4F49A

2.25a resolution structure of transmissible gastroenteritis virus protease containing a covalently bound dipeptidyl inhibitor
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
300
structure length
300
Chain Sequence
b'HSGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Broad-Spectrum Antivirals against 3C or 3C-Like Proteases of Picornaviruses, Noroviruses, and Coronaviruses.
pubmed doi rcsb
source organism Porcine transmissible gastroenteritis coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 83
structure length 300
sequence length 300
chains with identical sequence B, C, D
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2012-05-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4f49A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4f49A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4f49A01
1QQ4A 1CSOE 2LNCA 1O33A 2YNBA 1GDQA 3HK6B 3SGAE 1DWCH 2ALVA 2G4TA 4K69A 2ZGBH 1ZTLA 2FI4E 2CHAC 1O2NA 3MU5A 3RXFA 4AFQA 2Y82A 1P10A 3ZVBA 3MU8A 1M9UA 5F6MA 1HAVA 3UNRA 1O38A 3K65B 1GI2A 1E34B 2C4FH 3VXEH 2D1JA 1GHAF 2ILNA 3MU0A 1IHSH 2G51A 3EE0B 2O8WA 4YZUA 1RRKA 2QF3A 2RCEA 4IBLH 2B7DH 4ZUHA 3SU3A 1RS0A 4MPXA 1UVUH 2QAAA 2QGRA 2FMJA 1ZSKA 5JYIA 2F9UA 2AEIH 2G8TA 1FXYA 2C93B 4ZKRU 3SN8A 1SGIB 2Z3EA 1P2OA 4NA7A 1JRSA 1GDNA 2ZFQH 3I78A 3S9AA 1DE7H 3I77A 4Y7AA 1HAXB 3RXCA 1O2QA 1MZDA 1O3JA 1MD7A 1MH0A 3QN7A 1PPZA 4FUCA 1S0RA 3UNSA 2HPPH 2FOGA 4A6LA 2FLBH 3ATIA 1SHYA 1P04A 4BXWA 1OP8A 2ZU5A 2NU2E 3OY5U 3PO1C 3SV6A 2BDHA 3LGIA 1F0SA 2ODQA 2A2XH 1BHXB 2J92A 1KYNA 1RXPA 1HAVB 4UONA 1G3DA 1YPJH 3A85A 4ZKNU 5FBIA 1GMCG 2PKAB 2PUXB 2NU0E 4R0IA 1GJ4H 3L6PA 3TGKE 3HKIB 3SU5A 3SJKA 1KXDA 2WUBA 4J2YB 1CHOF 2ZGXH 3KIDU 4Z0KA 1TRNA 2F3CE 3MNCA 2VWNA 3F1SB 3MYWA 3BIVH 4WXIA 5IDKA 5CHAB 1H8IH 3GDVA 3NWUA 4BAOB 3UQOA 1O3MA 4K60A 2BTCE 1ZR0A 4BTTB 1D3TB 1D6WA 1S81A 1U6QA 3SZNA 1UJ1A 4GCHF 2OBOA 8GCHG 4UFGH 2ZFPH 1INCA 1FZZA 1S83A 3IG6B 5E0GA 1BBRH 1O2KA 1T7CA 3ZZ9A 1BTUA 1GBBA 4KKDA 3RUOA 3TLOA 3BTME 2GCHG 3UNQA 1LPZB 3TVJB 3G01A 2XBXA 3A83A 2D26C 3UY9A 1GBHA 2BD4A 1TNJA 4OS2A 1W14U 4MVNA 2ZGCA 2JETC 2BLQA 1N6YA 5FXLA 1SGTA 1K22H 1SL3A 2EC9H 3ZVEA 2GZ7A 1OPHB 1C5TA 2QV1A 1UTPA 3RXKA 4B2BA 2ZDNA 3SJ9A 1SB1H 4ZKSU 5FPTA 1G3BA 4MNYA 1NFWA 2FOMB 1BCUH 1LPKB 5F8XA 4CHAC 2HPQH 5C1UA 2BD9A 1EJAA 1C1UH 1G3CA 3TJOA 3BN9A 1J16A 3D65E 4GLYA 1VCQA 1EPTC 3HK3B 2GT8A 1HAZB 3ZV8A 1P12E 1UCYH 1K21H 1TIOA 3FVFB 3F9HA 4XSKU 2ZQ2A 1FIWA 4WF8A 1KDQA 1MCVA 1V3XA 1W0YH 1Q31A 2H1UA 1NFYA 1K2I1 1FN8A 3PLKA 2OQ5A 3Q3KA 4YLQH 1O2PA 4NA9H 1ARCA 5L2ZH 1SG8B 3E16B 3M7TA 1O3GA 1C2LA 3P70B 1TB6H 1IQJA 2G4UA 1YF4A 3RXPA 4XFQA 3ZZDA 1AE8H 4AGJA 1W13U 5SGAE 2ZPQA 3V7TA 4CRFA 2PKSC 2A32A 4GUXA 1TLDA 1NN6A 1AFQC 2IN2A 9ESTA 2ZZUH 3FP6E 1HJ9A 2H5CA 2EI8A 2XBVA 1B0EA 1VITF 1NESE 4BTUB 1YPMH 2FYQA 4XBDA 3PWBA 1IQGA 3W94A 4ABFA 4MLFB 2AGIX 1THRH 3MNXA 2CJIA 1GJ8B 5FX5A 2ANMH 1GCTC 1Y3YA 2SGEE 1KDQB 3KGPA 5TCCA 4OS1A 1IQHA 3EGKH 1Z8IB 4KGAA 1QRXA 1SQOA 3U8OH 1HLTH 3BG4B 1C5UA 3VPKA 3BEIB 1NY22 3GOVB 2W5EA 3ODDA 3TK9A 3D49H 1BRAA 1KLTA 1RIWB 2C90B 2HNTC 1O39A 5EU8A 3F9EA 2XC5A 2H9TH 4O97A 4XE4A 3SGQE 2ZHWH 4FUHA 1Z1IA 4IMQA 4FU7A 1YP9A 1DWEH 4AX9H 1C5NH 3UPEA 3FFGA 2GT7A 1P2MA 1KXAA 1O3CA 1CO7E 5H4IB 2GX4A 4GPGA 2GDDA 1AUTC 1Y59T 1H9LB 3A86A 1O2HA 1WOFA 1CHGA 1O3BA 1Q3XA 4KTCA 2Z7FE 2H9HA 3RLYH 1DUAA 6GCHG 4ISIH 3RXVA 5A8YA 1C2IA 1GGDB 3JZ2B 1P01A 3Q3XA 2QXJA 4Q2KA 5AHGH 1V2OT 3A84A 2ZHFH 4THNH 5J4QA 1O3NA 1NROH 3RM0H 2SGPE 3GY7A 2FOFA 1N8OB 4MTBA 5EPYA 2Y5FA 2SFAA 5DP7A 7KMEH 2V35A 1A5IA 1P9SA 3SNDA 1CGJE 1S82A 3HGNA 1SVPA 1BTYA 3U9AH 1LVBA 4NIYA 1BMNH 4DG4A 4DIIH 1TGNA 4YOGA 1K1OA 3KHVA 3U98H 3VB6A 2BQ7B 1S5SA 1Y3UA 4AB9A 1S6FA 2GMTC 3MFJA 1ELAA 1WTHD 2BQWB 3GISB 2TPIZ 2QYIA 3BSQA 1BTHH 2ZGHA 1SGEE 1TX6A 1BJVA 2ZI2H 1C2HA 1D9IA 2G55A 4Y7BA 1SC8U 2W26A 4ABIA 1H9IE 3PTNA 1A0HB 1AY6H 2TGPZ 5I25A 3Q77A 3P95A 3ZVCA 1GBMA 2BMGB 1XVOA 1UK4A 1NRNH 3UR9A 1AZZA 1EAIA 1NRPH 1W2KH 2ZCKP 3LGYA 1YYY1 1G36A 2Z94A 1VCWA 3HATH 1A0JA 2FM2A 3VB5A 1G2MA 2TGAA 1OWJA 4ABAA 3EAJA 2PWXA 4NIWA 3V3MA 1BRBE 2BDIA 1SGFG 2BLVA 1ZMJA 3QTVH 4FUDA 5DPAA 2QF0A 2FTMA 5E2PA 2OINA 3KQDA 3VGCC 2XBWA 2ZTXA 1SFQB 1BZXE 1HBTH 4K8BA 1GJAB 1TA6A 5PTPA 3S9CA 1GI4A 1QB6A 1AIXH 3T29A 5EXMA 4O3UA 3NZIA 1EP5A 2W7UA 1UVSH 2ZPRA 1XUGA 1P05A 1XUJA 4JYTA 3F6UH 1TBZH 2OD3B 1GJDB 4IW4E 2OQUA 4NGAH 1GBAA 1O35A 1SI5H 1SGYE 3RXGA 2VWOA 3KNXA 3RC5A 1EZUC 3M35A 1DSTA 1EZSC 3RU4E 4X6OA 1MUEB 1O3LA 1VZQH 4WJG2 3UQVA 1SGNE 1FQ3A 1C4Y2 2GKVE 1EOLA 4X8TH 3DFJA 4X1QU 1S84A 1WCZA 3AW0A 1MKXH 4JZDH 1BOQA 1SLWB 4WH8A 4FXGH 2IPHA 3M5OA 1T32A 4XBBA 1C5QA 1K1NA 4O9VA 1VJ9U 1TMTH 5FHTA 2HNTF 1O5GH 1QL7A 5E0JA 1PQ7A 3TJUA 1C1TA 1C1OA 3GDUA 3UWJH 2FEQH 1GVLA 3VB3A 1F0TA 3IITA 3SU4A 2F9BH 2UWPA 1HJAC 2BHGA 4NFFA 1NRSH 3Q00A 1V2PT 4TY6A 4AFUA 1C2FA 1F0RA 1ELDE 2ZU3A 4A5TS 1JWTA 3DUXH 1QBOA 1OWKA 1DT2A 3P92A 3VXFH 2AYWA 2W3IA 2EI6A 4BANB 1XM1A 3ELAH 1E0FD 1Z8JB 4DVAU 3TK6A 1UVPA 2ASUB 1BT7A 3ATWA 1C2MA 3A82A 5EW2H 3TIUA 1V2UT 1UO6A 1PYTD 2BX3A 3A8CA 1GL1A 3EA9A 1MD8A 3RXSA 