4F4EA

Crystal structure of aromatic-amino-acid aminotransferase from burkholderia pseudomallei covalently bound to pyridoxal phosphate
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
399
structure length
398
Chain Sequence
MSLFSAVELAPRDPILGLNEAFNADTRPTKVNLGVGVYTNEDGKIPLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTAQALGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNGYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRLFAAANLNVFVSSSFSSFSLYGERVGALSIITDSKDEAARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTGRICVAALNTRNLDVVANAIAAVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic-amino-acid aminotransferase
publication title Crystal structure of Aromatic-amino-acid aminotransferase from Burkholderia pseudomallei covalently bound to pyridoxal phosphate
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 153
structure length 398
sequence length 399
chains with identical sequence B
ec nomenclature ec 2.6.1.57: Aromatic-amino-acid transaminase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4f4eA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4f4eA01
2W8WA 1JS6A 1WYTB 1YJSA 2VGTA 1ZODA 1CL2A 2VMWA 3BWNC 3AEJA 3DXWA 3ELPA 3L8AA 3MAFB 3NDNA 4EB5A 2HOYA 1WSTA 1M0OA 3I5TA 3P6KA 4IX8A 3LV2A 1IVRA 2Z9VA 3VK3A 9AATA 1ELUA 2D65A 3JWAA 4W5KA 1MDXA 3AEPA 2YRIA 4JEXA 5DJ9A 5K8BA 1AHEA 2BI9A 2GMSA 3B8XA 1IUGA 3FFHA 5EIGA 3WKSA 1VEFA 3HVYA 4RJYA 4A0GA 5M46A 2D7ZA 1LC5A 2JGTA 3PAAA 4J5UA 1W7LA 4A0FA 5M49A 3AEJC 3II0A 3GETA 1DTYA 1MDZA 1TASA 3A8UX 1DJ9A 3Q8NA 1S06A 3RBLA 2EGYA 1SZSA 4EU1A 3AENB 2BHXA 5FT8A 3QBOA 4LW4A 5HHYA 4F5IA 3A2BA 2R5CB 3FZ7A 4R2NA 4WYDA 3ELEA 4IW7A 1V72A 1WYTA 3CQ5A 3MAFA 3WKRA 5M4BA 3K28A 1FG7A 4OBVA 1M0NA 2YOBA 1GBNA 1Z7DA 3A9YA 1C7GA 1ORDA 2JJGA 3EI8A 3ZRPA 1IX6A 5G4IA 3FDDA 1MDOA 3DR4A 3DU4A 4F5MA 2HOZA 4WYFA 3FQ8A 4J8LA 3USFA 1TATA 1WYUB 1GC3A 2G6WA 4MKJA 5FT6A 2ZC0A 2QMAA 1CQ6A 1ASDA 2GMUA 2W8UA 3LVJA 3LVLB 3MADA 4AZJA 4M2MA 3HLMA 4UHOA 2NMPA 3UWCA 4B98A 4WP0A 1GC0A 1M7YA 3AOVA 1U08A 4QGRA 3AENA 2BIEA 3ASBA 4LC3A 1EJIA 2R5CA 1UU1A 2VMXA 3ECDA 4TMRA 3G7QA 1I43A 3G8MA 3EZ1A 4L0OA 4ZSYA 2EZ2A 1AHFA 1SF2A 4ZDLA 3FFRA 3ZRRA 4K2MA 1AHYA 1PFFA 4WXGA 4W1VA 1C9CA 2O1BA 3G0TA 2ZSLA 3GZDA 2AY3A 1JS3A 2V0YA 4OT8A 1TPLA 2BKWA 4JF0A 4E3QA 1S08A 4Y0DA 4GE7A 1X2AA 1SZKA 1WYUA 5G0AA 4N0WA 1Y4IA 1QIRA 2QB2A 3KKIA 1CS1A 1SPAA 3OKSA 3F6TA 4XQ2A 4DQ6A 2ZY3A 1AJSA 3GZDC 1D7SA 1TOKA 1O62A 2DR1A 3VK2A 4GE4A 4PVFA 3EZSA 2D61A 1DFOA 4UHMA 4B9BA 4F5JA 1S0AA 3DC1A 1TOIA 2W7IA 1V2FA 2E7UA 4IY7A 2W7LA 4W1WA 1X28A 4WYGA 1IX7A 1B4XA 3FD0A 5AX8A 3ZZKA 3NYTA 3NYSA 1TOJA 5IWQA 4LNJA 3IHJA 2AY1A 3QN6A 4ZDPA 1N31A 1I41A 4IXOA 4XK1A 4WYAA 4XJMA 3OP7A 2BI3A 1IAXA 4F4EA 1GEWA 4ZWVA 3TCMA 3ATHA 3JWBA 1ASEA 1OHYA 3JW9A 1AKAA 5EUEA 3EUCA 5F9SA 3LVKA 1ASMA 2HUFA 4M2JA 5G2QA 2PO3A 4XJLA 1O69A 4RIZA 1G4XA 3CBFA 1B9HA 2C0RA 1D7UA 2EO5A 3AATA 4LW2A 3BWOA 2CB1A 2VMVA 4GRXA 4A6TA 4F5GA 3RUYA 1OXOA 2BIGA 4R5FA 2QB3A 1XEYA 3LG0A 1G7WA 3E77A 3QGUA 5FT5A 2W7GA 4FFCA 2VGSA 4JF1A 4OYTA 2FNUA 1AJRA 3EI5A 3MKJA 2CSTA 5G2PA 3COGA 2CH2A 1TOEA 2AY8A 2X8UA 3E2FA 3HT4A 4R5ZA 3H7FA 1DGDA 1DJUA 3P1TA 1BQAA 2AY4A 1BT4A 2BIAA 3CQ6A 1ZOBA 4ZSWA 4WLHA 1ASAA 2HP1A 4XEWA 2FNIA 4TN4A 5DJ1A 2YCNA 1H0CA 1LW4A 2WK9A 2FN6A 4RM1A 1RVYA 2CJGA 5DB5A 4A72A 4DGTA 1V2EA 3WX9A 2BWNA 1UKJA 4ZM3A 2HUUA 3VOMA 5F8VA 3HMUA 3W1HA 1B8GA 2DGMA 2EPJA 2HZPA 2VIAA 1EG5A 2D5YA 2YKXA 3GSBA 3PJ0A 3WCNA 1BQDA 1AICA 1OHVA 3HDOA 4F5LA 1N8PA 2O0RA 3DZZA 3B1DA 5EQCA 4Q76A 1AMQA 1KMKA 2VMOA 2BI5A 4DBCA 2Z61A 4TV7A 4BA5A 3ASAA 2E7JA 3RCHB 3BS8A 1G4VA 4RJ0A 4XAUA 2CJHA 2OATA 2VMQA 2WKAA 3QI6A 5E4ZA 1G7XA 2AY6A 4WYCA 1AMRA 4M2KA 3TATA 