4F49A

2.25a resolution structure of transmissible gastroenteritis virus protease containing a covalently bound dipeptidyl inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
300
structure length
300
Chain Sequence
HSGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Broad-Spectrum Antivirals against 3C or 3C-Like Proteases of Picornaviruses, Noroviruses, and Coronaviruses.
pubmed doi rcsb
source organism Porcine transmissible gastroenteritis coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 83
structure length 300
sequence length 300
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4f49A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4f49A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4f49A01
5HMAA 1YPEH 1P09A 1SVPA 1LVOA 1DXPA 5AFYH 4BNRA 1AFQB 1C1UH 2F9NA 2GD4B 1BTPA 4B76A 1QB9A 1ELFA 1BTWA 2ZDVH 4NZLA 1EAXA 5JBCS 1N8OB 2YNAA 1TGTA 3ZZ6A 1W10U 2OTVA 3RXJA 5EW1H 3AASA 3P8FA 2AGIX 2UWPA 1FN6A 5GDSH 2ZI2H 1FN8A 3KHVA 3FP8E 1WOFA 1TA2A 1KXAA 1BZXE 2C8YB 2ZNKH 2FESH 1CA8B 1GBTA 1O2MA 3TGIE 1YPHE 4AORA 1QQ4A 2JETB 2P3UB 3P8NA 5TCAA 1MTSA 4OS4A 3VPKA 2OBQA 1GBDA 3UOPA 1GMDG 5DP6A 2HNTC 4XSKU 1Z1JA 4GSOA 4XFQA 1CGHA 2ZDKA 4HZHA 2A31A 4X8TH 1J9CH 2CHAB 2ZGCA 1V3XA 4OS7A 1ZSLA 1BTHH 3ZVBA 2YNBA 1T31A 5K0HA 2A1DB 1MAXA 2P3FH 2XNIA 2HWLB 4HI3A 4Y0ZE 1EXFA 1C1PA 3TJVA 3B8JA 2ZGXH 1ACBE 3NWUA 1C1OA 2J95A 2TBSA 2F9BH 1SSXA 4WWYA 4DGJA 2WUBA 4GPGA 2SGFE 1OYTH 2QAAA 3RM0H 1J15A 2BY7X 1HAPH 3ATLA 1A1RA 5IYTA 1GHYH 3BEFB 5EXNA 2BQWB 2VU8E 4K1TA 1ABJH 4FU7A 2CF9H 1VCPA 3SNEA 4KGAA 1FMGA 4BAOB 2ESTE 4NA9H 3RXKA 1QQUA 1MKWK 1P2NA 5ESTE 1ETSH 2PKAB 2YOLA 1TNHA 2ZTYA 1YCPK 1L1JA 3UWJH 2XTTB 3RXBA 1EJNA 1S0QA 3QGNB 3GOVB 4ESTE 4M7GA 1QRWA 3A7YA 1IHTH 2CGAA 2BD8A 2OQUA 2BXTH 3SJ9A 4Q7YA 2GVFA 1GI4A 1P8VC 1NPMA 3QK1A 2GDDA 1Y8TA 1YPGH 1S5SA 1CGJE 2B9LA 1TA6A 5LPFA 2ZPRA 1GDNA 1EASA 1AKSB 5C1UA 1SI5H 4Y10E 4F49A 1BRCE 3A80A 5E0GA 5CHAB 3ZVGA 2A7HA 2VJ1A 1O2LA 1BBRH 1RIWC 3RXRA 2XCFA 5FCRA 3V13A 1QGFA 1OPHB 3SJIA 5CHAC 1TFXA 3GDUA 3ATMA 1O3BA 2QYIA 2CMYA 3QN7A 3GYMA 4KP0A 1WU1A 3UY9A 1O2WA 4WMEA 2FS8A 2RA3A 1MD8A 1V2ST 4RN6A 5IDKA 1Y5AT 4K1EA 1ZSKA 4NA7A 1RS0A 3A89A 1SGPE 3GY7A 4ZXYH 1OP2A 1IQKA 1ETRH 2CV3A 3HPTB 3SGQE 1MTVA 5EOKA 1LPGB 1TMBH 2ZU5A 1XXDA 1S84A 3HGPA 2Z9LA 1N6YA 3MOCA 3RXOA 1O2HA 1QJ1B 3MO9A 4AB9A 1BBRK 4U30A 1UMAH 4IC5A 1V2PT 2FYRA 5FBEA 2GX4A 1AVGH 1PPFE 1GJ8B 1E35B 4AGJA 1TPSA 3BIUH 5HXFA 1BQYA 1G3EA 4PROA 1O3IA 2ZFSA 4JCNA 1O3GA 3RXMA 3D62A 2ZHDA 3BN9A 1TBRH 3DFLA 1C1SA 3T62A 1DFPA 2HPQH 3RC5A 3ZZCA 2OINA 2H2ZA 2FODA 1O3JA 1AGJA 2VVUA 4UONA 3I78A 3EDXB 2CJIA 1QRZA 4O03A 1AHTH 1GCTB 2P3TB 4I32A 2BQ6B 1F0RA 1GDUA 1OXGA 4ZXXH 5HYOA 3T29A 3D49H 2GCHF 6CHAC 5K7RA 1C1TA 2DUCA 1P03A 2PGBB 4ABIA 3GCNA 1O2JA 2R9PA 1OOKB 3BG8A 3GCTG 1ELDE 1O3FA 3K2UA 1QJ7B 1IOEA 1SOZA 4VGCB 3V3MA 3ODDA 4MNWA 1GMDF 1BIOA 1UVUH 1GBMA 1S85A 5DP8A 2D2DA 2DE8A 4NZQA 4E7RG 1EPTB 1E0FD 2M5TA 1EAIA 1GJ4H 3BG4B 2FS9A 2CN0H 2LIZA 3MU1A 1QL8A 1X7AC 1O31A 3SJKA 1GMCF 1PFXC 4AFZA 1P2MA 1GJ6A 4UFGH 1O37A 1UTOA 2B7DH 2BHGA 4XOJA 3R3GB 5F8TA 2Z9GA 2SNWA 4GHTA 4JZIA 1OS8A 1GI7B 1LVBA 4X2WA 1G9IE 3PMJA 1B5GH 1D3PB 2BX4A 2ALPA 2XBVA 1Z8RA 1TRNA 1N1LA 3L33A 1L0ZA 2IN2A 3TJUA 1H1BA 1PQ8A 1C1QA 2WPMS 1BBRE 1HIAB 3B23B 1UK2A 2TGAA 2BDHA 4ABFA 2GV6A 2GZ7A 1LMWB 2ODQA 2VIPA 4K8BA 3SV8A 3A7ZA 1G2LA 1GHBF 1TGCA 5EU8A 4Y7AA 1ANCA 3RXHA 3LH3A 2Z3DA 2AYWA 3A82A 2G81E 3A7TA 1T7CA 3F9EA 1LHGH 1ZLRA 4LXBH 4OS1A 3PLKA 4A92A 1P9SA 1DICA 3K6YA 3TU7H 4AOQA 1K9OE 1IQJA 1JIMA 3N7OA 1Q3XA 4ABHA 1AU8A 1P2JA 1EKBB 1UCYK 1MQ6A 2ZF0H 1G36A 4SGBE 4Y6DA 3EQ0H 4WF8A 1SGRE 5DJ7A 2BDGA 2Q6FA 1EZQA 4ASHA 1O34A 1UCYE 5FPYA 1AZ8A 2F83A 2WYGA 2OUAA 4MPVA 4X0WU 5JPMH 3VFEA 1O2YA 8ESTE 1QIXB 2OXSA 1C1VH 1SQAA 4YT6H 2GCTB 4FU8A 4ISOA 4K60A 1GBBA 1CA0C 5EXLA 1GHAF 3E3TA 1HRTH 1MZDA 1UTLM 4HGCA 3UNSA 1EZUC 3TGJE 3UNRA 1ZHMA 5E0JA 2VWOA 4DT7B 5E2PA 2BY8X 1ZMNA 4MVNA 2BMGB 2ZKSA 4X2XA 3VB6A 2G00A 4SGAE 2ZDMA 2KAIB 3T28A 2O8MA 1K1IA 5F8XA 2IOTA 4ZKSU 1TWXB 2BLQA 4WXVA 2OC0A 2NU1E 4UD9H 2A4QA 4FUBA 4X6PA 3SU4A 1ZHRA 4YLQH 8LPRA 2P94A 1CHGA 2H9TH 1T4UH 1KIGH 2ANYA 5DKMA 2PLXA 2J2UA 3C1KA 1UO6A 1D3DB 1QL9A 5HM9A 2FOHA 2Y5FA 4MPUA 2EEKA 5FPTA 1PPZA 1XUIA 2ZG0H 5GCHG 3MNSA 1GI3A 4HFPB 1XKBC 3AAVA 4B1TA 2G51A 1GI5A 4IGDA 4Y8XA 1ARCA 5E2OA 3SW2B 1DWCH 1GBKA 1A4WH 1FV9A 1KXEA 1TYNA 2GKVE 4AX9H 3P8OA 1HAXB 3RMNH 1V2KT 2FM2A 1HXFH 1O2XA 2GZ8A 1O3HA 2CHAC 5DK1A 5ABWA 3MTYA 1HCGA 3LOXA 2H5CA 2F3CE 3CENA 1YPLH 1DDJA 2VVCA 3SU2A 3IG6B 3QTOH 2ZU4A 2H1UA 1TX6A 3QTVH 1ELCA 1P2KA 1YF4A 3MU8A 1SFQB 3AW1A 1QL7A 1T8NA 3BTFE 1QCPA 2OQ5A 4FVDA 1A5IA 2HNTF 4MTBA 4NFEA 2J9NA 2Z3CA 1GVKB 1SR5C 2ZCKP 3A7WA 3SUGA 3EAJA 1SGTA 3BTME 3PO1B 4UFEH 3KCGH 4MNYA 4CBOA 3QZQA 1AWFH 5EQRA 4I31A 2BDBA 2VGCC 3SGAE 5J4QA 2SFAA 2I6QA 2QV1A 2STAE 2VIOA 3GY6A 2PW8H 1G3CA 1NU9A 3S9BA 1BB0B 2AS9A 1CSOE 1FIZA 1OWIA 2GP9B 4WMFA 1H8IH 1ZGIA 3KL6A 3GCHB 5HGGA 1G2MA 2XCNA 1AVWA 1IQHA 1V2JT 2UUJB 3L3TA 4ZKOU 1S83A 2TGTA 3MU5A 1EZXC 4OGYA 4MLFB 3SV7A 3KQDA 2H6MA 1C5VA 