3A7XA 1ZJKA 5JPMH 2P16A 4IN1A 4ZHLU 2YOLA 4ABHA 2VNTA 1O2YA 3DA9B 2C8XB 5A0CA 1C1MA 1GG6B 2FIRH 2FZZA 1P2KA 1SBWA 4IN2A 2STBE 3ZZBA 1PPFE 4NSVA 1CT2E 3GCHB 5EQQA 2AH4X 2Q6GA 4Y6DA 3E90B 1ZHPA 5F8TA 3SV9A 4DT7B 1S6HA 4MDSA 2ZPSA 2AIPA 2O8TA 1TRMA 1G32B 1A4WH 1ZSJA 2VIDA 5DGJA 2K1QA 1O3IA 2Y80A 2UWLA 3VB4A 1SMFE 3M36A 1MTSA 2A5AA 3KQBA 4FU8A 5GPIB 1GBEA 2ZTYA 3LGWA 3SJIA 5FCKA 1Z7KA 3ZVFA 1ELTA 1UCYE 4CBNA 2ANWA 2A45B 4AYYB 3N7OA 1OS8A 5JBCS 1AWFH 3ATMA 1JXPA 4Y76A 1WUNH 5K0HA 2UUFB 4X2YA 2P93A 3LC3A 1ZJDA 3E0NB 1GVKB 2R3YA 5EODA 1SR5C 2BVXH 3TJNA 1GBJA 3PYHA 1VR1H 1K1PA 2A5KA 2J34A 3DD2H 2G5VA 1FNIA 4JMYA 2G00A 1FY8E 4INLA 5L2YH 1T4UH 2Y6TA 1ZZZA 3AAVA 1KLJH 3BTDE 3UFAA 1TX7A 1JRTA 3TK5A 3DT0H 2AMDA 1GL0E 1QURH 2I6SA 3TNSA 1IHTH 3LDXH 3KF2A 3I29A 3PMJA 2K7XA 3BTWE 1UHBA 1HGTH 4HGCA 1ANBA 1VJAU 4CBOA 1P2NA 2Z3CA 3UR6A 3KL6A 3STIA 4Z6AH 1IQMA 2FS9A 2PGBB 3RXDA 3PLPA 1DWDH 4GAWA 2GP9B 3VEQB 5C1XA 7GCHF 3BTHE 4AYVB 1MBMA 1PPGE 1C1QA 4FUEA 3RXAA 2XNIA 2ZDKA 3GYLB 3HKJB 3LC5A 3UOPA 4YT7H 1GWAA 3LH3A 1GI3A 6CHAB 1DFPA 2GTBA 1P09A 1O2TA 1ANEA 2A0QB 3LOXA 2ZDVH 1AVXA 1D3QB 4TPYA 4WWYA 5CHAC 5DP6A 4I8GA 4BTIB 4FUBA 4SGBE 1WQSA 3RXRA 3LT3A 1TABE 1C5WB 2ZFRH 5LPEA 4NIXA 4Y8XA 2PKAA 2RA3A 1C5OH 2ZHEH 1ZHRA 1OKXA 3GY4A 2QIQA 2FDAA 1LVYA 3KEEA 2J2UA 3E1XB 1AWHB 1TOMH 1LQEA 3U1IB 1UHBB 3GY5A 4UFDH 1YLDA 1SLXB 4CRGA 1TPAE 1LMWB 2TGTA 2GCTB 1HXEH 4H42U 4X6NA 5GIBA 2VWMA 2UUYA 1OX1A 2BVSH 4J1YA 3RXLA 3SI4H 1C4U2 2ZC9H 2PUQH 1TPOA 4FUGA 4RKJB 1GI1A 2F9NA 1DXPA 4F49A 2TRMA 1QRWA 2ZA5A 1A5HA 1YPLH 3MO6A 2OC8A 3PV4A 1BTXA 2RDLA 2P3TB 2C8ZB 2ZDMA 2R0LA 3K9XB 3MH7A 1ZTKA 1EX3A 1SOTA 4ABEA 3SUDA 3GY6A 2XW9A 1FUJA 1NT1A 2XWAA 4Q80A 5FAHA 2OP9A 3URCA 4ZMAH 1SLUB 1HNEE 1BQYA 1AZ8A 1EB2A 2OUAA 2DE8A 1QRZA 3FP8E 4U32A 3T25A 4BAHB 3SUEA 3AAUA 2VIOA 1JIMA 3NKKA 3WY8A 2R0KA 4RKOB 4B74A 4DIHH 3FAOA 1GMHF 1Y3XA 1PYTC 1C5LH 2VJ1A 5BRRE 2BY8X 2C8YB 4FUFA 4K1SA 1HFDA 5C67A 1THPB 4ISNA 1YPKH 2P94A 5A8XA 2HLCA 1VCPA 1O3KA 2ODYB 1C1SA 3E0PB 1H8DH 3NPSA 2HWLB 5B6OA 4Q7YA 2V0BA 2JH5D 1YBWA 2A31A 2CF9H 1P2IA 1YCPH 1P9UA 3A80A 1SLVB 4D7FA 1NU9A 2ESTE 2P59A 1P0SH 1IOEA 1ZHMA 1HAPH 1TAWA 1GPZA 4AFZA 3BEUA 4DCDA 1TNIA 2GVFA 4LXBH 2VIPA 5ABWA 5GXPA 3TH2H 2BX4A 5DP8A 1LHEH 2R9PA 1MZAA 5J4SA 2OCVB 3LJOA 1L2EA 1GJ6A 4H6SB 1X7AC 2F83A 1GBFA 2XYAA 8KME2 1K1IA 2XRCA 5C5NA 1ELFA 2A2QH 2TGDA 2LIZA 3F68H 1ACBE 1TNHA 4R8TB 2BB4A 1RIWC 4JCNA 4SGAE 3OTJE 2ZWLH 1O5CB 2A4GA 2PTCE 3P8FA 1TNKA 1C4V2 2BDGA 1Z6EA 3ZVDA 1P06A 1PQAA 2J4IA 1NO9H 3S9BA 2AMQA 4VGCB 3T28A 1C5YB 2GV7A 5FPYA 4YLUA 1HIAB 5C20A 1A0LA 5A0BA 1ARBA 2B5TB 2V3OH 1WTGH 4WMFA 1T31A 1DANH 5EG4A 1TBQH 1FV9A 3OYPA 1TMUH 4RSPA 1QBNA 1GGDC 3SU1A 2SNVA 1MKWH 2Z6BD 1BMLA 3ZV9A 1O36A 5LGOA 2VIVA 1N8OC 1EATA 1HPGA 1YCPM 5E0HA 1OWEA 1K1MA 1LHCH 1EXFA 3O8BA 4MPVA 1SGDE 1ABIH 1EJNA 3RXIA 1L4DA 4JYUH 3EYDA 4NIVA 1F2SE 4E06H 3QX5H 3ZZ7A 5DP9A 1YGCH 1FAKH 4K5ZA 2ZNKH 1V2RT 4UEHH 1UK3A 4XDEA 4I8JA 4WH6A 2HRVA 1TGTA 1J15A 4YOJA 4UDWH 3PB1E 5GCHF 1L0ZA 3SORA 3LGVA 1THSH 4UFFH 1HRTH 1QQUA 3EQ0H 1FAXA 1WV7H 1Y5UT 4AG2A 3CP7A 2EA3A 4KELA 1AKSA 5F8ZA 4WMEA 1WBGB 4MG3A 5C3NA 1W7GH 2BXTH 2TIOA 1HAGE 1Y3WA 3VFEA 2A7HA 1C5RA 2F9OA 4JZ1A 2VH6A 1BUIA 1ZYOA 2J94A 2GD4B 1FY4A 4DOQA 3JZ1B 3RLWH 2UWOA 1DVAH 2ANKH 5G4BA 4Q7ZA 4E05H 3T27A 2QN5T 1LQDB 1HCGA 1Q2WA 2ANYA 1QJ7B 2W3KA 3SNBA 2ZU1A 4TWWA 1O30A 3RMOH 4AG1A 1O5BB 1CQQA 1TNLA 4OS7A 1EP6A 1C9TA 4MPWA 1LVOA 4OS4A 1GBKA 5FCRA 2XC0A 3LKWA 5GDSH 1K1LA 3SQEE 1Z71A 2ZCHP 2FESH 3MU1A 2OXSA 1IQKA 2WPLS 1O5DH 1ESTA 1SGRE 1O5AB 1P11E 2ZHQH 1E37B 1ELVA 2A4OA 1A5GH 2OC0A 1C5VA 1AD8H 1GBTA 1O32A 2Z9IA 1KY9A 1ZPCA 1MQ5A 1AKSB 2WV4A 3F9FA 3A8AA 2Y5HA 1TGCA 4BNRA 4YO9A 1RJXB 2ZP0H 3BG8A 1KTSB 1LTOA 1OYTH 3BTEE 4MNXA 1XUFA 2FO9A 3T62A 4FVBA 2ZU2A 1DY9A 3SJ8A 4NZLA 3KN2A 3H7OA 1T8OA 1LHDH 1YPHC 3RXUA 3QO6A 4TY7A 4A1XA 1OOKB 3LH1A 2XC4A 1YKTA 1AFQB 7GCHG 4DGJA 1GHWH 4BAMB 1V2MT 2G5NA 2VWLA 1MTNB 4B76A 1C5ZB 1C2EA 2PW8H 3SUGA 3LONA 4LZ4B 1EQ9A 3O8RA 4BAQB 3ENSB 1FJSA 7LPRA 4TYDA 3QTOH 2PSXA 3ZZ5A 2FOCA 1HB0B 2CGAA 4CR9A 2XWBI 3BV9B 2XXLA 1CT0E 2VVCA 2ZEBA 3AASA 3A88A 1AU8A 1GMCF 4YESB 3OU0A 1YC0A 2BLWA 4A1TA 1GHAG 1MU8B 4MNVA 1BTZA 1P03A 3OY6U 3QGNB 1SHHB 1BBRK 1XXDA 1A7SA 3RXJA 2R2MB 1DLKB 3CS0A 1HAYB 1XUKA 3UUZA 3RXTA 1CA0B 1DWBH 5TCAA 1EAXA 1O3OA 2VGCB 1BRCE 1DLEA 1EUFA 4ESTE 1Z8RA 2Q6DA 4X2WA 1MAXA 4WVPE 2QCYA 1FLEE 2EEKA 1C1RA 4H6TA 3ZZ3A 1SGPE 1IQEA 1GG6C 3MH6A 3UOUA 3TU7H 4B1TA 1AB9B 1C2JA 2AFQB 1QIXB 2FLRH 3OX7U 2GCHF 4I8HA 1QBVH 3TH4H 3GCHC 2ZKSA 2BOHB 1QA7A 2ZECA 1UK2A 2PLXA 1A3BH 3Q76A 5HM2A 3BTQE 4BXSA 1BTWA 1QY6A 5A0AE 3ODFA 1LO6A 2AGEX 2GGVB 1UCYK 1VGCB 3PMHB 2O8MA 5CE1A 5L6NH 1TFXA 3H7TA 1CHOG 2B0FA 4B2AA 1CBWB 3D62A 2OC1A 1Y5BT 3RXQA 1A2CH 1SQTA 2FX4A 2KAIB 1GHYH 1FY3A 2BD3A 2G52A 1PPCE 2WV5A 4DW2U 1A3EH 1V2QT 3VB7A 2QA9E 1GMDF 2VIWA 1HYLA 5T6DA 3TH3H 1UTKA 4GCHG 4CH8B 4F4OC 1XXFA 1ZRKA 1G37A 2HALA 1LKBA 5FPSA 4ABBA 4ZHAA 2O8LA 4X0WU 1S0QA 2HOBA 3SV2H 1TE0A 1MBQA 1GJ7B 3MO3A 2FXRA 2D8WA 1QGFA 1BBRE 1WYKA 1YM0A 5C2ZA 3QUMP 1V2TT 1HUTH 1E36B 2FTLE 2HNTE 