2ZP7A 4GEBA 1GEYA 1GD9A 3BCXA 4ITGA 2DKJA 3PPLA 1T3IA 1CJ0A 1AX4A 1SZUA 4UQVA 4R8DA 4OBUA 1ARHA 1B9IA 1LC7A 3N5MA 1D2FA 4OMAA 4EMYA 3FVUA 2WK8A 3FZ6A 3KGWA 4ZWMA 2XH1A 3AEOA 3FKDA 1AAWA 4MQPA 1BJ4A 1ELQA 1UU2A 3BCBA 1LS3A 3PIUA 2DKBA 3NYUA 1AKBA 5G09A 3N75A 1QJ3A 3FCRA 4K2BA 3K7YA 3NUIA 4PFFA 4ZAHA 1YJZA 2CTZA 2R5EA 1QJ5A 3TQXA 3VK4A 1AY8A 2D64A 4KAMA 3RCHA 1PMMA 1LKCA 1PMOA 3MAUA 2ZSMA 3BB8A 1MGVA 2YKVA 3B1EA 3PGYA 1D7VA 1W23A 2BWOA 1IAYA 3WGCA 1S09A 4GDYA 1D7RA 3JTXA 2ZY2A 1LC8A 4WXBA 4WYEA 1W7MA 2YCPA 1DKAA 3LWSA 2YKYA 4MSOA 2VGWA 4N0BA 2C7TA 2E7IA 3QPGA 2W7DA 4IYOB 4MGRA 3F9TA 1V2DA 4A6UA 1TOGA 3FTBA 4GE9A 4JEYA 3B1CA 2JG2A 2BWPA 1M0PA 3NX3A 4JEZA 1ASLA 5EUDA 3I4JA 5HDMA 2AY9A 3BN1A 3WY7A 2V1PA 1IBJA 4F5FA 3F0HA 1AMSA 4BMKA 3PA9A 1ARTA 1JF9A 4EB7A 2GB3A 1OATA 1VP4A 2AY7A 4F5HA 3GJUA 2CANA 2JISA 3R9AA 1MAPA 4ADEA 2OQXA 2HP2A 1ASNA 1P3WA 1TARA 2VGVA 4JEWA 3DODA 4ATQA 3FZ8A 5EAVA 2F8JA 1ECXA 2RFVA 2DGKA 3ZRQA 3EI9A 1CZCA 1B5OA 1AMAA 2Z1ZA 3EIBA 3CQ4A 1X29A 1GDEA 2DOUA 3MC6A 4ZASA 1AHXA 1QISA 2E54A 2VMRA 5M4DA 4IYOA 3BC8A 2ZY5A 3ACZA 4ADCA 2GSAA 1SFFA 3R4TA 2Z1YA 2AEVA 1BJNA 3UAKA 4AZKA 1LK9A 4JE5A 3FVSA 1WYVB 3D6KA 1E5FA 1EQBA 1I29A 4U2HA 1BJOB 2R2NA 5J8QA 2JJEA 3K40A 4E3RA 4ZDOA 3MC6C 4F5KA 2HUIA 2DGLA 5I92A 1ASGA 1MLZA 1KKJA 4LNMA 2CJDA 4KXKA 1KL1A 2HOXA 2YRRA 4UOYA 4XJOA 1J04A 4CVQA 1BW0A 1XI9A 2BI2A 1GC4A 3T32A 1YIZA 1ASBA 2W7EA 4ADDA 5BJ4A 5D95A 4AH3A 2Z9XA 3FRKA 4ZLVA 2O7CA 1QZ9A 1C7OA 3NUBA 2ZUKA 5JAYA 1YOOA 2BI1A 2VMYA 3ISLA 1H1CA 5DX5A 4JE5D 3E2ZB 1VJOA 3NU7A 4A0HA 2QLRA 3PDBB 2AEUA 4A00A 2OKJA 1ZC9A 2Q7WA 2Z9WA 2OGAA 2FYFA 1WYVA 1O4SA 4BQ0A 4HF8A 2W8TA 1DGEA 1BJOA 1W3UA 2JJFA 2VGZA 1CZEA 1YIYA 4WD2A 2BYLA 2ZYJA 5EUNA 5TF5A 4P7YA 4UHNA 3TFUA 1YJYA 4ATPA 2D7YA 3GZCA 1OXPA 3PD6B 1CQ8A 2X5DA 4ISYA 1MAQA 2AATA 3NRAA 4IXSA 2VI9A 4A0RA 4BHDA 4W8IA 1O61A 2VIBA 4CXRA 1ARIA 2W8JA 1ASFA 1KMJA 4AO4A 3MBBA 4BA4A 1E5EA 1FG3A 2EZ1A 3I16A 4ADBA 4AO9A 2VMTA 2Z9UA 3DRDA 2Z20A 3FQ7A 2AY2A 3JU7A 4IXZA 1IX8A 4PIWA 1B5PA 5LH9A 4Q75A 4AOAA 3KE3A 2Z67A 2FM1A 2BYJA 1M6SA 3E2ZA 2GQNA 3DR7A 2PB2A 3PDBA 4WB0B 1AKCA 2CFBA 1CQ7A 3AEMA 4FL0A 5FT4A 1AAMA 2W7MA 3AELA 4W1XA 3WGBA 3ZZJA 1WKHA 3QM2A 2VGUA 2ORDA 3WLXA 1I48A 3PD6A 4Y0HA 2EH6A 1MLYA 2FQ6A 3NTJA 4WLJA 2R0TA 1ASCA 2YHKA 3B46A 1Z3ZA 3BV0A 3M5UA 4I8AA 3HL2A 3E2YA 1AY5A 2W7JA 1ARGA 1AY4A 3GR9A 1RV3A 4WBTA 2W7HA 3AV7A 4P3MA 5HXXA 3AEMC 3HBXA 1X0MA 4JEVA 2PB0A 2XBNA 4RKCA 4RLGA 3LVMA 4ITXA 3W1IA 2VMPA 4CBRA 1QGNA 3E9KA 3RQ1A 3FSLA 3IF2A 2CINA 4WB0A 3DYDA 1IJIA 4OTLA 3UE8A 1AJSB 3VAXA 3TFTA 3FDBA 4MY5A 2VYCA 3CAIA 4NOGA 1BS0A 2D66A 2VI8A 4HVKA 5LHAA 3A9ZA 3RBFA 5G4JA 4Q6RA 2W7KA 3HQTA 4XJPA 4Q31A 4W91A 1M0QA 2C44A 1LW5A 3EI7A 3L44A 1QITA 4A6RA 2TPLA 3KGXA 4E1OA 5BJ3A 1YAAA 1GCKA 3WZFA 4LNLA 2X5FA 3H14A 2OKKA 5C6UA 3BCAA 2QBTA 1AHGA 3MEBA 2WK7A 3EIAA 2D63A 2YCTA 1GC2A 4MQQA 3WCOA 1KL2A 1W7NA 3RI6A 8AATA 2W8VA 2QA3A 3FQAA 1RV4A 1N2TA 2VLHA 4RITA 1CL1A 1YNUA 3GBXA 1C7NA 4KYOA 1ARSA 4K2IA 4RAEA 2JJHA 1PG8A 4MKKA 2HORA 2W7FA 2VLFA 2CY8A 2ZJGA 4RKDA 3EI6A 2CH1A 3DXVA 4OC9A 1M4NA 2VMSA 3NU8A 1BJWA 3AOWA 3E6GA 4CBSA 3NNKA 2VMUA 3PDXA 5D5SA 4Y0IA 4PFNA 2C81A 2VMZA 5E3KA 2X3LA 1GEXA 1BKGA 4E77A 4EFFA 2AY5A 4CXQA 1DJEA 2ZY4A 2VMNA 2YKUA 3JZLA 3N0LA 2OGEA 3FVXA 1AIBA 5E5IA 5EFSA 5EIGB 1SVVA 1J32A 1FC4A 1JG8A 3GWPA 1S07A 5EAAA 1UU0A 1AIAA 3BWNA 3W1JA 1OHWA 7AATA 4GSAA 4MQRA 1RVUA 4WXFA 4U1TA 3VP6A 3QHXA 1M32A 3LY1A 4OCAA 1KKPA 3A9XA 1C0NA 1C4KA 4H51A 4O6ZA 4ZM4A 1WKGA
chains in the Genus database with same CATH superfamily
