A 4HDRB 1Z25A 2JIOA 2DQSA 4GNKA 2QVZX 2X3YA 4FCTA 4U7FA 1R6DA 5IJ0A 2C5GA 1KMMA 5DZSA 3WL5A 3G0CA 2HWUA 5B5SA 4LVUA 3ESAA 1XR3A 4DILA 1CUBA 1ZJZA 2ZSDA 3FDFA 3D3QA 3EVFA 2IS4A 1ZFNA 1EXWA 2HUPA 4NCKA 1PWHA 1QO9A 1V39A 1GNSA 2E6KA 5GZ6A 3EBLA 3Q3JB 4NMWA 1B1CA 1K5HA 1ZEMA 7MDHA 2HJHA 1SFRA 2J4DA 4TGLA 1HOXA 3AKCA 3HFRA 3GAFA 2J0QA 4Q34A 4YRGA 1LV7A 2DWPA 2J9YB 4IYRA 4OI4A 5JLJA 1YV9A 221PA 3CF0A 3FWYA 1MJNA 5FL3A 3P9QA 5LQSA 4D9JA 1CEEA 1J25A 4M8LA 4ZYYA 1KP3A 3KHKA 1I3KA 4Q4DA 2HIMA 4KUGA 1I2MA 4C0AC 1T24A 2GF2A 3IUPA 4C7XA 3LUHA 4CCAA 5B6IA 3TEJA 1JBKA 3IXLA 4DY6A 1AMOA 3FCSB 4R54A 1DBPA 4RYLA 4XFJA 1BWRA 1E4VA 1UJ5A 4DAOA 1LJ8A 1AQIA 4E4RA 4HUTA 2B2NA 4JYBA 4YT2A 5FEUA 5KQLA 1V1JA 2IEAA 2XYVA 4FT4A 4RJJA 4ZWNA 2QV0A 1NPYA 4CMEC 5HM8A 5MGNA 2RK4A 2YV1A 2B4KA 1ZNWA 4J3JA 4PG4A 2OQVA 5CH3A 3RD5A 1C3VA 1GFZA 2Q45A 1Q1GA 4NPHA 2QY9A 1SCAA 2Q6LA 3GFSA 2FFHA 1F5NA 2X7HA 1CRQA 1FF9A 2QKYA 3QLUC 1YDEA 4LSWA 5BSMA 3IJRA 3VMFA 3WK4A 4EHNA 2JI6A 3LDAA 3GV0A 4JMLA 1QHNA 3ZGOA 2PWAA 1N78A 3H4MA 2GZRA 1KOGA 1S4MA 4YXWA 3GEPA 2ST1A 1NMEA 2G0TA 3HKCB 4D43A 1CUCA 2HZBA 2Z6UA 3HCRA 1W6UA 3R2JA 2CMGA 1EZZA 4CKBA 1CNEA 1IXYA 4KVZA 3TXAA 4R1NA 4M0DA 1JHYA 3DBIA 5EMKA 3CCFA 1OZGA 2JGAA 4PLPA 3U7GA 5HJ7A 1XDZA 2WT9A 5DX8A 3G8CA 3FKJA 2XAUA 1UZUA 1N2JA 4RJLA 1M66A 2W2KA 1HZZA 3GBPA 4J8PA 4LNAA 1O58A 3IB3A 3L79A 3B3QA 2DQKA 2NXWA 2QTLA 1NAHA 2RK3A 1W7AA 3JATA 1FFXA 3D2LA 4DR7B 1IULA 4BNYA 1E2JA 1J9EA 1DEKA 4BVLA 5C81A 4IEEA 1POXA 4OQ4A 3TYXA 2VEDA 4FINA 4QDKA 4BNUA 5TMBA 5I6DA 3ZDDA 3CUTA 3ZE8A 1Q7CA 4NOKA 2HX1A 1XHFA 2OZEA 3FPKA 4WD3A 3UOGA 1WMBA 4A5OA 1XCMA 1Q3TA 1UC4B 5JD3A 3RWOA 4AF6A 3HPQA 5C51B 1RJ9B 1ZCZA 3L1UA 3C5WP 2NW6A 5FL7D 1ULBA 5LQKA 1O9BA 2ZWPA 3GAAA 4LZNA 1CYDA 3RVPA 3TKYA 3VNBA 