4F49A

2.25a resolution structure of transmissible gastroenteritis virus protease containing a covalently bound dipeptidyl inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
300
structure length
300
Chain Sequence
HSGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Broad-Spectrum Antivirals against 3C or 3C-Like Proteases of Picornaviruses, Noroviruses, and Coronaviruses.
pubmed doi rcsb
source organism Porcine transmissible gastroenteritis coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 83
structure length 300
sequence length 300
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4f49A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4f49A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4f49A01
3FAOA 2G8TA 3LGIA 1V6DA 3T62A 4FUIA 2BD3A 1SHYA 5DPAA 1JBUH 3IG6B 4B74A 2GGVB 3K6YA 2ANWA 2CJIA 1G9IE 1UCYH 3M61U 1QBOA 1FXYA 2C8XB 2EC9H 1CHOF 4LXBH 2H5DA 1QNJA 2FS9A 4JZFH 4O9VA 1UCYE 4RN6A 3PMHB 2AFQB 1E0FD 1GGDC 1GG6C 1XUHA 3URDA 3BTDE 1TBZH 4O03A 4XE4A 1QIXB 3MNXA 3SQHE 1Z6EA 1DXPA 2I6QA 1EZUC 3RXIA 5IYTA 5FPSA 5EW2H 5JB8S 6CHAB 1EZXC 1C2LA 1ZR0A 2TPIZ 3KGPA 4B76A 4ZAEA 1AUJA 1BRBE 1C5SA 1ZMJA 5GCHF 4AG1A 2OBOA 3DD2H 4I8GA 4RSPA 1YPJH 2QN5T 2BDHA 4AOQA 4ASHA 4CR9A 1PPEE 4DVAU 1O3KA 1O3MA 2VWNA 3VXFH 2ZCLP 4I8JA 3QGNB 2ANYA 1E34B 2FOBA 5EPYA 4JZEH 7ESTE 2F91A 3MNSA 1UK2A 2ZNKH 4ISNA 3ZZ9A 1TGNA 1QQUA 2BXUH 3LDXH 3M7UA 2D8WA 4MLFB 1CO7E 3RP2A 1CT4E 1LO6A 1U6QA 3OY6U 3EAJA 5HM2A 4X0WU 4GPGA 1FI8A 4I32A 4B71A 1L4ZA 1GMDG 1HFDA 2A4GA 2Y6TA 2ZHEH 3W94A 1G3CA 3AAUA 1QJ6B 5DGJA 1PPCE 1OKXA 2Z3DA 1K22H 3NZIA 1V2VT 1S6FA 2XRCA 3S69A 1QL7A 4UFDH 4THNH 2P95A 3LONA 2BDIA 1GI1A 3I77A 4WF8A 4UD9H 1HV7A 1Z6JH 1YPGH 2P3FH 5EOKA 1BMMH 2ZI2H 4K5ZA 1BA8B 2ZCHP 1RIWC 2CHAB 1SLUB 3BSQA 1O3FA 4X6NA 3LGVA 5IDKA 4ZMAH 3I29A 4XSKU 1SOZA 3RMOH 3MU5A 1O2IA 4WMEA 1GBTA 3FZZA 1JXPA 1HAYB 3U8OH 1NRNH 3VB4A 2DUCA 2JH6D 4HZHA 4CRAA 1O2YA 3OY5U 2NU4E 2ZU2A 3SJ8A 4BTUB 3RLYH 4E7RG 2FI4E 3TH3H 2QY0B 4IMZA 3RXGA 4BAQB 5F8ZA 2XC0A 3CENA 5L30H 3SUFA 3Q77A 1FIZA 1OWDA 4Z0KA 4X2YA 5TCAA 4Q7XA 4RKJB 5AHGH 1C1QA 3MU1A 3LU9B 2ZEBA 1YBWA 5E0GA 2QF3A 2ZDKA 4KGAA 1HXEH 2EI8A 3RM2H 3SJKA 2EEKA 2VH0A 3PTNA 3KIDU 3HK3B 1UVSH 2BY8X 1P0SH 2NU1E 3U1IB 3VXEH 5C2ZA 2VVUA 1GJ8B 1J15A 2FO9A 4Y10E 3SHCH 3WY8A 1AQ7A 2GZ7A 2VU8E 2ZDAH 4BXWA 1WYKA 2STBE 3BG8A 4U01A 3W95A 1AHTH 1JOUB 4MNYA 5FBIA 1W14U 1CA8B 5DP9A 6CHAC 4ABJA 3RXEA 3UWIA 3TPIZ 4F49A 1C2JA 4LOYH 1N1LA 2GP9B 1QB1A 1UMAH 3A8CA 1H9HE 2B9LA 2VWOA 1GJBB 5F8TA 2I6SA 4MVNA 3LH3A 1UO6A 2ILNA 1TNIA 1ZHPA 3A88A 1O3AA 5F8XA 1G3DA 4ZXXH 5ESTE 1K1MA 1TRMA 1P3CA 4IW4E 4X8UH 1WOFA 2BDBA 3PLBA 2GKVE 3SU6A 2FS8A 1JIMA 4NIYA 2OC8A 1THRH 2R3YA 1ABIH 3ZZ3A 4TYDA 1GBJA 2ZCKP 3MO3A 4UDWH 1C2FA 1D9IA 1O2VA 2Q6GA 1KY9A 1TGSZ 2OTVA 2J4IA 2P3UB 1C2GA 1WU1A 2G81E 2J38A 1EP5A 3BTWE 1O5FH 5FBEA 1DXWA 1TOCB 3UREA 4K69A 2FXRA 1SGQE 1EP6A 1NRRH 1W11U 1LPKB 1YPMH 5DP4A 1RTFB 2A1DB 2J95A 3MI4A 3K2UA 3JZ1B 1SVPA 3RU4E 2P16A 1TRYA 3GY5A 2OQUA 1AWHB 2RG3A 3A7ZA 3BIUH 3KQBA 3D62A 4UFGH 3ZVGA 1EJNA 1XKAC 5TJXA 1OWHA 5EXNA 6LPRA 1X7AC 4GAWA 2PTNA 3G01A 4CR5A 1HRTH 2W3KA 3MH4A 3UOPA 1AMHA 3EE0B 3ZYDA 1EAXA 2CHAC 1GI3A 2OC0A 3GYLB 5JBBS 5EQSA 4Y8YA 2OP9A 1MCTA 3HKJB 8GCHF 2PKSB 1XUKA 1S0RA 1ID5H 2C8WB 3E0PB 3OYPA 1TPAE 3M35A 1ARCA 2XBXA 4NFFA 1MKWK 1A3BH 2FZZA 2R0LA 4DY7B 3T5FH 3A86A 3ZZBA 4TWWA 1O5DH 1P03A 1HAOH 3K65B 5FX6A 2PV9B 1ELGA 2ZHFH 3PM3A 2G00A 1DLKB 3VEQB 2FP7B 5DJ7A 1OWEA 1ZGIA 1C2HA 3LKWA 1ANBA 1CHGA 4OGXA 4CH2B 2VB0A 3E16B 1A0LA 4TPYA 1QQ4A 1O2ZA 1DS2E 1GMCF 4BTTB 1EOLA 1N8OC 3ZYEA 2G52A 2AIQA 1G32B 1NO9H 2ZPRA 1TGBA 3NUMA 4X1QU 2UUJB 5L2YH 3TGIE 2OC1A 3A7YA 2W7UA 1GI0A 4GCHF 2BDCA 4K1SA 3M36A 3KN2A 4YOIA 2OLGA 1J17T 1YPKH 2G51A 2XBYA 2P94A 5SGAE 2VGCB 2BLOA 1G3BA 1P06A 1K28D 5FX5A 3DHKH 2QIQA 1GBLA 1GJAB 4A1TA 3EA7A 1ZRBA 2ODPA 1GBKA 3MHWU 2ZDMA 4XFQA 1D3TB 1Y59T 3RMMH 5A0AE 2W26A 3GISB 4X2VA 1TYNA 1YPHC 3BTFE 1UCYK 2H2ZA 2A5KA 2PKAB 4WMDA 2JH0D 1L0ZA 1P3EA 2G4TA 4DOQA 5A8XA 1SLVB 3NK8A 1MTWA 4X8TH 2EA3A 1IQJA 1SB1H 2PSYA 1VCWA 1YKTA 1SGFG 1P11E 1GWAA 1TGCA 1E36B 1D3QB 2FOEA 3RXUA 3HKIB 3UY9A 3S9AA 3B9FH 2FX6A 4CRCA 3GY6A 3ENSB 2Y80A 2BDGA 1P2IA 3A7TA 2ZU3A 2O8WA 7KMEH 1WBGB 3SU2A 1MQ6A 2ANKH 2RA0A 3A89A 1C2EA 4R8TB 1ZHRA 3KCGH 3KL6A 3RXDA 8KME2 1QA0A 1V2RT 1K1IA 2BQWB 3QK1A 1HNEE 1TB6H 2IPHA 1D4PB 2GTBA 4FUGA 1B0FA 4YT6H 2BOKA 1O3NA 1TX6A 2C4FH 2QYIA 3F9EA 1RXPA 2SGFE 4ZH8A 5E8EH 3RXHA 1OX1A 1BMNH 4E7NA 4BAMB 1SQOA 2O8UA 1GHWH 1QTFA 1P01A 3RXVA 4O3TA 4X6OA 3UQOA 3CP7A 3ODDA 3O8DA 1YPEH 1NC6A 2QC2A 1IOEA 2Z94A 1G3EA 1O2KA 3PV4A 5AFZH 3BEIB 1YCPM 2ZDNA 2CV3A 2ZTYA 2PKSC 1FPHH 2HGTH 2A2QH 2XNIA 3TK9A 2PGQB 5HGGA 4BOHA 1EX3A 2FIRH 1GBCA 3ITIA 4IN2A 4AB8A 1LHFH 3A84A 3ZV8A 2VJ1A 2BDYA 1TFXA 1HAIH 2F9UA 3SU4A 1ZLRA 3URCA 2G5VA 3GYMA 4O97A 4DW2U 1H8IH 1BDAA 1RRKA 3IITA 4JK6A 1AE8H 2ZQ2A 1B7XB 1ELEE 1O3IA 3AASA 3KQEA 5AVDA 4NIVA 1VR1H 3GICB 4IMQA 3ZZ5A 3QGJA 4ESTE 1IQEA 2NWNA 5BPEA 4CHAB 1BIOA 1LCYA 1ZTLA 1SOTA 3QX5H 1QFKH 2ZGXH 2DE9A 1BTWA 2RDLA 3RXBA 3RC4A 