1LHCH 4Q80A 2GGVB 1MMJN 4D7GA 4BAHB 1UCYH 3EA7A 3HK3B 1HIAA 2ZHQH 4NIWA 4NA8A 4DIIH 1SGYE 3O8CA 2KAIA 4B2CA 2A4OA 2C8XB 2FOEA 5ESBA 2ZDAH 4XE4A 3ZZ9A 3MFJA 1O3OA 1SMFE 3SNDA 4Q2KA 4B71A 1D6WA 1MH0A 1MZAA 3LGTA 3P8GA 1V2RT 1C4Y2 1MD7A 4A1VA 2ZA5A 1IQIA 1DE7H 1YPHC 2B0FA 3DFJA 4A6LA 1O5AB 1W14U 1Z71A 2Z9IA 2FX6A 3GDSA 3CS0A 1KDQB 2EI6A 3PTBA 4DURA 1TNJA 3BIVH 3ZVCA 1OKXA 1O5DH 1OSSA 1ZOMA 1LVMA 4Y71A 3P70B 8GCHG 1SFIA 3QGJA 1W7GH 2BD9A 2JH0D 2O8TA 3BSQA 1HGTH 1GJAB 2PSXA 1Y5UT 4WH6A 2BVXH 4IBLH 3MO6A 4K1SA 2H9HA 2GZ9A 3BF6H 1FDPA 2OLGA 2W26A 3RXCA 4MDSA 5ETXA 1AUTC 4DG4A 2JETC 1C4V2 1A0HB 1GI0A 4KELA 5B6OA 2UUFB 1IQMA 3E0NB 1Z6EA 3PMAB 2C8ZB 1DXWA 1P2IA 4MPXA 5I46H 1K1NA 4XBBA 1DVAH 3U8RH 4AFUA 3RMLH 4NCYA 8KME2 3FAOA 5EQQA 2BOHB 2Y81A 1SOTA 2A2QH 2HALA 1TLDA 4R8TB 1WYKA 1NFUA 2AFQB 1ZRBA 3E91A 1SGDE 2Z6BD 5EGMA 3Q3YA 2FI5E 1VCWA 3SI3H 2P93A 3ZZ8A 1P3CA 2BXUH 1GBHA 2IPHA 1HJAC 2Z9KA 1RGQA 1ZPZA 2WPJS 2QGRA 1ZRKA 4H42U 1ETTH 1ORFA 3A86A 1QTFA 1DANH 1UHBA 2Y7XA 3ZZAA 3ZZ7A 5FAHA 1GHZA 4YT7H 2PFEA 3LGIA 1WTHD 3OYPA 1F0TA 3U9AH 4D76A 1O2QA 1C5XB 1AE5A 2VIVA 3SQEE 1SG8B 2RA0A 4U32A 2XC0A 1MTNC 2QXHA 2SNVA 1O3AA 3U1JB 3DD2H 3HK6B 1GBIA 1GL0E 3FZDA 2OP9A 1O5BB 3AVZA 3QUMP 4X8VH 1OWKA 7GCHF 1GHVH 1O33A 3U98H 1GHWH 1D9IA 3H5CB 1QFKH 1VITH 2GT7A 3VB3A 3MMGA 4YESB 2TRMA 1T8LA 2V3HH 4F4OC 5F03A 1AI8H 1QB6A 3MI4A 4X6OA 1EAUA 5A8ZA 1BTZA 1O3NA 3M5OA 2AIPA 2PUXB 1IQFA 1QY6A 1C2IA 2FOGA 4GCHF 3S69A 1WUNH 4NIVA 3T26A 2XBWA 1ZPBA 1VJ9U 1ZZZA 3QLPH 1E36B 1O2PA 3TNSA 3SZNA 1M9UA 3BEIB 3KF2A 1YPKH 3NKKA 1GBAA 3DA9B 3GY5A 2VINA 1FLEE 1TRYA 3C27B 3K6ZA 2BDIA 1D6RA 5DP7A 5C1XA 3ZVDA 4KKDA 3ZVEA 1UTKA 3I29A 5GIBA 3GDVA 1P0SH 1SGQE 5L30H 1GI1A 1QRXA 1NO9H 3MH7A 1SQTA 2ZC9H 4UDWH 5BPEA 1VZQH 1ZMLA 1T32A 3L6PA 3RUOA 4DVAU 3M5NA 1QA7A 3VB7A 2AMQA 1CA0B 4JK6A 1NRQH 5A0BA 2P8OB 1TQ0B 2G55A 3E16B 4FU9A 1AB9B 4THNH 2SGAA 3DHKH 1NTPA 2FX4A 1AY6H 2GCHG 2OCVB 2HRVA 1FXYA 3Q3XA 1AB9C 3HATH 3PB1E 1VGCC 4U01A 2VIQA 3URCA 1O2UA 4O3TA 1W11U 2O8LA 1O36A 1HBTH 2RDLA 3GY8A 3KNXA 3SHCH 1PPBH 3BTHE 2PSYA 4JMYA 2P95A 4BTTB 3M37A 4D9RA 4AFQA 4H4FA 4Y79A 1QBOA 1DSTA 1D3QB 1HUTH 3PTNA 4ZHMU 1SLVB 1V2UT 2WYJA 3RXAA 2ZTXA 3MNCA 4Y0YE 1AZZA 3E1XB 2ZTZA 1BTYA 1S6HA 2ZFPH 1O2GH 3K9XB 3AW0A 2D26C 1MKWH 3M7TA 2TIOA 3MH4A 1G3DA 2LNCA 1FQ3A 1C2FA 3VXEH 1HAZB 2NWNA 3RXUA 4YO9A 3RC4A 2Z3EA 3TK9A 1AFEH 2BYAX 1G37A 2FTMA 1WBGB 1W8BH 1GVZA 1QB1A 1NRRH 1RFNA 2O8WA 3M3SA 5AHGH 2VH6A 2JH6D 1XVMA 1C5OH 1ELEE 1RIWB 3SO3A 3Q77A 1MAYA 5DG6A 1W2KH 1EAWA 1HAIH 2G4TA 1EOJA 1HAYB 1W13U 1AUJA 1BMAA 4D8NA 3RXFA 1C5ZB 1SQOA 4YOGA 1A5HA 1QBNA 3RXSA 3I77A 4JYUH 1A5GH 5C20A 2V0BA 3SUDA 2BVSH 3KQBA 1NN6A 4IMZA 4MG3A 3RM2H 4TYDA 1UVTH 3RXPA 3HKIB 1C2DA 4HTCH 1ZMJA 3GISB 1CHOF 4NGAH 1TNGA 1EQ9A 4K5ZA 4JZ1A 5LPRA 1LDTT 1YLCA 2BY9X 3RC6A 2PUQH 4ISNA 1Y59T 1BDAA 1SHYA 1VITF 2BLWA 2BM2A 1TPOA 5AF9H 3A87A 4NG9H 3BTTE 1RTFB 3UNQA 1C4U2 3GY4A 1MTWA 1H9LB 2ZFRH 5TCCA 1GG6B 1O2KA 2BOKA 2G5VA 5F8ZA 4BXWA 1C5TA 3GCHC 1GBFA 4X1SU 1FUJA 1OWEA 3SU5A 1C2HA 1GJBB 4XBDA 1DOJA 1S82A 1F7ZA 5T3HA 2OBOA 3TH2H 4O9VA 4AG1A 1MTNB 2WPHS 1SGIB 4AZ2B 1OX1A 3AAUA 1TBZH 3SI4H 2Q1JA 1TPAE 2J34A 1KXDA 2XBYA 3LIWA 2FOCA 2CXVA 1UTPA 1ID5H 1JOUB 1V2WT 3F6UH 2GCTC 5CMXH 1GCTC 3VB4A 2W3IA 1A7SA 3KQEA 3URDA 1NC6A 3D23A 4GLYA 3KQCA 9LPRA 2XC5A 2ZU1A 2J92A 1K21H 2BD3A 1TPPA 5A09A 1J16A 3FP7E 1KTTB 1K1OA 5EXMA 1YCPH 1DPOA 4CRDA 4I7YH 4JK5A 1UVPA 1T8OA 2OC8A 1WTGH 5DP5A 4LZ1H 1EPTA 4I8LA 3M35A 5T6GA 5DO4H 1XUFA 5DP9A 1DLKB 5T6DA 3TH4H 1SGFA 4YZUA 1EPTC 3O8RA 4Q7XA 1KY9A 3QDZB 2GT8A 2F9VA 3BEUA 3VGCC 1P10A 5JB8S 3NUMA 1UTJA 2Y7ZA 4CHAB 1C2GA 1C5PA 1TIOA 4KTSA 3RXLA 1HJ9A 1ANEA 1LHEH 1GJDB 2BDYA 1P11E 1Z8IB 2QC2A 1L1GA 1AN1E 1GBCA 4ABJA 1YPJH 3RXVA 5A0AE 1Y5BT 4NSYA 1O3DA 4E05H 1F92A 1LVYA 3S7KB 2AGEX 1HB0B 2W5EA 1P9UA 1C5SA 2VWMA 1UK3A 2G8TA 1V2TT 3EYDA 2SGPE 3ZVFA 9ESTA 3BTKE 4CRBA 2A4RA 2D1JA 1IQLA 1AD8H 3ZZ4A 1CT4E 4WH8A 1DWEH 3S0NA 3ATIA 3RXTA 1TNIA 2P8OC 3M7UA 1JIRA 2WV4A 4X2VA 4ZKRU 4AFSA 4AG2A 2ZFTA 3F9GA 2ANWA 3RXDA 3UQOA 1C2EA 2WINI 1C9PA 1KLIH 2FI4E 3A8CA 2F91A 3SJOA 5CE1A 1Y3YA 3E6PH 4BTIB 1KDQA 1SHHB 1IQNA 3PYHA 1NESE 4Q7ZA 1XUKA 5JBBS 1K2I1 1GMHG 5GCHF 1A3EH 1QA0A 1C5NH 2VWLA 1SLUB 1HFDA 1UHBB 2FYQA 3ENSB 4E06H 5EPYA 1K1MA 2W7SA 1G32B 3LT3A 1TNKA 1MBMA 1GCDA 5JBTA 2RCEA 3QZRA 4K8YA 2FI3E 2ZZUH 1O30A 1SGCA 1FZZA 5A0CA 3W94A 2BDCA 2R3YA 1BMNH 2AH4X 1YCPM 3UPEA 2QCYA 1P2OA 5PTPA 4FUHA 3TLOA 1DY9A 1THPB 3GYLB 3KN2A 3M7QA 4FUEA 4IS5A 1TABE 1O3LA 2GMTC 3QO6A 1O5EH 1A0JA 3RXGA 3TH3H 4CBNA 1O5FH 3CP7A 2QIQA 4Z6AH 2PGQB 4WVPE 2FTLE 1O2VA 5HM2A 1EATA 2BZ6H 2WPLS 1ZJDA 1TX8A 4CRFA 1BA8B 1ESBA 2QXJA 5L2ZH 3MYWA 1Q2WA 3PLBA 1NS3A 1TNLA 4FUDA 3ITIA 5EG4A 1GL1A 3U8TH 4ABGA 5A8XA 1RJXB 1WQVH 5DP3A 4Y8YA 2ZHEH 1AFQC 1DY8A 2K1QA 4ZHLU 2AGGX 2G4UA 2A0QB 4I8KA 1GVLA 4INLA 3Q76A 3HGNA 1THSH 1O3MA 2Y5GA 1AMHA 3PWCA 3RU4E 3TK6A 1E34B 4JZFH 1WAYB 2C8WB 4NFFA 1OWDA 1SB1H 4BAQB 1FAKH 2VH0A 3FVFB 2F9PA 3OSYA 1NT1A 7LPRA 3GY3A 2SGEE 2BY6X 1PJPA 1W7XH 1GDQA 1MUEB 1C1NA 1O32A 3UTUH 1GI9B 1L4DA 1ANBA 