5LPFA 1ESAA 2SGFE 2IOTA 2PR3A 2O8UA 2G81E 1G3EA 4KTSA 1H9HE 1S85A 1C1PA 1DS2E 1ANCA 1TBRH 1P2QA 3FZZA 5EXLA 4X2XA 3VGCB 1KSNA 1JBUH 3T2NA 1DDJA 3ITIA 3FANA 4Y8YA 2WYGA 1T8NA 4JZFH 4HFPB 1SGFA 2BXUH 1AQ7A 4JK6A 1QL8A 3STJA 1O3AA 2VIQA 3RC4A 5C5OA 5HM9A 1UTQA 1PPHE 2V6NA 5T6FA 3RMNH 1LHFH 1NFXA 2FOHA 4IGDA 4AB8A 1GCDA 1L1GA 2BDYA 3ATLA 4BOHA 5A09A 1BITA 2Z3DA 1TOCB 1NPMA 3SNEA 2BOKA 2C3SA 1MMJN 1GBCA 1QL9A 1C5XB 3GCNA 3V12A 4LZ1H 1LDTT 1T4VH 1W11U 2ZO3H 1IQNA 3E6PH 4UE7H 2BD7A 4U30A 5JBAS 2BDCA 2PTNA 3MWIU 1NFUA 1W0ZU 3ZZAA 1NZQH 4IC5A 3SQHE 1V2WT 2GCTC 4B73A 1OXGA 3HPTB 1NS3A 1WU1A 1OYQA 2YNAA 1BMAA 3SBKA 5CMXH 1GHBF 3E8LA 4Y10E 4Y79A 4UFEH 5EQSA 5AVDA 3S7HB 1FPHH 1E38B 2BY7X 4ISHH 2BY9X 2J95A 3RMLH 1UTMA 4KP0A 4DY7B 2VVUA 3M61U 1SOZA 3U8RH 4CREA 6LPRA 1K28D 1HAOH 1VITG 1BJUA 2VU8E 1BTPA 6GCHF 4DURA 1BB0B 1ZSLA 2P8OB 3NCLA 3PLBA 4Y0ZE 1DM4B 1AE5A 5JBBS 4JZEH 2ZFSA 2ZDAH 1UTJA 2THFB 1ZRBA 1OWIA 3MOCA 1O3FA 2SGQE 4I8KA 1AVGH 1NC6A 3TNTA 1LPGB 3QK1A 1MTVA 1T8MA 1UTOA 1E35B 4U01A 1N6XA 4GSOA 4I32A 4INHA 2CXVA 3U8TH 4CR5A 3RU4D 1AI8H 4NCYA 3K2UA 1C5PA 3L3TA 2Z9JA 4E7NA 2OC7A 2GV6A 1BMMH 1CA8B 4NFEA 3T26A 2F9PA 1ELBA 1QCPA 7ESTE 5ESBA 2NWNA 5FBEA 3MTYA 2HVXA 4ISOA 3A7VA 3F9GA 4A1VA 4YM9A 3DFLA 3MI4A 3QLPH 2FPZA 1P57B 3NUMA 5AFZH 1ZPBA 5L30H 2BLOA 2PV9B 2P3FH 5DG6A 1LHGH 1SQAA 2FODA 2J9NA 3BTGE 2BZ6H 1MU6B 1D6RA 1QHRB 3M5NA 3BF6H 5C1YA 4D9QA 1A1RA 1TPPA 3GCOA 1AUJA 4YOIA 1EASA 4ISLA 4I31A 4DJZB 4OGXA 3V13A 3MNSA 2OTVA 1QFKH 9LPRA 1QJ1B 3TGJE 2ULLA 3QDZB 1LCYA 5EPNA 1DUEA 4D7GA 1SFIA 2BDAA 1UTLM 1O5EH 2A4RA 4AOQA 5T6GA 2IJOB 4AGKA 1BDAA 4A92A 3T5FH 3UREA 1D3DB 1XUHA 2B8OH 3M3VA 4NZQA 1XKAC 3TPIZ 2W7SA 1L4ZA 1ELCA 2ZHDA 1O2ZA 3LU9B 4X1RU 4ZXYH 3A87A 1CGHA 2RG3A 2ZGJA 4X6PA 1HXFH 3NK8A 1V2LT 4QT8C 1O5FH 4GVUA 1C5MD 1MKXK 1GJ5H 2O9QA 2A4QA 2GZ8A 5DKMA 1D4PB 1O0DH 1G30B 4VGCC 4A7IB 1PPEE 2QXIA 5A2MH 2QXGA 3MMGA 1TGBA 1O2LA 1EAUA 1TALA 5EQRA 1BIOA 3RXMA 4INKA 3R0FA 1W12U 1FDPA 3RXBA 1NRQH 4OGYA 1V2NT 2AERH 8ESTE 5JB8S 3ZZ8A 3PROA 3CENA 4K2YA 1AVWA 1DPOA 3P6ZB 5HYOA 2XTTB 2CF8H 2F91A 5LH8A 1C5SA 4AFSA 1OP0A 3BTTE 4M7GA 4KTUA 3GYMA 3P8NA 1W7XH 2CHAB 5LPRA 1HIAA 2BVRH 2FI3E 1GJ9B 1NM6A 3SJOA 4K8YA 1J17T 1V2ST 3BIUH 3A8DA 1D3PB 3B9FH 3GCTF 4LK4A 2GZ9A 1O2JA 1EKBB 3O8DA 2WPJS 2CN0H 3QWCH 1BA8B 3RDZA 2AGGX 1GI6A 1ABJH 5JDUB 3TJVA 1A61H 3FP7E 3BG4C 1O2MA 4CRCA 1ZGIA 1BHXF 1AN1E 2FWWA 3RU4T 1DICA 3TITA 6ESTA 1F7ZA 3RM2H 4D9RA 2AIQA 3M7QA 1GVZA 3UIRA 1FIZA 2PFEA 2FOEA 1GBLA 3NXPA 1TGSZ 1RFNA 4LOYH 1F5KU 4BAKB 4Y71A 1Y3VA 1GJBB 3ESTA 3M5MA 1G2LA 1SGCA 3PO1B 4Y0YE 1ORFA 2JKHA 1RTKA 1UTNA 1YLCA 1OP2A 1WQVH 2PGQB 1C1NA 2CMYA 1TPSA 1GI9B 1GHZA 4WMDA 2A1DB 1QTFA 1G9IE 1KIGH 3A81A 1F92A 3Q3YA 1AFEH 1JOUB 2DE9A 4D8NA 1J14A 1C2GA 1O34A 1OWDA 2WPMS 1GMDG 1FMGA 1FY5A 2BY6X 3AW1A 5FX6A 3ZYDA 1AMHA 1PJPA 3RP2A 1GHXH 5HMAA 1ZMNA 3OSYA 3SNAA 1ETRH 3LPRA 2JH6D 5DP4A 2DUCA 4K3JA 4NWKA 1A46H 3GICB 5AF9H 1PFXC 4IMZA 3ZZ4A 4IC6A 4IS5A 1O2IA 3L33A 3KQCA 1ESBA 2FOAA 1FN6A 1O2GH 1GBIA 2BY5X 1ZMLA 2VINA 3GY3A 1V2KT 4JZIA 3ZZCA 4X1NU 2WYJA 1MQ6A 4O3TA 4Y11E 2J38A 1QR3E 3ATKA 4MQAA 3U69H 5AFYH 1EPTA 1O31A 2H5DA 3PMBB 3SI3H 1TX8A 4RN6A 3SUFA 3K6YA 2Z9KA 2VB0A 1Z1JA 2R3UA 3B23B 4HZHA 1MTNC 3SU2A 2BD2A 3AVZA 3MNBA 3EA8A 1ID5H 4NWLA 1O2VA 2R2WU 2BD5A 1CT4E 1ZTJA 1OWHA 1CE5A 3P8GA 4K1EA 2H9EH 2JETB 3RMMH 2ALPA 1QB9A 1TRYA 2D2DA 1XX9A 2ZCLP 1FY1A 2I6QA 1ELEE 3PMAB 3P17H 4CRBA 1KTTB 3S7KB 4FU9A 1QNJA 2WINI 4CRAA 5DP5A 1Z6JH 2QY0B 4TWYA 2XCNA 2BD8A 1K9OE 4H4FA 4CHAB 5EOKA 1HDTH 4E7RG 4YTAA 1CA0C 2RA0A 1XUIA 1W3CA 5BPEA 2VGCC 3A7WA 1QA0A 3RXEA 2Z9LA 2AMPA 2QC2A 8LPRA 1EZXC 1EOJA 1EPTB 2VH0A 1CVWH 1GHBG 2C8WB 1KLIH 3MH4A 1NTPA 1AB9C 2V3HH 1TA2A 1DX5M 5EXNA 3QZRA 5TJXA 2WUCA 3S0NA 1O2RA 2AS9A 2B9LA 3SU0A 4B71A 1F5RA 3PM3A 1RGQA 2ZG0H 2BM2A 5DO4H 2A5IA 3SHCH 1FPCH 1RD3B 1QJ6B 3A8BA 1WSSH 1L1NA 1N1LA 2PKSB 1IQFA 1MTWA 2ZTZA 4X1SU 1UVOA 1UVTH 3C1KA 3K6ZA 1ETTH 4CH2B 1VGCC 3HGPA 2BZAA 5A8ZA 2OBQA 1F0UA 3A7TA 1C1WH 1CBWC 1BRUP 3A89A 4Y8ZA 1H1BA 3H5CB 1NU7B 3PTBA 1O2OA 1O3EA 3DHKH 4ZH8A 4ASHA 2P95A 4UD9H 1P2JA 1NRRH 1JMOH 1SPJA 2ZFFH 4ABGA 1O3DA 2Y7ZA 1PPBH 1GCTB 4AN7A 3IWMA 3C27B 1T8LA 1C1VH 3M5LA 1DXWA 1C2DA 1W10U 4FVDA 2A7JA 3LJJA 1KXEA 2UUJB 5HXFA 2ODPA 3LGUA 3QZQA 2BDBA 1GI7B 5I46H 1F5LA 1YCPK 1O37A 2NU3E 4CRDA 4ZXXH 3QGJA 1ELGA 2KAIA 2TBSA 3RXHA 1OSSA 2EI7A 2F9VA 1PQ5A 2M5TA 1H4WA 1DITH 1EZQA 8GCHF 1TNGA 3UTUH 1GI8B 3R3GB 1HV7A 4X8SH 1P3EA 5DK1A 3M7UA 1IQIA 2PHBA 4O03A 4I8LA 4OS6A 1SSXA 2ZIQH 4NA8A 1XMNB 2STAE 4X6MA 3SU6A 1O2SA 1FONA 4K1TA 5JB9S 3B8JA 3URDA 4JYVH 3LGTA 2WPHS 2XBYA 3ZYEA 1EJMA 2Y81A 1MTUA 1HJ8A 2BYAX 5DJ7A 4ABDA 2WPIS 1SGQE 4AORA 2Q1JA 3D23A 1J8AA 1ZGVA 3LIWA 2FYRA 4Q7XA 5EGMA 2Z9GA 2PSYA 1V2VT 1ZOMA 2GMTB 1B7XB 4XOJA 3ZVGA 1GI5A 1C9PA 1GMHG 4AZ2B 4ZAEA 1TWXB 2SNWA 5ESTE 1AO5A 1MKWK 2Q6FA 1HAIH 4I7YH 2Y5GA 3A7ZA 2ZQ1A 1O2XA 3SV7A 5EW1H 3P8OA 1O3HA 1Y8TA 1CGIE 1GDUA 1Z8GA 1XVMA 1EAWA 1LVMA 1L1JA 4WXVA 3PWCA 5HGGA 3CS7A 1DY8A 2H6MA 3GCTG 2H2ZA 3MU4A 2P8OC 5ETXA 3U1JB 3SHAH 1ETSH 5F03A 1O3PB 2A7CA 4FUIA 1K1JA 