1H8DH 4H6TA 5FXLA 4VGCB 1AE5A 3QDZB 1AWFH 2Z9KA 1UTMA 1FLEE 3GCTG 1LKBA 1ANEA 5L6NH 1GHAF 3QTOH 1INCA 5AF9H 1D3PB 4NSVA 3STIA 1PPZA 4FUHA 1GVLA 3S7HB 3P8GA 3SGBE 2H6MA 3M5MA 2C8ZB 3KNXA 1TRNA 2VGCC 3OSYA 2XC5A 2Y5FA 2B5TB 3RDZA 3TVJB 3B23B 2Y81A 2TIOA 1W3CA 3RXSA 1AVGH 5GDSH 5EQQA 5K7RA 4WXVA 3ZVBA 4BAOB 1EASA 2AH4X 2AMPA 5GWZA 3SNEA 6GCHG 1VJAU 2HWLB 2BVRH 2P3TB 1O2TA 3RU4D 1KSNA 4Y0ZE 2Z9JA 1KXFA 1NTPA 4ZHMU 1O2OA 5G4BA 4MPUA 1W13U 1Y3YA 1Z8RA 1C1MA 1SL3A 2V35A 1G30B 1VZQH 1UHBB 2FOFA 4ABHA 4YO9A 1GJ7B 3P17H 3GCHB 3LH1A 1KIGH 3SN8A 1O34A 3LGYA 3S9BA 5AFYH 4D7FA 1IQKA 2J34A 1W7GH 1O3OA 4Y71A 2OQ5A 4JYUH 3TU7H 2BZ6H 1VITH 1O3BA 2BQ7B 4AZ2B 1ACBE 1C1VH 1J9CH 1EB1H 3U69H 3SV6A 2BB4A 5GJ4B 1NY22 1AUTC 3SV7A 4OS4A 1JMOH 2GCHF 1ANCA 1O30A 3M5OA 2ZFTA 1K1PA 4H4FA 2ZO3H 2HVXA 3SU3A 3LOXA 2CF9H 1C5ZB 2SGPE 1HIAB 1CU1A 4UFFH 3SI4H 2D26C 1DWDH 1EKBB 4AX9H 1LKAA 2ZWLH 1GI2A 3SV2H 2NU0E 3L3TA 1DY9A 3MO6A 1MQ5A 1OYQA 1XKBC 3A8DA 2ASUB 2ZIQH 1SGYE 4NWLA 3NXPA 1TA2A 4WVPE 1O3HA 2FYRA 1J14A 1WUNH 4I7YH 1XUIA 4XDEA 4NIXA 4J1YA 1W7XH 4CBOA 1MTUA 2FTLE 1Z8JB 1KTSB 1O2GH 1B5GH 3PO1B 1WQVH 2XBVA 1C1OA 1AD8H 3TGJE 1GHYH 1BHXF 2AMQA 3A7WA 4I31A 2ZU1A 4JCNA 3GY4A 1ZYOA 5LH8A 2ALVA 1A5HA 1EB2A 1V2UT 3VB3A 4CHAC 2RA3A 2XW9A 1N6YA 1CBWB 2TGDA 3CS7A 2ZPSA 3E8LA 3A85A 3UOUA 3GCNA 4Y7BA 1FY1A 2Y7XA 2ZGBH 1NRQH 4VGCC 1G36A 1OP2A 3P8NA 2BLVA 4FUDA 4FUCA 4X1NU 4BANB 2THFB 1LHGH 4NGAH 1GI8B 3M7TA 1E38B 1VITG 3KHVA 4K2YA 1O2MA 1RTLA 2A5AA 2BY7X 1C1NA 4B75A 2V6NA 2A2XH 2Q6FA 4X1SU 4E06H 4B2AA 1ELVA 2ZHWH 2ZHDA 2F9VA 2HPQH 2IN2A 3LGTA 1K21H 5E2PA 4YT7H 3LGUA 5DP8A 5C5NA 4MNVA 4YM9A 3D23A 5C5OA 1EZQA 3D65E 2O9QA 2BD7A 2ODQA 2FOAA 1AKSB 3C1KA 2FLRH 4M7GA 5FAHA 2H1UA 3EBNA 1BTYA 1PPFE 1MZAA 5T6DA 2BD5A 1SLWB 4HTCH 4U2WA 4WXIA 2F9NA 1BMLA 3TH4H 1QB6A 4KTUA 5T3HA 4OS2A 1AU8A 1ZSJA 1FDPA 1THSH 1TLDA 1DWEH 1NS3A 4Z6AH 2H9TH 1RGQA 1KDQA 3P6ZB 1GHBF 2K1QA 4R0IA 4X6PA 2ZGHA 2P93A 1LPGB 2VWLA 3SO3A 2BQ6B 4TY6A 1O2XA 1TBQH 3GCHC 2GV6A 3SNAA 3UNQA 1A5IA 3ATIA 1KDQB 1S81A 1ANDA 1GBHA 5EU8A 1C5PA 2C3SA 1QY6A 1YCPH 1SGFA 1IQFA 2Z6BD 1MUEB 1FY3A 1NFWA 1O3EA 4I8KA 5J4SA 4ZROA 1P2MA 1ETTH 2G5NA 2OUAA 3KQDA 7LPRA 2PGBB 1EAUA 3HGPA 2GX4A 3A81A 1C5NH 5GIBA 4F4OC 2UUKB 4PROA 4IBLH 3P8FA 2VIQA 3UTUH 2HLCA 1BZXE 1C5MD 4NIWA 1A61H 2FEQH 2ZF0H 2BD4A 1DWCH 2AGGX 5GXPA 2Z7FE 1KXEA 4NA8A 4B2BA 1W2KH 1EXFA 2SGQE 1IQHA 1DLEA 3AAVA 4WY3A 3UWJH 1FY8E 3SNCA 2F83A 3L33A 1G2LA 1EPTA 3KF2A 1C5OH 3E90B 1FN8A 4YLUA 2QV1A 3GY7A 3TJUA 2HALA 3SOSA 4ISOA 1C5TA 3M37A 1C5XB 4H6SB 1BCUH 1UTKA 3DT0H 1W8BH 1HAGE 3GY2A 3O8CA 3RXTA 1SGNE 3STJA 1EPTB 1O3GA 3PO1C 1OSSA 1AFQB 3U1JB 2VVCA 1QGFA 1OP8A 2CN0H 3PLPA 1BRAA 2XC4A 1F5RA 1P2OA 3P95A 2W5EA 4ABFA 4DURA 5A8YA 4A6LA 1GI6A 2UWOA 2H5CA 2PFEA 1H1BA 1BJVA 5BRRE 3RMNH 3ZZ7A 1Q3XA 1RTKA 1LVYA 1CBWC 1MKXH 1MTNB 5DG6A 4YTAA 4NA7A 4BAKB 1KTTB 2PW8H 1AO5A 4DJZB 3RXRA 2LNCA 1ZTJA 1CA0B 3BTQE 1GDNA 3AVZA 2HRVA 5GCHG 4A92A 1HJAB 1Z1IA 1CGIE 1HAHH 3ZV9A 5FPTA 3SV9A 1O5AB 3RXCA 3EGKH 1C1PA 4MTBA 4KP0A 2C8YB 2ZDLA 2O8TA 3SQEE 4JMYA 1CVWH 1GCTB 2UUYA 2LPRA 2VIOA 3SJIA 1PPHE 3LIWA 3Q76A 3RXJA 2W3IA 3V12A 1QR3E 1UVPA 2ZU4A 2V3HH 1O3CA 2BX3A 4DT7B 4LZ4B 1UVOA 1AY6H 1PYTD 3BTME 2D1JA 1O5EH 1XMNB 1Z1JA 4KTCA 3QWCH 4AFUA 5JYIA 1O31A 5A8ZA 4D8NA 2ANMH 1FUJA 4AFZA 2HNTC 1GHZA 1HJ9A 1O38A 4NZQA 3T25A 3FP6E 2TRMA 1XXFA 1LMWB 3ZVFA 4AGJA 1UJ1A 4ABBA 2WINI 1SFIA 1YM0A 1SLXB 4UFEH 4CBNA 1Y3XA 2QXJA 1O0DH 1FONA 1JRSA 4HFPB 2V0BA 4KTSA 2WYJA 4FUJA 2SGAA 3A82A 3K6ZA 1H9IE 3MFJA 5I25A 1SMFE 2R0KA 1AZZA 3SW2B 2FOGA 4ZUHA 4X1PU 4TWYA 5CE1A 3BV9B 1Y5UT 1GVZA 1P09A 2J94A 1MBMA 4A5TS 2FX4A 4ZHLU 2GT7A 2PR3A 1ELDE 4GUXA 4DGJA 4Y6DA 1MU6B 1CGHA 1MMJN 3BF6H 3RXAA 4JYVH 3P8OA 4OS1A 1AZ8A 2BXTH 9ESTA 2FMJA 1GL0E 4YOJA 1DSUA 3UQVA 4NG9H 4Y7AA 3MH5A 1ARBA 1O2SA 4J2YB 1QBNA 1O32A 1BT7A 4DIHH 1HAVA 1LHDH 1UTQA 3ATMA 1O2PA 2QXGA 4AG2A 1DICA 4Y76A 1BTPA 3MYWA 1IQLA 5CHAB 3TJVA 2P8OB 3Q00A 3S7KB 2PKAA 3TK5A 3T26A 1C9TA 3GDSA 1HAVB 1C5WB 2OCVB 1EPTC 1TBRH 1TAWA 3T29A 3UNSA 1AFQC 2F3CE 1V2LT 3GCOA 1YPHE 3E0NB 1LDTT 6GCHF 1C5LH 2AGEX 2ZQ1A 1ZMNA 1ZGVA 1UK4A 1H4WA 2QF0A 2QAAA 3T27A 1DUAA 2D2DA 1NN6A 3RC6A 1MTNC 4NZLA 1GBBA 3B8JA 3ODFA 1GHVH 3OTJE 1D6RA 5C1YA 1F7ZA 1KLTA 2AYWA 1CA0C 2BY5X 3SGQE 1SGCA 3ZZCA 3O8RA 1BRUP 2GMTB 2NU2E 1HJAC 3Q3KA 1IQNA 2VIVA 1PPGE 1J16A 1K1JA 1S82A 1Z71A 3ZVCA 3GOVB 1LTOA 3SGAE 3QO6A 5A2MH 1GCTC 1O2QA 1TMTH 1GBAA 1GL1A 3F9HA 4Y8XA 4CRFA 1AVXA 3PWCA 1NRSH 2WPJS 1AN1E 5PTPA 1F92A 1SG8B 4FUFA 1GBDA 3ZVDA 4AGKA 1EAIA 4K8YA 1MAXA 1F2SE 1IQGA 1T8OA 2BD9A 2JETB 4MPVA 3SZNA 1UTOA 4WH6A 3A8AA 2J92A 1C5VA 1UTPA 5E0HA 1GBIA 3KEEA 1QRXA 2VNTA 1HAXB 1N6XA 1W0YH 3ATWA 1WTGH 3MH6A 2UWLA 1MTVA 1T8LA 4ABEA 3M5LA 2WPLS 3FP7E 4ZKRU 3K9XB 4ZXYH 4XBCA 1GJ6A 1RFNA 1C5RA 1GCDA 1GJ9B 1KXDA 1XVOA 5T6FA 1T8MA 4K3JA 2BYAX 1OS8A 1C2MA 3QN7A 1EOJA 5F03A 1LVOA 1UVUH 3ZZ8A 3FVFB 1GJ5H 4JK5A 5C1UA 1QB9A 1A2CH 4D9RA 4OS7A 3E91A 2ZZUH 1FY5A 3SBKA 4WMFA 4KKDA 1Y3VA 3UIRA 4X8VH 1P05A 3L6PA 4NFEA 2FWWA 3VPKA 1NRPH 2ZGJA 1FMGA 1MD7A 1BTXA 1QCPA 1BBRH 