5FXLA 1O0DH 1ARBA 4UEHH 1BHXB 2Y82A 1FY8E 2A4GA 3SV2H 1FIWA 2ZHFH 1SLXB 1QJ6B 1MQ5A 2C93B 1TE0A 1HV7A 1C1MA 2ZQ2A 2DE9A 1F0SA 3VXFH 1OWJA 3EA8A 5J4SA 1SL3A 1NZQH 3M36A 3SNAA 4QT8C 4NIYA 4INKA 7KMEH 1JMOH 1MU8B 1C2KA 2ZEBA 7ESTE 5AFZH 3LGUA 1PPGE 2R3UA 2R2WU 2SGDE 2GV7A 4ZMAH 2J4IA 1F5RA 1Y3XA 3EBNA 1SPJA 1DLEA 1GMHF 1DUAA 1Y3VA 4MQAA 3ZZBA 2LPRA 2FOMB 3BTQE 3W95A 4A7IB 2ZFFH 4FUJA 4JYTA 1HJAB 2VGCB 2R0LA 4JZEH 4DOQA 2NU2E 5C5OA 3M61U 2BD7A 5GPIB 5C3NA 2AERH 1ZTKA 2V6NA 1CGIE 2OC1A 5A2MH 2WUCA 1T8MA 1H9HE 2Z7FE 1N8OC 1C5YB 1YLDA 3P6ZB 3BG4C 3S7HB 3KIDU 1RTLA 1P01A 1F5KU 3VGCB 2ANKH 1E38B 1XKAC 3MH6A 4DJZB 2GMTB 1Z1IA 3HKJB 1UJ1A 5EQSA 4X1PU 2EI8A 1O35A 4ZAEA 1N6XA 1J17T 2TGDA 2V3OH 3OX7U 1KXCA 1P02A 1XUGA 4BOHA 4Z0KA 1HAOH 4BTUB 2FPZA 4IN2A 1OP0A 1S0RA 3RP2A 2FP7B 1ZPCA 1IHSH 2PV9B 3TITA 3UQVA 3NK8A 1TQ7B 1CO7E 2FIRH 4FVBA 1V2NT 3V0XA 1W0ZU 2ZPQA 1FY5A 3B9FH 1AKSA 4A5TS 2PHBA 4ISHH 3F68H 3TIUA 4ZUHA 1CT2E 1GBJA 1EZSC 5AVDA 1MKXK 1QHRB 1ELVA 4UFDH 1PQAA 2Q6GA 2XW9A 3SBKA 3M3VA 1LPKB 3O8DA 6ESTA 4TPIZ 3PM3A 4A1XA 4OS5A 2XWBI 1Z8JB 1O3KA 3ZYEA 3UUZA 3DUXH 4OGXA 5JYIA 4BANB 1NRNH 1UVOA 1GGDB 2BD5A 1P04A 1VITG 3LONA 1FAXA 2ZU3A 3UR9A 3LU9B 1NU7B 1YM0A 2C90B 4CR9A 5TJXA 2BD4A 3FZZA 1SGFG 5DGJA 5FX6A 1A2CH 1CT0E 4KTCA 2OD3B 1LTOA 5FBIA 1ABIH 1YKTA 2FDAA 1YPMH 3M5LA 1CBWB 1P57B 3RXEA 1KLTA 1CE5A 2THFB 3TJNA 1AO5A 1L1NA 2PTCE 4ISLA 1SGNE 2ZGJA 4XBCA 2VB0A 1C1WH 3SGBE 2XYAA 1WCZA 1O2OA 8GCHF 1MBQA 3EA9A 3E0PB 4I8HA 3SORA 4IMQA 1JRSA 1TAWA 4WY3A 1DWDH 1TRMA 1FY3A 1GHBG 2I6SA 2Y80A 4LK4A 1P2QA 4ZH8A 3MU4A 4CR5A 2AIQA 1FJSA 4CH8B 3SU6A 1YGCH 2ZGHA 1C5UA 3SUEA 1CQQA 4BAMB 4I33A 1NM6A 4I8GA 4ZKNU 3PMBB 1S6FA 2A32A 3GY2A 1SC8U 5E8EH 2FMJA 4MPWA 3U1IB 3V7TA 1LHDH 3STJA 4K69A 1JRTA 3UR6A 1B7XB 4CHAC 3GICB 2A2XH 1YBWA 3QX5H 1O3CA 4YOIA 2PWXA 1B0FA 3BV9B 3ATKA 5JBAS 2R2MB 4GCHG 2BY5X 5FHTA 3S9CA 2UWLA 5E0HA 3PV4A 3LDXH 3U69H 1TMTH 2HVXA 5FPSA 3UOUA 2D8WA 1DT2A 3FP6E 1PQ7A 3A81A 1K1PA 3OY5U 4U2WA 5L6NH 4JZDH 1O2NA 1FONA 1GHAG 1BRAA 2VIDA 1B0EA 1TGBA 3LJJA 4KTUA 2BZAA 3NZIA 1ZTJA 4YTAA 1ZGVA 3A8AA 1CVWH 1BOQA 1HAGE 1H9IE 1A3BH 2VWNA 1EOLA 1DITH 1W3CA 1GJCB 1HNEE 2XWAA 1BCUH 2FLBH 3TGKE 1GHXH 2H5DA 1ZJKA 4D9QA 1KSNA 1ZR0A 3JZ1B 1NFWA 3A83A 2ASUB 1MCVA 1ZSJA 3DT0H 4WXIA 5LGOA 3SU0A 3BTDE 2HPPH 1INCA 2UUYA 3T27A 1TOCB 4ZROA 3PO1C 4AGKA 1GJ9B 2JH5D 3A85A 2GTBA 4LZ4B 3P95A 3U8OH 3QWCH 4VGCC 1O5CB 1MKXH 3T2NA 5EODA 5LPEA 4TPYA 3ZZ5A 3ATWA 2Y5HA 4I8JA 1EX3A 4MNXA 1SGEE 2FWWA 3MH5A 3LC5A 3IWMA 2PTNA 1LPZB 2PR3A 5JB9S 2ZPSA 3Q3KA 3TJOA 1HLTH 4RKJB 1S81A 3BTGE 2XC4A 3LJOA 1FPCH 1UTNA 3UREA 3PWBA 3LGYA 4B74A 4O97A 5C2ZA 1HJ8A 4FUGA 2BX3A 3LH1A 1LCYA 1C9TA 3FANA 4X8UH 2ODPA 3MO3A 3LPRA 1O38A 4BXSA 1PPHE 3MWIU 3LGWA 5I25A 4TWWA 3ZYDA 1ZTLA 1QURH 5G4BA 1JBUH 3TPIZ 2FLRH 1FY4A 3FFGA 5BRRE 1YP9A 4YM9A 1HAVA 1ZYOA 2ZP0H 3GCOA 1D4PB 2J94A 2FXRA 1AQ7A 2BQ7B 1IQGA 2OC7A 4IW4E 3SUFA 2FOBA 2AMDA 1C2LA 5GXPA 3P92A 1EP5A 1P06A 4RKOB 4J2YB 4UFFH 2ZDNA 1O2IA 5T6FA 1WQSA 1KLJH 1JWTA 1U6QA 1THRH 2A7CA 4X1RU 1O2SA 1YC0A 3VB5A 2IJOB 5SGAE 3GCTF 1EB2A 2EC9H 3O8BA 2A5AA 1GJ7B 3ELAH 1HAVB 4UE7H 3P17H 5EPNA 3A88A 5FCKA 3RMOH 3A84A 5FX5A 3TNTA 2R0KA 1OP8A 1GI2A 1A0LA 3E8LA 4NWLA 1HDTH 2Y6TA 1LKBA 1V2VT 3G01A 4WJG2 7GCHG 3WY8A 1PPEE 1E37B 1WV7H 3SN8A 4JYVH 3ZV8A 1C2JA 1HXEH 2A5KA 1CBWC 2EA3A 3LGVA 4R0IA 3D65E 1V6DA 1H4WA 1UK4A 1J14A 5C1YA 1Z7KA 1W12U 1IAUA 1LO6A 2QY0B 1TGSZ 1UTMA 2ZECA 4OS6A 1C5QA 2HNTE 1W0YH 1GWAA 3SNCA 1PPCE 2UUKB 1ELTA 3EE0B 1LQDB 1QBVH 1Y3UA 1TB6H 1KTSB 1BMLA 1V2OT 3A8DA 1MTUA 2TPIZ 1TBQH 1O2ZA 5EW2H 2ZQ1A 1MU6B 4K3JA 1V2LT 2CF8H 4DCDA 1GG6C 1Z6JH 1Q31A 2WV5A 2VVVA 4YLUA 3MNBA 4CRAA 1O2TA 1BITA 5DPAA 3ZZ3A 3CS7A 5GWZA 1O5GH 3IITA 1VR1H 2ULLA 4RSPA 1BRBE 2BDAA 4AYYB 1KYNA 1BT7A 4E7NA 2Z9JA 2NU0E 4B2BA 4TWYA 3BTWE 3KEEA 1C5RA 1RXPA 5H4IB 1O39A 4DIHH 3SV9A 1P12E 1GMCG 2ZHWH 1TGNA 3EGKH 4AYVB 1O2RA 1RTKA 1CHOG 3STIA 1HPGA 3MU0A 3NPSA 1EP6A 1SLWB 1XVOA 3ZZDA 4FUCA 2F9OA 1J8AA 3UWIA 3PLPA 6GCHG 4DW2U 4K2YA 2ZCHP 1ESTA 1K1JA 4CH2B 2ZU2A 5C67A 1D3TB 4Y8ZA 6LPRA 5JDUB 1OYQA 2W3KA 1P05A 4TY7A 1FY1A 1O3PB 1TALA 4GHQA 3ZV9A 5F6MA 1CU1A 4B2AA 3LKWA 1V2MT 3BTEE 4X1NU 2XBXA 1GI6A 2WPKS 2QF0A 1TOMH 3A7VA 1WSSH 1AWHB 2W7UA 1BUIA 2XRCA 2C3SA 2BD2A 1DS2E 2G5NA 1GJ5H 1XM1A 2WPIS 1LHFH 1FI8A 2FOFA 4GVUA 1DUEA 1K1LA 2HOBA 1P3EA 3RU4T 4TY6A 2FEQH 4DY7B 2Z94A 4BAKB 4NWKA 3RXQA 3SNBA 2ODYB 1DM4B 1K22H 3S9AA 4X1QU 1A61H 3MNXA 3H7TA 1GBLA 2TGPZ 1TMUH 3A8BA 3Q00A 2B5TB 4FUFA 2BTCE 4IN1A 1C1RA 3LC3A 3K65B 1ELAA 1PYTD 2VIWA 2C4FH 5GJ4B 1EB1H 2FO9A 1C5WB 1HAHH 1ANDA 1SBWA 4ABBA 1G30B 1AVXA 2HGTH 5DP4A 2ALVA 4NIXA 2O8UA 2QA9E 2A5IA 1T4VH 1VJAU 3JZ2B 1K28D 6GCHF 4NSVA 2B8OH 2RG3A 1NROH 2P16A 1XUHA 1FNIA 2BLOA 2ZO3H 1BJUA 2BB4A 3RLWH 4YOJA 3F9FA 2AEIH 3OU0A 1DSUA 1VCQA 3TVJB 3UFAA 3ZVAA 3PMHB 4B75A 3R0FA 4CREA 4GUXA 2ZGBH 4Y76A 3ODFA 4OS2A 3NCLA 2HLCA 1F2SE 2A45B 1HYLA 2EI7A 2QN5T 2J38A 2XXLA 1F5LA 1BMMH 1G3BA 4ISIH 2FOAA 4O3UA 1NFXA 1O3EA 1XMNB 2A7JA 2UWOA 2BVRH 2SGQE 1FPHH 4Y11E 4WMDA 3SJ8A 3M3TA 3KGPA 1AE8H 2ZDLA 1EJMA 