2W8WA 1JS6A 1WYTB 1YJSA 2VGTA 1ZODA 1CL2A 2VMWA 3BWNC 3AEJA 3DXWA 3ELPA 3L8AA 3MAFB 3NDNA 4EB5A 2HOYA 1WSTA 1M0OA 3I5TA 3P6KA 4IX8A 3LV2A 1IVRA 2Z9VA 3VK3A 9AATA 1ELUA 2D65A 3JWAA 4W5KA 1MDXA 3AEPA 2YRIA 4JEXA 5DJ9A 5K8BA 1AHEA 2BI9A 2GMSA 3B8XA 1IUGA 3FFHA 5EIGA 3WKSA 3N4XA 1VEFA 3HVYA 4RJYA 4A0GA 5M46A 2D7ZA 1LC5A 2JGTA 3PAAA 4J5UA 1W7LA 4A0FA 4K05A 5M49A 3AEJC 3II0A 3GETA 1DTYA 1MDZA 1TASA 3A8UX 1DJ9A 3Q8NA 1S06A 3RBLA 2EGYA 1SZSA 4EU1A 3AENB 2BHXA 5FT8A 3QBOA 4LW4A 5HHYA 4F5IA 3A2BA 2R5CB 3FZ7A 4R2NA 4WYDA 3ELEA 4IW7A 1V72A 1WYTA 3CQ5A 3MAFA 3WKRA 5M4BA 3K28A 1FG7A 4OBVA 1M0NA 2YOBA 1GBNA 1Z7DA 3A9YA 1C7GA 1ORDA 2JJGA 3EI8A 3ZRPA 1IX6A 5G4IA 3FDDA 1MDOA 3DR4A 3DU4A 4F5MA 2HOZA 4WYFA 3FQ8A 4J8LA 3USFA 1TATA 1WYUB 1GC3A 2G6WA 4MKJA 5FT6A 2ZC0A 2QMAA 1CQ6A 1ASDA 2GMUA 2W8UA 3LVJA 3LVLB 3MADA 4AZJA 4M2MA 3HLMA 4UHOA 2NMPA 3UWCA 4B98A 4WP0A 1GC0A 1M7YA 3AOVA 1U08A 4QGRA 3AENA 2BIEA 3ASBA 4LC3A 1EJIA 2R5CA 1UU1A 2VMXA 3ECDA 4TMRA 3G7QA 1I43A 3G8MA 3EZ1A 4L0OA 4ZSYA 2EZ2A 1AHFA 1SF2A 4ZDLA 3FFRA 3ZRRA 4K2MA 1AHYA 1PFFA 4WXGA 4W1VA 1C9CA 2O1BA 3G0TA 2ZSLA 3GZDA 2AY3A 1JS3A 2V0YA 2FKIA 4OT8A 1TPLA 2BKWA 4JF0A 4E3QA 1S08A 4Y0DA 4GE7A 1X2AA 1SZKA 1WYUA 5G0AA 4N0WA 1Y4IA 1QIRA 2QB2A 3KKIA 1CS1A 1SPAA 3OKSA 3F6TA 4XQ2A 4DQ6A 2ZY3A 1AJSA 3GZDC 1D7SA 1TOKA 1O62A 2DR1A 3VK2A 4GE4A 4PVFA 3EZSA 2D61A 1DFOA 4UHMA 4B9BA 4F5JA 1S0AA 3DC1A 1TOIA 2W7IA 1V2FA 2E7UA 4IY7A 2W7LA 4W1WA 1X28A 4WYGA 1IX7A 1B4XA 3FD0A 5AX8A 3ZZKA 3NYTA 3NYSA 1TOJA 5IWQA 4LNJA 3IHJA 2AY1A 3QN6A 4ZDPA 1N31A 1I41A 4IXOA 4XK1A 4WYAA 4XJMA 3OP7A 2BI3A 1IAXA 4F4EA 1GEWA 4ZWVA 3TCMA 3ATHA 3JWBA 1ASEA 1OHYA 3JW9A 1AKAA 5EUEA 3EUCA 5F9SA 3LVKA 1ASMA 2HUFA 4M2JA 5G2QA 2PO3A 4XJLA 1O69A 4RIZA 1G4XA 3CBFA 1B9HA 2C0RA 1D7UA 2EO5A 3AATA 4LW2A 3BWOA 2CB1A 2VMVA 4GRXA 4A6TA 4F5GA 3RUYA 1OXOA 2BIGA 4R5FA 2QB3A 1XEYA 3LG0A 1G7WA 3E77A 3QGUA 5FT5A 2W7GA 4FFCA 2VGSA 4JF1A 4OYTA 2FNUA 1AJRA 3EI5A 3MKJA 2CSTA 5G2PA 3COGA 2CH2A 1TOEA 2AY8A 2X8UA 3E2FA 3HT4A 4R5ZA 4H63Q 3H7FA 1DGDA 1DJUA 3P1TA 1BQAA 2AY4A 1BT4A 2BIAA 3CQ6A 1ZOBA 4ZSWA 4WLHA 1ASAA 2HP1A 1KAFA 4XEWA 2FNIA 4TN4A 5DJ1A 2YCNA 1H0CA 1LW4A 2WK9A 2FN6A 4RM1A 1RVYA 2CJGA 5DB5A 4A72A 4DGTA 1V2EA 3WX9A 2BWNA 1UKJA 4ZM3A 2HUUA 3VOMA 5F8VA 3HMUA 3W1HA 1B8GA 2DGMA 2EPJA 2HZPA 2VIAA 1EG5A 2D5YA 2YKXA 3GSBA 3PJ0A 3WCNA 1BQDA 1AICA 1OHVA 3HDOA 4F5LA 1N8PA 2O0RA 3DZZA 3B1DA 5EQCA 4Q76A 1AMQA 1KMKA 2VMOA 2BI5A 4DBCA 2Z61A 4TV7A 4BA5A 3ASAA 3N4RA 2E7JA 3RCHB 3BS8A 1G4VA 4RJ0A 4XAUA 2CJHA 2OATA 2VMQA 2WKAA 3QI6A 5E4ZA 1G7XA 2AY6A 4WYCA 1AMRA 4M2KA 3TATA 2ZP7A 4GEBA 1GEYA 1GD9A 3BCXA 4ITGA 2DKJA 3PPLA 1T3IA 1CJ0A 1AX4A 1SZUA 4UQVA 4R8DA 4OBUA 1ARHA 1B9IA 1LC7A 3N5MA 1D2FA 4OMAA 4EMYA 3FVUA 2WK8A 3FZ6A 3KGWA 4ZWMA 2XH1A 3AEOA 3FKDA 1AAWA 4MQPA 1BJ4A 1ELQA 1UU2A 3BCBA 1LS3A 3PIUA 2DKBA 3NYUA 1AKBA 5G09A 3N75A 1QJ3A 3FCRA 4K2BA 3K7YA 3NUIA 4PFFA 4ZAHA 1YJZA 2CTZA 2R5EA 1QJ5A 3TQXA 3VK4A 1AY8A 2D64A 4KAMA 3RCHA 1PMMA 1LKCA 1PMOA 3MAUA 2ZSMA 3BB8A 1MGVA 2YKVA 3B1EA 3PGYA 1D7VA 1W23A 2BWOA 1IAYA 3WGCA 1S09A 4GDYA 1D7RA 3JTXA 2ZY2A 1LC8A 4WXBA 4WYEA 1W7MA 2YCPA 1DKAA 3LWSA 2YKYA 4MSOA 2VGWA 4N0BA 2C7TA 2E7IA 3QPGA 2W7DA 4IYOB 4MGRA 3F9TA 1V2DA 4A6UA 1TOGA 3FTBA 4GE9A 4JEYA 3B1CA 2JG2A 2BWPA 1M0PA 3NX3A 4JEZA 1ASLA 5EUDA 3I4JA 5HDMA 2AY9A 3BN1A 3WY7A 2V1PA 1IBJA 4F5FA 3F0HA 1AMSA 4BMKA 3PA9A 1ARTA 1JF9A 4EB7A 2GB3A 1OATA 1VP4A 2AY7A 4F5HA 3GJUA 2CANA 2JISA 3R9AA 1MAPA 4ADEA 2OQXA 2HP2A 1ASNA 1P3WA 1TARA 2VGVA 4JEWA 3DODA 4ATQA 3FZ8A 5EAVA 2F8JA 1ECXA 2RFVA 2DGKA 3ZRQA 3EI9A 1CZCA 1B5OA 1AMAA 2Z1ZA 3EIBA 3CQ4A 1X29A 1GDEA 2DOUA 3MC6A 4ZASA 1AHXA 1QISA 2E54A 2VMRA 5M4DA 4IYOA 3BC8A 2ZY5A 3ACZA 4ADCA 2GSAA 1SFFA 3R4TA 2Z1YA 2AEVA 1BJNA 3UAKA 4AZKA 1LK9A 4JE5A 3FVSA 1WYVB 3D6KA 1E5FA 1EQBA 1I29A 4U2HA 1BJOB 2R2NA 5J8QA 2JJEA 3K40A 4E3RA 4ZDOA 3MC6C 4F5KA 