1FI8A 1W8BH 2ZFTA 4X2VA 3ZVAA 2FS8A 1AGJA 5GJ4B 2JH0D 3GY2A 3M37A 3EA7A 4XBCA 3E3TA 3SOSA 3M3SA 1MCTA 1EB1H 6CHAC 2GDEH 4I33A 4NSYA 4B2CA 4GHTA 1GJCB 1RTFB 2FP7B 2ZF0H 3A7YA 3TGIE 2NU1E 2Y7XA 1IQLA 1J9CH 3UWIA 4WY3A 4ZHMU 1DSUA 3KQEA 1DOJA 1QB1A 1GI0A 1JIRA 1V2JT 4JK5A 3S69A 4ZROA 3ZZ6A 1ZLRA 1WAYB 1GBDA 1HAHH 1IAUA 1LKAA 1P8VC 3BEFB 4MPUA 4X8VH 3RC6A 3BTKE 1B5GH 3SNCA 1VITH 1O2WA 1KXCA 5DP3A 2FI5E 4MNWA 2SGDE 3RXOA 2OLGA 4ABJA 3EBNA 4D76A 3BTFE 3EDXB 1KXFA 5K7RA 2CV3A 5E8EH 2ZU4A 4TPIZ 3O8CA 1YPHE 1TQ0B 1YPEH 1C2KA 3E91A 1V6DA 4NG9H 2FOBA 3SO3A 2P3UB 1RTLA 1TMBH 2WPKS 2LPRA 1KXBA 4PROA 4B75A 1P3CA 3SGBE 1YPGH 4U2WA 2HGTH 1TQ7B 4X1PU 3GDSA 3W95A 1HJAB 2QXHA 4HTCH 1TYNA 4YT6H 1ZPZA 4GHQA 3SV8A 3SW2B 1PQ8A 3GY8A 3M3TA 5GCHG 1ANDA 3MO9A 3FZDA 4HI3A 1B0FA 3MH5A 3KCGH 1P02A 4ZKOU 5JBTA 1Y5AT 3MHWU 5IYTA 2VVVA 2FX6A 4OS5A 1GHVH 1UMAH 1CU1A 2ZDLA 1AHTH 5T3HA 2XCFA 5GWZA 2SGAA 1XKBC 4X8UH 3V0XA 2BQ6B 1TONA 2NU4E 1O2UA 5E2OA 2UUKB 1MAYA 4FUJA
chains in the Genus database with same CATH superfamily
1QQ4A 1CSOE 2LNCA 1O33A 2YNBA 1GDQA 3HK6B 3SGAE 1DWCH 2ALVA 2G4TA 4ZCNA 4K69A 2ZGBH 1ZTLA 2FI4E 2CHAC 1O2NA 3MU5A 3RXFA 4AFQA 2Y82A 1P10A 3ZVBA 2V3MA 4FOUC 3MU8A 1M9UA 4FETA 5F6MA 1HAVA 3UNRA 1O38A 3K65B 1GI2A 1E34B 2C4FH 3VXEH 2D1JA 1GHAF 2ILNA 3MU0A 1IHSH 2G51A 3EE0B 2O8WA 4YZUA 1RRKA 2QF3A 2RCEA 4IBLH 2B7DH 4ZUHA 3SU3A 1RS0A 4MPXA 1UVUH 2QAAA 2QGRA 2FMJA 1ZSKA 5JYIA 2F9UA 2AEIH 2G8TA 1FXYA 2C93B 4ZKRU 3SN8A 1SGIB 2Z3EA 1P2OA 4XD7D 3PRBA 4NA7A 1JRSA 1OHHD 1GDNA 2ZFQH 3I78A 3S9AA 1DE7H 3I77A 4Y7AA 1HAXB 3RXCA 3UB0A 1O2QA 1MZDA 1O3JA 1MD7A 1MH0A 3QN7A 1PPZA 4FUCA 1S0RA 3UNSA 2HPPH 2FOGA 4A6LA 2W6ID 1H8HD 3OEED 2FLBH 3ATIA 1SHYA 1P04A 4BXWA 1OP8A 2ZU5A 2KM0A 2NU2E 3OY5U 3PO1C 3SV6A 2BDHA 3LGIA 1F0SA 2ODQA 2A2XH 1BHXB 2J92A 1KYNA 1RXPA 1HAVB 4UONA 1G3DA 1YPJH 3A85A 5KGOA 4ZKNU 5FBIA 1GMCG 2PKAB 2PUXB 2NU0E 4R0IA 1GJ4H 3L6PA 3TGKE 3HKIB 1W0KD 3SU5A 3SJKA 1KXDA 2WUBA 4J2YB 1CHOF 2ZGXH 3KIDU 4Z0KA 1TRNA 2F3CE 2IJD1 3MNCA 2VWNA 3F1SB 3MYWA 3BIVH 4WXIA 5IDKA 5CHAB 1H8IH 3GDVA 3NWUA 4BAOB 3UQOA 1O3MA 4K60A 2BTCE 1ZR0A 4BTTB 1D3TB 1D6WA 1S81A 1U6QA 3SZNA 1UJ1A 4GCHF 2OBOA 4TSFD 8GCHG 4UFGH 2ZFPH 1INCA 1FZZA 1S83A 3IG6B 5E0GA 1BBRH 1O2KA 1T7CA 3ZZ9A 1BTUA 1GBBA 4KKDA 3RUOA 3TLOA 1VKYA 3BTME 2GCHG 3UNQA 1LPZB 3TVJB 3G01A 2WPDD 2XBXA 3A83A 2D26C 5KEDA 3UY9A 1GBHA 2BD4A 1TNJA 4OS2A 1W14U 4MVNA 2ZGCA 2JETC 2BLQA 1N6YA 5FXLA 1SGTA 1K22H 1SL3A 2EC9H 3ZVEA 2GZ7A 1OPHB 1C5TA 2QV1A 1UTPA 3RXKA 4B2BA 2ZDNA 1COWD 1SB1H 4ZKSU 5FPTA 3SJ9A 1G3BA 2JIZD 4MNYA 1NFWA 2FOMB 3MQKC 4RI0A 4DT4A 1BCUH 3KYGA 1LPKB 5F8XA 4CHAC 2HPQH 5C1UA 2BD9A 1EJAA 1C1UH 4ASUD 1G3CA 2M2AA 3TJOA 3BN9A 1J16A 3D65E 4GLYA 1VCQA 1EPTC 3HK3B 2GT8A 1HAZB 3ZV8A 1P12E 1UCYH 1K21H 1TIOA 3FVFB 3F9HA 3N7EA 4XSKU 2ZQ2A 1FIWA 4WF8A 1KDQA 1MCVA 1V3XA 1W0YH 1Q31A 2H1UA 1NFYA 1K2I1 2F4LA 1FN8A 3PLKA 2OQ5A 3Q3KA 4YLQH 1O2PA 4NA9H 1ARCA 5L2ZH 2RDEA 1SG8B 3E16B 3M7TA 1O3GA 1C2LA 3P70B 1TB6H 1IQJA 2G4UA 1YF4A 3RXPA 4TT3D 4XFQA 3ZZDA 1AE8H 4AGJA 1W13U 5SGAE 2ZPQA 3V7TA 4CRFA 2PKSC 2A32A 4GUXA 1TLDA 1NN6A 1AFQC 2IN2A 9ESTA 2ZZUH 3FP6E 1HJ9A 2H5CA 2EI8A 2XBVA 1B0EA 1VITF 1NESE 4BTUB 1YPMH 2FYQA 4XBDA 3PWBA 1IQGA 3W94A 4ABFA 4MLFB 2AGIX 1THRH 3MNXA 2CJIA 1GJ8B 5FX5A 2ANMH 1GCTC 1Y3YA 2SGEE 1KDQB 3KGPA 5TCCA 1YY3A 4OS1A 1IQHA 3EGKH 1Z8IB 4KGAA 1QRXA 1SQOA 3U8OH 1HLTH 3BG4B 1C5UA 3VPKA 3BEIB 1NY22 3GOVB 2W5EA 3ODDA 3TK9A 3D49H 1BRAA 1KLTA 1RIWB 2C90B 2HNTC 1O39A 5EU8A 3F9EA 2XC5A 2H9TH 4O97A 4XE4A 3SGQE 2ZHWH 4FUHA 1Z1IA 4IMQA 4FU7A 1YP9A 1DWEH 4AX9H 1C5NH 3UPEA 3FFGA 2GT7A 1P2MA 1KXAA 1O3CA 1CO7E 3GS9A 5H4IB 4M9FA 2GX4A 4GPGA 2GDDA 1AUTC 1Y59T 1H9LB 3A86A 1O2HA 1WOFA 1CHGA 1O3BA 1Q3XA 4KTCA 2Z7FE 2H9HA 3RLYH 1DUAA 6GCHG 4ISIH 3RXVA 5A8YA 1C2IA 2WSSD 1GGDB 3JZ2B 1P01A 3Q3XA 2QXJA 4Q2KA 5AHGH 1V2OT 3A84A 2ZHFH 4THNH 5J4QA 1O3NA 1NROH 3RM0H 2SGPE 3GY7A 2FOFA 1N8OB 4MTBA 5EPYA 2Y5FA 2SFAA 5DP7A 7KMEH 2V35A 1A5IA 1P9SA 1SQRA 3SNDA 1CGJE 1S82A 3HGNA 1SVPA 1BTYA 3U9AH 1LVBA 4NIYA 1BMNH 4DG4A 4F55A 4DIIH 1TGNA 4YOGA 1K1OA 3KHVA 3U98H 3VB6A 3FN8A 1E79D 2BQ7B 1S5SA 1Y3UA 4AB9A 1S6FA 2GMTC 3MFJA 1ELAA 3OE7D 1WTHD 2BQWB 3GISB 2TPIZ 2QYIA 1NBME 3BSQA 1BTHH 2ZGHA 1SGEE 1TX6A 2J97A 1BJVA 2ZI2H 1C2HA 1D9IA 2G55A 4Y7BA 1SC8U 2W26A 4ABIA 1H9IE 3PTNA 1A0HB 1AY6H 2TGPZ 5I25A 3Q77A 3P95A 3ZVCA 1GBMA 2BMGB 1XVOA 1UK4A 2J98B 1NRNH 3UR9A 1AZZA 1EAIA 1NRPH 1W2KH 2ZCKP 1S6LA 3LGYA 5F53A 1YYY1 1G36A 2Z94A 1VCWA 3HATH 1A0JA 2FM2A 3VB5A 1G2MA 2TGAA 1OWJA 4ABAA 3EAJA 2PWXA 4NIWA 3V3MA 1BRBE 2BDIA 1SGFG 2BLVA 1ZMJA 3QTVH 4FUDA 5DPAA 2QF0A 2FTMA 3DCLA 5E2PA 2OINA 3KQDA 3VGCC 2XBWA 2ZTXA 1SFQB 1BZXE 1HBTH 4K8BA 1GJAB 1TA6A 5PTPA 3S9CA 1GI4A 1QB6A 1AIXH 3T29A 4RT1A 5EXMA 4O3UA 3NZIA 4OM9A 1EP5A 2W7UA 1UVSH 2ZPRA 1XUGA 1P05A 1XUJA 4JYTA 3F6UH 1TBZH 2OD3B 1GJDB 4IW4E 2OQUA 4NGAH 1GBAA 1O35A 1SI5H 1SGYE 3RXGA 2VWOA 3KNXA 3RC5A 1EZUC 3M35A 1DSTA 1EZSC 3RU4E 4X6OA 1MUEB 1O3LA 1VZQH 4WJG2 3UQVA 1SGNE 1FQ3A 1C4Y2 2GKVE 4RT0A 1EOLA 4X8TH 3DFJA 4X1QU 1S84A 1WCZA 3AW0A 1MKXH 4JZDH 1BOQA 1SLWB 4WH8A 