2G52A 4X8SH 3OY6U 2PKAA 3SHAH 2F9UA 2ZIQH 3SU3A 3RMMH 2H9EH 1L4ZA 5C5NA 1TX7A 4X6NA 1EUFA 1L2EA 3NXPA 1Z8GA 4AN7A 3RXIA 1BHXF 3VEQB 1OWHA 1C2MA 1JXPA 4CRGA 1A46H 4H6SB 1KXBA 1NRSH 1BJVA 4X6MA 4Y7BA 1EJAA 3H7OA 2K7XA 3T5FH 4LOYH 1NFYA 2VNTA 3OTJE 1F0UA 2FZZA 5A8YA 5LH8A 1RD3B 1BTUA 2JKHA 1ELGA 4B73A 4ABEA 2O9QA 1PQ5A 2NU3E 4ABAA 1TONA 2Q6DA 1ESAA 3F1SB 3V12A 1PYTC 1GPZA 2PKSB 1BRUP 1RRKA 2AMPA 4H6TA 4X2YA 1GBEA 3F9HA 2STBE 2QXGA 2ILNA 2GDEH 4ABDA 1ZHPA 2PKSC 1UVSH 3ESTA 1LKAA 3A7XA 1Y3WA 2V35A 3E90B 1GGDC 4A1TA 4CRCA 3SOSA 3SQHE 3RU4D 2NU4E 1YYY1 1C5MD 4AB8A 3T25A 3TK5A 4FXGH 2ZWLH 4IC6A 3SV6A 1XX9A 2QXIA 3MHWU 2QF3A 4XDEA 1AIXH 1DWBH 2ZFQH 4J1YA 1DX5M 5L2YH 4INHA 3PROA 1NY22 3RLYH 2P59A 1LQEA 3UIRA 1V2QT 3SU1A 1XXFA 1C5LH 3M5MA 1UTQA 1MCTA 1QNJA 4GAWA 1H8DH 3RDZA 2ANMH 4ZHAA 4MNVA 1XUJA 1ELBA 1KXFA 2BLVA 1IQEA 6CHAB 4D7FA 1VGCB 4FUIA 1QR3E 1NRPH 1BTXA 2ZCLP 1GI8B
chains in the Genus database with same CATH superfamily
5HMAA 1YPEH 1P09A 1SVPA 1LVOA 1DXPA 5AFYH 4BNRA 1AFQB 1C1UH 2F9NA 2GD4B 1BTPA 4B76A 1QB9A 1ELFA 1BTWA 2ZDVH 4NZLA 1EAXA 5JBCS 1N8OB 2YNAA 1TGTA 3ZZ6A 1W10U 2OTVA 3RXJA 5EW1H 3AASA 3P8FA 2AGIX 2UWPA 1FN6A 5GDSH 2ZI2H 1FN8A 3KHVA 3FP8E 1WOFA 1TA2A 1KXAA 1BZXE 2C8YB 2ZNKH 2FESH 1CA8B 1GBTA 1O2MA 3TGIE 1YPHE 4AORA 1QQ4A 2JETB 2P3UB 3P8NA 5TCAA 1MTSA 4OS4A 3VPKA 2QF5A 2OBQA 1GBDA 3UOPA 1GMDG 3EE7A 5DP6A 2HNTC 4XSKU 1Z1JA 3CNRA 4GSOA 4XFQA 1CGHA 2ZDKA 4HZHA 2A31A 3WWFA 4X8TH 1J9CH 2CHAB 2ZGCA 1V3XA 4OS7A 1ZSLA 1BTHH 3ZVBA 2YNBA 1T31A 5K0HA 2A1DB 1MAXA 2P3FH 2XNIA 4B6FA 2HWLB 4HI3A 4Y0ZE 1EXFA 1C1PA 3TJVA 3B8JA 2ZGXH 1ACBE 3NWUA 1C1OA 2J95A 2TBSA 2F9BH 1SSXA 1UW7A 4WWYA 4DGJA 2WUBA 4GPGA 2SGFE 1OYTH 2QAAA 3RM0H 1J15A 2BY7X 1HAPH 3ATLA 1A1RA 5IYTA 1GHYH 3BEFB 5EXNA 2BQWB 2VU8E 4K1TA 1ABJH 4FU7A 2CF9H 1VCPA 3SNEA 4KGAA 1FMGA 4BAOB 2ESTE 4NA9H 3RXKA 1QQUA 1MKWK 3PRDA 1P2NA 3N7DA 5ESTE 1ETSH 2PKAB 2YOLA 1TNHA 2ZTYA 1YCPK 2KX4A 1L1JA 3UWJH 2XTTB 3RXBA 1EJNA 1S0QA 3QGNB 3GOVB 4ESTE 4M7GA 1QRWA 3A7YA 1IHTH 2CGAA 2BD8A 2OQUA 2BXTH 3SJ9A 4Q7YA 2GVFA 1GI4A 1P8VC 1NPMA 3QK1A 2GDDA 1Y8TA 1YPGH 1S5SA 1CGJE 2B9LA 1TA6A 5LPFA 2ZPRA 1GDNA 1EASA 3W1EA 1AKSB 5C1UA 1SI5H 4Y10E 2K8IA 4F49A 1BRCE 3A80A 3PV5A 5E0GA 5CHAB 3ZVGA 2A7HA 2VJ1A 1O2LA 1BBRH 1RIWC 3RXRA 2J98B 2XCFA 5FCRA 3V13A 1QGFA 1OPHB 3SJIA 5CHAC 1TFXA 3GDUA 3ATMA 1O3BA 2QYIA 2CMYA 3QN7A 3GYMA 4KP0A 1WU1A 3UY9A 1O2WA 4WMEA 2FS8A 2RA3A 1MD8A 1V2ST 4RN6A 4RI0A 5IDKA 1YWUA 1Y5AT 4K1EA 1ZSKA 4NA7A 1RS0A 3A89A 1SGPE 3GY7A 4ZXYH 1OP2A 1IQKA 1ETRH 2CV3A 3HPTB 3SGQE 1MTVA 5EOKA 1LPGB 1TMBH 2ZU5A 1XXDA 3FOAA 1S84A 3DSGA 3HGPA 2Z9LA 1N6YA 3MOCA 3RXOA 4TT3D 1O2HA 1QJ1B 3MO9A 4AB9A 1BBRK 4U30A 1UMAH 4IC5A 1V2PT 2FYRA 5FBEA 2GX4A 1AVGH 1PPFE 1GJ8B 1E35B 4AGJA 2AHME 1TPSA 3BIUH 5HXFA 1BQYA 1G3EA 4PROA 1O3IA 2ZFSA 4JCNA 1O3GA 3RXMA 3D62A 2ZHDA 3BN9A 1TBRH 3DFLA 4FETA 1C1SA 3T62A 1DFPA 2HPQH 3RC5A 3ZZCA 2OINA 2H2ZA 2FODA 1O3JA 1AGJA 2VVUA 4UONA 3I78A 3EDXB 5GNDA 2CJIA 1QRZA 4O03A 1AHTH 1GCTB 2P3TB 4I32A 2BQ6B 1F0RA 1GDUA 1OXGA 4ZXXH 5HYOA 3T29A 3D49H 2GCHF 6CHAC 5K7RA 1C1TA 2DUCA 1P03A 2PGBB 4ABIA 3GCNA 1O2JA 2R9PA 1OOKB 3BG8A 3GCTG 1ELDE 1O3FA 3K2UA 1QJ7B 1IOEA 1SOZA 4VGCB 3V3MA 3ODDA 3NRLA 4MNWA 5B6LA 1GMDF 1BIOA 1UVUH 1GBMA 1S85A 5DP8A 2D2DA 2DE8A 4NZQA 4E7RG 1EPTB 1E0FD 2M5TA 1EAIA 5EIYA 1GJ4H 3BG4B 2FS9A 2CN0H 2LIZA 3MU1A 1QL8A 1X7AC 1O31A 3SJKA 1GMCF 1PFXC 4AFZA 1P2MA 1GJ6A 4UFGH 1O37A 1UTOA 2B7DH 2BHGA 4XOJA 3R3GB 5F8TA 2Z9GA 2SNWA 4GHTA 4JZIA 1OS8A 1GI7B 1LVBA 4X2WA 1G9IE 3PMJA 3GS9A 1B5GH 1D3PB 2BX4A 2ALPA 2XBVA 1Z8RA 1TRNA 1N1LA 3L33A 1L0ZA 2IN2A 3TJUA 1H1BA 1PQ8A 1C1QA 2WPMS 1BBRE 1HIAB 3B23B 1UK2A 2TGAA 2BDHA 4ABFA 2GV6A 2GZ7A 1LMWB 2ODQA 2VIPA 4K8BA 3SV8A 3A7ZA 1G2LA 1GHBF 1TGCA 5EU8A 4Y7AA 1ANCA 3RXHA 3LH3A 2Z3DA 2AYWA 3A82A 2G81E 5KECA 3A7TA 1T7CA 3F9EA 2KCOA 1LHGH 1ZLRA 4LXBH 4OS1A 3PLKA 4A92A 1P9SA 1DICA 3K6YA 3TU7H 4AOQA 2GJGA 1K9OE 1IQJA 1JIMA 3N7OA 1Q3XA 4ABHA 1AU8A 1P2JA 1EKBB 1UCYK 1MQ6A 2ZF0H 1G36A 4SGBE 4Y6DA 3EQ0H 4WF8A 1SGRE 5DJ7A 2BDGA 2Q6FA 1EZQA 4ASHA 1O34A 1UCYE 5FPYA 1AZ8A 2F83A 2WYGA 2OUAA 4M9FA 4XD7D 4MPVA 4X0WU 5JPMH 3VFEA 1O2YA 8ESTE 1QIXB 2OXSA 1C1VH 1SQAA 4YT6H 2GCTB 4FU8A 4ISOA 4K60A 1GBBA 1CA0C 5EXLA 1GHAF 3E3TA 1HRTH 1MZDA 1UTLM 4HGCA 3UNSA 1EZUC 3TGJE 3UNRA 1ZHMA 5E0JA 2IJD1 2VWOA 4DT7B 2JJ1D 5E2PA 2BY8X 1ZMNA 4MVNA 2BMGB 2ZKSA 4X2XA 3VB6A 2G00A 2EY4C 4SGAE 2ZDMA 1YLNA 2KAIB 3T28A 2O8MA 1K1IA 5F8XA 2IOTA 4ZKSU 1TWXB 2BLQA 2IPQX 2KCYA 4WXVA 2OC0A 2NU1E 4UD9H 2A4QA 4FUBA 4X6PA 3SU4A 1ZHRA 4YLQH 8LPRA 2P94A 1CHGA 2H9TH 1T4UH 1KIGH 2ANYA 5DKMA 2J2UA 2PLXA 3C1KA 1UO6A 1D3DB 1QL9A 5HM9A 2FOHA 2Y5FA 4MPUA 2EEKA 5FPTA 1PPZA 1XUIA 2ZG0H 5GCHG 3MNSA 1GI3A 4HFPB 1XKBC 3AAVA 4B1TA 2G51A 1GI5A 4IGDA 4Y8XA 1ARCA 5E2OA 3UB0A 1NBME 3SW2B 1DWCH 1GBKA 1A4WH 1FV9A 1KXEA 1TYNA 2GKVE 2VBCA 3P8OA 4AX9H 1HAXB 3RMNH 1V2KT 2FM2A 1HXFH 1O2XA 4FOUC 2GZ8A 1O3HA 2CHAC 5DK1A 5ABWA 3MTYA 1HCGA 3LOXA 2HLDD 2H5CA 3H09A 2F3CE 3CENA 1YPLH 1DDJA 2VVCA 3PV2A 3SU2A 3IG6B 3QTOH 5EJZA 2ZU4A 2H1UA 1TX6A 3QTVH 1ELCA 1P2KA 