4LF9B 1O94A 1E6KA 2V54A 5JISA 2REQB 3THRA 2CXQA 2H4ZA 1OPXA 3NIWA 4G1VA 1UK8A 3P2EA 3RG2A 3T5CA 4PICA 3MELA 3TLGA 4X91A 5BPFA 1EFKA 2Q1SA 4WEQA 5DASA 4E0BA 1SQFA 4MUKA 2JA2A 3O9ZA 3I32A 3TZBA 5ALWA 4ZAXA 3WRXC 5EJ7A 5IKEA 3FUTA 1Q84A 2WIFA 3UICA 5C7OO 1NR1A 3EMDA 2W58A 4BO6A 1QFSA 2Q6KA 4RKQA 3KUXA 4YAJA 2YC2C 4P98A 4PYQA 2YW9A 2FZWA 4X84A 5IBCA 2YJZA 3BXGA 1IY9A 4MB0A 2B7BA 1ONNA 3IESA 3E15A 4JJ8A 5E7JA 4B85A 4BJ3A 3F6YA 3FZQA 2R4TA 4OHVA 4RF2A 1E2LA 1VSTA 2HMUA 1IB6A 1S6YA 1ZBDA 1T8UA 2PZFA 5IFLA 3MD9A 2CSXA 2J30A 2P35A 5JJLA 3HU5A 1KAOA 2WIAA 1L7MA 5TJ9A 3ZZMA 4KO4S 4AZSA 3NVKI 1MQSA 3WMWA 1R4MA 2ODQA 2Q2VA 1W5SA 5HF6A 1Q20A 2VDUE 4Q00A 1T4GA 4R1PA 3IC5A 1UP6A 2BBTA 1E9BA 3T3MB 3H99A 5FCDA 3N39C 4OSEA 2X2EA 4REQB 3VVCA 2WP8J 2QVLA 3AJRA 3VJKA 4CW7A 1NFRA 2EZ8A 1E2UA 3IBGA 3GWGA 2O4UX 1KMHB 4IVRA 4PU0A 1O95C 2UUAB 1XTVA 3TNLA 4AI6A 4X97A 3I2KA 4BIIA 1GFIA 4EHAA 2ZETA 1YAJA 1D9XA 3IBTA 5CA0F 4WWHA 4UTNA 4AJNA 2GRAA 3M2PA 3UTCA 1B1AA 4RM2A 2OM6A 3MTIA 4KPFC 4IIEA 3FDIA 3ODPA 3Q5GA 4C7KA 3TBFA 4ES6A 3VR6D 4ISCA 4AB1A 1WCWA 2OILA 3MQ2A 1I7PA 3I6BA 5ESWA 1U5AA 3C5EA 1S96A 3KJQA 4I3GA 2AXQA 4QNMA 2FX3A 2OYRA 4CFYA 1LLCA 4UVEA 4LISA 4OHRA 4OK6A 2EZUA 2XV1A 2X8JA 3DMGA 3ESQA 3KB6A 2B37A 3FJOA 3AF5A 4DF3A 5BSRA 5KTMA 3PR3A 3IDQA 4Q03A 2EWVA 3F3YA 5HHTA 5K3AA 2Q9AA 1L9KA 3TNYA 1GDHA 4EQ6A 3A4TA 3BE6A 1ISPA 4MIOA 1JALA 5K4AA 2NO6A 4AMBA 1W8DA 2CFOA 2Y3IA 4FGKA 5LP6F 3SF0A 121PA 1OGIA 3HCNA 4GQIA 1YZFA 4HMQA 4ZVMA 1JW9B 4C3UA 2ODPA 3WA6A 2WZBA 5LUAA 3EUAA 5JR3A 4GR5A 1XBTA 3EA0A 4U0KA 1ZESA 4KWEA 2AQHA 4IIGA 4ECEA 5FBVB 1ETUA 4GO1A 5IC6A 3RFUA 5JFGA 2VXBA 5DLEA 3EGXB 2RHWA 1KNXA 4WZAB 4G5FA 5LQMA 4OAQA 1M3SA 4EQ6B 4OGKA 3ZBQA 4EY3A 4R6XA 1TF5A 2IIQA 1P77A 3WLKX 2K7FA 2AC4A 2P9CA 2NWQA 