1QRZA 3OU0A 4FVDA 3BN9A 3GDUA 1OPHB 3N7OA 1C4Y2 2XCNA 3FFGA 3U98H 1CQQA 1IAUA 3GDVA 1BTZA 1BQYA 2EI6A 4X6MA 5EGMA 4K1EA 2ZFFH 1BBRE 2YNAA 1QJ1B 2A32A 3ATKA 2VWMA 4YESB 2NU3E 2GZ9A 1GMDF 5CHAC 2P8OC 2RCEA 3EA8A 5LPFA 2PUXB 1ZHMA 3F9FA 1SGTA 4MG3A 1SGIB 3TJNA 5L2ZH 1XUFA 1GJ4H 1FIWA 1A1RA 2ULLA 1HDTH 1UHBA 1C4V2 1GJDB 1A7SA 3UUZA 3ELAH 2FDAA 2ZHQH 1RD3B 1OP0A 1JIRA 2JKHA 1IQMA 1NFXA 4NWKA 1WTHD 1QA7A 1ZRKA 3FANA 2FM2A 2GMTC 1O3DA 2UUFB 1Z8IB 1MU8B 1C2IA 1ZPBA 1T4UH 3GY8A 4XBBA 1SGEE 2UWPA 4AORA 2SGEE 1DDJA 1S0QA 1O2NA 1A4WH 1ZPCA 2GDDA 3SV8A 3VGCB 6ESTA 2BLWA 1MKXK 1BTHH 2VVVA 2A0QB 2WPMS 2B8OH 4ABGA 1HIAA 2ZECA 4NA9H 4OS5A 2ZA5A 3QTVH 3UNRA 1Z7KA 4UE7H 1BOQA 4JYTA 1WQSA 2ALPA 3O8BA 4H42U 2JETC 2Y82A 5I46H 1C9PA 1F5KU 2W7SA 3BTHE 3GY3A 3LJJA 1F0UA 4GHTA 4IC5A 4NCYA 3ZZDA 3TITA 1XXDA 3M3SA 2ZC9H 5JB9S 1TOMH 1NESE 1S85A 1D3DB 3RXOA 1BITA 3QLPH 3D49H 3SU1A 1QJ7B 2ZGCA 3RU4T 1LQEA 3ATLA 1C1WH 4HGCA 4B73A 1ELBA 1YYY1 4Y0YE 1YLCA 2AGIX 1O2JA 1MH0A 1BMAA 5A0BA 3UPEA 1DVAH 3TLOA 1A46H 1DUEA 3S0NA 3M3VA 5B6OA 3PB1E 2WUBA 4UEHH 1ZMLA 2YOLA 3E6PH 4BNRA 5CMXH 2HOBA 4ABDA 2ZG0H 1C1TA 2A45B 1AIXH 1O5BB 1S5SA 4HI3A 1DX5M 1BJUA 2A7CA 1UTNA 1V2NT 3I78A 1V2TT 3MOCA 1GJCB 1GPZA 1P2QA 1HXFH 2AERH 2FESH 3SU0A 1SGPE 4KELA 3PMJA 1HCGA 5A09A 5ESBA 5JBCS 1A0JA 3FZDA 4B1TA 3F68H 1O37A 1LQDB 4BAHB 5EW1H 3A87A 4CRDA 4Q7ZA 1QHRB 3RXQA 2F9OA 9LPRA 1ESBA 1SGRE 3SUGA 1TMUH 2OXSA 5F6MA 3NPSA 1F0TA 4YLQH 4IGDA 4TPIZ 4AB9A 1QBVH 3BTTE 1Q2WA 1AKSA 1S84A 3PMAB 3ZZAA 3PROA 2BHGA 5C3NA 4FUBA 3DA9B 3IWMA 2J9NA 1OWIA 5LPEA 1GHAG 1O3JA 1BTUA 8LPRA 3SI3H 3DFJA 2FOMB 1QRWA 1L1GA 4D76A 1FV9A 1YLDA 3F1SB 2VIWA 7GCHG 1GBEA 1KXAA 4DIIH 1ZPZA 4A1VA 1L4DA 1DPOA 1W10U 1IHTH 1O2UA 3RXFA 2FOCA 1CSOE 3DFLA 4MNWA 2BOHB 1O2HA 3A7VA 1P9UA 3QZRA 1THPB 2Y5GA 1KYNA 1TWXB 1GMHG 3Q3YA 1W12U 2OINA 3M3TA 1ELCA 3MO9A 1HJ8A 3F9GA 1NZQH 3RXMA 2QCYA 1MBQA 1DE7H 3SUDA 2ZKSA 3ESTA 2C90B 4Q7YA 2OC7A 3BG4B 2VINA 2GD4B 2WPHS 3BTEE 3V13A 2ZTZA 4OS6A 4ISHH 1PPBH 1P2NA 2GV7A 1Y5BT 1DSTA 2BLQA 3VGCC 2AMDA 3TNSA 1H9LB 2PTCE 4FVBA 3QUMP 3EQ0H 1FZZA 1DITH 1DT2A 1EQ9A 4CRGA 2LIZA 1PQ8A 4MPWA 1FJSA 2BZAA 5T6GA 5EODA 2XWAA 1TQ7B 4Y79A 3HGNA 4ABAA 2R2MB 4OGYA 1NU9A 3LPRA 3A7XA 1FNIA 1HPGA 2A7JA 5A0CA 2HNTF 3MH7A 2Z9IA 3U8TH 1HGTH 3E3TA 1AB9B 3SHAH 1CT2E 1N8OB 3P92A 1D6WA 4FXGH 4INHA 1C5QA 4BXSA 4GHQA 2GCHG 1NROH 1XUGA 5HYOA 2WPIS 2GCTB 3R0FA 1FAKH 1CHOG 1TNHA 1WV7H 3LC5A 5FPYA 1V3XA 4FU7A 1GBMA 2BVXH 3EYDA 1G37A 3MWIU 3LT3A 1F0SA 1S6HA 1O3PB 2DE8A 4SGAE 4I8LA 2O8MA 5FCKA 4YOGA 1OWJA 1B0EA 1ABJH 5DP7A 1EATA 2G55A 1V2OT 5LPRA 1FY4A 1O2LA 4X2XA 2AS9A 2OBQA 4ISLA 1HB0B 1KXBA 1Q31A 5C1XA 3TK6A 4JZIA 2PHBA 5TCCA 4U32A 1T7CA 1Y8TA 1TNLA 4I8HA 1TX7A 1C2KA 1A3EH 2SNWA 1E37B 4ABIA 2GVFA 1SFQB 3VB7A 1O33A 1QL9A 4IC6A 2TGPZ 1PQ7A 3MMGA 1WAYB 4NSYA 3SNDA 1ZJDA 1NPMA 1LHEH 2BDAA 3R3GB 1FAXA 1E35B 1O39A 4SGBE 1T8NA 1GI7B 1V2JT 2PSXA 1K1NA 1ZTKA 4A7IB 1TPSA 4AFQA 1TGTA 3EDXB 1BBRK 2O8LA 4ZHAA 5FCRA 1GDQA 2HNTE 1K1OA 1Y3WA 2G4UA 1SSXA 4WH8A 4X8SH 1ORFA 2VH6A 1VGCB 1M9UA 5HXFA 2PUQH 1VJ9U 3MU0A 3RM0H 1QL8A 1SGDE 2PWXA 1L2EA 1P2KA 3P70B 4GLYA 2AIPA 1UVTH 4INKA 3A83A 1ZJKA 4K60A 2YNBA 1S83A 1MCVA 2R9PA 2Y5HA 5DKMA 1KLIH 1L1NA 1FPCH 5JBAS 1MTSA 1VCQA 3UR9A 1C5YB 4MPXA 3BG4C 1C1RA 1PFXC 2BM2A 1GHBG 5HM9A 5DP3A 2A31A 3H7TA 4JZDH 1XVMA 1P57B 1WCZA 3NWUA 3QZQA 4GSOA 4ISIH 1NM6A 3TIUA 4MQAA 1K2I1 1WSSH 1P02A 1C4U2 1K1LA 1TMBH 1TNKA 2QXIA 4D9QA 2H9EH 4XOJA 1V2PT 1GI5A 1ZZZA 1BB0B 2WV5A 2BY6X 1K9OE 3T28A 4AYVB 1P9SA 2Q1JA 3GCTF 5JBTA 2SGDE 1PQAA 2ZTXA 1NU7B 1AB9C 1O5GH 4DG4A 1V2MT 3H7OA 2Z3EA 2BY9X 1ESTA 2STAE 4XBDA 1T4VH 3M5NA 1AVWA 1J8AA 2WV4A 4FU9A 1YPLH 1Y5AT 4RKOB 3HK6B 1SBWA 2GCTC 1JRTA 3RXKA 1P2JA 1TONA 3RC5A 2FYQA 3V0XA 1O36A 2F9BH 3VFEA 4I33A 2GT8A 5ETXA 3SJ9A 2B0FA 4D7GA 3RLWH 4Y11E 8ESTE 1TPPA 5DO4H 2Z9LA 5EXLA 1G2MA 3FP8E 3ZZ6A 1IQIA 3ZVAA 5DP6A 3A8BA 1AFEH 2XYAA 2K7XA 1BRCE 1GBFA 1ZOMA 3VB6A 3RXLA 2TBSA 1OXGA 1XUJA 4FUEA 3DUXH 2V3OH 1NT1A 1YP9A 2R2WU 4FU8A 2OD3B 1O2RA 5DK1A 2ZFQH 1V2ST 3SJOA 1DFPA 1IHSH 1HUTH 2ESTE 2BVSH 3UR6A 1ETSH 1TIOA 2A5IA 1TQ0B 4LK4A 1T32A 5J4QA 4E05H 3MNBA 4IS5A 1F5LA 1LPZB 1L1JA 1SR5C 2CXVA 1LVBA 3ZVEA 1RS0A 2FOHA 3ZZ4A 3M7QA 3BTGE 1ZSLA 1HAZB 5EPNA 2Z3CA 1HYLA 1EJAA 1TNGA 2ZFPH 2A4RA 2XBWA 3AW0A 4QT8C 5GPIB 1NFUA 3PTBA 4ZKSU 5E0JA 3V3MA 4AFSA 1VGCC 1O35A 4MDSA 4YZUA 3RUOA 1O2WA 2IOTA 1DWBH 2XXLA 3CS0A 3PMBB 1C2DA 4LZ1H 1RJXB 3LJOA 2R3UA 4BTIB 1EUFA 5JPMH 5EG4A 3TGKE 2Z9GA 4ZKOU 3LGWA 1SHHB 2F9PA 1EAWA 3PYHA 4X1RU 1V2KT 5EQRA 1ETRH 1ESAA 1DOJA 2FI3E 3RXPA 1A5GH 1SC8U 4MNXA 8GCHG 2IJOB 2BD8A 2J2UA 4AYYB 1FN6A 2Y7ZA 5C20A 4TY7A 1GGDB 1PQ5A 1P12E 1UK3A 1GG6B 1SPJA 4K1TA 5HMAA 3OX7U 3TNTA 1TE0A 4ZKNU 2EI7A 1ELFA 2XWBI 1HAPH 2BX4A 3V7TA 1T31A 1LHCH 1TABE 1YGCH 3SUEA 1SQTA 2HPPH 2VIDA 4X2WA 3Q3XA 4AN7A 3NCLA 2QA9E 4CRBA 3H5CB 5EXMA 3BEFB 2A7HA 1YF4A 1VITF 3MU4A 1AI8H 3HPTB 2PLXA 5FHTA 1C1SA 1YCPK 1ZSKA 1KXCA 4IN1A 1GMCG 5ABWA 1LVMA 2BTCE 2A4OA 5H4IB 1GDUA 4Y8ZA 3MNCA 2ZFSA 3AW1A 1SI5H 2C93B 1DY8A 2FODA 2SNVA 3BEUA 1JWTA 1HBTH 2WUCA 