4FXGH 2IPHA 3M5OA 1T32A 4XBBA 2QF4A 1C5QA 1K1NA 4O9VA 1VJ9U 1TMTH 2K8IA 5FHTA 2HNTF 1O5GH 5HIZA 1QL7A 5E0JA 1PQ7A 3TJUA 1C1TA 1C1OA 3GDUA 3UWJH 2FEQH 1GVLA 3VB3A 1F0TA 3IITA 3SU4A 2F9BH 2UWPA 1HJAC 5DN6D 2BHGA 4NFFA 1NRSH 3Q00A 1V2PT 4TY6A 4AFUA 1C2FA 1F0RA 1ELDE 2KCPA 2ZU3A 4A5TS 1JWTA 3DUXH 1QBOA 1OWKA 1DT2A 3P92A 3VXFH 2AYWA 2W3IA 2EI6A 4BANB 1XM1A 3ELAH 1E0FD 1Z8JB 2KFWA 4DVAU 3TK6A 1UVPA 2ASUB 1BT7A 3ATWA 1C2MA 3A82A 5EW2H 3TIUA 1V2UT 1UO6A 1PYTD 2BX3A 3A8CA 1GL1A 3EA9A 1MD8A 3RXSA 3A7XA 1ZJKA 5JPMH 2P16A 4IN1A 4ZHLU 2YOLA 2KCAA 4ABHA 2VNTA 1O2YA 3DA9B 2C8XB 5A0CA 1C1MA 1GG6B 2FIRH 2FZZA 1P2KA 1SBWA 4IN2A 2STBE 3ZZBA 3EE7A 1PPFE 4NSVA 1CT2E 3GCHB 5EQQA 2AH4X 2Q6GA 4Y6DA 3E90B 1ZHPA 5F8TA 3SV9A 4DT7B 1S6HA 4MDSA 2ZPSA 2AIPA 2O8TA 1TRMA 1G32B 1A4WH 1K0HA 1ZSJA 2VIDA 5DGJA 2K1QA 1O3IA 2Y80A 2UWLA 3VB4A 1SMFE 3M36A 1MTSA 2A5AA 3KQBA 4FU8A 5GPIB 1GBEA 2ZTYA 3LGWA 3SJIA 5FCKA 1Z7KA 3ZVFA 1ELTA 1UCYE 4CBNA 2ANWA 2A45B 4AYYB 3N7OA 1OS8A 5JBCS 1AWFH 3ATMA 1JXPA 4Y76A 1WUNH 5K0HA 2UUFB 4X2YA 2P93A 3LC3A 1ZJDA 3E0NB 1GVKB 2R3YA 5EODA 1SR5C 2BVXH 3TJNA 1GBJA 3PYHA 1VR1H 1K1PA 2A5KA 2J34A 3DD2H 2G5VA 1FNIA 4JMYA 2G00A 1H8ED 1FY8E 4INLA 5L2YH 1T4UH 3ZIAD 2Y6TA 5KECA 1ZZZA 3AAVA 1KLJH 3BTDE 3UFAA 1TX7A 1JRTA 3TK5A 3DT0H 2AMDA 1FX0B 1GL0E 1QURH 2I6SA 3TNSA 1IHTH 3LDXH 3KF2A 3I29A 3PMJA 2K7XA 3BTWE 1UHBA 2AHME 1HGTH 4HGCA 1ANBA 1VJAU 4CBOA 1P2NA 3N99A 2Z3CA 3UR6A 3KL6A 3STIA 4Z6AH 1IQMA 2FS9A 2PGBB 3RXDA 3PLPA 1DWDH 4GAWA 2GP9B 3VEQB 5C1XA 7GCHF 3BTHE 4AYVB 1MBMA 1PPGE 1C1QA 4FUEA 3RXAA 2XNIA 2ZDKA 3GYLB 3HKJB 3LC5A 3UOPA 4YT7H 1GWAA 3LH3A 1GI3A 6CHAB 1DFPA 2GTBA 1P09A 2YMSB 4ACAA 5C0UA 1O2TA 1ANEA 2A0QB 5EIYA 3LOXA 2ZDVH 1AVXA 1D3QB 4TPYA 1YLNA 4WWYA 3F2HA 5CHAC 5DP6A 4I8GA 4BTIB 4FUBA 4SGBE 1WQSA 3RXRA 3LT3A 1TABE 5EJLA 1C5WB 2ZFRH 5LPEA 4NIXA 4Y8XA 2PKAA 2RA3A 1C5OH 2ZHEH 1ZHRA 1OKXA 3GY4A 2QIQA 2FDAA 1LVYA 3KEEA 2J2UA 3E1XB 1AWHB 1TOMH 1LQEA 3U1IB 1UHBB 5T1VA 5HIYA 3GY5A 4UFDH 3PV5A 1YLDA 1SLXB 4CRGA 1TPAE 1LMWB 2TGTA 2GCTB 1HXEH 4H42U 4X6NA 5GIBA 2VWMA 2UUYA 2KX4A 1OX1A 2BVSH 4J1YA 3RXLA 3SI4H 1C4U2 2ZC9H 2PUQH 1TPOA 4FUGA 4RKJB 1GI1A 2F9NA 1DXPA 4F49A 1SKYE 2TRMA 1QRWA 2ZA5A 1A5HA 1YPLH 3DSGA 3MO6A 2OC8A 3PV4A 1BTXA 2RDLA 2P3TB 2C8ZB 2ZDMA 2R0LA 3K9XB 3MH7A 5C17A 1ZTKA 1EX3A 1SOTA 4HG6A 4ABEA 3SUDA 3GY6A 2XW9A 1FUJA 1NT1A 2XWAA 4Q80A 5FAHA 2OP9A 3URCA 4ZMAH 3CNRA 1SLUB 1HNEE 1BQYA 1AZ8A 1EB2A 2OUAA 2DE8A 1QRZA 3FP8E 4U32A 3T25A 4BAHB 3SUEA 3AAUA 2VIOA 1JIMA 3NKKA 4B6FA 3WY8A 2R0KA 4RKOB 4B74A 4DIHH 3FAOA 1GMHF 1Y3XA 1PYTC 1C5LH 2VJ1A 2IPQX 5BRRE 2BY8X 2C8YB 4FUFA 4K1SA 1HFDA 5C67A 1THPB 3F0PA 4ISNA 1YPKH 2P94A 4YXWD 5B6LA 5A8XA 2HLCA 1VCPA 1O3KA 2ODYB 1C1SA 3E0PB 1H8DH 3NPSA 2HWLB 5B6OA 4Q7YA 2V0BA 2JH5D 1YBWA 2A31A 2CF9H 1P2IA 1YCPH 1P9UA 3A80A 1SLVB 4D7FA 1NU9A 2ESTE 2P59A 1P0SH 1IOEA 1ZHMA 1HAPH 1TAWA 1GPZA 4AFZA 3BEUA 4DCDA 3WWFA 1TNIA 2GVFA 4LXBH 2VIPA 5ABWA 5GXPA 3TH2H 2BX4A 2LELA 5DP8A 2VBCA 1LHEH 2R9PA 1MZAA 5J4SA 4AC9A 2OCVB 3LJOA 1L2EA 1GJ6A 4H6SB 1X7AC 2F83A 1GBFA 2XYAA 8KME2 1K1IA 2XRCA 5C5NA 1ELFA 2A2QH 2TGDA 3OEHD 2LIZA 3F68H 1ACBE 1TNHA 4R8TB 2BB4A 1RIWC 4JCNA 4SGAE 3OTJE 2ZWLH 1O5CB 2A4GA 2PTCE 3P8FA 1TNKA 1C4V2 2BDGA 1Z6EA 3ZVDA 1P06A 1PQAA 2J4IA 1NO9H 3S9BA 2AMQA 4VGCB 3T28A 1C5YB 2GV7A 5FPYA 4YLUA 1HIAB 5C20A 1A0LA 5DSFA 5A0BA 1ARBA 2B5TB 2V3OH 1WTGH 4WMFA 1T31A 1DANH 5EG4A 1TBQH 1FV9A 3OYPA 1TMUH 4RSPA 1QBNA 1GGDC 3SU1A 2SNVA 1MKWH 2Z6BD 1BMLA 3ZV9A 1O36A 5LGOA 2VIVA 1N8OC 1EATA 1HPGA 1YCPM 5E0HA 1OWEA 1K1MA 1LHCH 1EXFA 3O8BA 4MPVA 1SGDE 1ABIH 1EJNA 3RXIA 1L4DA 4JYUH 3EYDA 4NIVA 1F2SE 4E06H 3QX5H 3ZZ7A 5DP9A 1YGCH 1FAKH 4K5ZA 2ZNKH 1V2RT 4UEHH 1UK3A 4XDEA 4I8JA 4WH6A 2HRVA 1TGTA 1J15A 4YOJA 2KCYA 4UDWH 3PB1E 5GCHF 1L0ZA 3SORA 3LGVA 1THSH 4UFFH 1HRTH 1QQUA 3EQ0H 1FAXA 1WV7H 1Y5UT 4AG2A 3CP7A 2EA3A 4KELA 1AKSA 5F8ZA 4WMEA 1WBGB 4MG3A 5C3NA 1W7GH 2BXTH 2TIOA 1HAGE 1Y3WA 3VFEA 2A7HA 1C5RA 2F9OA 4JZ1A 2VH6A 1BUIA 1ZYOA 2J94A 2GD4B 1FY4A 4DOQA 3JZ1B 3RLWH 2UWOA 1DVAH 2ANKH 5G4BA 4Q7ZA 4E05H 3T27A 2QN5T 1LQDB 1HCGA 1Q2WA 2ANYA 1QJ7B 2W3KA 3SNBA 2ZU1A 4TWWA 1O30A 3RMOH 4AG1A 1O5BB 1CQQA 1TNLA 4OS7A 1EP6A 1C9TA 4MPWA 1LVOA 4OS4A 1GBKA 5FCRA 2XC0A 3LKWA 4I86A 5GDSH 1K1LA 2YMSD 3SQEE 1Z71A 2ZCHP 2FESH 3MU1A 2OXSA 1IQKA 2WPLS 1O5DH 1ESTA 3W1EA 1SGRE 1O5AB 1P11E 2ZHQH 1E37B 1UW7A 1ELVA 2A4OA 1A5GH 2J98A 2OC0A 1C5VA 1AD8H 1GBTA 1O32A 2Z9IA 1KY9A 1ZPCA 1MQ5A 1AKSB 2WV4A 3F9FA 4P00A 3A8AA 2Y5HA 1TGCA 4BNRA 4YO9A 1RJXB 2ZP0H 3BG8A 1KTSB 1LTOA 1OYTH 3BTEE 4MNXA 1XUFA 2FO9A 3T62A 4FVBA 2ZU2A 1DY9A 3SJ8A 4NZLA 3KN2A 3H7OA 1T8OA 1LHDH 1YPHC 3RXUA 3QO6A 4TY7A 4A1XA 1OOKB 3WW7A 3LH1A 2XC4A 1YKTA 1AFQB 7GCHG 4DGJA 1GHWH 4BAMB 1V2MT 2G5NA 2VWLA 1MTNB 3DSPA 3SZEA 1C5ZB 1C2EA 2PW8H 3SUGA 3LONA 4B76A 4LZ4B 1EQ9A 3O8RA 4BAQB 3ENSB 1FJSA 7LPRA 4TYDA 3QTOH 2PSXA 3ZZ5A 2FOCA 1HB0B 2CGAA 4CR9A 2XWBI 3BV9B 2XXLA 1CT0E 2VVCA 2ZEBA 3AASA 3A88A 1AU8A 1GMCF 4YESB 3OU0A 1YC0A 2BLWA 4A1TA 1GHAG 1MU8B 4MNVA 1BTZA 1P03A 3OY6U 3QGNB 1SHHB 1BBRK 1XXDA 1A7SA 3RXJA 2R2MB 1DLKB 3CS0A 1HAYB 1XUKA 