4GS5A 2W2TA 1UR5A 1TA0A 1Z0DA 5D7NA 1C3OB 5TGZA 1EFTA 2H63A 3CC8A 3EGEA 4F9EA 4DR3B 1XNQB 4NVRA 3N3AC 1M33A 4B8YA 4BZQA 4HLQB 1L5SA 1LDMA 4FR5A 2QMHA 4ZCRA 5DN6D 2NVBA 4JB8A 1LLDA 3R76A 3KKNA 3T7CA 3GRCA 4H7KA 1AHIA 4DYDA 4OMFG 2ABWA 5HGXA 1QC5B 3FSGA 1B7GO 3JQ9C 4KPEC 1X87A 1E58A 1Y5NA 3WC4A 1F2VA 3L7MA 5BVGB 1E6LA 2ZREA 3L06A 4BZXA 1H2FA 3BRSA 3ZHYA 1V4VA 1VI6A 2BI4A 3T38A 1QIIA 2DTEA 2Z58A 2HHJA 3A4IA 5KZMB 3LHIA 1KVSA 3S4YA 3ZWNA 3CBGA 4B6SA 3HV0A 2DWCA 3ADPA 3D3WB 4LYGA 2IBSA 3QEOA 3RKUA 2P9QA 4N65A 3WK9A 2C3YA 3DO5A 1QC5A 2LKCA 2R6AA 1SXPA 4M0EA 5CFMA 1J23A 2FUG1 2FZVA 2H1CA 3IHTA 3AVPA 2HLPA 1GPYA 4DDHA 3NHPA 2K6GA 1FFGA 3K70D 1P7YA 3EPJA 1M0WA 1RBMA 2JFXA 2MMGA 4JBHA 4LMRA 5L53A 1VC2A 1USIA 4TXNA 1W4RA 2VLIA 4HAOA 2QDKA 4IMIB 3CNQS 1CZHA 4BWGA 1PLLA 3AUYA 1UBSB 4UBIA 4XPZA 3B20A 1LRJA 4FDMA 1U8YA 2GHTA 3U4DA 5AW2A 3NUGA 2GMWA 1JLRA 3CO5A 2O57A 1M7GA 3L4BA 1A9SA 4B33A 2Y1XA 2WMDA 2FEOA 4CMBA 1PG0A 3O3MB 1OI2A 3J81k 1V1RA 1TFRA 3CUWA 4GGOA 4LZAA 5IJXA 4D82A 2R25B 3W2FA 1YBFA 3LECA 4QT0A 4ALKA 1CUSA 3SZGA 4FDTA 3KQNA 4RBNA 3KRTA 4B0PA 4OXYA 1R8QA 4ROSA 4EP1A 4EO7A 5JJIA 5JWRA 1JJIA 1KDRA 1NJ6A 4D3SA 2YZ7A 1BQEA 3ASYA 4G1BA 3V00A 4AMGA 4W8GA 4PFSA 3OE5A 2WUGA 3OWOA 3R8XA 1KC3A 4L5BA 4GUDA 3WFJA 1UBGA 2PUFA 5IANA 4C05A 5LPNA 4XASA 4DUGA 1EVIA 2WF7A 2D1RA 2CLOB 1V41E 5SY4A 3B48A 4GX2A 4L9AA 3JQPA 1P2TA 1QP4A 4WNAA 1PN3A 5BSTA 5KOIA 1A7KA 2GETA 4GPTA 3UMMA 1GL3A 2G76A 1GSOA 1QG0A 2EJCA 4MR8B 1E2FA 1Y7IA 2YZNA 3B2EA 3DWGA 4CI9A 5JMWA 5M7EA 4WKGA 4DBLE 1IM8A 3UHPA 5H59A 1JXQA 3OZUA 4BMYA 2OCDA 1V96A 4UD6A 3KU4A 1TW2A 3R24A 5E7IA 1G63A 1ND6A 5C8DA 2F3QA 1OZFA 2QYSA 2A9QA 1PX0A 2JASA 3UG7A 1AHNA 1B41A 1Z7WA 1ESEA 3EXG1 4JL8A 4WUVA 3RR2A 3THXB 3PCXA 1GSAA 2G09A 3OIUA 2WIKA 4UQPA 