1COWD 1YF4A 3MU8A 1SFQB 3AW1A 1QL7A 1T8NA 3BTFE 1QCPA 2OQ5A 4FVDA 1A5IA 2HNTF 4MTBA 4NFEA 2J9NA 2Z3CA 1GVKB 1SR5C 2ZCKP 3A7WA 3SUGA 3EAJA 1SGTA 3BTME 3PO1B 3MQKC 4UFEH 3KCGH 3VG8A 4MNYA 4CBOA 3QZQA 1AWFH 5EQRA 4I31A 2BDBA 2VGCC 3SGAE 5J4QA 2QF4A 2SFAA 2I6QA 2QV1A 2STAE 2VIOA 3GY6A 2PW8H 1YY3A 1G3CA 1NU9A 3S9BA 1BB0B 2AS9A 1CSOE 1FIZA 1OWIA 2GP9B 4WMFA 1H8IH 1ZGIA 3KL6A 3GCHB 5HGGA 1G2MA 2XCNA 1AVWA 1IQHA 1V2JT 2UUJB 5HIYA 3L3TA 4ZKOU 1S83A 2TGTA 3MU5A 3SYJA 1EZXC 4OGYA 4MLFB 3SV7A 3KQDA 2H6MA 1C5VA 1LHCH 4Q80A 2GGVB 1MMJN 4D7GA 4BAHB 1UCYH 5C17A 3EA7A 3HK3B 1HIAA 2ZHQH 4NIWA 4NA8A 4DIIH 1SGYE 3O8CA 2KAIA 4B2CA 2A4OA 2C8XB 2FOEA 5ESBA 2ZDAH 4XE4A 3ZZ9A 3MFJA 1O3OA 1SMFE 3SNDA 4Q2KA 4B71A 1D6WA 1MH0A 1MZAA 3LGTA 3P8GA 1V2RT 1C4Y2 1MD7A 4A1VA 2ZA5A 1IQIA 1DE7H 1YPHC 2B0FA 3DFJA 4A6LA 1O5AB 1W14U 1Z71A 2Z9IA 5DN6D 2FX6A 3GDSA 3CS0A 1KDQB 2EI6A 3PTBA 4DURA 1TNJA 3BIVH 3ZVCA 1OKXA 1O5DH 1OSSA 1ZOMA 1LVMA 4Y71A 1H8HD 3P70B 8GCHG 1SFIA 3QGJA 2KCAA 1W7GH 2BD9A 2JH0D 2O8TA 2L6OA 3BSQA 4YXWD 1HGTH 1GJAB 2PSXA 1Y5UT 4WH6A 2BVXH 4IBLH 3MO6A 4K1SA 2H9HA 2GZ9A 3BF6H 1FDPA 2OLGA 2W26A 3RXCA 4MDSA 5ETXA 1AUTC 2KFWA 4DG4A 2JETC 1C4V2 1A0HB 1GI0A 4KELA 5B6OA 2UUFB 1IQMA 3E0NB 1Z6EA 3PMAB 2C8ZB 1DXWA 1P2IA 4MPXA 5I46H 1K1NA 4XBBA 1DVAH 3U8RH 4AFUA 3RMLH 4NCYA 8KME2 3FAOA 2W6ID 5EQQA 2BOHB 2Y81A 1SOTA 2A2QH 2HALA 1TLDA 4R8TB 1WYKA 1NFUA 2AFQB 1ZRBA 3E91A 1E79D 1SGDE 2Z6BD 5EGMA 3Q3YA 2FI5E 1VCWA 3SI3H 2P93A 3U28C 1P3CA 2BXUH 1GBHA 2IPHA 3ZZ8A 1HJAC 2Z9KA 1RGQA 4B6EA 1ZPZA 2WPJS 2QGRA 1ZRKA 4H42U 1ETTH 1ORFA 1SQRA 3A86A 1QTFA 1DANH 1UHBA 2Y7XA 3ZZAA 3WW7A 3ZZ7A 5FAHA 1GHZA 4YT7H 2PFEA 4ACAA 3LGIA 1WTHD 3OYPA 1F0TA 3U9AH 4D76A 1O2QA 3OTPA 1C5XB 1AE5A 2VIVA 3SQEE 1SG8B 2RA0A 4U32A 2XC0A 1MTNC 2QXHA 2SNVA 1O3AA 3U1JB 3DD2H 3HK6B 1GBIA 1GL0E 3FZDA 2OP9A 1O5BB 3N7EA 3AVZA 3QUMP 4X8VH 1OWKA 7GCHF 4P02A 1GHVH 1O33A 3U98H 1GHWH 1D9IA 3H5CB 1QFKH 1VITH 2GT7A 3VB3A 3MMGA 4YESB 2TRMA 1T8LA 2V3HH 4F4OC 5F03A 1AI8H 1QB6A 3MI4A 4X6OA 1EAUA 5A8ZA 1BTZA 1O3NA 3M5OA 2AIPA 2PUXB 1IQFA 1QY6A 1C2IA 2FOGA 4GCHF 3S69A 1WUNH 4NIVA 3T26A 2XBWA 1ZPBA 1VJ9U 1ZZZA 3QLPH 1E36B 1O2PA 3TNSA 3SZNA 1M9UA 3BEIB 3KF2A 1YPKH 3NKKA 1GBAA 3DA9B 3GY5A 2VINA 1FLEE 1TRYA 3C27B 3K6ZA 2BDIA 1D6RA 5DP7A 5C1XA 3ZVDA 4KKDA 3ZVEA 1UTKA 3I29A 5GIBA 3GDVA 1P0SH 1SGQE 5L30H 1GI1A 1QRXA 1NO9H 3MH7A 1SQTA 2ZC9H 4RT0A 3F2GA 4UDWH 5BPEA 2KR7A 1VZQH 1ZMLA 1T32A 3L6PA 3RUOA 4DVAU 3M5NA 1QA7A 3VB7A 2AMQA 1CA0B 4JK6A 1NRQH 5A0BA 2RDEA 2P8OB 1TQ0B 2G55A 3E16B 4FU9A 1AB9B 4THNH 2SGAA 3DHKH 1NTPA 2FX4A 1AY6H 2GCHG 2OCVB 2HRVA 1FXYA 3Q3XA 1AB9C 3HATH 3PB1E 1VGCC 4U01A 2VIQA 3URCA 1O2UA 4O3TA 1W11U 2O8LA 1O36A 1HBTH 2RDLA 3GY8A 3KNXA 3SHCH 1PPBH 3BTHE 2PSYA 2JDID 4JMYA 2P95A 4BTTB 3M37A 4D9RA 4AFQA 4H4FA 4Y79A 1QBOA 3DSOA 1DSTA 1D3QB 1HUTH 3PTNA 4ZHMU 1SLVB 1V2UT 2WYJA 3RXAA 2ZTXA 3MNCA 4Y0YE 1AZZA 3E1XB 2ZTZA 3KYGA 1BTYA 1S6HA 2ZFPH 1O2GH 3K9XB 3AW0A 2D26C 1MKWH 3M7TA 2TIOA 3MH4A 1G3DA 2LNCA 1FQ3A 1C2FA 3VXEH 1HAZB 2NWNA 3RXUA 4YO9A 1FX0B 2Z3EA 3RC4A 3TK9A 1AFEH 4TSFD 2JIZD 2BYAX 1G37A 2FTMA 1WBGB 5C94A 1W8BH 1GVZA 1QB1A 1NRRH 1RFNA 1KMHB 2O8WA 3M3SA 5AHGH 2VH6A 2JH6D 1XVMA 1C5OH 1ELEE 1RIWB 3SO3A 3Q77A 1MAYA 5DG6A 1W2KH 1EAWA 1HAIH 2G4TA 1EOJA 1HAYB 1W13U 1AUJA 1BMAA 4D8NA 3RXFA 1C5ZB 1SQOA 4YOGA 1A5HA 1QBNA 3RXSA 3I77A 4JYUH 3KQ5A 1A5GH 5C20A 1E1RD 2V0BA 2BVSH 3KQBA 1NN6A 4IMZA 4MG3A 3RM2H 3SUDA 4TYDA 1UVTH 3RXPA 5EJLA 3HKIB 4P00A 1C2DA 4HTCH 1ZMJA 3GISB 1CHOF 4NGAH 1TNGA 1EQ9A 4K5ZA 4JZ1A 5LPRA 1LDTT 1YLCA 2BY9X 3RC6A 2PUQH 4ISNA 1Y59T 1BDAA 1SHYA 1VITF 2BLWA 2BM2A 1TPOA 5AF9H 3A87A 4NG9H 3BTTE 1RTFB 3UNQA 1C4U2 3GY4A 1MTWA 1H9LB 2ZFRH 5TCCA 1GG6B 1O2KA 2BOKA 2G5VA 5F8ZA 4BXWA 1C5TA 3GCHC 1GBFA 4X1SU 1FUJA 1OWEA 3SU5A 1C2HA 1GJBB 4XBDA 1DOJA 1S82A 1F7ZA 5T3HA 2OBOA 3TH2H 4O9VA 4F48B 4AG1A 1MTNB 2WPHS 1SGIB 4AZ2B 1OX1A 3AAUA 1TBZH 3SI4H 2Q1JA 1TPAE 2J34A 1KXDA 2XBYA 3LIWA 2FOCA 2CXVA 1UTPA 1ID5H 1JOUB 1V2WT 1MABB 3F6UH 2GCTC 5CMXH 1GCTC 3VB4A 2W3IA 1A7SA 2F43B 3UAIC 3KQEA 3URDA 1NC6A 2LELA 3D23A 3PRBA 4GLYA 3KQCA 9LPRA 2XC5A 2ZU1A 2J92A 1K21H 2BD3A 1TPPA 5A09A 1J16A 2JJ2D 3FP7E 1KTTB 1K1OA 5EXMA 1YCPH 1DPOA 4CRDA 4I7YH 4JK5A 1UVPA 3DCLA 1T8OA 2OC8A 3OAAD 1WTGH 5DP5A 4LZ1H 1EPTA 4I8LA 3M35A 2M2AA 5T6GA 5DO4H 2V7QD 1XUFA 5DP9A 1DLKB 5T6DA 3TH4H 1SGFA 4YZUA 1EPTC 3O8RA 4Q7XA 1KY9A 3QDZB 2GT8A 2F9VA 3BEUA 3VGCC 1P10A 2PP6A 5JB8S 3NUMA 1UTJA 2Y7ZA 4CHAB 1C2GA 1C5PA 1TIOA 4KTSA 4OM9A 3RXLA 1HJ9A 1ANEA 1LHEH 1GJDB 2BDYA 1P11E 1Z8IB 2QC2A 1L1GA 1AN1E 1GBCA 4ABJA 1YPJH 3RXVA 5A0AE 1Y5BT 4NSYA 1O3DA 4E05H 1F92A 1LVYA 3S7KB 2AGEX 1HB0B 2W5EA 1P9UA 1C5SA 2VWMA 1UK3A 2G8TA 1V2TT 5FL7D 2KM0A 3EYDA 2SGPE 3ZVFA 9ESTA 3BTKE 4CRBA 2A4RA 2D1JA 1IQLA 4DT4A 5EJ1A 1AD8H 3ZZ4A 1CT4E 4WH8A 1DWEH 3S0NA 2WHXA 3ATIA 3RXTA 1TNIA 2P8OC 3M7UA 1JIRA 2WV4A 4X2VA 4ZKRU 4AFSA 4AG2A 2ZFTA 3F9GA 2ANWA 3RXDA 3UQOA 1C2EA 2WINI 3SZEA 1C9PA 1KLIH 2FI4E 3A8CA 2HVYB 2F91A 3SJOA 5CE1A 1Y3YA 3E6PH 4BTIB 1KDQA 1SHHB 1IQNA 3PYHA 1NESE 4Q7ZA 1XUKA 5JBBS 1K2I1 1GMHG 5GCHF 1A3EH 