3UUZA 3RXTA 1CA0B 1DWBH 5TCAA 1EAXA 1O3OA 2VGCB 2GJGA 1BRCE 1DLEA 1EUFA 4ESTE 1Z8RA 2Q6DA 4X2WA 1MAXA 4WVPE 2QCYA 1FLEE 2EEKA 1C1RA 4H6TA 3SYJA 3ZZ3A 3PRDA 1SGPE 1IQEA 1GG6C 3MH6A 3UOUA 3TU7H 4B1TA 1AB9B 1C2JA 2AFQB 1QIXB 2FLRH 3OX7U 2GCHF 4I8HA 1QBVH 3TH4H 3GCHC 2ZKSA 2BOHB 1QA7A 2ZECA 1UK2A 2PLXA 1A3BH 3Q76A 5HM2A 3BTQE 4BXSA 1BTWA 2JJ2D 1QY6A 5A0AE 3ODFA 1LO6A 2AGEX 2GGVB 1UCYK 1VGCB 3PMHB 2O8MA 5CE1A 5L6NH 1TFXA 3H7TA 1CHOG 2B0FA 4B2AA 1CBWB 3D62A 2OC1A 1Y5BT 3RXQA 1A2CH 1SQTA 2FX4A 2KAIB 1GHYH 1FY3A 2BD3A 2G52A 2EY4C 1PPCE 2WV5A 4DW2U 1A3EH 1V2QT 3VB7A 2QA9E 1GMDF 2VIWA 1HYLA 5T6DA 3TH3H 1UTKA 4GCHG 4CH8B 4F4OC 1XXFA 1ZRKA 1G37A 2HALA 1LKBA 5FPSA 4ABBA 4ZHAA 2O8LA 4X0WU 1S0QA 4B6EA 2HOBA 3SV2H 1TE0A 1MBQA 1GJ7B 3MO3A 2FXRA 2D8WA 1QGFA 1BBRE 1WYKA 1YM0A 5C2ZA 3QUMP 1V2TT 1HUTH 1E36B 2FTLE 2HNTE 5LPFA 1ESAA 2SGFE 2IOTA 2PR3A 2O8UA 2G81E 1G3EA 1YWUA 4KTSA 1H9HE 1S85A 1C1PA 1DS2E 1ANCA 1TBRH 1P2QA 3FZZA 5EXLA 4X2XA 3VGCB 1KSNA 1JBUH 3T2NA 1DDJA 3ITIA 3FANA 4Y8YA 2WYGA 1T8NA 4JZFH 4HFPB 1SGFA 2BXUH 2YMSC 1AQ7A 3DSOA 4JK6A 1QL8A 3STJA 1NBMD 1O3AA 2VIQA 3RC4A 5C5OA 5HM9A 1UTQA 1PPHE 2V6NA 5T6FA 3RMNH 1LHFH 1BMFD 1NFXA 2FOHA 4IGDA 4AB8A 1GCDA 1L1GA 2BDYA 3ATLA 4BOHA 5A09A 1BITA 2Z3DA 1TOCB 1NPMA 3SNEA 2BOKA 2C3SA 1MMJN 1GBCA 1QL9A 1C5XB 3GCNA 5IK2D 3V12A 4LZ1H 1LDTT 1T4VH 1W11U 2ZO3H 1IQNA 3E6PH 4UE7H 2BD7A 4U30A 5JBAS 2BDCA 2PTNA 3MWIU 1NFUA 1W0ZU 3ZZAA 1NZQH 4IC5A 3SQHE 1V2WT 2GCTC 4B73A 1OXGA 3HPTB 1NS3A 1WU1A 1OYQA 2YNAA 1BMAA 3SBKA 5CMXH 1GHBF 3E8LA 4Y10E 4Y79A 4UFEH 5EQSA 5AVDA 3S7HB 1FPHH 2EQNA 1E38B 2BY7X 4ISHH 2BY9X 2J95A 3RMLH 1UTMA 4KP0A 4DY7B 5EJ1A 2VVUA 3M61U 1SOZA 3U8RH 4CREA 6LPRA 1K28D 1HAOH 2L74A 1VITG 2XNDD 3H09A 1BJUA 2VU8E 1BTPA 6GCHF 4DURA 1BB0B 2KCOA 1ZSLA 2P8OB 3NCLA 3PLBA 4Y0ZE 1DM4B 5HKKD 1AE5A 5JBBS 4JZEH 2ZFSA 2ZDAH 1UTJA 2THFB 1ZRBA 1OWIA 3MOCA 1O3FA 2SGQE 4I8KA 1AVGH 1NC6A 3TNTA 1LPGB 2JJ1D 1MTVA 1T8MA 1UTOA 1E35B 3QK1A 4U01A 1N6XA 4GSOA 2OK5A 4I32A 3U28C 4INHA 2CXVA 3U8TH 4CR5A 3RU4D 1AI8H 4NCYA 3K2UA 1C5PA 3L3TA 2Z9JA 4E7NA 2OC7A 2GV6A 1BMMH 1CA8B 3N7DA 4NFEA 3T26A 2F9PA 1ELBA 1QCPA 2LP6A 7ESTE 5ESBA 2NWNA 5FBEA 3MTYA 2HVXA 4ISOA 3A7VA 3F9GA 4A1VA 4YM9A 3DFLA 3MI4A 3QLPH 2FPZA 1P57B 3NUMA 5AFZH 1ZPBA 5L30H 5C94A 2BLOA 2PV9B 2P3FH 5DG6A 1LHGH 1SQAA 2FODA 2J9NA 3BTGE 2BZ6H 1MU6B 1D6RA 1QHRB 3M5NA 3BF6H 5C1YA 4D9QA 1A1RA 1TPPA 4XRNA 3GCOA 1AUJA 4YOIA 1EASA 4ISLA 4I31A 4DJZB 4OGXA 3V13A 3MNSA 2OTVA 1E1QD 1QFKH 9LPRA 1QJ1B 3TGJE 2ULLA 3QDZB 1LCYA 5EPNA 1DUEA 4D7GA 1SFIA 2BDAA 1UTLM 1O5EH 2A4RA 3AK5A 4AOQA 5T6GA 2IJOB 4AGKA 1BDAA 2RFKC 4A92A 3T5FH 3UREA 1D3DB 1XUHA 2B8OH 3M3VA 4NZQA 1XKAC 3TPIZ 2W7SA 1L4ZA 1ELCA 2ZHDA 1O2ZA 3LU9B 4X1RU 4ZXYH 3A87A 1CGHA 2RG3A 2ZGJA 4X6PA 1HXFH 3NK8A 1V2LT 4QT8C 1O5FH 4GVUA 1C5MD 1MKXK 1GJ5H 2O9QA 2A4QA 2GZ8A 5DKMA 1D4PB 1O0DH 1G30B 4VGCC 4A7IB 1PPEE 2KR7A 2QXIA 5A2MH 2QXGA 3MMGA 1TGBA 1O2LA 1EAUA 1TALA 5EQRA 3F2GA 1BIOA 3RXMA 4INKA 3R0FA 1W12U 1FDPA 3RXBA 1NRQH 4OGYA 1V2NT 2AERH 8ESTE 5JB8S 4P02A 3ZZ8A 2HVYB 2PP6A 3PROA 3CENA 4K2YA 1AVWA 1DPOA 3P6ZB 5HYOA 2XTTB 2CF8H 2F91A 5LH8A 1C5SA 4AFSA 1OP0A 2J5UA 2K0QA 3BTTE 4M7GA 4KTUA 3GYMA 3P8NA 1W7XH 2CHAB 5LPRA 1HIAA 5CHBA 2BVRH 2FI3E 1GJ9B 1NM6A 3SJOA 4K8YA 1J17T 1V2ST 5FL7D 3BIUH 3A8DA 1D3PB 3B9FH 3GCTF 4LK4A 2GZ9A 1O2JA 1EKBB 3O8DA 2WPJS 2CN0H 3QWCH 1BA8B 3RDZA 2AGGX 1GI6A 1ABJH 5JDUB 3TJVA 1A61H 3FP7E 3BG4C 1O2MA 1EFRD 3KQ5A 1ZGIA 4CRCA 1BHXF 2V7QD 1AN1E 2FWWA 3RU4T 1DICA 3TITA 6ESTA 1F7ZA 3RM2H 4D9RA 2AIQA 3M7QA 3F3BA 1GVZA 3UIRA 1FIZA 2PFEA 2FOEA 1GBLA 2QE7D 3NXPA 1MABB 1TGSZ 1RFNA 4LOYH 1F5KU 4BAKB 4Y71A 1Y3VA 5CDFE 1GJBB 3ESTA 3M5MA 1G2LA 2CK3D 1SGCA 3PO1B 4Y0YE 1ORFA 2JKHA 1WXRA 1RTKA 1UTNA 1YLCA 1OP2A 1WQVH 2PGQB 1C1NA 2CMYA 1TPSA 1GI9B 1GHZA 4WMDA 2A1DB 1QTFA 1G9IE 1KIGH 3A81A 1F92A 3Q3YA 1AFEH 1JOUB 2DE9A 4D8NA 1J14A 1C2GA 1O34A 1OWDA 2WPMS 1GMDG 1FMGA 1FY5A 2BY6X 3AW1A 5FX6A 3ZYDA 1AMHA 1PJPA 3RP2A 1GHXH 5HMAA 1ZMNA 3OSYA 3SNAA 1ETRH 3LPRA 2JH6D 5DP4A 2DUCA 4K3JA 4NWKA 1A46H 3GICB 5AF9H 4Z1MD 1PFXC 4IMZA 3ZZ4A 4IC6A 4IS5A 1O2IA 3L33A 3KQCA 1ESBA 2FOAA 1FN6A 1O2GH 1GBIA 2BY5X 1ZMLA 2VINA 3GY3A 1V2KT 4JZIA 3ZZCA 4X1NU 5C0TA 2WYJA 1MQ6A 3F0OA 4O3TA 4Y11E 2J38A 1QR3E 3FO8D 3ATKA 4MQAA 3U69H 5AFYH 3KYFA 1EPTA 1O31A 2H5DA 3PMBB 3WWBA 3SI3H 1TX8A 4RN6A 3SUFA 3K6YA 2Z9KA 2VB0A 1Z1JA 2R3UA 3B23B 4HZHA 1MTNC 3SU2A 2BD2A 3AVZA 3MNBA 3EA8A 1ID5H 4NWLA 1O2VA 2R2WU 2BD5A 1CT4E 1ZTJA 1OWHA 1CE5A 3P8GA 4K1EA 2H9EH 2JETB 3RMMH 2ALPA 1QB9A 1TRYA 4ACBA 2D2DA 1XX9A 2ZCLP 1FY1A 2I6QA 1ELEE 3PMAB 3P17H 4CRBA 1KTTB 3S7KB 4FU9A 1QNJA 2WINI 4CRAA 5DP5A 1Z6JH 2QY0B 4TWYA 2XCNA 2BD8A 1K9OE 4H4FA 4CHAB 5EOKA 1HDTH 4E7RG 4YTAA 1CA0C 2RA0A 1XUIA 1W3CA 5BPEA 2VGCC 3A7WA 1QA0A 3RXEA 2Z9LA 2AMPA 2QC2A 8LPRA 1EZXC 1EOJA 1EPTB 3NRLA 2VH0A 1CVWH 1GHBG 2F43B 2C8WB 1KLIH 3MH4A 1NTPA 4Q4LA 1AB9C 2V3HH 1TA2A 1DX5M 5EXNA 3QZRA 3FOAA 5TJXA 2WUCA 3S0NA 1O2RA 2AS9A 2B9LA 3SU0A 4B71A 1F5RA 3PM3A 1RGQA 2ZG0H 2BM2A 5DO4H 2HLDD 2A5IA 3SHCH 1FPCH 1RD3B 1QJ6B 3A8BA 1WSSH 1L1NA 1N1LA 2PKSB 1IQFA 1MTWA 2ZTZA 