2AEIH 2ZU5A 1TPOA 1OWKA 1MZDA 2CMYA 2VIPA 4UONA 3EA9A 3C27B 1YC0A 4CREA 4GCHG 1HLTH 2QGRA 2ZFRH 2FI5E 1VCPA 1AGJA 3BTKE 3E1XB 3PLKA 1UTLM 4O3UA 7GCHF 4GVUA 1EJMA 1GVKB 2GDEH 1XM1A 1QURH 2TGTA 3BIVH 1FQ3A 1OOKB 1SQAA 1PJPA 2H9HA 4U30A 4B2CA 1MKWH 2M5TA 1V2WT 1GI9B 3MTYA 2ZDVH 5LGOA 2QXHA 2P59A 2XCFA 3HATH 1O5CB 1GMHF 3UFAA 3SU5A 1Y3UA 2SFAA 4WJG2 4WWYA 3SNBA 2FTMA 2FPZA 1MAYA 1P04A 2B7DH 4K8BA 1CT0E 1V2QT 2WYGA 1A0HB 4Q80A 2JH5D 5DP5A 1UTJA 4Q2KA 1F0RA 1DANH 4DCDA 5K0HA 1NFYA 1OYTH 1RIWB 1ELAA 2GZ8A 3F6UH 3JZ2B 3MU8A 1DM4B 1TA6A 1MD8A 3U8RH 3S9CA 3U9AH 2ODYB 2KAIA 1BUIA 2CF8H 5C67A 3RMLH 4JZ1A 1ELTA 1EZSC 1BHXB 2Q6DA 1C1UH 1Z8GA 1TX8A 1GI4A 2XTTB 3LC3A 3A80A 4INLA 1P10A 3PWBA 5E2OA 2KAIB 4CH8B 2CGAA 1CE5A 3TH2H 1CGJE 1XX9A 3NKKA 2A4QA 1PYTC 1TNJA 2WPKS 1GHXH 1TALA 3KQCA 1W0ZU 2BMGB 2TGAA 2FLBH 3VB5A 2ZP0H 3SORA 1KLJH 2BD2A 1C5UA 3T2NA 2ZPQA 1O3LA 5JDUB 1P8VC 4A1XA 3TJOA
chains in the Genus database with same CATH superfamily
3FAOA 2G8TA 3LGIA 1V6DA 3T62A 4FUIA 2BD3A 1SHYA 5DPAA 1JBUH 2M2AA 3IG6B 4B74A 2GGVB 1OHHD 3K6YA 5KGOA 2ANWA 2CJIA 2KCYA 1G9IE 1UCYH 3FKSD 3M61U 1QBOA 1FXYA 2C8XB 2EC9H 1CHOF 4LXBH 2H5DA 1QNJA 2FS9A 4JZFH 4O9VA 1UCYE 4RN6A 3PMHB 2AFQB 1E0FD 1GGDC 1GG6C 1XUHA 3URDA 3BTDE 1TBZH 4O03A 4XE4A 1QIXB 3MNXA 3SQHE 1Z6EA 1DXPA 2I6QA 1EZUC 3RXIA 5IYTA 5FPSA 5EW2H 5JB8S 6CHAB 1EZXC 1C2LA 1ZR0A 2TPIZ 3KGPA 4B76A 4ZAEA 1AUJA 1BRBE 1C5SA 1ZMJA 5GCHF 4AG1A 2OBOA 5HIYA 3DD2H 4I8GA 4RSPA 1YPJH 2QN5T 2BDHA 4AOQA 5C17A 4ASHA 4CR9A 1PPEE 4DVAU 1O3KA 1O3MA 2VWNA 3VXFH 5IK2D 2ZCLP 4I8JA 3QGNB 2ANYA 1E34B 3GS9A 2FOBA 5EPYA 4JZEH 7ESTE 2F91A 3MNSA 1UK2A 2ZNKH 4ISNA 3ZZ9A 1TGNA 1QQUA 2BXUH 3LDXH 3M7UA 2D8WA 4MLFB 1CO7E 3RP2A 1CT4E 1LO6A 1U6QA 3OY6U 3EAJA 5HM2A 4X0WU 4GPGA 3AK5A 1FI8A 4I32A 4B71A 1L4ZA 1GMDG 3SZEA 1HFDA 2A4GA 2Y6TA 2ZHEH 3W94A 1G3CA 3AAUA 1QJ6B 5DGJA 1PPCE 1OKXA 2EQNA 2Z3DA 1K22H 3NZIA 1V2VT 1S6FA 2XRCA 3S69A 1QL7A 4UFDH 4THNH 2P95A 3LONA 2BDIA 1GI1A 3I77A 4WF8A 4UD9H 4RI0A 1HV7A 1Z6JH 1YPGH 2P3FH 4P00A 5EOKA 1BMMH 2ZI2H 4K5ZA 1BA8B 2ZCHP 1RIWC 2CHAB 1SLUB 3SYJA 3BSQA 1O3FA 4X6NA 3LGVA 5IDKA 4ZMAH 3I29A 4XSKU 1SOZA 3RMOH 3MU5A 1O2IA 4WMEA 1GBTA 3FZZA 1JXPA 1HAYB 3U8OH 3FOAA 1NRNH 3VB4A 2DUCA 2JH6D 4HZHA 4CRAA 1O2YA 3OY5U 2NU4E 2ZU2A 3SJ8A 4BTUB 3RLYH 4E7RG 2FI4E 2J98A 3TH3H 2QY0B 4IMZA 3RXGA 4BAQB 5F8ZA 2XC0A 3CENA 5L30H 3SUFA 3Q77A 1FIZA 1OWDA 4Z0KA 4X2YA 2J98B 5TCAA 4Q7XA 4RKJB 5AHGH 1C1QA 3MU1A 3LU9B 2ZEBA 1YBWA 5E0GA 2QF3A 2ZDKA 4KGAA 1HXEH 2EI8A 3RM2H 3SJKA 2EEKA 2V7QD 2VH0A 3PTNA 3KIDU 3HK3B 1UVSH 2BY8X 1P0SH 2NU1E 3U1IB 3VXEH 5C2ZA 2VVUA 1GJ8B 1J15A 2FO9A 4Y10E 3SHCH 3WY8A 1AQ7A 2GZ7A 2VU8E 2ZDAH 4BXWA 1WYKA 2STBE 3BG8A 4U01A 3W95A 1AHTH 1JOUB 4MNYA 5FBIA 1W14U 2WZQA 1CA8B 5DP9A 6CHAC 4ABJA 3RXEA 3UWIA 3TPIZ 4F49A 1C2JA 4LOYH 1E1RD 1N1LA 2GP9B 1QB1A 1UMAH 3A8CA 1H9HE 2B9LA 2VWOA 1GJBB 5F8TA 3DSOA 2I6SA 4MVNA 3LH3A 1UO6A 2ILNA 1TNIA 1ZHPA 3A88A 1O3AA 5F8XA 1G3DA 2LELA 4ZXXH 5ESTE 1K1MA 1TRMA 1P3CA 4IW4E 4X8UH 1WOFA 2BDBA 3VG8A 3PLBA 2GKVE 3SU6A 2FS8A 1JIMA 4NIYA 2OC8A 1THRH 2R3YA 1ABIH 3ZZ3A 4TYDA 1GBJA 2ZCKP 3MO3A 4UDWH 1C2FA 1D9IA 1O2VA 2Q6GA 1KY9A 1TGSZ 2OTVA 2J4IA 2P3UB 1C2GA 1WU1A 2G81E 2J38A 3F0OA 1EP5A 3BTWE 1O5FH 5FBEA 1DXWA 1TOCB 3UREA 4K69A 2FXRA 1SGQE 1EP6A 1NRRH 1W11U 1LPKB 1WXRA 1YPMH 5DP4A 1RTFB 2A1DB 2J95A 3MI4A 3K2UA 3JZ1B 1SVPA 3RU4E 2P16A 1TRYA 3GY5A 2OQUA 1AWHB 2RG3A 3A7ZA 3BIUH 3KQBA 3D62A 4UFGH 3ZVGA 1EJNA 1XKAC 5TJXA 1OWHA 5EXNA 6LPRA 1X7AC 4GAWA 2PTNA 3G01A 4CR5A 1HRTH 1W0KD 2W3KA 3MH4A 3UOPA 1AMHA 2HLDD 3EE0B 3ZYDA 1EAXA 2CHAC 1GI3A 2OC0A 3GYLB 5JBBS 5EQSA 4Y8YA 2KCAA 2OP9A 1MCTA 3HKJB 8GCHF 2PKSB 1XUKA 1S0RA 1ID5H 2C8WB 3E0PB 3OYPA 1TPAE 3M35A 1ARCA 2XBXA 4NFFA 1MKWK 1A3BH 2FZZA 2R0LA 4DY7B 3T5FH 3A86A 3ZZBA 4TWWA 1O5DH 1P03A 1HAOH 3K65B 5FX6A 2PV9B 1ELGA 2ZHFH 3PM3A 2G00A 1DLKB 3VEQB 2FP7B 5DJ7A 1OWEA 1ZGIA 1C2HA 3LKWA 1ANBA 1CHGA 4OGXA 4CH2B 2VB0A 3E16B 1A0LA 4TPYA 1QQ4A 1O2ZA 1DS2E 1GMCF 4BTTB 1EOLA 1N8OC 3ZYEA 3WWFA 2G52A 2AIQA 1G32B 1NO9H 2ZPRA 1TGBA 3NUMA 4X1QU 2UUJB 5L2YH 3UB0A 2OC1A 3TGIE 3A7YA 2W7UA 1GI0A 4GCHF 2BDCA 4K1SA 3M36A 3KN2A 4YOIA 2OLGA 1J17T 1YPKH 2G51A 2XBYA 2P94A 5SGAE 2VGCB 2BLOA 4RT1A 1G3BA 1P06A 1K28D 5FX5A 5EJLA 3DHKH 2QIQA 1GBLA 1GJAB 4A1TA 3EA7A 1ZRBA 2ODPA 1GBKA 3MHWU 2ZDMA 4XFQA 1D3TB 1Y59T 3PRBA 3RMMH 5A0AE 2W26A 3GISB 4X2VA 4ZCNA 1TYNA 1YPHC 3BTFE 1UCYK 2H2ZA 2A5KA 2PKAB 4WMDA 2JH0D 1L0ZA 1P3EA 2G4TA 4ACAA 4DOQA 5A8XA 1SLVB 2JJ2D 4Q63A 3NK8A 1MTWA 4X8TH 2EA3A 1IQJA 1SB1H 2PSYA 1VCWA 1YKTA 3OTPA 3W1EA 1SGFG 1P11E 1GWAA 1TGCA 1E36B 1D3QB 2FOEA 3RXUA 3HKIB 3UY9A 3S9AA 3B9FH 2FX6A 4CRCA 2JJ1D 3GY6A 3ENSB 2Y80A 2BDGA 3MQKC 1P2IA 3A7TA 2ZU3A 1SQRA 2O8WA 7KMEH 1WBGB 3SU2A 1MQ6A 2ANKH 2RA0A 3A89A 1C2EA 4R8TB 1ZHRA 3KCGH 3KL6A 3RXDA 8KME2 1QA0A 1V2RT 1K1IA 2BQWB 3QK1A 1HNEE 1TB6H 2IPHA 1D4PB 2GTBA 4FUGA 1B0FA 4YT6H 2YMSB 2BOKA 2QE7D 1O3NA 1TX6A 2C4FH 2QYIA 3F9EA 1RXPA 2SGFE 4ZH8A 5E8EH 3RXHA 1OX1A 1BMNH 5FL7D 4BAMB 4E7NA 1SQOA 2O8UA 1GHWH 1QTFA 2PP6A 1P01A 3RXVA 4O3TA 4X6OA 3UQOA 3CP7A 3ODDA 