2HUIA 2DGLA 5I92A 1ASGA 1MLZA 1KKJA 4LNMA 2CJDA 4KXKA 1KL1A 2HOXA 2YRRA 4UOYA 4XJOA 1J04A 4CVQA 1BW0A 1XI9A 2BI2A 1GC4A 3T32A 1YIZA 1ASBA 2W7EA 4ADDA 5BJ4A 5D95A 4AH3A 2Z9XA 3FRKA 4ZLVA 2O7CA 1QZ9A 1C7OA 3NUBA 2ZUKA 5JAYA 1YOOA 2BI1A 2VMYA 3ISLA 2WB6A 1H1CA 5DX5A 4JE5D 3E2ZB 1VJOA 2A1VA 3NU7A 4A0HA 2QLRA 2G7JA 3PDBB 2AEUA 4A00A 2OKJA 1ZC9A 2Q7WA 2Z9WA 2OGAA 2FYFA 1WYVA 1O4SA 4BQ0A 4HF8A 2W8TA 1DGEA 1BJOA 1W3UA 2JJFA 2VGZA 1CZEA 1YIYA 4WD2A 2BYLA 2ZYJA 5EUNA 5TF5A 4P7YA 4UHNA 3TFUA 1YJYA 4ATPA 2D7YA 3GZCA 1OXPA 3PD6B 1CQ8A 2X5DA 4ISYA 1MAQA 2AATA 3NRAA 4IXSA 2VI9A 4A0RA 4BHDA 4W8IA 1O61A 2VIBA 4CXRA 1ARIA 2W8JA 1ASFA 1KMJA 4AO4A 3MBBA 4BA4A 1E5EA 1FG3A 2EZ1A 3I16A 4ADBA 4AO9A 2VMTA 2Z9UA 3DRDA 2Z20A 3FQ7A 2AY2A 3JU7A 4IXZA 1IX8A 4PIWA 1B5PA 5LH9A 4Q75A 4AOAA 3KE3A 2Z67A 2FM1A 2BYJA 1M6SA 3E2ZA 2GQNA 3DR7A 2PB2A 3PDBA 4WB0B 1AKCA 2CFBA 3N4SA 1CQ7A 3AEMA 4FL0A 5FT4A 1AAMA 2W7MA 3AELA 4W1XA 3WGBA 3ZZJA 1WKHA 3QM2A 2VGUA 2ORDA 3WLXA 1I48A 3PD6A 4Y0HA 2EH6A 1MLYA 2FQ6A 3NTJA 4WLJA 2R0TA 1ASCA 2YHKA 3B46A 1Z3ZA 3BV0A 3M5UA 4I8AA 3HL2A 3E2YA 1AY5A 2W7JA 1ARGA 1AY4A 3GR9A 1RV3A 4WBTA 2W7HA 3AV7A 4P3MA 5HXXA 3AEMC 3HBXA 1X0MA 4JEVA 2PB0A 2XBNA 4RKCA 4RLGA 3LVMA 4ITXA 3W1IA 2VMPA 4CBRA 1QGNA 3E9KA 3RQ1A 3FSLA 3IF2A 2CINA 4WB0A 3DYDA 1IJIA 4OTLA 3UE8A 1AJSB 3VAXA 3TFTA 3FDBA 4MY5A 2VYCA 3CAIA 4NOGA 1BS0A 2D66A 2VI8A 4HVKA 5LHAA 3A9ZA 3RBFA 5G4JA 4Q6RA 2W7KA 3HQTA 4XJPA 4Q31A 4W91A 1M0QA 2C44A 1LW5A 3EI7A 3L44A 1QITA 4A6RA 2TPLA 3KGXA 4E1OA 5BJ3A 1YAAA 1GCKA 3WZFA 4LNLA 2X5FA 3H14A 2OKKA 5C6UA 3BCAA 2QBTA 1AHGA 3MEBA 2WK7A 3EIAA 2D63A 2YCTA 1GC2A 4MQQA 3WCOA 1KL2A 1W7NA 3RI6A 8AATA 2W8VA 2QA3A 3FQAA 1RV4A 1N2TA 2VLHA 4RITA 1CL1A 1YNUA 3GBXA 1C7NA 4KYOA 1ARSA 4K2IA 4RAEA 2JJHA 1PG8A 4MKKA 2HORA 2W7FA 2VLFA 2CY8A 2ZJGA 4RKDA 3EI6A 2CH1A 3DXVA 4OC9A 1M4NA 2VMSA 3NU8A 1BJWA 3AOWA 3E6GA 4CBSA 3NNKA 2VMUA 3PDXA 5D5SA 4Y0IA 4PFNA 2C81A 5KTBA 2VMZA 5E3KA 2X3LA 1GEXA 2QSRA 1BKGA 4E77A 4EFFA 2AY5A 3H9XA 4CXQA 2EYQA 1DJEA 2ZY4A 2VMNA 2YKUA 3JZLA 3N0LA 2OGEA 3FVXA 1AIBA 5E5IA 2KFPA 5EFSA 5EIGB 1SVVA 1J32A 1FC4A 1JG8A 3GWPA 1S07A 5EAAA 1UU0A 1AIAA 3BWNA 3W1JA 1OHWA 7AATA 4GSAA 4MQRA 1RVUA 4WXFA 3N7NA 4U1TA 3VP6A 3QHXA 1M32A 3LY1A 4OCAA 1KKPA 3A9XA 1C0NA 1C4KA 4H51A 4O6ZA 4ZM4A 1WKGA
chains in the Genus database with same CATH topology
2W8WA 1JS6A 1WYTB 1YJSA 2VGTA 1ZODA 1CL2A 2VMWA 3BWNC 3AEJA 3DXWA 3ELPA 3L8AA 3MAFB 3NDNA 4EB5A 2HOYA 1WSTA 1M0OA 3I5TA 3P6KA 4IX8A 3LV2A 1IVRA 2Z9VA 3VK3A 9AATA 1ELUA 2D65A 3JWAA 4W5KA 1MDXA 3AEPA 2YRIA 4JEXA 5DJ9A 5K8BA 1AHEA 2BI9A 2GMSA 3B8XA 1IUGA 3FFHA 5EIGA 3WKSA 3N4XA 1VEFA 3HVYA 4RJYA 4A0GA 5M46A 2D7ZA 1LC5A 2JGTA 3PAAA 4J5UA 1W7LA 4A0FA 4K05A 5M49A 3AEJC 3II0A 3GETA 1DTYA 1MDZA 1TASA 3A8UX 1DJ9A 3Q8NA 1S06A 3RBLA 2EGYA 1SZSA 4EU1A 3AENB 2BHXA 5FT8A 3QBOA 4LW4A 5HHYA 4F5IA 3A2BA 2R5CB 3FZ7A 4R2NA 4WYDA 3ELEA 4IW7A 1V72A 1WYTA 3CQ5A 3MAFA 3WKRA 5M4BA 3K28A 1FG7A 4OBVA 1M0NA 2YOBA 1GBNA 1Z7DA 3A9YA 1C7GA 1ORDA 2JJGA 3EI8A 3ZRPA 1IX6A 5G4IA 3FDDA 1MDOA 3DR4A 3DU4A 4F5MA 2HOZA 4WYFA 3FQ8A 4J8LA 3USFA 1TATA 1WYUB 1GC3A 2G6WA 4MKJA 5FT6A 2ZC0A 2QMAA 1CQ6A 1ASDA 2GMUA 2W8UA 3LVJA 3LVLB 3MADA 4AZJA 4M2MA 3HLMA 4UHOA 2NMPA 3UWCA 4B98A 4WP0A 1GC0A 1M7YA 3AOVA 1U08A 4QGRA 3AENA 2BIEA 3ASBA 4LC3A 1EJIA 2R5CA 1UU1A 2VMXA 3ECDA 4TMRA 3G7QA 1I43A 3G8MA 3EZ1A 4L0OA 4ZSYA 2EZ2A 1AHFA 1SF2A 4ZDLA 3FFRA 3ZRRA 4K2MA 1AHYA 1PFFA 4WXGA 4W1VA 1C9CA 2O1BA 3G0TA 2ZSLA 3GZDA 2AY3A 1JS3A 2V0YA 2FKIA 4OT8A 1TPLA 2BKWA 4JF0A 4E3QA 1S08A 4Y0DA 4GE7A 1X2AA 1SZKA 1WYUA 5G0AA 4N0WA 1Y4IA 1QIRA 2QB2A 3KKIA 1CS1A 1SPAA 3OKSA 3F6TA 4XQ2A 4DQ6A 2ZY3A 1AJSA 3GZDC 1D7SA 1TOKA 1O62A 2DR1A 3VK2A 4GE4A 4PVFA 