4X1SU 1UVOA 1UVTH 3C1KA 3K6ZA 1ETTH 4CH2B 1VGCC 3HGPA 3PV2A 4Q63A 2BZAA 5A8ZA 2OBQA 1F0UA 3A7TA 1C1WH 1CBWC 1BRUP 3A89A 4Y8ZA 1H1BA 3H5CB 1NU7B 3PTBA 1O2OA 1O3EA 3DHKH 4ZH8A 4ASHA 2P95A 4UD9H 1W0JD 1P2JA 2WZQA 1NRRH 1JMOH 1SPJA 2ZFFH 4ABGA 1O3DA 2Y7ZA 1PPBH 1GCTB 4AN7A 3IWMA 3C27B 1T8LA 1C1VH 3M5LA 1DXWA 1C2DA 1W10U 4FVDA 2A7JA 3LJJA 1KXEA 2UUJB 5HXFA 2ODPA 3LGUA 3QZQA 2BDBA 1GI7B 5I46H 1F5LA 1YCPK 1O37A 2NU3E 4CRDA 4ZXXH 3QGJA 1ELGA 2KAIA 2TBSA 3RXHA 1OSSA 2EI7A 2F9VA 1PQ5A 2M5TA 2QF5A 1H4WA 1DITH 1EZQA 3UAIC 8GCHF 1KMHB 1TNGA 3UTUH 1GI8B 3R3GB 1HV7A 4X8SH 1P3EA 5DK1A 3M7UA 1IQIA 2PHBA 4O03A 2WHXA 4I8LA 4OS6A 1SSXA 2ZIQH 4NA8A 1XMNB 2STAE 4X6MA 3SU6A 1O2SA 1FONA 4K1TA 5JB9S 3B8JA 3URDA 4JYVH 3LGTA 2WPHS 2XBYA 3ZYEA 1EJMA 5EJZA 2Y81A 1MTUA 1HJ8A 2BYAX 5DJ7A 4ABDA 2WPIS 1SGQE 4AORA 2Q1JA 3D23A 1J8AA 3OAAD 1ZGVA 3LIWA 2FYRA 4Q7XA 5EGMA 2Z9GA 2PSYA 1V2VT 1ZOMA 2GMTB 1B7XB 4XOJA 3ZVGA 1GI5A 1C9PA 1GMHG 4AZ2B 4ZAEA 1TWXB 2SNWA 5ESTE 1AO5A 1MKWK 2Q6FA 1HAIH 4I7YH 2Y5GA 3A7ZA 2ZQ1A 1O2XA 2L6OA 3SV7A 1WDIA 5EW1H 3P8OA 2XOKD 1O3HA 1Y8TA 1CGIE 1GDUA 1Z8GA 1XVMA 2KZ4A 1EAWA 1LVMA 1L1JA 4WXVA 3PWCA 5HGGA 3CS7A 1DY8A 2H6MA 3GCTG 2H2ZA 3MU4A 2P8OC 5ETXA 3U1JB 3SHAH 1ETSH 5F03A 1O3PB 4F48B 2A7CA 4FUIA 1K1JA 1FI8A 1W8BH 2ZFTA 4X2VA 3ZVAA 2FS8A 1AGJA 2W6JD 5GJ4B 2JH0D 3GY2A 3M37A 3EA7A 4XBCA 3E3TA 3SOSA 3M3SA 1MCTA 1EB1H 6CHAC 2GDEH 4I33A 4NSYA 4B2CA 4GHTA 1GJCB 1RTFB 2FP7B 2ZF0H 3A7YA 3TGIE 2NU1E 3F2FA 2Y7XA 1IQLA 2JDID 1J9CH 3UWIA 4WY3A 4ZHMU 1DSUA 3KQEA 1DOJA 1QB1A 1GI0A 1JIRA 1V2JT 4JK5A 3S69A 4ZROA 3ZZ6A 1ZLRA 1WAYB 1GBDA 1HAHH 1IAUA 1LKAA 1P8VC 3BEFB 4MPUA 4X8VH 3RC6A 3BTKE 1B5GH 1E1RD 3VG8A 3SNCA 1VITH 1O2WA 1KXCA 5DP3A 2FI5E 4MNWA 2SGDE 3RXOA 2OLGA 4ABJA 3EBNA 4D76A 3BTFE 3EDXB 1KXFA 5K7RA 2CV3A 5E8EH 2ZU4A 4TPIZ 3O8CA 1YPHE 1TQ0B 1YPEH 1C2KA 3E91A 1V6DA 4NG9H 2FOBA 3SO3A 2P3UB 1RTLA 3OFND 1TMBH 2WPKS 2LPRA 1KXBA 4PROA 4B75A 1P3CA 3SGBE 1YPGH 4U2WA 2HGTH 1TQ7B 4X1PU 3GDSA 3W95A 3OTPA 1HJAB 2QXHA 4HTCH 1TYNA 4YT6H 1ZPZA 4GHQA 3SV8A 3SW2B 1PQ8A 3GY8A 3M3TA 5GCHG 1ANDA 3MO9A 3FZDA 4HI3A 1B0FA 3MH5A 3KCGH 1P02A 4ZKOU 5JBTA 1Y5AT 3FKSD 3MHWU 2WV9A 5IYTA 2VVVA 2FX6A 5GNDA 4OS5A 1GHVH 1UMAH 1CU1A 2ZDLA 1AHTH 5T3HA 2XCFA 5GWZA 2SGAA 1XKBC 4X8UH 1QZ8A 2BQ6B 3V0XA 1TONA 2NU4E 1O2UA 5E2OA 2UUKB 1MAYA 4FUJA
chains in the Genus database with same CATH topology
1QQ4A 1CSOE 2LNCA 1O33A 2YNBA 1GDQA 3HK6B 3SGAE 1DWCH 2ALVA 2G4TA 4K69A 2ZGBH 1ZTLA 2FI4E 2CHAC 1O2NA 3MU5A 3RXFA 4AFQA 2Y82A 1P10A 3ZVBA 3MU8A 1M9UA 5F6MA 1HAVA 3UNRA 1O38A 3K65B 1GI2A 1E34B 2C4FH 3VXEH 2D1JA 1GHAF 2ILNA 3MU0A 1IHSH 2G51A 3EE0B 2O8WA 4YZUA 1RRKA 2QF3A 2RCEA 4IBLH 2B7DH 4ZUHA 3SU3A 1RS0A 4MPXA 1UVUH 2QAAA 2QGRA 2FMJA 1ZSKA 5JYIA 2F9UA 2AEIH 2G8TA 1FXYA 2C93B 4ZKRU 3SN8A 1SGIB 2Z3EA 1P2OA 4NA7A 1JRSA 1GDNA 2ZFQH 3I78A 3S9AA 1DE7H 3I77A 4Y7AA 1HAXB 3RXCA 1O2QA 1MZDA 1O3JA 1MD7A 1MH0A 3QN7A 1PPZA 4FUCA 1S0RA 3UNSA 2HPPH 2FOGA 4A6LA 2FLBH 3ATIA 1SHYA 1P04A 4BXWA 1OP8A 2ZU5A 2NU2E 3OY5U 3PO1C 3SV6A 2BDHA 3LGIA 1F0SA 2ODQA 2A2XH 1BHXB 2J92A 1KYNA 1RXPA 1HAVB 4UONA 1G3DA 1YPJH 3A85A 4ZKNU 5FBIA 1GMCG 2PKAB 2PUXB 2NU0E 4R0IA 1GJ4H 3L6PA 3TGKE 3HKIB 3SU5A 3SJKA 1KXDA 2WUBA 4J2YB 1CHOF 2ZGXH 3KIDU 4Z0KA 1TRNA 2F3CE 3MNCA 2VWNA 3F1SB 3MYWA 3BIVH 4WXIA 5IDKA 5CHAB 1H8IH 3GDVA 3NWUA 4BAOB 3UQOA 1O3MA 4K60A 2BTCE 1ZR0A 4BTTB 1D3TB 1D6WA 1S81A 1U6QA 3SZNA 1UJ1A 4GCHF 2OBOA 8GCHG 4UFGH 2ZFPH 1INCA 1FZZA 1S83A 3IG6B 5E0GA 1BBRH 1O2KA 1T7CA 3ZZ9A 1BTUA 1GBBA 4KKDA 3RUOA 3TLOA 3BTME 2GCHG 3UNQA 1LPZB 3TVJB 3G01A 2XBXA 3A83A 2D26C 3UY9A 1GBHA 2BD4A 1TNJA 4OS2A 1W14U 4MVNA 2ZGCA 2JETC 2BLQA 1N6YA 5FXLA 1SGTA 1K22H 1SL3A 2EC9H 3ZVEA 2GZ7A 1OPHB 1C5TA 2QV1A 1UTPA 3RXKA 4B2BA 2ZDNA 3SJ9A 1SB1H 4ZKSU 5FPTA 1G3BA 4MNYA 1NFWA 2FOMB 1BCUH 1LPKB 5F8XA 4CHAC 2HPQH 5C1UA 2BD9A 1EJAA 1C1UH 1G3CA 3TJOA 3BN9A 1J16A 3D65E 4GLYA 1VCQA 1EPTC 3HK3B 2GT8A 1HAZB 3ZV8A 1P12E 1UCYH 1K21H 1TIOA 3FVFB 3F9HA 4XSKU 2ZQ2A 1FIWA 4WF8A 1KDQA 1MCVA 1V3XA 1W0YH 1Q31A 2H1UA 1NFYA 1K2I1 1FN8A 3PLKA 2OQ5A 3Q3KA 4YLQH 1O2PA 4NA9H 1ARCA 5L2ZH 1SG8B 3E16B 3M7TA 1O3GA 1C2LA 3P70B 1TB6H 1IQJA 2G4UA 1YF4A 3RXPA 4XFQA 3ZZDA 1AE8H 4AGJA 1W13U 5SGAE 2ZPQA 3V7TA 4CRFA 2PKSC 2A32A 4GUXA 1TLDA 1NN6A 1AFQC 2IN2A 9ESTA 2ZZUH 3FP6E 1HJ9A 2H5CA 2EI8A 2XBVA 1B0EA 1VITF 1NESE 4BTUB 1YPMH 2FYQA 4XBDA 3PWBA 1IQGA 3W94A 4ABFA 4MLFB 2AGIX 1THRH 3MNXA 2CJIA 1GJ8B 5FX5A 2ANMH 1GCTC 1Y3YA 2SGEE 1KDQB 3KGPA 5TCCA 4OS1A 1IQHA 3EGKH 1Z8IB 4KGAA 1QRXA 1SQOA 3U8OH 1HLTH 3BG4B 1C5UA 3VPKA 3BEIB 1NY22 3GOVB 2W5EA 3ODDA 3TK9A 3D49H 1BRAA 1KLTA 1RIWB 2C90B 2HNTC 1O39A 5EU8A 3F9EA 2XC5A 2H9TH 4O97A 4XE4A 3SGQE 2ZHWH 4FUHA 1Z1IA 4IMQA 4FU7A 1YP9A 1DWEH 4AX9H 1C5NH 3UPEA 3FFGA 2GT7A 1P2MA 1KXAA 1O3CA 1CO7E 5H4IB 2GX4A 4GPGA 2GDDA 1AUTC 1Y59T 1H9LB 3A86A 1O2HA 1WOFA 1CHGA 1O3BA 1Q3XA 4KTCA 2Z7FE 2H9HA 3RLYH 1DUAA 6GCHG 4ISIH 3RXVA 5A8YA 1C2IA 1GGDB 3JZ2B 1P01A 3Q3XA 2QXJA 4Q2KA 5AHGH 1V2OT 3A84A 2ZHFH 4THNH 5J4QA 1O3NA 1NROH 3RM0H 2SGPE 3GY7A 2FOFA 1N8OB 4MTBA 5EPYA 2Y5FA 2SFAA 5DP7A 7KMEH 2V35A 1A5IA 