3O8DA 1YPEH 1NC6A 2QC2A 1IOEA 2Z94A 1G3EA 1O2KA 3PV4A 5AFZH 3BEIB 1YCPM 2ZDNA 2CV3A 2ZTYA 2PKSC 1FPHH 2HGTH 2A2QH 2XNIA 3TK9A 2PGQB 5HGGA 4BOHA 1EX3A 2FIRH 1GBCA 3ITIA 4IN2A 4AB8A 1LHFH 3A84A 3ZV8A 2VJ1A 2BDYA 1TFXA 1HAIH 2F9UA 3SU4A 1ZLRA 3URCA 2G5VA 3GYMA 4O97A 4DW2U 1H8IH 1BDAA 1RRKA 3IITA 4JK6A 1AE8H 2ZQ2A 1B7XB 1ELEE 1O3IA 3AASA 3KQEA 5AVDA 3NRLA 4NIVA 1VR1H 3GICB 4IMQA 2XNDD 3QGJA 3ZZ5A 4ESTE 1IQEA 2NWNA 5BPEA 4CHAB 1BIOA 1LCYA 1ZTLA 1SOTA 3QX5H 1QFKH 2ZGXH 2DE9A 1BTWA 2RDLA 3RXBA 4FOUC 3RC4A 3WW7A 1H8DH 4H6TA 5FXLA 3F2FA 4VGCB 1AE5A 2OK5A 1E1QD 3QDZB 1AWFH 2Z9KA 1UTMA 1FLEE 3GCTG 1LKBA 1ANEA 5L6NH 1GHAF 3QTOH 1INCA 5AF9H 1D3PB 4NSVA 3STIA 1PPZA 4FUHA 1GVLA 3S7HB 3P8GA 3SGBE 2H6MA 3M5MA 2C8ZB 3KNXA 1TRNA 1YLNA 2VGCC 3OSYA 2XC5A 2Y5FA 2B5TB 3RDZA 3TVJB 3B23B 1QZ8A 2Y81A 2TIOA 1W3CA 3RXSA 1AVGH 5GDSH 5EQQA 5K7RA 4WXVA 3ZVBA 4BAOB 4M9FA 1EASA 2AH4X 2AMPA 5GWZA 3SNEA 6GCHG 1VJAU 2HWLB 2BVRH 2P3TB 1O2TA 3RU4D 1KSNA 4Y0ZE 2Z9JA 1KXFA 1NTPA 4ZHMU 1O2OA 5G4BA 4MPUA 1SKYE 1W13U 1Y3YA 1Z8RA 1C1MA 1SL3A 2V35A 1G30B 1VZQH 2V3MA 1UHBB 2FOFA 4ABHA 4XD7D 4YO9A 1GJ7B 3P17H 3GCHB 3LH1A 4HG6A 1KIGH 3SN8A 1O34A 3LGYA 3S9BA 5AFYH 4D7FA 1IQKA 3PV5A 3OE7D 2J34A 1W7GH 1O3OA 4Y71A 2OQ5A 4JYUH 3TU7H 2BZ6H 1VITH 1O3BA 2BQ7B 4AZ2B 1ACBE 1C1VH 1J9CH 1EB1H 1KMHB 2YMSC 3U69H 3SV6A 2BB4A 5GJ4B 1NY22 4B6FA 1AUTC 3SV7A 4OS4A 1JMOH 2GCHF 5C0TA 1ANCA 1O30A 3M5OA 2ZFTA 1NBMD 4F48B 1K1PA 4H4FA 2ZO3H 2HVXA 3SU3A 3LOXA 2CF9H 1C5ZB 2SGPE 1HIAB 1CU1A 4UFFH 3SI4H 2D26C 1DWDH 1EKBB 4AX9H 1LKAA 2ZWLH 1GI2A 3SV2H 4I86A 2NU0E 4Z1MD 3L3TA 1DY9A 3MO6A 1MQ5A 1OYQA 1XKBC 3A8DA 2ASUB 2ZIQH 1SGYE 4NWLA 3NXPA 1TA2A 4WVPE 1O3HA 2FYRA 1J14A 1WUNH 4I7YH 1XUIA 4XDEA 4NIXA 4J1YA 1W7XH 4CBOA 1MTUA 2FTLE 1Z8JB 1KTSB 1O2GH 1B5GH 3PO1B 1WQVH 2XBVA 1C1OA 1AD8H 3TGJE 1GHYH 1BHXF 2AMQA 3A7WA 4I31A 2ZU1A 4JCNA 3KYFA 3GY4A 1ZYOA 5LH8A 2ALVA 1A5HA 1EB2A 1V2UT 3VB3A 4CHAC 2RFKC 2IPQX 2RA3A 2XW9A 1N6YA 1CBWB 2TGDA 3CS7A 2ZPSA 3E8LA 3A85A 3UOUA 3GCNA 4Y7BA 1FY1A 2Y7XA 2ZGBH 1NRQH 4VGCC 1G36A 1OP2A 3P8NA 2BLVA 4FUDA 4FUCA 4X1NU 4BANB 2THFB 1LHGH 4NGAH 1GI8B 3M7TA 1E38B 1VITG 3KHVA 4K2YA 1O2MA 1RTLA 2A5AA 2BY7X 2W6ID 1C1NA 4B75A 2V6NA 2A2XH 2Q6FA 4X1SU 4E06H 4B2AA 1ELVA 2ZHWH 2ZHDA 2F9VA 2HPQH 2IN2A 3LGTA 2KCPA 1K21H 5E2PA 4YT7H 3N99A 3LGUA 5DP8A 5C5NA 4MNVA 4YM9A 3D23A 5C5OA 1EZQA 3D65E 2O9QA 2BD7A 2ODQA 2FOAA 1AKSB 3C1KA 2FLRH 4M7GA 5FAHA 2H1UA 3EBNA 1BTYA 1PPFE 1MZAA 5T6DA 2BD5A 1SLWB 4HTCH 4U2WA 4WXIA 2F9NA 2XOKD 1BMLA 3TH4H 1QB6A 4KTUA 5T3HA 4OS2A 1AU8A 1ZSJA 1FDPA 1THSH 1TLDA 1DWEH 1NS3A 4Z6AH 2H9TH 1RGQA 1KDQA 3F2GA 3P6ZB 1GHBF 2K1QA 4P02A 4R0IA 4X6PA 2ZGHA 2P93A 1LPGB 2VWLA 3SO3A 2BQ6B 4TY6A 1O2XA 1TBQH 3GCHC 2GV6A 3SNAA 3UNQA 1A5IA 3ATIA 1KDQB 1S81A 1ANDA 1GBHA 5EU8A 1C5PA 2C3SA 1QY6A 1YCPH 1SGFA 1IQFA 2Z6BD 1MUEB 1FY3A 1NFWA 1O3EA 4I8KA 5J4SA 4ZROA 1P2MA 1ETTH 2G5NA 2OUAA 3KQDA 7LPRA 2PGBB 1EAUA 3HGPA 2GX4A 3A81A 1C5NH 5GIBA 4F4OC 2UUKB 4PROA 4IBLH 3P8FA 2VIQA 3UTUH 2HLCA 1BZXE 1K0HA 1C5MD 4NIWA 1A61H 2FEQH 2ZF0H 2BD4A 2AHME 1DWCH 2AGGX 5GXPA 2Z7FE 2JIZD 1KXEA 4NA8A 4B2BA 1W2KH 1EXFA 2SGQE 2F43B 1IQHA 1DLEA 3AAVA 4WY3A 3UWJH 1FY8E 4TSFD 3SNCA 2F83A 3L33A 1G2LA 1EPTA 3KF2A 1C5OH 2KFWA 1FN8A 3E90B 4YLUA 2QV1A 3GY7A 3TJUA 2HALA 3SOSA 4ISOA 1C5TA 3M37A 1C5XB 4H6SB 1BCUH 1UTKA 3DT0H 1W8BH 1HAGE 3GY2A 3O8CA 3RXTA 1SGNE 3STJA 1EPTB 1O3GA 3PO1C 1OSSA 1AFQB 3U1JB 2VVCA 1QGFA 1OP8A 2CN0H 3PLPA 1BRAA 2XC4A 1F5RA 1P2OA 3P95A 2W5EA 4ABFA 4DURA 5A8YA 4A6LA 1GI6A 2UWOA 2H5CA 2PFEA 1H1BA 1BJVA 5BRRE 3RMNH 3ZZ7A 1Q3XA 1RTKA 1LVYA 1CBWC 1MKXH 1MTNB 5DG6A 4YTAA 4NA7A 4BAKB 1KTTB 2PW8H 1AO5A 4DJZB 3RXRA 2LNCA 1ZTJA 1CA0B 3BTQE 1GDNA 5HIZA 3AVZA 2HRVA 5GCHG 4A92A 1HJAB 1Z1IA 1CGIE 1HAHH 3PV2A 3ZV9A 5FPTA 3SV9A 1O5AB 3RXCA 3EGKH 1C1PA 4MTBA 4KP0A 2C8YB 2ZDLA 2O8TA 3SQEE 4JMYA 1CVWH 1GCTB 2UUYA 2LPRA 2VIOA 3SJIA 1PPHE 3LIWA 4XRNA 3Q76A 3RXJA 2W3IA 3V12A 1QR3E 1UVPA 2ZU4A 3N7EA 2V3HH 1O3CA 2BX3A 4DT7B 4LZ4B 1UVOA 1AY6H 1PYTD 5DN6D 3BTME 2D1JA 1O5EH 1XMNB 2GJGA 1Z1JA 4KTCA 3QWCH 2YMSD 4AFUA 5JYIA 1O31A 5A8ZA 4D8NA 2CK3D 2ANMH 1FUJA 4AFZA 2HNTC 1GHZA 1HJ9A 1O38A 4NZQA 3T25A 3FP6E 2TRMA 1XXFA 1LMWB 3ZVFA 4AGJA 1UJ1A 4ABBA 2WINI 1SFIA 1YM0A 1SLXB 4FETA 4UFEH 4CBNA 1Y3XA 2QXJA 1O0DH 1FONA 1JRSA 4HFPB 2V0BA 4KTSA 2WYJA 4FUJA 2SGAA 3A82A 3K6ZA 1H9IE 3MFJA 5I25A 1SMFE 4YXWD 2R0KA 1AZZA 3SW2B 2FOGA 4ZUHA 4X1PU 4TWYA 5CE1A 3BV9B 5C0UA 1Y5UT 1GVZA 1P09A 2J94A 1MBMA 4A5TS 2FX4A 4ZHLU 5F53A 2GT7A 1NBME 2PR3A 1ELDE 4GUXA 4DGJA 4Y6DA 1MU6B 1CGHA 1MMJN 5GNDA 3BF6H 3RXAA 4JYVH 3P8OA 4OS1A 1AZ8A 2BXTH 9ESTA 2FMJA 1GL0E 4YOJA 1DSUA 3UQVA 4NG9H 4Y7AA 5T1VA 3MH5A 1ARBA 1O2SA 4J2YB 1QBNA 1O32A 1BT7A 4DIHH 1HAVA 1LHDH 1UTQA 3ATMA 1O2PA 2QXGA 4AG2A 1DICA 4Y76A 1BTPA 3MYWA 1IQLA 5CHAB 3TJVA 2P8OB 3Q00A 3S7KB 2PKAA 3TK5A 3T26A 1C9TA 3GDSA 1HAVB 1C5WB 2OCVB 1MABB 1EPTC 1TBRH 1TAWA 4TT3D 3T29A 3OAAD 3UNSA 1AFQC 2F3CE 1V2LT 3GCOA 1YPHE 3E0NB 1LDTT 6GCHF 5KECA 1C5LH 2AGEX 2ZQ1A 1ZMNA 3OEED 1ZGVA 1UK4A 1H4WA 2QF0A 2QAAA 3T27A 1DUAA 2D2DA 1NN6A 3RC6A 1MTNC 4NZLA 