3EZSA 2D61A 1DFOA 4UHMA 4B9BA 4F5JA 1S0AA 3DC1A 1TOIA 2W7IA 1V2FA 2E7UA 4IY7A 2W7LA 4W1WA 1X28A 4WYGA 1IX7A 1B4XA 3FD0A 5AX8A 3ZZKA 3NYTA 3NYSA 1TOJA 5IWQA 4LNJA 3IHJA 2AY1A 3QN6A 4ZDPA 1N31A 1I41A 4IXOA 4XK1A 4WYAA 4XJMA 3OP7A 2BI3A 1IAXA 4F4EA 1GEWA 4ZWVA 3TCMA 3ATHA 3JWBA 1ASEA 1OHYA 3JW9A 1AKAA 5EUEA 3EUCA 5F9SA 3LVKA 1ASMA 2HUFA 4M2JA 5G2QA 2PO3A 4XJLA 1O69A 4RIZA 1G4XA 3CBFA 1B9HA 2C0RA 1D7UA 2EO5A 3AATA 4LW2A 3BWOA 2CB1A 2VMVA 4GRXA 4A6TA 4F5GA 3RUYA 1OXOA 2BIGA 4R5FA 2QB3A 1XEYA 3LG0A 1G7WA 3E77A 3QGUA 5FT5A 2W7GA 4FFCA 2VGSA 4JF1A 4OYTA 2FNUA 1AJRA 3EI5A 3MKJA 2CSTA 5G2PA 3COGA 2CH2A 1TOEA 2AY8A 2X8UA 3E2FA 3HT4A 4R5ZA 4H63Q 3H7FA 1DGDA 1DJUA 3P1TA 1BQAA 2AY4A 1BT4A 2BIAA 3CQ6A 1ZOBA 4ZSWA 4WLHA 1ASAA 2HP1A 4XEWA 2FNIA 4TN4A 5DJ1A 2YCNA 1H0CA 1LW4A 2WK9A 2FN6A 4RM1A 1RVYA 2CJGA 5DB5A 4A72A 4DGTA 1V2EA 3WX9A 2BWNA 1UKJA 4ZM3A 2HUUA 3VOMA 5F8VA 3HMUA 3W1HA 1B8GA 2DGMA 2EPJA 2HZPA 2VIAA 1EG5A 2D5YA 2YKXA 3GSBA 3PJ0A 3WCNA 1BQDA 1AICA 1OHVA 3HDOA 4F5LA 1N8PA 2O0RA 3DZZA 3B1DA 5EQCA 4Q76A 1AMQA 1KMKA 2VMOA 2BI5A 4DBCA 2Z61A 4TV7A 4BA5A 3ASAA 3N4RA 2E7JA 3RCHB 3BS8A 1G4VA 4RJ0A 4XAUA 2CJHA 2OATA 2VMQA 2WKAA 3QI6A 5E4ZA 1G7XA 2AY6A 4WYCA 1AMRA 4M2KA 3TATA 2ZP7A 4GEBA 1GEYA 1GD9A 3BCXA 4ITGA 2DKJA 3PPLA 1T3IA 1CJ0A 1AX4A 1SZUA 4UQVA 4R8DA 4OBUA 1ARHA 1B9IA 1LC7A 3N5MA 1D2FA 4OMAA 4EMYA 3FVUA 2WK8A 3FZ6A 3KGWA 4ZWMA 2XH1A 3AEOA 3FKDA 1AAWA 4MQPA 1BJ4A 1ELQA 1UU2A 3BCBA 1LS3A 3PIUA 2DKBA 3NYUA 1AKBA 5G09A 3N75A 1QJ3A 3FCRA 4K2BA 3K7YA 3NUIA 4PFFA 4ZAHA 1YJZA 2CTZA 2R5EA 1QJ5A 3TQXA 3VK4A 1AY8A 2D64A 4KAMA 3RCHA 1PMMA 1LKCA 1PMOA 3MAUA 2ZSMA 3BB8A 1MGVA 2YKVA 3B1EA 3PGYA 1D7VA 1W23A 2BWOA 1IAYA 3WGCA 1S09A 4GDYA 1D7RA 3JTXA 2ZY2A 1LC8A 4WXBA 4WYEA 1W7MA 2YCPA 1DKAA 3LWSA 2YKYA 4MSOA 2VGWA 4N0BA 2C7TA 2E7IA 3QPGA 2W7DA 4IYOB 4MGRA 3F9TA 1V2DA 4A6UA 1TOGA 3FTBA 4GE9A 4JEYA 3B1CA 2JG2A 2BWPA 1M0PA 3NX3A 4JEZA 1ASLA 5EUDA 3I4JA 5HDMA 2AY9A 3BN1A 3WY7A 2V1PA 1IBJA 4F5FA 3F0HA 1AMSA 4BMKA 3PA9A 1ARTA 1JF9A 4EB7A 2GB3A 1OATA 1VP4A 2AY7A 4F5HA 3GJUA 2CANA 2JISA 3R9AA 1MAPA 4ADEA 2OQXA 2HP2A 1ASNA 1P3WA 1TARA 2VGVA 4JEWA 3DODA 4ATQA 3FZ8A 5EAVA 2F8JA 1ECXA 2RFVA 2DGKA 3ZRQA 3EI9A 1CZCA 1B5OA 1AMAA 2Z1ZA 3EIBA 3CQ4A 1X29A 1GDEA 2DOUA 3MC6A 4ZASA 1AHXA 1QISA 2E54A 2VMRA 5M4DA 4IYOA 3BC8A 2ZY5A 3ACZA 4ADCA 2GSAA 1SFFA 3R4TA 2Z1YA 2AEVA 1BJNA 3UAKA 4AZKA 1LK9A 4JE5A 3FVSA 1WYVB 3D6KA 1E5FA 1EQBA 1I29A 4U2HA 1BJOB 2R2NA 5J8QA 2JJEA 3K40A 4E3RA 4ZDOA 3MC6C 4F5KA 2HUIA 2DGLA 5I92A 1ASGA 1MLZA 1KKJA 4LNMA 2CJDA 4KXKA 1KL1A 2HOXA 2YRRA 4UOYA 4XJOA 1J04A 4CVQA 1BW0A 1XI9A 2BI2A 1GC4A 3T32A 1YIZA 1ASBA 2W7EA 4ADDA 5BJ4A 5D95A 4AH3A 2Z9XA 3FRKA 4ZLVA 2O7CA 1QZ9A 1C7OA 3NUBA 2ZUKA 5JAYA 1YOOA 2BI1A 2VMYA 3ISLA 2WB6A 1H1CA 5DX5A 4JE5D 3E2ZB 1VJOA 2A1VA 3NU7A 4A0HA 2QLRA 2G7JA 3PDBB 2AEUA 4A00A 2OKJA 1ZC9A 2Q7WA 2Z9WA 2OGAA 2FYFA 1WYVA 1O4SA 4BQ0A 4HF8A 2W8TA 1DGEA 1BJOA 1W3UA 2JJFA 2VGZA 1CZEA 1YIYA 4WD2A 2BYLA 2ZYJA 5EUNA 5TF5A 4P7YA 4UHNA 3TFUA 1YJYA 4ATPA 2D7YA 3GZCA 1OXPA 3PD6B 1CQ8A 2X5DA 4ISYA 1MAQA 2AATA 3NRAA 4IXSA 2VI9A 4A0RA 4BHDA 4W8IA 1O61A 2VIBA 4CXRA 1ARIA 2W8JA 1ASFA 1KMJA 4AO4A 3MBBA 4BA4A 1E5EA 1FG3A 2EZ1A 3I16A 4ADBA 4AO9A 2VMTA 2Z9UA 3DRDA 2Z20A 3FQ7A 2AY2A 3JU7A 4IXZA 1IX8A 4PIWA 1B5PA 5LH9A 4Q75A 4AOAA 3KE3A 2Z67A 2FM1A 2BYJA 1M6SA 3E2ZA 2GQNA 3DR7A 2PB2A 3PDBA 4WB0B 1AKCA 2CFBA 3N4SA 1CQ7A 3AEMA 4FL0A 5FT4A 1AAMA 2W7MA 3AELA 4W1XA 3WGBA 3ZZJA 1WKHA 3QM2A 2VGUA 2ORDA 3WLXA 1I48A 3PD6A 4Y0HA 2EH6A 1MLYA 2FQ6A 3NTJA 4WLJA 2R0TA 1ASCA 2YHKA 3B46A 1Z3ZA 3BV0A 3M5UA 4I8AA 3HL2A 3E2YA 1AY5A 2W7JA 1ARGA 1AY4A 3GR9A 1RV3A 4WBTA 2W7HA 3AV7A 4P3MA 5HXXA 3AEMC 3HBXA 1X0MA 4JEVA 2PB0A 2XBNA 4RKCA 