1QA0A 1C5NH 2VWLA 1SLUB 1HFDA 1UHBB 2FYQA 4XRNA 3ENSB 4E06H 5EPYA 1K1MA 2W7SA 1G32B 3LT3A 1TNKA 1MBMA 1GCDA 5JBTA 2RCEA 3QZRA 4K8YA 2FI3E 2ZZUH 1O30A 1SGCA 1FZZA 5A0CA 3W94A 2BDCA 2R3YA 1BMNH 2AH4X 1YCPM 3UPEA 2QCYA 4F55A 1P2OA 5PTPA 4FUHA 3TLOA 1DY9A 1THPB 3GYLB 3KN2A 3M7QA 4FUEA 4IS5A 3ZIAD 1TABE 1O3LA 2GMTC 3QO6A 1O5EH 1A0JA 3RXGA 3TH3H 4CBNA 1O5FH 3CP7A 2WSSD 2QIQA 4Z6AH 2PGQB 4WVPE 2FTLE 1O2VA 5HM2A 1EATA 2BZ6H 2WPLS 2YMSC 1ZJDA 1TX8A 4CRFA 1BA8B 1ESBA 2QXJA 5L2ZH 3MYWA 1Q2WA 3PLBA 1NS3A 1TNLA 4FUDA 3ITIA 5EG4A 1GL1A 3U8TH 4ABGA 5A8XA 1RJXB 1WQVH 5DP3A 4Y8YA 2ZHEH 3FO8D 1AFQC 1DY8A 2K1QA 4ZHLU 2AGGX 2G4UA 2A0QB 4I8KA 1GVLA 4INLA 3Q76A 3HGNA 1THSH 1O3MA 2Y5GA 1AMHA 3PWCA 3RU4E 3TK6A 1E34B 4JZFH 1WAYB 2C8WB 4NFFA 1OWDA 1SB1H 4BAQB 1FAKH 2LP6A 2VH0A 3FVFB 2F9PA 3OSYA 1NT1A 7LPRA 3GY3A 2SGEE 2BY6X 1PJPA 1W7XH 1GDQA 1MUEB 1C1NA 1O32A 3UTUH 1GI9B 1L4DA 1ANBA 3OEED 5FXLA 1O0DH 1ARBA 4UEHH 1BHXB 2Y82A 2OK5A 1FY8E 2A4GA 3SV2H 5KEDA 1FIWA 2ZHFH 1SLXB 1QJ6B 1MQ5A 2C93B 1TE0A 1HV7A 1C1MA 2ZQ2A 2DE9A 1F0SA 3VXFH 1OWJA 3EA8A 5J4SA 1SL3A 1NZQH 3M36A 3SNAA 4QT8C 4NIYA 4INKA 7KMEH 1JMOH 1MU8B 1C2KA 2ZEBA 7ESTE 5AFZH 3LGUA 1PPGE 2R3UA 2R2WU 2SGDE 2GV7A 4ZMAH 2J4IA 1F5RA 1Y3XA 3EBNA 1SPJA 1DLEA 1GMHF 1DUAA 1Y3VA 4MQAA 5T1VA 3ZZBA 1H8ED 2LPRA 2FOMB 3BTQE 3W95A 4A7IB 2ZFFH 4FUJA 4JYTA 1HJAB 2VGCB 2R0LA 4JZEH 4DOQA 2NU2E 5C5OA 3M61U 2BD7A 5GPIB 5C3NA 2AERH 1ZTKA 2V6NA 1CGIE 2OC1A 5A2MH 2WUCA 1T8MA 1H9HE 2Z7FE 1N8OC 1C5YB 1YLDA 2L74A 3BG4C 3P6ZB 3S7HB 3KIDU 1RTLA 1P01A 1F5KU 3VGCB 2ANKH 1E38B 1XKAC 3MH6A 4DJZB 2GMTB 1Z1IA 3HKJB 1UJ1A 5EQSA 4X1PU 2EI8A 1O35A 4ZAEA 1N6XA 1J17T 2TGDA 2V3OH 5C0TA 3OX7U 1KXCA 1P02A 1XUGA 4BOHA 4Z0KA 1HAOH 4BTUB 2FPZA 4IN2A 1OP0A 1S0RA 3RP2A 2FP7B 1ZPCA 4I86A 1IHSH 2PV9B 3TITA 3UQVA 3NK8A 1TQ7B 1CO7E 2FIRH 4FVBA 1V2NT 3V0XA 1W0ZU 2ZPQA 1FY5A 3B9FH 1AKSA 4A5TS 5CDFE 2PHBA 4ISHH 3F68H 3TIUA 4ZUHA 1CT2E 1GBJA 2XOKD 1EZSC 4RT1A 1MKXK 1QHRB 5AVDA 1ELVA 3OE7D 4UFDH 1PQAA 3FKSD 2Q6GA 2XW9A 2CK3D 2J98A 3M3VA 1LPKB 3SBKA 3O8DA 6ESTA 4TPIZ 3N99A 3PM3A 4A1XA 4OS5A 2XWBI 2YMSD 1Z8JB 1O3KA 3ZYEA 3UUZA 3DUXH 4OGXA 5JYIA 4BANB 1NRNH 1UVOA 1GGDB 2BD5A 1P04A 1VITG 3LONA 1FAXA 2ZU3A 3UR9A 3LU9B 1NU7B 1YM0A 2C90B 4CR9A 5TJXA 2BD4A 3FZZA 1SGFG 5DGJA 5FX6A 1A2CH 1CT0E 4KTCA 2OD3B 1EFRD 1LTOA 5FBIA 1ABIH 1YKTA 2FDAA 1YPMH 3M5LA 1CBWB 1P57B 3RXEA 1KLTA 1CE5A 2THFB 2KCPA 3TJNA 1AO5A 1L1NA 2PTCE 4ISLA 1SGNE 2ZGJA 4XBCA 2VB0A 1C1WH 3SGBE 2XYAA 1WCZA 1O2OA 3KYFA 8GCHF 1WDIA 1MBQA 3EA9A 3E0PB 4I8HA 3SORA 4IMQA 1JRSA 1TAWA 4WY3A 1DWDH 1TRMA 1FY3A 1GHBG 2I6SA 2Y80A 4LK4A 1P2QA 4ZH8A 3MU4A 4CR5A 2AIQA 1FJSA 4CH8B 3F2FA 3SU6A 1YGCH 2ZGHA 1C5UA 3SUEA 1CQQA 4BAMB 4I33A 1NM6A 4I8GA 4ZKNU 3PMBB 1S6FA 2A32A 3GY2A 1SC8U 5E8EH 2FMJA 4MPWA 3U1IB 3V7TA 1LHDH 3STJA 4K69A 1JRTA 5CHBA 3UR6A 1B7XB 4CHAC 3GICB 2A2XH 1YBWA 3QX5H 1OHHD 1O3CA 4YOIA 2PWXA 4Q4LA 1B0FA 3BV9B 3ATKA 5JBAS 2R2MB 4ASUD 4GCHG 2BY5X 5FHTA 4Q63A 3S9CA 2UWLA 5E0HA 3PV4A 3LDXH 3U69H 1TMTH 2HVXA 5FPSA 3UOUA 2D8WA 1DT2A 3FP6E 1PQ7A 3A81A 1K1PA 3OY5U 4U2WA 5L6NH 4JZDH 1O2NA 1FONA 1GHAG 1BRAA 2VIDA 1B0EA 1TGBA 3LJJA 4KTUA 2BZAA 3NZIA 1ZTJA 4YTAA 1ZGVA 3A8AA 5HIZA 1CVWH 1BOQA 1HAGE 1H9IE 1A3BH 2VWNA 1EOLA 1DITH 1W3CA 1GJCB 1HNEE 2XWAA 1BCUH 2FLBH 3TGKE 1GHXH 2H5DA 1ZJKA 4D9QA 1KSNA 1ZR0A 3JZ1B 1NFWA 3A83A 2ASUB 1MCVA 1ZSJA 3DT0H 4WXIA 5LGOA 3SU0A 3DSPA 3BTDE 2HPPH 1INCA 2UUYA 3T27A 1TOCB 4ZROA 3PO1C 4AGKA 1GJ9B 2JH5D 3A85A 2GTBA 4LZ4B 3P95A 3U8OH 3QWCH 4VGCC 1O5CB 1MKXH 3T2NA 5EODA 5LPEA 4TPYA 3ZZ5A 3ATWA 2Y5HA 4I8JA 1EX3A 4MNXA 1SGEE 2FWWA 3MH5A 3LC5A 3IWMA 2PTNA 1LPZB 2PR3A 5JB9S 2ZPSA 3Q3KA 3TJOA 1HLTH 4RKJB 1S81A 3BTGE 5KGOA 2XC4A 3LJOA 1FPCH 1UTNA 3UREA 3PWBA 3LGYA 4B74A 4O97A 5C2ZA 2RFKC 1HJ8A 4FUGA 2BX3A 2YMSB 3LH1A 1LCYA 1C9TA 3FANA 4X8UH 2ODPA 3MO3A 3LPRA 1O38A 4BXSA 1PPHE 3MWIU 3LGWA 5I25A 4TWWA 3ZYDA 1ZTLA 1QURH 5G4BA 1JBUH 2V3MA 3TPIZ 2FLRH 1FY4A 3FFGA 3OEHD 5BRRE 1YP9A 4YM9A 1HAVA 1ZYOA 2ZP0H 3GCOA 2XNDD 1D4PB 2J94A 2FXRA 1AQ7A 2BQ7B 1IQGA 2OC7A 4IW4E 3SUFA 2FOBA 2AMDA 1C2LA 5GXPA 3P92A 1EP5A 1P06A 3F3BA 4RKOB 4J2YB 4UFFH 2ZDNA 2WZQA 1O2IA 5T6FA 1WQSA 1KLJH 1JWTA 1U6QA 1THRH 2A7CA 2J5UA 4X1RU 1O2SA 1YC0A 3VB5A 2IJOB 5SGAE 3GCTF 1EB2A 2EC9H 3O8BA 2A5AA 1GJ7B 3ELAH 1HAVB 5HKKD 4UE7H 3P17H 5EPNA 3A88A 5FCKA 2WV9A 3RMOH 3A84A 5FX5A 3TNTA 2R0KA 1OP8A 1GI2A 1A0LA 3E8LA 4NWLA 1E1QD 1HDTH 2Y6TA 1LKBA 1V2VT 3G01A 4WJG2 7GCHG 3WY8A 5IK2D 1PPEE 1E37B 1WV7H 3SN8A 4JYVH 3ZV8A 1C2JA 1HXEH 2A5KA 1CBWC 2EA3A 3LGVA 4R0IA 3D65E 1V6DA 1H4WA 1UK4A 1J14A 5C1YA 1Z7KA 1W12U 1IAUA 1LO6A 2QY0B 1TGSZ 1UTMA 2ZECA 4OS6A 1C5QA 2HNTE 1W0YH 1GWAA 3SNCA 1PPCE 2UUKB 1ELTA 3EE0B 1LQDB 1QBVH 3AK5A 1Y3UA 1TB6H 1KTSB 1S6LA 1BMLA 1V2OT 3A8DA 1MTUA 2TPIZ 1TBQH 1O2ZA 5EW2H 2J97A 2ZQ1A 1MU6B 4K3JA 1V2LT 2CF8H 4DCDA 1GG6C 1Z6JH 1Q31A 2WV5A 2VVVA 4YLUA 3MNBA 4CRAA 1O2TA 1BITA 5DPAA 3ZZ3A 3FN8A 3CS7A 5GWZA 1O5GH 3IITA 1VR1H 2ULLA 4RSPA 1BRBE 2BDAA 4AYYB 1KYNA 1BT7A 4E7NA 2Z9JA 2NU0E 4B2BA 4TWYA 3BTWE 3KEEA 1C5RA 1RXPA 5H4IB 1O39A 4DIHH 3SV9A 1P12E 1GMCG 