1GBBA 3B8JA 3ODFA 1GHVH 3OTJE 1D6RA 5C1YA 1F7ZA 1KLTA 2J5UA 2WSSD 2AYWA 1CA0C 2BY5X 3SGQE 1SGCA 3ZZCA 3O8RA 1BRUP 2GMTB 2NU2E 1HJAC 3Q3KA 1IQNA 2VIVA 1PPGE 1J16A 1K1JA 1S82A 2KX4A 1Z71A 4AC9A 3ZVCA 3GOVB 1LTOA 3SGAE 3QO6A 5A2MH 1GCTC 1O2QA 1TMTH 1GBAA 1GL1A 3F9HA 4Y8XA 4CRFA 1AVXA 3PWCA 1NRSH 2WPJS 1AN1E 5PTPA 1F92A 1SG8B 4FUFA 1GBDA 3ZVDA 4AGKA 1EAIA 3DSGA 4K8YA 2QF4A 1MAXA 1F2SE 1IQGA 1T8OA 2BD9A 2JETB 4MPVA 3SZNA 1UTOA 4WH6A 3A8AA 2J92A 1C5VA 1UTPA 5E0HA 1GBIA 3KEEA 1QRXA 2VNTA 1HAXB 1N6XA 1W0YH 3ATWA 1WTGH 3MH6A 2UWLA 1MTVA 1T8LA 4ABEA 2W6JD 3M5LA 2WPLS 3FP7E 4ZKRU 3K9XB 4ZXYH 4XBCA 1GJ6A 1RFNA 1C5RA 1GCDA 1GJ9B 1KXDA 1XVOA 5T6FA 1T8MA 4K3JA 2BYAX 1OS8A 1C2MA 3QN7A 1EOJA 5F03A 1LVOA 1UVUH 1H8HD 3ZZ8A 3FVFB 1GJ5H 4JK5A 5C1UA 1QB9A 1A2CH 4D9RA 4OS7A 3E91A 2ZZUH 1FY5A 3SBKA 4WMFA 4KKDA 1Y3VA 3UIRA 2K0QA 4X8VH 1P05A 3L6PA 4NFEA 2FWWA 3VPKA 1NRPH 2ZGJA 5CDFE 1FMGA 1MD7A 1BTXA 1QCPA 1BBRH 1QRZA 3OU0A 4FVDA 3BN9A 3GDUA 1OPHB 3N7OA 1C4Y2 2XCNA 3FFGA 3U98H 1CQQA 1IAUA 3GDVA 1BTZA 1BQYA 2EI6A 4X6MA 5EGMA 4K1EA 2ZFFH 1BBRE 2YNAA 5B6LA 1QJ1B 2A32A 3ATKA 2VWMA 4YESB 4ACBA 2NU3E 2WHXA 2GZ9A 1GMDF 5CHAC 2P8OC 2RCEA 3EA8A 5LPFA 2PUXB 1ZHMA 3ZIAD 3F9FA 1SGTA 4MG3A 1SGIB 3TJNA 5L2ZH 1XUFA 1GJ4H 1FIWA 1VKYA 1A1RA 2ULLA 1HDTH 1UHBA 1C4V2 1GJDB 1A7SA 3UUZA 3ELAH 2FDAA 2ZHQH 1RD3B 1OP0A 1JIRA 2JKHA 1IQMA 1NFXA 4NWKA 1WTHD 1QA7A 1ZRKA 2QF5A 3FANA 2FM2A 2GMTC 1O3DA 2UUFB 1Z8IB 1MU8B 1C2IA 1ZPBA 1T4UH 3GY8A 4XBBA 1SGEE 2VBCA 2UWPA 4AORA 2SGEE 1DDJA 1S0QA 1O2NA 1A4WH 1ZPCA 2GDDA 3SV8A 3VGCB 6ESTA 2BLWA 1MKXK 1BTHH 2VVVA 5EJZA 2A0QB 2WPMS 2B8OH 4ABGA 1HIAA 2ZECA 4NA9H 4OS5A 2ZA5A 3QTVH 3UNRA 1Z7KA 4UE7H 1BOQA 4JYTA 1WQSA 2ALPA 3O8BA 4H42U 2JETC 2Y82A 5I46H 1C9PA 1F5KU 2W7SA 3BTHE 3GY3A 3LJJA 1F0UA 4GHTA 4IC5A 4NCYA 3ZZDA 3TITA 1XXDA 3M3SA 2ZC9H 5JB9S 1TOMH 1NESE 1S85A 1S6LA 1D3DB 3RXOA 1BITA 3PRDA 3QLPH 4ASUD 3D49H 3SU1A 1QJ7B 2ZGCA 3RU4T 1LQEA 3ATLA 1C1WH 4HGCA 2LP6A 4B73A 4RT0A 1ELBA 1YYY1 4Y0YE 1YLCA 2AGIX 1O2JA 1MH0A 1BMAA 5A0BA 3UPEA 1DVAH 3TLOA 1A46H 1DUEA 3S0NA 3M3VA 5B6OA 3PB1E 2WUBA 4UEHH 1ZMLA 2YOLA 3E6PH 4BNRA 5CMXH 2HOBA 4ABDA 2ZG0H 1C1TA 2A45B 1AIXH 1O5BB 1S5SA 4HI3A 1DX5M 1BJUA 2A7CA 1UTNA 1V2NT 3I78A 1V2TT 3MOCA 1GJCB 1GPZA 1P2QA 1HXFH 2AERH 2FESH 3SU0A 3FN8A 1SGPE 3F0PA 4KELA 3PMJA 1HCGA 5A09A 5ESBA 2KCOA 5JBCS 1A0JA 3FZDA 4B1TA 3F68H 1O37A 1LQDB 4BAHB 5EW1H 3A87A 4CRDA 4Q7ZA 1QHRB 3RXQA 2F9OA 5CHBA 9LPRA 1ESBA 1SGRE 3SUGA 1TMUH 4F55A 2OXSA 5F6MA 3NPSA 1F0TA 4YLQH 4IGDA 4TPIZ 4AB9A 1YWUA 1QBVH 3BTTE 1Q2WA 1AKSA 1S84A 3PMAB 3ZZAA 3PROA 2BHGA 5C3NA 4FUBA 3DA9B 3IWMA 2J9NA 1OWIA 5LPEA 1GHAG 1O3JA 1BTUA 2KM0A 8LPRA 3SI3H 3DFJA 2FOMB 4Q4LA 1QRWA 1L1GA 4D76A 1FV9A 1YLDA 3F1SB 3UAIC 2VIWA 7GCHG 1GBEA 1KXAA 4DIIH 1ZPZA 4A1VA 1L4DA 1DPOA 1W10U 1IHTH 1O2UA 3RXFA 2FOCA 3WWBA 1CSOE 3DFLA 4MNWA 2BOHB 1O2HA 2K8IA 3F2HA 3A7VA 1P9UA 3QZRA 1THPB 2JDID 2Y5GA 1KYNA 1TWXB 1GMHG 3Q3YA 1W12U 3CNRA 2OINA 3M3TA 1ELCA 3MO9A 1HJ8A 3F9GA 1NZQH 3RXMA 2QCYA 1MBQA 1DE7H 3SUDA 2ZKSA 3ESTA 2C90B 5EJ1A 4Q7YA 2OC7A 3BG4B 2VINA 2GD4B 2WPHS 3BTEE 3V13A 2ZTZA 4OS6A 4ISHH 3U28C 1PPBH 1P2NA 2GV7A 1Y5BT 1DSTA 2BLQA 3VGCC 2AMDA 3TNSA 1H9LB 2PTCE 4FVBA 3QUMP 3EQ0H 2RDEA 1FZZA 1DITH 1DT2A 1EQ9A 4CRGA 2LIZA 1PQ8A 4MPWA 1FJSA 1EFRD 2BZAA 5T6GA 1COWD 5EODA 2XWAA 1TQ7B 4Y79A 3HGNA 4ABAA 2R2MB 3KYGA 4OGYA 1NU9A 3LPRA 3A7XA 1FNIA 1HPGA 2A7JA 5A0CA 2HNTF 3MH7A 2Z9IA 3U8TH 1HGTH 3E3TA 1AB9B 3SHAH 1CT2E 1N8OB 3P92A 1D6WA 4FXGH 4INHA 1C5QA 4BXSA 4GHQA 2GCHG 1NROH 1XUGA 5HYOA 2WPIS 2GCTB 3R0FA 1FAKH 1CHOG 1TNHA 1WV7H 3LC5A 5FPYA 5HKKD 1V3XA 4FU7A 1E79D 1GBMA 2BVXH 3EYDA 1G37A 3MWIU 3LT3A 1F0SA 1S6HA 2F4LA 1O3PB 2DE8A 4SGAE 2L6OA 4I8LA 2O8MA 5FCKA 4YOGA 1OWJA 1B0EA 1ABJH 5DP7A 1EATA 2G55A 1V2OT 5LPRA 1FY4A 1WDIA 5C94A 1O2LA 4X2XA 2AS9A 2HVYB 2OBQA 3FO8D 4ISLA 1HB0B 1KXBA 1Q31A 5C1XA 3TK6A 4JZIA 2PHBA 5TCCA 4U32A 1T7CA 1Y8TA 1TNLA 4I8HA 1TX7A 1C2KA 1A3EH 3OEHD 2SNWA 1E37B 4ABIA 2GVFA 1SFQB 3VB7A 1O33A 1QL9A 4IC6A 2TGPZ 1PQ7A 3MMGA 1WAYB 4NSYA 3SNDA 3DSPA 1ZJDA 1NPMA 1LHEH 2BDAA 3R3GB 1FAXA 1E35B 1O39A 4SGBE 1T8NA 1GI7B 1V2JT 2PSXA 1K1NA 1ZTKA 4A7IB 1TPSA 4AFQA 1TGTA 3EDXB 1BBRK 2IJD1 2O8LA 4ZHAA 3H09A 5FCRA 1GDQA 2HNTE 1K1OA 1Y3WA 2G4UA 1SSXA 4WH8A 4X8SH 1ORFA 2VH6A 1VGCB 1M9UA 5HXFA 2PUQH 1VJ9U 3MU0A 3RM0H 1QL8A 1SGDE 2PWXA 1L2EA 1P2KA 3P70B 4GLYA 2AIPA 1UVTH 4INKA 3A83A 1ZJKA 4K60A 2YNBA 1S83A 1MCVA 2R9PA 2KZ4A 2Y5HA 5DKMA 1KLIH 1L1NA 1FPCH 5JBAS 1MTSA 1VCQA 3UR9A 3N7DA 1C5YB 4MPXA 3BG4C 1C1RA 1PFXC 2BM2A 1GHBG 5HM9A 5DP3A 2A31A 3H7TA 4JZDH 1XVMA 1P57B 1WCZA 3NWUA 3QZQA 4GSOA 4ISIH 1NM6A 3TIUA 4MQAA 1K2I1 1WSSH 1P02A 1C4U2 1K1LA 1TMBH 1TNKA 2QXIA 4D9QA 2H9EH 4XOJA 1V2PT 1GI5A 1ZZZA 1BB0B 2WV5A 2BY6X 1K9OE 3T28A 4AYVB 1P9SA 2Q1JA 3GCTF 5JBTA 2SGDE 1PQAA 2ZTXA 2KR7A 1NU7B 1AB9C 1O5GH 4DG4A 1V2MT 3H7OA 2Z3EA 2BY9X 1ESTA 2STAE 4XBDA 1T4VH 3M5NA 1AVWA 1J8AA 2WV4A 4FU9A 1YPLH 1Y5AT 4RKOB 3HK6B 1SBWA 2GCTC 1JRTA 5EIYA 3RXKA 1P2JA 1TONA 3RC5A 2FYQA 3V0XA 1O36A 2F9BH 3VFEA 4I33A 2GT8A 1YY3A 5ETXA 3SJ9A 2B0FA 3EE7A 4D7GA 