4RLGA 3LVMA 4ITXA 3W1IA 2VMPA 4CBRA 1QGNA 3E9KA 3RQ1A 3FSLA 3IF2A 2CINA 4WB0A 3DYDA 1IJIA 4OTLA 3UE8A 1AJSB 3VAXA 3TFTA 3FDBA 4MY5A 2VYCA 3CAIA 4NOGA 1BS0A 2D66A 2VI8A 4HVKA 5LHAA 3A9ZA 3RBFA 5G4JA 4Q6RA 2W7KA 3HQTA 4XJPA 4Q31A 4W91A 1M0QA 2C44A 1LW5A 3EI7A 3L44A 1QITA 4A6RA 2TPLA 3KGXA 4E1OA 5BJ3A 1YAAA 1GCKA 3WZFA 4LNLA 2X5FA 3H14A 2OKKA 5C6UA 3BCAA 2QBTA 1AHGA 3MEBA 2WK7A 3EIAA 2D63A 2YCTA 1GC2A 4MQQA 3WCOA 1KL2A 1W7NA 3RI6A 8AATA 2W8VA 2QA3A 3FQAA 1RV4A 1N2TA 2VLHA 4RITA 1CL1A 1YNUA 3GBXA 1C7NA 4KYOA 1ARSA 4K2IA 4RAEA 2JJHA 1PG8A 4MKKA 2HORA 2W7FA 2VLFA 2CY8A 2ZJGA 4RKDA 3EI6A 2CH1A 3DXVA 4OC9A 1M4NA 2VMSA 3NU8A 1BJWA 3AOWA 3E6GA 4CBSA 3NNKA 2VMUA 3PDXA 5D5SA 4Y0IA 4PFNA 2C81A 5KTBA 2VMZA 5E3KA 2X3LA 1GEXA 2QSRA 1BKGA 4E77A 4EFFA 2AY5A 3H9XA 4CXQA 2EYQA 1DJEA 2ZY4A 2VMNA 2YKUA 3JZLA 3N0LA 2OGEA 3FVXA 1AIBA 5E5IA 2KFPA 5EFSA 5EIGB 1SVVA 1J32A 1FC4A 1JG8A 3GWPA 1S07A 5EAAA 1UU0A 1AIAA 3BWNA 3W1JA 1OHWA 7AATA 4GSAA 4MQRA 1RVUA 4WXFA 3N7NA 4U1TA 3VP6A 3QHXA 1M32A 3LY1A 4OCAA 1KKPA 3A9XA 1C0NA 1C4KA 4H51A 4O6ZA 4ZM4A 1WKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8W A;  1JS6 A;  1WYT B;  1YJS A;  2VGT A;  1ZOD A;  1CL2 A;  2VMW A;  3BWN C;  3AEJ A;  3DXW A;  3ELP A;  3L8A A;  3MAF B;  3NDN A;  4EB5 A;  2HOY A;  1WST A;  1M0O A;  3I5T A;  3P6K A;  4IX8 A;  3LV2 A;  1IVR A;  2Z9V A;  3VK3 A;  9AAT A;  1ELU A;  2D65 A;  3JWA A;  4W5K A;  1MDX A;  3AEP A;  2YRI A;  4JEX A;  5DJ9 A;  5K8B A;  1AHE A;  2BI9 A;  2GMS A;  3B8X A;  1IUG A;  3FFH A;  5EIG A;  3WKS A;  1VEF A;  3HVY A;  4RJY A;  4A0G A;  5M46 A;  2D7Z A;  1LC5 A;  2JGT A;  3PAA A;  4J5U A;  1W7L A;  4A0F A;  5M49 A;  3AEJ C;  3II0 A;  3GET A;  1DTY A;  1MDZ A;  1TAS A;  3A8U X;  1DJ9 A;  3Q8N A;  1S06 A;  3RBL A;  2EGY A;  1SZS A;  4EU1 A;  3AEN B;  2BHX A;  5FT8 A;  3QBO A;  4LW4 A;  5HHY A;  4F5I A;  3A2B A;  2R5C B;  3FZ7 A;  4R2N A;  4WYD A;  3ELE A;  4IW7 A;  1V72 A;  1WYT A;  3CQ5 A;  3MAF A;  3WKR A;  5M4B A;  3K28 A;  1FG7 A;  4OBV A;  1M0N A;  2YOB A;  1GBN A;  1Z7D A;  3A9Y A;  1C7G A;  1ORD A;  2JJG A;  3EI8 A;  3ZRP A;  1IX6 A;  5G4I A;  3FDD A;  1MDO A;  3DR4 A;  3DU4 A;  4F5M A;  2HOZ A;  4WYF A;  3FQ8 A;  4J8L A;  3USF A;  1TAT A;  1WYU B;  1GC3 A;  2G6W A;  4MKJ A;  5FT6 A;  2ZC0 A;  2QMA A;  1CQ6 A;  1ASD A;  2GMU A;  2W8U A;  3LVJ A;  3LVL B;  3MAD A;  4AZJ A;  4M2M A;  3HLM A;  4UHO A;  2NMP A;  3UWC A;  4B98 A;  4WP0 A;  1GC0 A;  1M7Y A;  3AOV A;  1U08 A;  4QGR A;  3AEN A;  2BIE A;  3ASB A;  4LC3 A;  1EJI A;  2R5C A;  1UU1 A;  2VMX A;  3ECD A;  4TMR A;  3G7Q A;  1I43 A;  3G8M A;  3EZ1 A;  4L0O A;  4ZSY A;  2EZ2 A;  1AHF A;  1SF2 A;  4ZDL A;  3FFR A;  3ZRR A;  4K2M A;  1AHY A;  1PFF A;  4WXG A;  4W1V A;  1C9C A;  2O1B A;  3G0T A;  2ZSL A;  3GZD A;  2AY3 A;  1JS3 A;  2V0Y A;  4OT8 A;  1TPL A;  2BKW A;  4JF0 A;  4E3Q A;  1S08 A;  4Y0D A;  4GE7 A;  1X2A A;  1SZK A;  1WYU A;  5G0A A;  4N0W A;  1Y4I A;  1QIR A;  2QB2 A;  3KKI A;  1CS1 A;  1SPA A;  3OKS A;  3F6T A;  4XQ2 A;  4DQ6 A;  2ZY3 A;  1AJS A;  3GZD C;  1D7S A;  1TOK A;  1O62 A;  2DR1 A;  3VK2 A;  4GE4 A;  4PVF A;  3EZS A;  2D61 A;  1DFO A;  4UHM A;  4B9B A;  4F5J A;  1S0A A;  3DC1 A;  1TOI A;  2W7I A;  1V2F A;  2E7U A;  4IY7 A;  2W7L A;  4W1W A;  1X28 A;  4WYG A;  1IX7 A;  1B4X A;  3FD0 A;  5AX8 A;  3ZZK A;  3NYT A;  3NYS A;  1TOJ A;  5IWQ A;  4LNJ A;  3IHJ A;  2AY1 A;  3QN6 A;  4ZDP A;  1N31 A;  1I41 A;  4IXO A;  4XK1 A;  4WYA A;  4XJM A;  3OP7 A;  2BI3 A;  1IAX A;  4F4E A;  1GEW A;  4ZWV A;  3TCM A;  3ATH A;  3JWB A;  1ASE A;  1OHY A;  3JW9 A;  1AKA A;  5EUE A;  3EUC A;  5F9S A;  3LVK A;  1ASM A;  2HUF A;  4M2J A;  5G2Q A;  2PO3 A;  4XJL A;  1O69 