2ZHWH 2WPDD 1TGNA 3EGKH 4AYVB 1O2RA 1RTKA 1CHOG 3STIA 1HPGA 3MU0A 3NPSA 1EP6A 1SLWB 1XVOA 3ZZDA 4FUCA 2F9OA 1J8AA 3UWIA 3WWBA 3PLPA 6GCHG 4DW2U 4K2YA 2ZCHP 1ESTA 1K1JA 4CH2B 2ZU2A 5C67A 1D3TB 4Y8ZA 6LPRA 5JDUB 1OYQA 2W3KA 1P05A 4TY7A 1FY1A 1O3PB 1TALA 4GHQA 3ZV9A 5F6MA 1CU1A 4B2AA 3F0OA 3LKWA 2F4LA 1V2MT 3BTEE 4X1NU 2XBXA 1GI6A 2WPKS 2QF0A 1TOMH 3F2HA 3A7VA 1WSSH 1AWHB 2W7UA 1BUIA 2XRCA 2C3SA 2BD2A 1DS2E 2G5NA 1GJ5H 1XM1A 2WPIS 1LHFH 1FI8A 2FOFA 4GVUA 1DUEA 1K1LA 2HOBA 1P3EA 3RU4T 4TY6A 2FEQH 4DY7B 2Z94A 4BAKB 4NWKA 3RXQA 3SNBA 2ODYB 4ZCNA 1DM4B 1K22H 3S9AA 4X1QU 1A61H 3MNXA 3H7TA 1GBLA 2TGPZ 1TMUH 3A8BA 3Q00A 2B5TB 4FUFA 2BTCE 4IN1A 1C1RA 3LC3A 3K65B 1ELAA 1PYTD 2VIWA 2C4FH 5GJ4B 1EB1H 2FO9A 1C5WB 1HAHH 4ACBA 1ANDA 1SBWA 4ABBA 1G30B 1WXRA 1AVXA 2HGTH 5DP4A 2ALVA 4NIXA 2O8UA 2QA9E 2QE7D 2A5IA 1T4VH 1VJAU 3JZ2B 1K28D 6GCHF 4NSVA 2B8OH 2RG3A 1NROH 2P16A 1XUHA 1FNIA 2BLOA 2ZO3H 1BJUA 2BB4A 3RLWH 4YOJA 3F9FA 2AEIH 3OU0A 1DSUA 1VCQA 3TVJB 3UFAA 3ZVAA 3PMHB 4B75A 3R0FA 2W6JD 4CREA 4GUXA 2ZGBH 4Y76A 1VKYA 3ODFA 4OS2A 3NCLA 2HLCA 1F2SE 2A45B 1HYLA 2EI7A 2QN5T 2J38A 2XXLA 1F5LA 1BMMH 1G3BA 4ISIH 2FOAA 4O3UA 1NFXA 1O3EA 1XMNB 2A7JA 2UWOA 2BVRH 2SGQE 3OFND 1FPHH 4Y11E 4WMDA 3SJ8A 3M3TA 3KGPA 1AE8H 2ZDLA 1EJMA 1W0KD 2G52A 4X8SH 3OY6U 2PKAA 3SHAH 2F9UA 2ZIQH 3SU3A 3RMMH 1SKYE 2H9EH 2EQNA 1L4ZA 5C5NA 1K0HA 1TX7A 4X6NA 1EUFA 1L2EA 1NBMD 3NXPA 1Z8GA 2KZ4A 4AN7A 3RXIA 1BHXF 3VEQB 4AC9A 1OWHA 1C2MA 1JXPA 4CRGA 1A46H 4H6SB 1KXBA 1NRSH 1BJVA 5C0UA 4X6MA 4Y7BA 1EJAA 3H7OA 2K7XA 3T5FH 4LOYH 4HG6A 1NFYA 2VNTA 3OTJE 1F0UA 2FZZA 5A8YA 5LH8A 5DSFA 1RD3B 1BTUA 2JKHA 1ELGA 4B73A 4ABEA 2O9QA 1PQ5A 2NU3E 4ABAA 1TONA 2Q6DA 1ESAA 5F53A 1W0JD 3F1SB 3V12A 1PYTC 1GPZA 2PKSB 1BRUP 1RRKA 2AMPA 4H6TA 4X2YA 1GBEA 3F9HA 2STBE 2QXGA 2ILNA 2GDEH 4ABDA 1ZHPA 2PKSC 1UVSH 3ESTA 1LKAA 3A7XA 1Y3WA 2V35A 1QZ8A 3E90B 1GGDC 4A1TA 4CRCA 3SOSA 3SQHE 3RU4D 2NU4E 1YYY1 1C5MD 4AB8A 3T25A 3TK5A 4FXGH 2ZWLH 4IC6A 3SV6A 1XX9A 2QXIA 3MHWU 2QF3A 4XDEA 4Z1MD 1AIXH 1DWBH 2ZFQH 4J1YA 1DX5M 5L2YH 4INHA 3PROA 1NY22 3RLYH 2P59A 3F0PA 1LQEA 3UIRA 1V2QT 3SU1A 1XXFA 1C5LH 3M5MA 2K0QA 1UTQA 1MCTA 1QNJA 4GAWA 1H8DH 3RDZA 2ANMH 4ZHAA 4MNVA 1XUJA 1ELBA 1KXFA 2BLVA 1IQEA 6CHAB 4D7FA 1VGCB 1BMFD 4FUIA 1QR3E 1NRPH 1BTXA 2ZCLP 1GI8B
chains in the Genus database with same CATH topology
5HMAA 1YPEH 1P09A 1SVPA 1LVOA 1DXPA 5AFYH 4BNRA 1AFQB 1C1UH 2F9NA 2GD4B 1BTPA 4B76A 1QB9A 1ELFA 1BTWA 2ZDVH 4NZLA 1EAXA 5JBCS 1N8OB 2YNAA 1TGTA 3ZZ6A 1W10U 2OTVA 3RXJA 5EW1H 3AASA 3P8FA 2AGIX 2UWPA 1FN6A 5GDSH 2ZI2H 1FN8A 3KHVA 3FP8E 1WOFA 1TA2A 1KXAA 1BZXE 2C8YB 2ZNKH 2FESH 1CA8B 1GBTA 1O2MA 3TGIE 1YPHE 4AORA 1QQ4A 2JETB 2P3UB 3P8NA 5TCAA 1MTSA 4OS4A 3VPKA 2OBQA 1GBDA 3UOPA 1GMDG 5DP6A 2HNTC 4XSKU 1Z1JA 4GSOA 4XFQA 1CGHA 2ZDKA 4HZHA 2A31A 4X8TH 1J9CH 2CHAB 2ZGCA 1V3XA 4OS7A 1ZSLA 1BTHH 3ZVBA 2YNBA 1T31A 5K0HA 2A1DB 1MAXA 2P3FH 2XNIA 2HWLB 4HI3A 4Y0ZE 1EXFA 1C1PA 3TJVA 3B8JA 2ZGXH 1ACBE 3NWUA 1C1OA 2J95A 2TBSA 2F9BH 1SSXA 4WWYA 4DGJA 2WUBA 4GPGA 2SGFE 1OYTH 2QAAA 3RM0H 1J15A 2BY7X 1HAPH 3ATLA 1A1RA 5IYTA 1GHYH 3BEFB 5EXNA 2BQWB 2VU8E 4K1TA 1ABJH 4FU7A 2CF9H 1VCPA 3SNEA 4KGAA 1FMGA 4BAOB 2ESTE 4NA9H 3RXKA 1QQUA 1MKWK 1P2NA 5ESTE 1ETSH 2PKAB 2YOLA 1TNHA 2ZTYA 1YCPK 1L1JA 3UWJH 2XTTB 3RXBA 1EJNA 1S0QA 3QGNB 3GOVB 4ESTE 4M7GA 1QRWA 3A7YA 1IHTH 2CGAA 2BD8A 2OQUA 2BXTH 3SJ9A 4Q7YA 2GVFA 1GI4A 1P8VC 1NPMA 3QK1A 2GDDA 1Y8TA 1YPGH 1S5SA 1CGJE 2B9LA 1TA6A 5LPFA 2ZPRA 1GDNA 1EASA 1AKSB 5C1UA 1SI5H 4Y10E 4F49A 1BRCE 3A80A 5E0GA 5CHAB 3ZVGA 2A7HA 2VJ1A 1O2LA 1BBRH 1RIWC 3RXRA 2XCFA 5FCRA 3V13A 1QGFA 1OPHB 3SJIA 5CHAC 1TFXA 3GDUA 3ATMA 1O3BA 2QYIA 2CMYA 3QN7A 3GYMA 4KP0A 1WU1A 3UY9A 1O2WA 4WMEA 2FS8A 2RA3A 1MD8A 1V2ST 4RN6A 5IDKA 1Y5AT 4K1EA 1ZSKA 4NA7A 1RS0A 3A89A 1SGPE 3GY7A 4ZXYH 1OP2A 1IQKA 1ETRH 2CV3A 3HPTB 3SGQE 1MTVA 5EOKA 1LPGB 1TMBH 2ZU5A 1XXDA 1S84A 3HGPA 2Z9LA 1N6YA 3MOCA 3RXOA 1O2HA 1QJ1B 3MO9A 4AB9A 1BBRK 4U30A 1UMAH 4IC5A 1V2PT 2FYRA 5FBEA 2GX4A 1AVGH 1PPFE 1GJ8B 1E35B 4AGJA 1TPSA 3BIUH 5HXFA 1BQYA 1G3EA 4PROA 1O3IA 2ZFSA 4JCNA 1O3GA 3RXMA 3D62A 2ZHDA 3BN9A 1TBRH 3DFLA 1C1SA 3T62A 1DFPA 2HPQH 3RC5A 3ZZCA 2OINA 2H2ZA 2FODA 1O3JA 1AGJA 2VVUA 4UONA 3I78A 3EDXB 2CJIA 1QRZA 4O03A 1AHTH 1GCTB 2P3TB 4I32A 2BQ6B 1F0RA 1GDUA 1OXGA 4ZXXH 5HYOA 3T29A 3D49H 2GCHF 6CHAC 5K7RA 1C1TA 2DUCA 1P03A 2PGBB 4ABIA 3GCNA 1O2JA 2R9PA 1OOKB 3BG8A 3GCTG 1ELDE 1O3FA 3K2UA 1QJ7B 1IOEA 1SOZA 4VGCB 3V3MA 3ODDA 4MNWA 1GMDF 1BIOA 1UVUH 1GBMA 1S85A 5DP8A 2D2DA 2DE8A 4NZQA 4E7RG 1EPTB 1E0FD 2M5TA 1EAIA 1GJ4H 3BG4B 2FS9A 2CN0H 2LIZA 3MU1A 1QL8A 1X7AC 1O31A 3SJKA 1GMCF 1PFXC 4AFZA 1P2MA 1GJ6A 4UFGH 1O37A 1UTOA 2B7DH 2BHGA 4XOJA 3R3GB 5F8TA 2Z9GA 2SNWA 4GHTA 4JZIA 1OS8A 1GI7B 1LVBA 4X2WA 1G9IE 3PMJA 1B5GH 1D3PB 2BX4A 2ALPA 2XBVA 1Z8RA 1TRNA 1N1LA 3L33A 1L0ZA 2IN2A 3TJUA 1H1BA 1PQ8A 1C1QA 2WPMS 1BBRE 1HIAB 3B23B 1UK2A 2TGAA 2BDHA 4ABFA 2GV6A 2GZ7A 1LMWB 2ODQA 2VIPA 4K8BA 3SV8A 3A7ZA 1G2LA 1GHBF 1TGCA 5EU8A 4Y7AA 1ANCA 3RXHA 3LH3A 2Z3DA 2AYWA 3A82A 2G81E 3A7TA 1T7CA 3F9EA 1LHGH 1ZLRA 