3RLWH 4Y11E 8ESTE 1TPPA 5DO4H 2Z9LA 5EXLA 1UW7A 1H8ED 1G2MA 3FP8E 3ZZ6A 1IQIA 3ZVAA 5DP6A 3A8BA 1AFEH 2XYAA 2K7XA 1BRCE 1GBFA 1ZOMA 3VB6A 3RXLA 2TBSA 1OXGA 1XUJA 5KEDA 4FUEA 3DUXH 2V3OH 1NT1A 1YP9A 2R2WU 4FU8A 2OD3B 1O2RA 5DK1A 2ZFQH 1V2ST 3SJOA 1DFPA 1IHSH 1HUTH 2WV9A 2ESTE 2BVSH 3UR6A 1ETSH 1TIOA 3DCLA 2A5IA 1TQ0B 4LK4A 1T32A 5J4QA 4E05H 3MNBA 4IS5A 1F5LA 1W0JD 1LPZB 1L1JA 1SR5C 2CXVA 1LVBA 3ZVEA 1RS0A 2FOHA 3ZZ4A 3M7QA 3BTGE 1ZSLA 1HAZB 5EPNA 2Z3CA 1HYLA 1EJAA 1TNGA 2ZFPH 2A4RA 2XBWA 3AW0A 4QT8C 5GPIB 1NFUA 3PTBA 4ZKSU 5E0JA 3V3MA 4AFSA 1VGCC 1O35A 4MDSA 4YZUA 3RUOA 1O2WA 2IOTA 4B6EA 1DWBH 2XXLA 2WPDD 3CS0A 3PMBB 1C2DA 4LZ1H 1RJXB 3LJOA 2R3UA 4BTIB 2L74A 1EUFA 5JPMH 5EG4A 3TGKE 2Z9GA 2EY4C 4ZKOU 4OM9A 3LGWA 1SHHB 2F9PA 1EAWA 3PYHA 4X1RU 1V2KT 5EQRA 1ETRH 1ESAA 1DOJA 2FI3E 3RXPA 1A5GH 1SC8U 4MNXA 8GCHG 2IJOB 2BD8A 2J2UA 4AYYB 1FN6A 2Y7ZA 5C20A 4TY7A 1GGDB 1PQ5A 1P12E 1UK3A 1GG6B 1SPJA 4K1TA 5HMAA 3OX7U 3TNTA 1TE0A 4ZKNU 2EI7A 1ELFA 2XWBI 3KQ5A 1HAPH 2BX4A 3V7TA 1T31A 1LHCH 1TABE 1YGCH 3SUEA 1SQTA 2HPPH 2VIDA 4X2WA 3Q3XA 4AN7A 3NCLA 2QA9E 4CRBA 3H5CB 5EXMA 3BEFB 2A7HA 1YF4A 1VITF 3MU4A 1AI8H 3HPTB 2PLXA 5FHTA 1C1SA 1YCPK 1ZSKA 1KXCA 4IN1A 1GMCG 5ABWA 1LVMA 2BTCE 2A4OA 5H4IB 1GDUA 4Y8ZA 3MNCA 2ZFSA 3AW1A 1SI5H 2C93B 1DY8A 2FODA 2SNVA 3BEUA 2J97A 1JWTA 1HBTH 2WUCA 2AEIH 2ZU5A 1TPOA 1OWKA 1MZDA 2CMYA 2VIPA 4UONA 3EA9A 3C27B 1YC0A 4CREA 4GCHG 1HLTH 2QGRA 2ZFRH 2FI5E 1VCPA 1AGJA 3BTKE 3E1XB 3PLKA 1UTLM 4O3UA 7GCHF 4GVUA 1EJMA 1GVKB 2GDEH 1XM1A 1QURH 2TGTA 3BIVH 1FQ3A 1OOKB 1SQAA 1PJPA 2H9HA 4U30A 4B2CA 1MKWH 2M5TA 1V2WT 1GI9B 3MTYA 2ZDVH 5LGOA 2QXHA 2P59A 2XCFA 3HATH 1O5CB 1GMHF 3UFAA 3SU5A 1Y3UA 2SFAA 4WJG2 4WWYA 3SNBA 2FTMA 2FPZA 4DT4A 1MAYA 1P04A 2B7DH 4K8BA 1CT0E 1V2QT 2WYGA 1A0HB 3OFND 4Q80A 2JH5D 5DP5A 1UTJA 4Q2KA 1F0RA 1DANH 4DCDA 5K0HA 1NFYA 1OYTH 1RIWB 1ELAA 2GZ8A 3F6UH 3JZ2B 3MU8A 1DM4B 1TA6A 1MD8A 3U8RH 3S9CA 3U9AH 2ODYB 2KAIA 1BUIA 2CF8H 5C67A 3RMLH 4JZ1A 1ELTA 1EZSC 1BHXB 2Q6DA 1C1UH 1Z8GA 1TX8A 1GI4A 1BMFD 2XTTB 3LC3A 3A80A 4INLA 1P10A 3PWBA 5E2OA 2KAIB 4CH8B 2CGAA 1CE5A 3TH2H 1CGJE 1FX0B 1XX9A 3NKKA 2A4QA 1PYTC 1TNJA 2WPKS 1GHXH 1TALA 3KQCA 1W0ZU 2BMGB 2TGAA 3F3BA 2FLBH 3VB5A 2ZP0H 3SORA 1KLJH 2BD2A 1C5UA 3T2NA 2ZPQA 1O3LA 5JDUB 1P8VC 5DSFA 4A1XA 3TJOA
chains in the Genus database with same CATH topology
3FAOA 2G8TA 3LGIA 1V6DA 3T62A 4FUIA 2BD3A 1SHYA 5DPAA 1JBUH 3IG6B 4B74A 2GGVB 3K6YA 2ANWA 2CJIA 1G9IE 1UCYH 3M61U 1QBOA 1FXYA 2C8XB 2EC9H 1CHOF 4LXBH 2H5DA 1QNJA 2FS9A 4JZFH 4O9VA 1UCYE 4RN6A 3PMHB 2AFQB 1E0FD 1GGDC 1GG6C 1XUHA 3URDA 3BTDE 1TBZH 4O03A 4XE4A 1QIXB 3MNXA 3SQHE 1Z6EA 1DXPA 2I6QA 1EZUC 3RXIA 5IYTA 5FPSA 5EW2H 5JB8S 6CHAB 1EZXC 1C2LA 1ZR0A 2TPIZ 3KGPA 4B76A 4ZAEA 1AUJA 1BRBE 1C5SA 1ZMJA 5GCHF 4AG1A 2OBOA 3DD2H 4I8GA 4RSPA 1YPJH 2QN5T 2BDHA 4AOQA 4ASHA 4CR9A 1PPEE 4DVAU 1O3KA 1O3MA 2VWNA 3VXFH 2ZCLP 4I8JA 3QGNB 2ANYA 1E34B 2FOBA 5EPYA 4JZEH 7ESTE 2F91A 3MNSA 1UK2A 2ZNKH 4ISNA 3ZZ9A 1TGNA 1QQUA 2BXUH 3LDXH 3M7UA 2D8WA 4MLFB 1CO7E 3RP2A 1CT4E 1LO6A 1U6QA 3OY6U 3EAJA 5HM2A 4X0WU 4GPGA 1FI8A 4I32A 4B71A 1L4ZA 1GMDG 1HFDA 2A4GA 2Y6TA 2ZHEH 3W94A 1G3CA 3AAUA 1QJ6B 5DGJA 1PPCE 1OKXA 2Z3DA 1K22H 3NZIA 1V2VT 1S6FA 2XRCA 3S69A 1QL7A 4UFDH 4THNH 2P95A 3LONA 2BDIA 1GI1A 3I77A 4WF8A 4UD9H 1HV7A 1Z6JH 1YPGH 2P3FH 5EOKA 1BMMH 2ZI2H 4K5ZA 1BA8B 2ZCHP 1RIWC 2CHAB 1SLUB 3BSQA 1O3FA 4X6NA 3LGVA 5IDKA 4ZMAH 3I29A 4XSKU 1SOZA 3RMOH 3MU5A 1O2IA 4WMEA 1GBTA 3FZZA 1JXPA 1HAYB 3U8OH 1NRNH 3VB4A 2DUCA 2JH6D 4HZHA 4CRAA 1O2YA 3OY5U 2NU4E 2ZU2A 3SJ8A 4BTUB 3RLYH 4E7RG 2FI4E 3TH3H 2QY0B 4IMZA 3RXGA 4BAQB 5F8ZA 2XC0A 3CENA 5L30H 3SUFA 3Q77A 1FIZA 1OWDA 4Z0KA 4X2YA 5TCAA 4Q7XA 4RKJB 5AHGH 1C1QA 3MU1A 3LU9B 2ZEBA 1YBWA 5E0GA 2QF3A 2ZDKA 4KGAA 1HXEH 2EI8A 3RM2H 3SJKA 2EEKA 2VH0A 3PTNA 3KIDU 3HK3B 1UVSH 2BY8X 1P0SH 2NU1E 3U1IB 3VXEH 5C2ZA 2VVUA 1GJ8B 1J15A 2FO9A 4Y10E 3SHCH 3WY8A 1AQ7A 2GZ7A 2VU8E 2ZDAH 4BXWA 1WYKA 2STBE 3BG8A 4U01A 3W95A 1AHTH 1JOUB 4MNYA 5FBIA 1W14U 1CA8B 5DP9A 6CHAC 4ABJA 3RXEA 3UWIA 3TPIZ 4F49A 1C2JA 4LOYH 1N1LA 2GP9B 1QB1A 1UMAH 3A8CA 1H9HE 2B9LA 2VWOA 1GJBB 5F8TA 2I6SA 4MVNA 3LH3A 1UO6A 2ILNA 1TNIA 1ZHPA 3A88A 1O3AA 5F8XA 1G3DA 4ZXXH 5ESTE 1K1MA 1TRMA 1P3CA 4IW4E 4X8UH 1WOFA 2BDBA 3PLBA 2GKVE 3SU6A 2FS8A 1JIMA 4NIYA 2OC8A 1THRH 2R3YA 1ABIH 3ZZ3A 4TYDA 1GBJA 2ZCKP 3MO3A 4UDWH 1C2FA 1D9IA 1O2VA 2Q6GA 1KY9A 1TGSZ 2OTVA 2J4IA 2P3UB 1C2GA 1WU1A 2G81E 2J38A 1EP5A 3BTWE 1O5FH 5FBEA 1DXWA 1TOCB 3UREA 4K69A 2FXRA 1SGQE 1EP6A 1NRRH 1W11U 1LPKB 1YPMH 5DP4A 1RTFB 2A1DB 2J95A 3MI4A 3K2UA 3JZ1B 1SVPA 3RU4E 2P16A 1TRYA 3GY5A 2OQUA 1AWHB 2RG3A 3A7ZA 3BIUH 3KQBA 3D62A 4UFGH 3ZVGA 1EJNA 1XKAC 5TJXA 1OWHA 5EXNA 6LPRA 1X7AC 4GAWA 2PTNA 3G01A 4CR5A 1HRTH 2W3KA 3MH4A 3UOPA 1AMHA 3EE0B 3ZYDA 1EAXA 2CHAC 1GI3A 2OC0A 3GYLB 5JBBS 5EQSA 4Y8YA 2OP9A 1MCTA 3HKJB 8GCHF 2PKSB 1XUKA 1S0RA 1ID5H 2C8WB 3E0PB 3OYPA 1TPAE 3M35A 1ARCA 2XBXA 4NFFA 1MKWK 1A3BH 2FZZA 2R0LA 4DY7B 3T5FH 3A86A 3ZZBA 4TWWA 1O5DH 1P03A 1HAOH 3K65B 5FX6A 2PV9B 1ELGA 2ZHFH 3PM3A 2G00A 1DLKB 3VEQB 2FP7B 5DJ7A 