A;  4RIZ A;  1G4X A;  3CBF A;  1B9H A;  2C0R A;  1D7U A;  2EO5 A;  3AAT A;  4LW2 A;  3BWO A;  2CB1 A;  2VMV A;  4GRX A;  4A6T A;  4F5G A;  3RUY A;  1OXO A;  2BIG A;  4R5F A;  2QB3 A;  1XEY A;  3LG0 A;  1G7W A;  3E77 A;  3QGU A;  5FT5 A;  2W7G A;  4FFC A;  2VGS A;  4JF1 A;  4OYT A;  2FNU A;  1AJR A;  3EI5 A;  3MKJ A;  2CST A;  5G2P A;  3COG A;  2CH2 A;  1TOE A;  2AY8 A;  2X8U A;  3E2F A;  3HT4 A;  4R5Z A;  3H7F A;  1DGD A;  1DJU A;  3P1T A;  1BQA A;  2AY4 A;  1BT4 A;  2BIA A;  3CQ6 A;  1ZOB A;  4ZSW A;  4WLH A;  1ASA A;  2HP1 A;  4XEW A;  2FNI A;  4TN4 A;  5DJ1 A;  2YCN A;  1H0C A;  1LW4 A;  2WK9 A;  2FN6 A;  4RM1 A;  1RVY A;  2CJG A;  5DB5 A;  4A72 A;  4DGT A;  1V2E A;  3WX9 A;  2BWN A;  1UKJ A;  4ZM3 A;  2HUU A;  3VOM A;  5F8V A;  3HMU A;  3W1H A;  1B8G A;  2DGM A;  2EPJ A;  2HZP A;  2VIA A;  1EG5 A;  2D5Y A;  2YKX A;  3GSB A;  3PJ0 A;  3WCN A;  1BQD A;  1AIC A;  1OHV A;  3HDO A;  4F5L A;  1N8P A;  2O0R A;  3DZZ A;  3B1D A;  5EQC A;  4Q76 A;  1AMQ A;  1KMK A;  2VMO A;  2BI5 A;  4DBC A;  2Z61 A;  4TV7 A;  4BA5 A;  3ASA A;  2E7J A;  3RCH B;  3BS8 A;  1G4V A;  4RJ0 A;  4XAU A;  2CJH A;  2OAT A;  2VMQ A;  2WKA A;  3QI6 A;  5E4Z A;  1G7X A;  2AY6 A;  4WYC A;  1AMR A;  4M2K A;  3TAT A;  2ZP7 A;  4GEB A;  1GEY A;  1GD9 A;  3BCX A;  4ITG A;  2DKJ A;  3PPL A;  1T3I A;  1CJ0 A;  1AX4 A;  1SZU A;  4UQV A;  4R8D A;  4OBU A;  1ARH A;  1B9I A;  1LC7 A;  3N5M A;  1D2F A;  4OMA A;  4EMY A;  3FVU A;  2WK8 A;  3FZ6 A;  3KGW A;  4ZWM A;  2XH1 A;  3AEO A;  3FKD A;  1AAW A;  4MQP A;  1BJ4 A;  1ELQ A;  1UU2 A;  3BCB A;  1LS3 A;  3PIU A;  2DKB A;  3NYU A;  1AKB A;  5G09 A;  3N75 A;  1QJ3 A;  3FCR A;  4K2B A;  3K7Y A;  3NUI A;  4PFF A;  4ZAH A;  1YJZ A;  2CTZ A;  2R5E A;  1QJ5 A;  3TQX A;  3VK4 A;  1AY8 A;  2D64 A;  4KAM A;  3RCH A;  1PMM A;  1LKC A;  1PMO A;  3MAU A;  2ZSM A;  3BB8 A;  1MGV A;  2YKV A;  3B1E A;  3PGY A;  1D7V A;  1W23 A;  2BWO A;  1IAY A;  3WGC A;  1S09 A;  4GDY A;  1D7R A;  3JTX A;  2ZY2 A;  1LC8 A;  4WXB A;  4WYE A;  1W7M A;  2YCP A;  1DKA A;  3LWS A;  2YKY A;  4MSO A;  2VGW A;  4N0B A;  2C7T A;  2E7I A;  3QPG A;  2W7D A;  4IYO B;  4MGR A;  3F9T A;  1V2D A;  4A6U A;  1TOG A;  3FTB A;  4GE9 A;  4JEY A;  3B1C A;  2JG2 A;  2BWP A;  1M0P A;  3NX3 A;  4JEZ A;  1ASL A;  5EUD A;  3I4J A;  5HDM A;  2AY9 A;  3BN1 A;  3WY7 A;  2V1P A;  1IBJ A;  4F5F A;  3F0H A;  1AMS A;  4BMK A;  3PA9 A;  1ART A;  1JF9 A;  4EB7 A;  2GB3 A;  1OAT A;  1VP4 A;  2AY7 A;  4F5H A;  3GJU A;  2CAN A;  2JIS A;  3R9A A;  1MAP A;  4ADE A;  2OQX A;  2HP2 A;  1ASN A;  1P3W A;  1TAR A;  2VGV A;  4JEW A;  3DOD A;  4ATQ A;  3FZ8 A;  5EAV A;  2F8J A;  1ECX A;  2RFV A;  2DGK A;  3ZRQ A;  3EI9 A;  1CZC A;  1B5O A;  1AMA A;  2Z1Z A;  3EIB A;  3CQ4 A;  1X29 A;  1GDE A;  2DOU A;  3MC6 A;  4ZAS A;  1AHX A;  1QIS A;  2E54 A;  2VMR A;  5M4D A;  4IYO A;  3BC8 A;  2ZY5 A;  3ACZ A;  4ADC A;  2GSA A;  1SFF A;  3R4T A;  2Z1Y A;  2AEV A;  1BJN A;  3UAK A;  4AZK A;  1LK9 A;  4JE5 A;  3FVS A;  1WYV B;  3D6K A;  1E5F A;  1EQB A;  1I29 A;  4U2H A;  1BJO B;  2R2N A;  5J8Q A;  2JJE A;  3K40 A;  4E3R A;  4ZDO A;  3MC6 C;  4F5K A;  2HUI A;  2DGL A;  5I92 A;  1ASG A;  1MLZ A;  1KKJ A;  4LNM A;  2CJD A;  4KXK A;  1KL1 A;  2HOX A;  2YRR A;  4UOY A;  4XJO A;  1J04 A;  4CVQ A;  1BW0 A;  1XI9 A;  2BI2 A;  1GC4 A;  3T32 A;  1YIZ A;  1ASB A;  2W7E A;  4ADD A;  5BJ4 A;  5D95 A;  4AH3 A;  2Z9X A;  3FRK A;  4ZLV A;  2O7C A;  1QZ9 A;  1C7O A;  3NUB A;  2ZUK A;  5JAY A;  1YOO A;  2BI1 A;  2VMY A;  3ISL A;  1H1C A;  5DX5 A;  4JE5 D;  3E2Z B;  1VJO A;  3NU7 A;  4A0H A;  2QLR A;  3PDB B;  2AEU A;  4A00 A;  2OKJ A;  1ZC9 A;  2Q7W A;  2Z9W A;  2OGA A;  2FYF A;  1WYV