3EVBA 3EWSA 3TFOA 2RJOA 1JR2A 4A8HA 2A1UA 4GAEA 1PSWA 3H2IA 3PJRA 1ORWA 2OZLA 1PX2A 1G60A 1G42A 3ACCA 3AZQA 1RACA 3HKEB 3QF7A 4QPZA 4YI5A 5C8XA 4MI1A 3AR6A 3AGQA 5DM60 2UUBB 4ZEVA 2EG9A 1NU6A 2ASEA 1RWPA 3D6MA 3AM1A 1H5UA 3EFHA 2W42A 1M74A 1Q17A 1SBTA 3R6LA 4LAFA 1BD3A 1U0RA 5JMTA 3NANA 2QLBA 3ZX4A 1FSPA 1KVRA 4K6KA 4LZPA 4XCQA 2JW5A 1ZWLA 4JI4B 5F5NA 1P1CA 3A1CA 1U8AA 1Y6QA 2R8BA 1R0LA 2ONZA 4KVGA 3E9DA 3WDKA 4ZKDA 3U3DA 2P2YA 1AKNA 5DM1A 4BJ5A 2PFGA 4JXKA 1YJCA 3C70A 4V0MA 5JMPA 4CTKA 3JVUA 2NU7A 4EJSA 1T36A 5ECGC 1Z16A 4B6EA 2FKAA 4ZGBA 2HI0A 5DDIP 1YZVA 5DSTA 4PC2A 2BFAA 1TTQB 3QHQA 2Y77A 3CRQA 5EE0A 3I23A 4G86A 2AOTA 4OG2A 2VAWA 3GDOA 2B4QA 1RM5A 3FYSA 1EX1A 3QG5A 1MCZA 1DFIA 5BR8B 2BFEB 1DP4A 1Q12A 2RGBA 1TZ2A 2XSZD 3MGAA 1U5BB 3LBAA 1CUGA 2Q3EA 1JFVA 1XZHA 4AICA 4UOEA 1CIPA 1PJ3A 4X5OA 4EGSA 1K6MA 1GITA 2P2SA 2AG6A 3BFJA 3NUZA 4XRGA 3F5QA 4E1BA 1R7RA 1W2HA 1D8TA 4XKJA 1V45E 2ZUWA 4OA8A 3QX9A 1NMXA 4DCGA 5CH8A 3RJMA 1K86A 3N2LA 4YTEA 6GPBA 5CFOA 4Q37A 4RPHA 1QKIA 1TK2A 1XCLA 4N6GA 4OJKA 1HL3A 2SECE 1QK4A 2XA9A 3A11A 5AM0A 1G6HA 4PHCA 3H3XA 1PJRA 1NUHA 3TINA 5TMEA 3OU7A 4P1ZA 5FQOA 4EGAA 4BQRA 1UWCA 2LGJA 621PA 4GRIA 1I30A 4IBOA 2Z6VA 5LP1A 4G25A 2WKQA 2FZ5A 3UJCA 3WQQA 2X4GA 5DNVA 2Z8YM 3ZV5A 4DQUA 1JI3A 2P79A 4YHHB 1N8NA 2VOEA 2XBUA 2XYHA 4WW0A 2FPIB 5CNIA 3W8DA 2FEXA 4JENA 2A5JA 1UQTA 1BW9B 3HU1A 2BM0A 3R3WA 2CDRA 4LOHA 3LRTA 5CB4B 1VLJA 1Y3BE 3I58A 5IEJA 3D3JA 5TNXA 1G8SA 2UZ4A 4CEIA 1R8JA 3AEQB 4J1QA 2J67A 3DEAA 2AWNA 3OETA 1EP9A 3O8DA 4WESB 4B3GA 1GG2A 4Z4EA 3EWIA 3C4JA 3KVRA 5J1SB 3O8OA 2FWNA 3U4QA 4FBLA 3TB4A 2ZWVA 3VR4H 1OXMA 2VJNA 4FD3A 5TV2A 1QTRA 3QKRB 1PGJA 2NU8B 1OLXB 1R50A 3V4ZA 5GJCA 4ZHSA 2F8TA 1FBTA 2X2PA 4J0DA 1XZQA 3NONA 1KZ1A 3N2KA 4L22A 3NBXX 