4LXBH 4OS1A 3PLKA 4A92A 1P9SA 1DICA 3K6YA 3TU7H 4AOQA 1K9OE 1IQJA 1JIMA 3N7OA 1Q3XA 4ABHA 1AU8A 1P2JA 1EKBB 1UCYK 1MQ6A 2ZF0H 1G36A 4SGBE 4Y6DA 3EQ0H 4WF8A 1SGRE 5DJ7A 2BDGA 2Q6FA 1EZQA 4ASHA 1O34A 1UCYE 5FPYA 1AZ8A 2F83A 2WYGA 2OUAA 4MPVA 4X0WU 5JPMH 3VFEA 1O2YA 8ESTE 1QIXB 2OXSA 1C1VH 1SQAA 4YT6H 2GCTB 4FU8A 4ISOA 4K60A 1GBBA 1CA0C 5EXLA 1GHAF 3E3TA 1HRTH 1MZDA 1UTLM 4HGCA 3UNSA 1EZUC 3TGJE 3UNRA 1ZHMA 5E0JA 2VWOA 4DT7B 5E2PA 2BY8X 1ZMNA 4MVNA 2BMGB 2ZKSA 4X2XA 3VB6A 2G00A 4SGAE 2ZDMA 2KAIB 3T28A 2O8MA 1K1IA 5F8XA 2IOTA 4ZKSU 1TWXB 2BLQA 4WXVA 2OC0A 2NU1E 4UD9H 2A4QA 4FUBA 4X6PA 3SU4A 1ZHRA 4YLQH 8LPRA 2P94A 1CHGA 2H9TH 1T4UH 1KIGH 2ANYA 5DKMA 2PLXA 2J2UA 3C1KA 1UO6A 1D3DB 1QL9A 5HM9A 2FOHA 2Y5FA 4MPUA 2EEKA 5FPTA 1PPZA 1XUIA 2ZG0H 5GCHG 3MNSA 1GI3A 4HFPB 1XKBC 3AAVA 4B1TA 2G51A 1GI5A 4IGDA 4Y8XA 1ARCA 5E2OA 3SW2B 1DWCH 1GBKA 1A4WH 1FV9A 1KXEA 1TYNA 2GKVE 4AX9H 3P8OA 1HAXB 3RMNH 1V2KT 2FM2A 1HXFH 1O2XA 2GZ8A 1O3HA 2CHAC 5DK1A 5ABWA 3MTYA 1HCGA 3LOXA 2H5CA 2F3CE 3CENA 1YPLH 1DDJA 2VVCA 3SU2A 3IG6B 3QTOH 2ZU4A 2H1UA 1TX6A 3QTVH 1ELCA 1P2KA 1YF4A 3MU8A 1SFQB 3AW1A 1QL7A 1T8NA 3BTFE 1QCPA 2OQ5A 4FVDA 1A5IA 2HNTF 4MTBA 4NFEA 2J9NA 2Z3CA 1GVKB 1SR5C 2ZCKP 3A7WA 3SUGA 3EAJA 1SGTA 3BTME 3PO1B 4UFEH 3KCGH 4MNYA 4CBOA 3QZQA 1AWFH 5EQRA 4I31A 2BDBA 2VGCC 3SGAE 5J4QA 2SFAA 2I6QA 2QV1A 2STAE 2VIOA 3GY6A 2PW8H 1G3CA 1NU9A 3S9BA 1BB0B 2AS9A 1CSOE 1FIZA 1OWIA 2GP9B 4WMFA 1H8IH 1ZGIA 3KL6A 3GCHB 5HGGA 1G2MA 2XCNA 1AVWA 1IQHA 1V2JT 2UUJB 3L3TA 4ZKOU 1S83A 2TGTA 3MU5A 1EZXC 4OGYA 4MLFB 3SV7A 3KQDA 2H6MA 1C5VA 1LHCH 4Q80A 2GGVB 1MMJN 4D7GA 4BAHB 1UCYH 3EA7A 3HK3B 1HIAA 2ZHQH 4NIWA 4NA8A 4DIIH 1SGYE 3O8CA 2KAIA 4B2CA 2A4OA 2C8XB 2FOEA 5ESBA 2ZDAH 4XE4A 3ZZ9A 3MFJA 1O3OA 1SMFE 3SNDA 4Q2KA 4B71A 1D6WA 1MH0A 1MZAA 3LGTA 3P8GA 1V2RT 1C4Y2 1MD7A 4A1VA 2ZA5A 1IQIA 1DE7H 1YPHC 2B0FA 3DFJA 4A6LA 1O5AB 1W14U 1Z71A 2Z9IA 2FX6A 3GDSA 3CS0A 1KDQB 2EI6A 3PTBA 4DURA 1TNJA 3BIVH 3ZVCA 1OKXA 1O5DH 1OSSA 1ZOMA 1LVMA 4Y71A 3P70B 8GCHG 1SFIA 3QGJA 1W7GH 2BD9A 2JH0D 2O8TA 3BSQA 1HGTH 1GJAB 2PSXA 1Y5UT 4WH6A 2BVXH 4IBLH 3MO6A 4K1SA 2H9HA 2GZ9A 3BF6H 1FDPA 2OLGA 2W26A 3RXCA 4MDSA 5ETXA 1AUTC 4DG4A 2JETC 1C4V2 1A0HB 1GI0A 4KELA 5B6OA 2UUFB 1IQMA 3E0NB 1Z6EA 3PMAB 2C8ZB 1DXWA 1P2IA 4MPXA 5I46H 1K1NA 4XBBA 1DVAH 3U8RH 4AFUA 3RMLH 4NCYA 8KME2 3FAOA 5EQQA 2BOHB 2Y81A 1SOTA 2A2QH 2HALA 1TLDA 4R8TB 1WYKA 1NFUA 2AFQB 1ZRBA 3E91A 1SGDE 2Z6BD 5EGMA 3Q3YA 2FI5E 1VCWA 3SI3H 2P93A 3ZZ8A 1P3CA 2BXUH 1GBHA 2IPHA 1HJAC 2Z9KA 1RGQA 1ZPZA 2WPJS 2QGRA 1ZRKA 4H42U 1ETTH 1ORFA 3A86A 1QTFA 1DANH 1UHBA 2Y7XA 3ZZAA 3ZZ7A 5FAHA 1GHZA 4YT7H 2PFEA 3LGIA 1WTHD 3OYPA 1F0TA 3U9AH 4D76A 1O2QA 1C5XB 1AE5A 2VIVA 3SQEE 1SG8B 2RA0A 4U32A 2XC0A 1MTNC 2QXHA 2SNVA 1O3AA 3U1JB 3DD2H 3HK6B 1GBIA 1GL0E 3FZDA 2OP9A 1O5BB 3AVZA 3QUMP 4X8VH 1OWKA 7GCHF 1GHVH 1O33A 3U98H 1GHWH 1D9IA 3H5CB 1QFKH 1VITH 2GT7A 3VB3A 3MMGA 4YESB 2TRMA 1T8LA 2V3HH 4F4OC 5F03A 1AI8H 1QB6A 3MI4A 4X6OA 1EAUA 5A8ZA 1BTZA 1O3NA 3M5OA 2AIPA 2PUXB 1IQFA 1QY6A 1C2IA 2FOGA 4GCHF 3S69A 1WUNH 4NIVA 3T26A 2XBWA 1ZPBA 1VJ9U 1ZZZA 3QLPH 1E36B 1O2PA 3TNSA 3SZNA 1M9UA 3BEIB 3KF2A 1YPKH 3NKKA 1GBAA 3DA9B 3GY5A 2VINA 1FLEE 1TRYA 3C27B 3K6ZA 2BDIA 1D6RA 5DP7A 5C1XA 3ZVDA 4KKDA 3ZVEA 1UTKA 3I29A 5GIBA 3GDVA 1P0SH 1SGQE 5L30H 1GI1A 1QRXA 1NO9H 3MH7A 1SQTA 2ZC9H 4UDWH 5BPEA 1VZQH 1ZMLA 1T32A 3L6PA 3RUOA 4DVAU 3M5NA 1QA7A 3VB7A 2AMQA 1CA0B 4JK6A 1NRQH 5A0BA 2P8OB 1TQ0B 2G55A 3E16B 4FU9A 1AB9B 4THNH 2SGAA 3DHKH 1NTPA 2FX4A 1AY6H 2GCHG 2OCVB 2HRVA 1FXYA 3Q3XA 1AB9C 3HATH 3PB1E 1VGCC 4U01A 2VIQA 3URCA 1O2UA 4O3TA 1W11U 2O8LA 1O36A 1HBTH 2RDLA 3GY8A 3KNXA 3SHCH 1PPBH 3BTHE 2PSYA 4JMYA 2P95A 4BTTB 3M37A 4D9RA 4AFQA 4H4FA 4Y79A 1QBOA 1DSTA 1D3QB 1HUTH 3PTNA 4ZHMU 1SLVB 1V2UT 2WYJA 3RXAA 2ZTXA 3MNCA 4Y0YE 1AZZA 3E1XB 2ZTZA 1BTYA 1S6HA 2ZFPH 1O2GH 3K9XB 3AW0A 2D26C 1MKWH 3M7TA 2TIOA 3MH4A 1G3DA 2LNCA 1FQ3A 1C2FA 3VXEH 1HAZB 2NWNA 3RXUA 4YO9A 3RC4A 2Z3EA 3TK9A 1AFEH 2BYAX 1G37A 2FTMA 1WBGB 1W8BH 1GVZA 1QB1A 1NRRH 1RFNA 2O8WA 3M3SA 5AHGH 2VH6A 2JH6D 1XVMA 1C5OH 1ELEE 1RIWB 3SO3A 3Q77A 1MAYA 5DG6A 1W2KH 1EAWA 1HAIH 2G4TA 1EOJA 1HAYB 1W13U 1AUJA 1BMAA 4D8NA 3RXFA 1C5ZB 1SQOA 4YOGA 1A5HA 1QBNA 3RXSA 3I77A 4JYUH 1A5GH 5C20A 2V0BA 3SUDA 2BVSH 3KQBA 1NN6A 4IMZA 4MG3A 3RM2H 4TYDA 1UVTH 3RXPA 3HKIB 1C2DA 4HTCH 1ZMJA 3GISB 1CHOF 4NGAH 1TNGA 1EQ9A 4K5ZA 4JZ1A 5LPRA 1LDTT 1YLCA 2BY9X 3RC6A 2PUQH 4ISNA 1Y59T 1BDAA 1SHYA 1VITF 2BLWA 2BM2A 1TPOA 5AF9H 3A87A 4NG9H 3BTTE 1RTFB 3UNQA 1C4U2 3GY4A 1MTWA 1H9LB 2ZFRH 5TCCA 1GG6B 1O2KA 2BOKA 2G5VA 5F8ZA 4BXWA 1C5TA 3GCHC 1GBFA 4X1SU 1FUJA 1OWEA 3SU5A 1C2HA 1GJBB 4XBDA 1DOJA 1S82A 1F7ZA 5T3HA 2OBOA 3TH2H 4O9VA 4AG1A 1MTNB 2WPHS 1SGIB 4AZ2B 1OX1A 3AAUA 1TBZH 3SI4H 2Q1JA 1TPAE 2J34A 1KXDA 2XBYA 3LIWA 2FOCA 2CXVA 1UTPA 1ID5H 1JOUB 1V2WT 3F6UH 2GCTC 5CMXH 1GCTC 3VB4A 2W3IA 1A7SA 3KQEA 3URDA 1NC6A 3D23A 4GLYA 3KQCA 9LPRA 2XC5A 2ZU1A 2J92A 1K21H 2BD3A 1TPPA 5A09A 1J16A 3FP7E 1KTTB 1K1OA 5EXMA 1YCPH 1DPOA 4CRDA 4I7YH 4JK5A 1UVPA 1T8OA 2OC8A 1WTGH 5DP5A 4LZ1H 1EPTA 4I8LA 3M35