1OWEA 1ZGIA 1C2HA 3LKWA 1ANBA 1CHGA 4OGXA 4CH2B 2VB0A 3E16B 1A0LA 4TPYA 1QQ4A 1O2ZA 1DS2E 1GMCF 4BTTB 1EOLA 1N8OC 3ZYEA 2G52A 2AIQA 1G32B 1NO9H 2ZPRA 1TGBA 3NUMA 4X1QU 2UUJB 5L2YH 3TGIE 2OC1A 3A7YA 2W7UA 1GI0A 4GCHF 2BDCA 4K1SA 3M36A 3KN2A 4YOIA 2OLGA 1J17T 1YPKH 2G51A 2XBYA 2P94A 5SGAE 2VGCB 2BLOA 1G3BA 1P06A 1K28D 5FX5A 3DHKH 2QIQA 1GBLA 1GJAB 4A1TA 3EA7A 1ZRBA 2ODPA 1GBKA 3MHWU 2ZDMA 4XFQA 1D3TB 1Y59T 3RMMH 5A0AE 2W26A 3GISB 4X2VA 1TYNA 1YPHC 3BTFE 1UCYK 2H2ZA 2A5KA 2PKAB 4WMDA 2JH0D 1L0ZA 1P3EA 2G4TA 4DOQA 5A8XA 1SLVB 3NK8A 1MTWA 4X8TH 2EA3A 1IQJA 1SB1H 2PSYA 1VCWA 1YKTA 1SGFG 1P11E 1GWAA 1TGCA 1E36B 1D3QB 2FOEA 3RXUA 3HKIB 3UY9A 3S9AA 3B9FH 2FX6A 4CRCA 3GY6A 3ENSB 2Y80A 2BDGA 1P2IA 3A7TA 2ZU3A 2O8WA 7KMEH 1WBGB 3SU2A 1MQ6A 2ANKH 2RA0A 3A89A 1C2EA 4R8TB 1ZHRA 3KCGH 3KL6A 3RXDA 8KME2 1QA0A 1V2RT 1K1IA 2BQWB 3QK1A 1HNEE 1TB6H 2IPHA 1D4PB 2GTBA 4FUGA 1B0FA 4YT6H 2BOKA 1O3NA 1TX6A 2C4FH 2QYIA 3F9EA 1RXPA 2SGFE 4ZH8A 5E8EH 3RXHA 1OX1A 1BMNH 4E7NA 4BAMB 1SQOA 2O8UA 1GHWH 1QTFA 1P01A 3RXVA 4O3TA 4X6OA 3UQOA 3CP7A 3ODDA 3O8DA 1YPEH 1NC6A 2QC2A 1IOEA 2Z94A 1G3EA 1O2KA 3PV4A 5AFZH 3BEIB 1YCPM 2ZDNA 2CV3A 2ZTYA 2PKSC 1FPHH 2HGTH 2A2QH 2XNIA 3TK9A 2PGQB 5HGGA 4BOHA 1EX3A 2FIRH 1GBCA 3ITIA 4IN2A 4AB8A 1LHFH 3A84A 3ZV8A 2VJ1A 2BDYA 1TFXA 1HAIH 2F9UA 3SU4A 1ZLRA 3URCA 2G5VA 3GYMA 4O97A 4DW2U 1H8IH 1BDAA 1RRKA 3IITA 4JK6A 1AE8H 2ZQ2A 1B7XB 1ELEE 1O3IA 3AASA 3KQEA 5AVDA 4NIVA 1VR1H 3GICB 4IMQA 3ZZ5A 3QGJA 4ESTE 1IQEA 2NWNA 5BPEA 4CHAB 1BIOA 1LCYA 1ZTLA 1SOTA 3QX5H 1QFKH 2ZGXH 2DE9A 1BTWA 2RDLA 3RXBA 3RC4A 1H8DH 4H6TA 5FXLA 4VGCB 1AE5A 3QDZB 1AWFH 2Z9KA 1UTMA 1FLEE 3GCTG 1LKBA 1ANEA 5L6NH 1GHAF 3QTOH 1INCA 5AF9H 1D3PB 4NSVA 3STIA 1PPZA 4FUHA 1GVLA 3S7HB 3P8GA 3SGBE 2H6MA 3M5MA 2C8ZB 3KNXA 1TRNA 2VGCC 3OSYA 2XC5A 2Y5FA 2B5TB 3RDZA 3TVJB 3B23B 2Y81A 2TIOA 1W3CA 3RXSA 1AVGH 5GDSH 5EQQA 5K7RA 4WXVA 3ZVBA 4BAOB 1EASA 2AH4X 2AMPA 5GWZA 3SNEA 6GCHG 1VJAU 2HWLB 2BVRH 2P3TB 1O2TA 3RU4D 1KSNA 4Y0ZE 2Z9JA 1KXFA 1NTPA 4ZHMU 1O2OA 5G4BA 4MPUA 1W13U 1Y3YA 1Z8RA 1C1MA 1SL3A 2V35A 1G30B 1VZQH 1UHBB 2FOFA 4ABHA 4YO9A 1GJ7B 3P17H 3GCHB 3LH1A 1KIGH 3SN8A 1O34A 3LGYA 3S9BA 5AFYH 4D7FA 1IQKA 2J34A 1W7GH 1O3OA 4Y71A 2OQ5A 4JYUH 3TU7H 2BZ6H 1VITH 1O3BA 2BQ7B 4AZ2B 1ACBE 1C1VH 1J9CH 1EB1H 3U69H 3SV6A 2BB4A 5GJ4B 1NY22 1AUTC 3SV7A 4OS4A 1JMOH 2GCHF 1ANCA 1O30A 3M5OA 2ZFTA 1K1PA 4H4FA 2ZO3H 2HVXA 3SU3A 3LOXA 2CF9H 1C5ZB 2SGPE 1HIAB 1CU1A 4UFFH 3SI4H 2D26C 1DWDH 1EKBB 4AX9H 1LKAA 2ZWLH 1GI2A 3SV2H 2NU0E 3L3TA 1DY9A 3MO6A 1MQ5A 1OYQA 1XKBC 3A8DA 2ASUB 2ZIQH 1SGYE 4NWLA 3NXPA 1TA2A 4WVPE 1O3HA 2FYRA 1J14A 1WUNH 4I7YH 1XUIA 4XDEA 4NIXA 4J1YA 1W7XH 4CBOA 1MTUA 2FTLE 1Z8JB 1KTSB 1O2GH 1B5GH 3PO1B 1WQVH 2XBVA 1C1OA 1AD8H 3TGJE 1GHYH 1BHXF 2AMQA 3A7WA 4I31A 2ZU1A 4JCNA 3GY4A 1ZYOA 5LH8A 2ALVA 1A5HA 1EB2A 1V2UT 3VB3A 4CHAC 2RA3A 2XW9A 1N6YA 1CBWB 2TGDA 3CS7A 2ZPSA 3E8LA 3A85A 3UOUA 3GCNA 4Y7BA 1FY1A 2Y7XA 2ZGBH 1NRQH 4VGCC 1G36A 1OP2A 3P8NA 2BLVA 4FUDA 4FUCA 4X1NU 4BANB 2THFB 1LHGH 4NGAH 1GI8B 3M7TA 1E38B 1VITG 3KHVA 4K2YA 1O2MA 1RTLA 2A5AA 2BY7X 1C1NA 4B75A 2V6NA 2A2XH 2Q6FA 4X1SU 4E06H 4B2AA 1ELVA 2ZHWH 2ZHDA 2F9VA 2HPQH 2IN2A 3LGTA 1K21H 5E2PA 4YT7H 3LGUA 5DP8A 5C5NA 4MNVA 4YM9A 3D23A 5C5OA 1EZQA 3D65E 2O9QA 2BD7A 2ODQA 2FOAA 1AKSB 3C1KA 2FLRH 4M7GA 5FAHA 2H1UA 3EBNA 1BTYA 1PPFE 1MZAA 5T6DA 2BD5A 1SLWB 4HTCH 4U2WA 4WXIA 2F9NA 1BMLA 3TH4H 1QB6A 4KTUA 5T3HA 4OS2A 1AU8A 1ZSJA 1FDPA 1THSH 1TLDA 1DWEH 1NS3A 4Z6AH 2H9TH 1RGQA 1KDQA 3P6ZB 1GHBF 2K1QA 4R0IA 4X6PA 2ZGHA 2P93A 1LPGB 2VWLA 3SO3A 2BQ6B 4TY6A 1O2XA 1TBQH 3GCHC 2GV6A 3SNAA 3UNQA 1A5IA 3ATIA 1KDQB 1S81A 1ANDA 1GBHA 5EU8A 1C5PA 2C3SA 1QY6A 1YCPH 1SGFA 1IQFA 2Z6BD 1MUEB 1FY3A 1NFWA 1O3EA 4I8KA 5J4SA 4ZROA 1P2MA 1ETTH 2G5NA 2OUAA 3KQDA 7LPRA 2PGBB 1EAUA 3HGPA 2GX4A 3A81A 1C5NH 5GIBA 4F4OC 2UUKB 4PROA 4IBLH 3P8FA 2VIQA 3UTUH 2HLCA 1BZXE 1C5MD 4NIWA 1A61H 2FEQH 2ZF0H 2BD4A 1DWCH 2AGGX 5GXPA 2Z7FE 1KXEA 4NA8A 4B2BA 1W2KH 1EXFA 2SGQE 1IQHA 1DLEA 3AAVA 4WY3A 3UWJH 1FY8E 3SNCA 2F83A 3L33A 1G2LA 1EPTA 3KF2A 1C5OH 3E90B 1FN8A 4YLUA 2QV1A 3GY7A 3TJUA 2HALA 3SOSA 4ISOA 1C5TA 3M37A 1C5XB 4H6SB 1BCUH 1UTKA 3DT0H 1W8BH 1HAGE 3GY2A 3O8CA 3RXTA 1SGNE 3STJA 1EPTB 1O3GA 3PO1C 1OSSA 1AFQB 3U1JB 2VVCA 1QGFA 1OP8A 2CN0H 3PLPA 1BRAA 2XC4A 1F5RA 1P2OA 3P95A 2W5EA 4ABFA 4DURA 5A8YA 4A6LA 1GI6A 2UWOA 2H5CA 2PFEA 1H1BA 1BJVA 5BRRE 3RMNH 3ZZ7A 1Q3XA 1RTKA 1LVYA 1CBWC 1MKXH 1MTNB 5DG6A 4YTAA 4NA7A 4BAKB 1KTTB 2PW8H 1AO5A 4DJZB 3RXRA 2LNCA 1ZTJA 1CA0B 3BTQE 1GDNA 3AVZA 2HRVA 5GCHG 4A92A 1HJAB 1Z1IA 1CGIE 1HAHH 3ZV9A 5FPTA 3SV9A 1O5AB 3RXCA 3EGKH 1C1PA 4MTBA 4KP0A 2C8YB 2ZDLA 2O8TA 3SQEE 4JMYA 1CVWH 1GCTB 2UUYA 2LPRA 2VIOA 3SJIA 1PPHE 3LIWA 3Q76A 3RXJA 2W3IA 3V12A 1QR3E 1UVPA 2ZU4A 2V3HH 1O3CA 2BX3A 4DT7B 4LZ4B 1UVOA 1AY6H 1PYTD 3BTME 2D1JA 1O5EH 1XMNB 1Z1JA 4KTCA 3QWCH 4AFUA 5JYIA 1O31A 5A8ZA 4D8NA 2ANMH 1FUJA 4AFZA 2HNTC 1GHZA 1HJ9A 1O38A 4NZQA 3T25A 3FP6E 2TRMA 1XXFA 1LMWB 3ZVFA 4AGJA 1UJ1A 4ABBA 2WINI 1SFIA 1YM0A 1SLXB 4UFEH 4CBNA 1Y3XA 2QXJA 1O0DH 1FONA 1JRSA 4HFPB 2V0BA