4NU6A 4PBRA 5SICE 4D9MA 4C0JA 5BR7A 4H15A 2XUQA 4QPPA 2CHGA 4P5DA 5LDDC 5AJZA 2IWHA 3PITA 3HVJA 2Y71A 4RMHA 3FKSD 4YCJA 2X1VA 2ZU0C 4BEVA 1G4AE 2FPMA 4ZJZA 1IH8A 2V7PA 1F6BA 1N5IA 2Z1NA 4RL6A 4JBNA 3D4OA 2ZCJA 1LSOA 3KR2A 1GXSB 2ZYTX 1EXNA 5JCOA 5J4HA 3B7PA 3I5MA 1BCRB 3IKMB 3BE5A 2L19A 3EG9A 3FTDA 2JGDA 4WSOA 3EXG2 3IAAA 1POWA 4Z86A 3RRJA 3VOAA 4HAYA 4D4LA 1ZGZA 3FOAA 5F3RA 3HA2A 4KCGA 4M54A 5H8WA 1R4AA 4NOMA 2XITA 1R0WA 4PTZA 4BQEA 1O6FA 4GSYA 1XV5A 5ALPA 4J7CA 1WVIA 1ZHHA 4A26A 2GM4A 5BSFA 1HE4A 4US0R 4WOJA 5LQUA 1H4SA 4K9NA 1QZTA 4GMXA 4B47A 4OF4A 5JECA 2QX4A 5CNKA 2B8NA 3I5XA 3TZQA 4JHLA 4V02A 2D1QA 1OI4A 3W7VA 4R2LA 1EFRA 4U2BA 1OVGA 4N40A 1X77A 1NIPA 2EWMA 3DQPA 4G37A 5HS4A 3ZHUA 1FYXA 4I5IA 1N3YA 2J0EA 1IN6A 2FW8A 2VUHB 1N9ZA 1O6BA 1LQUA 3FCCA 4KXWA 4CT0A 5JS6A 5BUZA 1P29A 2GKOA 5AD1A 1D1PA 1XTRA 1NHGA 1KPIA 4O2BA 2QGFA 2QXTA 5L9AA 1BDHA 4QT4A 1XALA 4WNIA 4IJWA 2OMEA 3DF7A 5LDGA 1P4HA 5ES4B 4DNQA 1Z0IA 2BKVA 3W2EA 2H0RA 3EOZA 1LPMA 2GYUA 2IYVA 4IMPA 3HY4A 4XPIB 1VG8A 2A0YA 2H08A 4R84A 3ZHBA 4B34A 1T2NA 4F4CA 4Q0MA 4YK7A 3EAFA 3ID6C 4WZBA 4PG8A 3WKEA 3EYAA 1JKXA 2ZYIA 2VUTA 1FXUA 4IJQA 2Y1CA 2H8GA 2IHYA 4NK4A 4MDEA 5DCUA 2EBHX 1CLUA 1GVHA 2FEMA 5C7IO 2QM3A 4ZEMA 1XGKA 2JIZA 2G5PA 2WVGA 2CE2X 1ML4A 1WBJB 3ZYCA 4CLRA 3DLAA 1ELOA 1DAMA 3LCCA 3TGWA 1BVYF 1CUHA 1WU7A 1YBMA 1S2DA 3GJ8A 3SC4A 1EBFA 3KPJA 3U37A 1G5IA 4ZOLF 5FV7A 2EX4A 2IXAA 4ZDKA 5B4TA 2IY9A 3IAFA 2I3DA 1Q0RA 5EIBD 2B7CA 4DLBA 1WCXA 1XZLA 1CFJA 1KVTA 2MOKA 4UM9D 2HB6A 4FFSA 5BW6B 4A7PA 5E9WA 1UKVY 1QX3A 5TMDA 3OQNA 1QE3A 1ZK0A 3M3HA 3PR1A 2AN1A 2HBQA 3NRJA 5CJPA 3UCEA 4CL0A 5JCXA 1JJBA 1RHUA 1T6YA 3Q7PA 3S40A 2IH4A 1LK0A 1EG2A 4R81A 4TQAA 3ADDA 4QUKA 2IODA 3D0OA 3DOJA 4Z53A 1R9GA 2EP5A 3G8BA 1X0VA 2O7RA 1N5RA