1P9SA 3SNDA 1CGJE 1S82A 3HGNA 1SVPA 1BTYA 3U9AH 1LVBA 4NIYA 1BMNH 4DG4A 4DIIH 1TGNA 4YOGA 1K1OA 3KHVA 3U98H 3VB6A 2BQ7B 1S5SA 1Y3UA 4AB9A 1S6FA 2GMTC 3MFJA 1ELAA 1WTHD 2BQWB 3GISB 2TPIZ 2QYIA 3BSQA 1BTHH 2ZGHA 1SGEE 1TX6A 1BJVA 2ZI2H 1C2HA 1D9IA 2G55A 4Y7BA 1SC8U 2W26A 4ABIA 1H9IE 3PTNA 1A0HB 1AY6H 2TGPZ 5I25A 3Q77A 3P95A 3ZVCA 1GBMA 2BMGB 1XVOA 1UK4A 1NRNH 3UR9A 1AZZA 1EAIA 1NRPH 1W2KH 2ZCKP 3LGYA 1YYY1 1G36A 2Z94A 1VCWA 3HATH 1A0JA 2FM2A 3VB5A 1G2MA 2TGAA 1OWJA 4ABAA 3EAJA 2PWXA 4NIWA 3V3MA 1BRBE 2BDIA 1SGFG 2BLVA 1ZMJA 3QTVH 4FUDA 5DPAA 2QF0A 2FTMA 5E2PA 2OINA 3KQDA 3VGCC 2XBWA 2ZTXA 1SFQB 1BZXE 1HBTH 4K8BA 1GJAB 1TA6A 5PTPA 3S9CA 1GI4A 1QB6A 1AIXH 3T29A 5EXMA 4O3UA 3NZIA 1EP5A 2W7UA 1UVSH 2ZPRA 1XUGA 1P05A 1XUJA 4JYTA 3F6UH 1TBZH 2OD3B 1GJDB 4IW4E 2OQUA 4NGAH 1GBAA 1O35A 1SI5H 1SGYE 3RXGA 2VWOA 3KNXA 3RC5A 1EZUC 3M35A 1DSTA 1EZSC 3RU4E 4X6OA 1MUEB 1O3LA 1VZQH 4WJG2 3UQVA 1SGNE 1FQ3A 1C4Y2 2GKVE 1EOLA 4X8TH 3DFJA 4X1QU 1S84A 1WCZA 3AW0A 1MKXH 4JZDH 1BOQA 1SLWB 4WH8A 4FXGH 2IPHA 3M5OA 1T32A 4XBBA 1C5QA 1K1NA 4O9VA 1VJ9U 1TMTH 5FHTA 2HNTF 1O5GH 1QL7A 5E0JA 1PQ7A 3TJUA 1C1TA 1C1OA 3GDUA 3UWJH 2FEQH 1GVLA 3VB3A 1F0TA 3IITA 3SU4A 2F9BH 2UWPA 1HJAC 2BHGA 4NFFA 1NRSH 3Q00A 1V2PT 4TY6A 4AFUA 1C2FA 1F0RA 1ELDE 2ZU3A 4A5TS 1JWTA 3DUXH 1QBOA 1OWKA 1DT2A 3P92A 3VXFH 2AYWA 2W3IA 2EI6A 4BANB 1XM1A 3ELAH 1E0FD 1Z8JB 4DVAU 3TK6A 1UVPA 2ASUB 1BT7A 3ATWA 1C2MA 3A82A 5EW2H 3TIUA 1V2UT 1UO6A 1PYTD 2BX3A 3A8CA 1GL1A 3EA9A 1MD8A 3RXSA 3A7XA 1ZJKA 5JPMH 2P16A 4IN1A 4ZHLU 2YOLA 4ABHA 2VNTA 1O2YA 3DA9B 2C8XB 5A0CA 1C1MA 1GG6B 2FIRH 2FZZA 1P2KA 1SBWA 4IN2A 2STBE 3ZZBA 1PPFE 4NSVA 1CT2E 3GCHB 5EQQA 2AH4X 2Q6GA 4Y6DA 3E90B 1ZHPA 5F8TA 3SV9A 4DT7B 1S6HA 4MDSA 2ZPSA 2AIPA 2O8TA 1TRMA 1G32B 1A4WH 1ZSJA 2VIDA 5DGJA 2K1QA 1O3IA 2Y80A 2UWLA 3VB4A 1SMFE 3M36A 1MTSA 2A5AA 3KQBA 4FU8A 5GPIB 1GBEA 2ZTYA 3LGWA 3SJIA 5FCKA 1Z7KA 3ZVFA 1ELTA 1UCYE 4CBNA 2ANWA 2A45B 4AYYB 3N7OA 1OS8A 5JBCS 1AWFH 3ATMA 1JXPA 4Y76A 1WUNH 5K0HA 2UUFB 4X2YA 2P93A 3LC3A 1ZJDA 3E0NB 1GVKB 2R3YA 5EODA 1SR5C 2BVXH 3TJNA 1GBJA 3PYHA 1VR1H 1K1PA 2A5KA 2J34A 3DD2H 2G5VA 1FNIA 4JMYA 2G00A 1FY8E 4INLA 5L2YH 1T4UH 2Y6TA 1ZZZA 3AAVA 1KLJH 3BTDE 3UFAA 1TX7A 1JRTA 3TK5A 3DT0H 2AMDA 1GL0E 1QURH 2I6SA 3TNSA 1IHTH 3LDXH 3KF2A 3I29A 3PMJA 2K7XA 3BTWE 1UHBA 1HGTH 4HGCA 1ANBA 1VJAU 4CBOA 1P2NA 2Z3CA 3UR6A 3KL6A 3STIA 4Z6AH 1IQMA 2FS9A 2PGBB 3RXDA 3PLPA 1DWDH 4GAWA 2GP9B 3VEQB 5C1XA 7GCHF 3BTHE 4AYVB 1MBMA 1PPGE 1C1QA 4FUEA 3RXAA 2XNIA 2ZDKA 3GYLB 3HKJB 3LC5A 3UOPA 4YT7H 1GWAA 3LH3A 1GI3A 6CHAB 1DFPA 2GTBA 1P09A 1O2TA 1ANEA 2A0QB 3LOXA 2ZDVH 1AVXA 1D3QB 4TPYA 4WWYA 5CHAC 5DP6A 4I8GA 4BTIB 4FUBA 4SGBE 1WQSA 3RXRA 3LT3A 1TABE 1C5WB 2ZFRH 5LPEA 4NIXA 4Y8XA 2PKAA 2RA3A 1C5OH 2ZHEH 1ZHRA 1OKXA 3GY4A 2QIQA 2FDAA 1LVYA 3KEEA 2J2UA 3E1XB 1AWHB 1TOMH 1LQEA 3U1IB 1UHBB 3GY5A 4UFDH 1YLDA 1SLXB 4CRGA 1TPAE 1LMWB 2TGTA 2GCTB 1HXEH 4H42U 4X6NA 5GIBA 2VWMA 2UUYA 1OX1A 2BVSH 4J1YA 3RXLA 3SI4H 1C4U2 2ZC9H 2PUQH 1TPOA 4FUGA 4RKJB 1GI1A 2F9NA 1DXPA 4F49A 2TRMA 1QRWA 2ZA5A 1A5HA 1YPLH 3MO6A 2OC8A 3PV4A 1BTXA 2RDLA 2P3TB 2C8ZB 2ZDMA 2R0LA 3K9XB 3MH7A 1ZTKA 1EX3A 1SOTA 4ABEA 3SUDA 3GY6A 2XW9A 1FUJA 1NT1A 2XWAA 4Q80A 5FAHA 2OP9A 3URCA 4ZMAH 1SLUB 1HNEE 1BQYA 1AZ8A 1EB2A 2OUAA 2DE8A 1QRZA 3FP8E 4U32A 3T25A 4BAHB 3SUEA 3AAUA 2VIOA 1JIMA 3NKKA 3WY8A 2R0KA 4RKOB 4B74A 4DIHH 3FAOA 1GMHF 1Y3XA 1PYTC 1C5LH 2VJ1A 5BRRE 2BY8X 2C8YB 4FUFA 4K1SA 1HFDA 5C67A 1THPB 4ISNA 1YPKH 2P94A 5A8XA 2HLCA 1VCPA 1O3KA 2ODYB 1C1SA 3E0PB 1H8DH 3NPSA 2HWLB 5B6OA 4Q7YA 2V0BA 2JH5D 1YBWA 2A31A 2CF9H 1P2IA 1YCPH 1P9UA 3A80A 1SLVB 4D7FA 1NU9A 2ESTE 2P59A 1P0SH 1IOEA 1ZHMA 1HAPH 1TAWA 1GPZA 4AFZA 3BEUA 4DCDA 1TNIA 2GVFA 4LXBH 2VIPA 5ABWA 5GXPA 3TH2H 2BX4A 5DP8A 1LHEH 2R9PA 1MZAA 5J4SA 2OCVB 3LJOA 1L2EA 1GJ6A 4H6SB 1X7AC 2F83A 1GBFA 2XYAA 8KME2 1K1IA 2XRCA 5C5NA 1ELFA 2A2QH 2TGDA 2LIZA 3F68H 1ACBE 1TNHA 4R8TB 2BB4A 1RIWC 4JCNA 4SGAE 3OTJE 2ZWLH 1O5CB 2A4GA 2PTCE 3P8FA 1TNKA 1C4V2 2BDGA 1Z6EA 3ZVDA 1P06A 1PQAA 2J4IA 1NO9H 3S9BA 2AMQA 4VGCB 3T28A 1C5YB 2GV7A 5FPYA 4YLUA 1HIAB 5C20A 1A0LA 5A0BA 1ARBA 2B5TB 2V3OH 1WTGH 4WMFA 1T31A 1DANH 5EG4A 1TBQH 1FV9A 3OYPA 1TMUH 4RSPA 1QBNA 1GGDC 3SU1A 2SNVA 1MKWH 2Z6BD 1BMLA 3ZV9A 1O36A 5LGOA 2VIVA 1N8OC 1EATA 1HPGA 1YCPM 5E0HA 1OWEA 1K1MA 1LHCH 1EXFA 3O8BA 4MPVA 1SGDE 1ABIH 1EJNA 3RXIA 1L4DA 4JYUH 3EYDA 4NIVA 1F2SE 4E06H 3QX5H 3ZZ7A 5DP9A 1YGCH 1FAKH 4K5ZA 2ZNKH 1V2RT 4UEHH 1UK3A 4XDEA 4I8JA 4WH6A 2HRVA 1TGTA 1J15A 4YOJA 4UDWH 3PB1E 5GCHF 1L0ZA 3SORA 3LGVA 1THSH 4UFFH 1HRTH 1QQUA 3EQ0H 1FAXA 1WV7H 1Y5UT 4AG2A 3CP7A 2EA3A 4KELA 1AKSA 5F8ZA 4WMEA 1WBGB 4MG3A 5C3NA 1W7GH 2BXTH 2TIOA 1HAGE 1Y3WA 3VFEA 2A7HA 1C5RA 2F9OA 4JZ1A 2VH6A 1BUIA 1ZYOA 2J94A 2GD4B 1FY4A 4DOQA 3JZ1B 3RLWH 2UWOA 1DVAH 2ANKH 5G4BA 4Q7ZA 4E05H 3T27A 2QN5T 1LQDB 1HCGA 1Q2WA 2ANYA 1QJ7B 2W3KA 3SNBA 2ZU1A 4TWWA 1O30A 3RMOH 4AG1A 1O5BB 1CQQA 1TNLA 4OS7A 1EP6A 1C9TA 4MPWA 1LVOA 4OS4A 1GBKA 5FCRA 2XC0A 3LKWA 5GDSH 1K1LA 3SQEE 1Z71A 2ZCHP 2FESH 3MU1A 2OXSA 1IQKA 2WPLS 1O5DH 1ESTA 1SGRE 1O5AB 1P11E 2ZHQH 1E37B