A;  1O4S A;  4BQ0 A;  4HF8 A;  2W8T A;  1DGE A;  1BJO A;  1W3U A;  2JJF A;  2VGZ A;  1CZE A;  1YIY A;  4WD2 A;  2BYL A;  2ZYJ A;  5EUN A;  5TF5 A;  4P7Y A;  4UHN A;  3TFU A;  1YJY A;  4ATP A;  2D7Y A;  3GZC A;  1OXP A;  3PD6 B;  1CQ8 A;  2X5D A;  4ISY A;  1MAQ A;  2AAT A;  3NRA A;  4IXS A;  2VI9 A;  4A0R A;  4BHD A;  4W8I A;  1O61 A;  2VIB A;  4CXR A;  1ARI A;  2W8J A;  1ASF A;  1KMJ A;  4AO4 A;  3MBB A;  4BA4 A;  1E5E A;  1FG3 A;  2EZ1 A;  3I16 A;  4ADB A;  4AO9 A;  2VMT A;  2Z9U A;  3DRD A;  2Z20 A;  3FQ7 A;  2AY2 A;  3JU7 A;  4IXZ A;  1IX8 A;  4PIW A;  1B5P A;  5LH9 A;  4Q75 A;  4AOA A;  3KE3 A;  2Z67 A;  2FM1 A;  2BYJ A;  1M6S A;  3E2Z A;  2GQN A;  3DR7 A;  2PB2 A;  3PDB A;  4WB0 B;  1AKC A;  2CFB A;  1CQ7 A;  3AEM A;  4FL0 A;  5FT4 A;  1AAM A;  2W7M A;  3AEL A;  4W1X A;  3WGB A;  3ZZJ A;  1WKH A;  3QM2 A;  2VGU A;  2ORD A;  3WLX A;  1I48 A;  3PD6 A;  4Y0H A;  2EH6 A;  1MLY A;  2FQ6 A;  3NTJ A;  4WLJ A;  2R0T A;  1ASC A;  2YHK A;  3B46 A;  1Z3Z A;  3BV0 A;  3M5U A;  4I8A A;  3HL2 A;  3E2Y A;  1AY5 A;  2W7J A;  1ARG A;  1AY4 A;  3GR9 A;  1RV3 A;  4WBT A;  2W7H A;  3AV7 A;  4P3M A;  5HXX A;  3AEM C;  3HBX A;  1X0M A;  4JEV A;  2PB0 A;  2XBN A;  4RKC A;  4RLG A;  3LVM A;  4ITX A;  3W1I A;  2VMP A;  4CBR A;  1QGN A;  3E9K A;  3RQ1 A;  3FSL A;  3IF2 A;  2CIN A;  4WB0 A;  3DYD A;  1IJI A;  4OTL A;  3UE8 A;  1AJS B;  3VAX A;  3TFT A;  3FDB A;  4MY5 A;  2VYC A;  3CAI A;  4NOG A;  1BS0 A;  2D66 A;  2VI8 A;  4HVK A;  5LHA A;  3A9Z A;  3RBF A;  5G4J A;  4Q6R A;  2W7K A;  3HQT A;  4XJP A;  4Q31 A;  4W91 A;  1M0Q A;  2C44 A;  1LW5 A;  3EI7 A;  3L44 A;  1QIT A;  4A6R A;  2TPL A;  3KGX A;  4E1O A;  5BJ3 A;  1YAA A;  1GCK A;  3WZF A;  4LNL A;  2X5F A;  3H14 A;  2OKK A;  5C6U A;  3BCA A;  2QBT A;  1AHG A;  3MEB A;  2WK7 A;  3EIA A;  2D63 A;  2YCT A;  1GC2 A;  4MQQ A;  3WCO A;  1KL2 A;  1W7N A;  3RI6 A;  8AAT A;  2W8V A;  2QA3 A;  3FQA A;  1RV4 A;  1N2T A;  2VLH A;  4RIT A;  1CL1 A;  1YNU A;  3GBX A;  1C7N A;  4KYO A;  1ARS A;  4K2I A;  4RAE A;  2JJH A;  1PG8 A;  4MKK A;  2HOR A;  2W7F A;  2VLF A;  2CY8 A;  2ZJG A;  4RKD A;  3EI6 A;  2CH1 A;  3DXV A;  4OC9 A;  1M4N A;  2VMS A;  3NU8 A;  1BJW A;  3AOW A;  3E6G A;  4CBS A;  3NNK A;  2VMU A;  3PDX A;  5D5S A;  4Y0I A;  4PFN A;  2C81 A;  2VMZ A;  5E3K A;  2X3L A;  1GEX A;  1BKG A;  4E77 A;  4EFF A;  2AY5 A;  4CXQ A;  1DJE A;  2ZY4 A;  2VMN A;  2YKU A;  3JZL A;  3N0L A;  2OGE A;  3FVX A;  1AIB A;  5E5I A;  5EFS A;  5EIG B;  1SVV A;  1J32 A;  1FC4 A;  1JG8 A;  3GWP A;  1S07 A;  5EAA A;  1UU0 A;  1AIA A;  3BWN A;  3W1J A;  1OHW A;  7AAT A;  4GSA A;  4MQR A;  1RVU A;  4WXF A;  4U1T A;  3VP6 A;  3QHX A;  1M32 A;  3LY1 A;  4OCA A;  1KKP A;  3A9X A;  1C0N A;  1C4K A;  4H51 A;  4O6Z A;  4ZM4 A;  1WKG A; 
#chains in the Genus database with same CATH topology
 2W8W A;  1JS6 A;  1WYT B;  1YJS A;  2VGT A;  1ZOD A;  1CL2 A;  2VMW A;  3BWN C;  3AEJ A;  3DXW A;  3ELP A;  3L8A A;  3MAF B;  3NDN A;  4EB5 A;  2HOY A;  1WST A;  1M0O A;  3I5T A;  3P6K A;  4IX8 A;  3LV2 A;  1IVR A;  2Z9V A;  3VK3 A;  9AAT A;  1ELU A;  2D65 A;  3JWA A;  4W5K A;  1MDX A;  3AEP A;  2YRI A;  4JEX A;  5DJ9 A;  5K8B A;  1AHE A;  2BI9 A;  2GMS A;  3B8X A;  1IUG A;  3FFH A;  5EIG A;  3WKS A;  3N4X A;  1VEF A;  3HVY A;  4RJY A;  4A0G A;  5M46 A;  2D7Z A;  1LC5 A;  2JGT A;  3PAA A;  4J5U A;  1W7L A;  4A0F A;  4K05 A;  5M49 A;  3AEJ C;  3II0 A;  3GET A;  1DTY A;  1MDZ A;  1TAS A;  3A8U X;  1DJ9 A;  3Q8N A;  1S06 A;  3RBL A;  2EGY A;  1SZS A;  4EU1 A;  3AEN B;  2BHX A;  5FT8 A;  3QBO A;  4LW4 A;  5HHY A;  4F5I A;  3A2B A;  2R5C B;  3FZ7 A;  4R2N A;  4WYD A;  3ELE A;  4IW7 A;  1V72 A;  1WYT A;  3CQ5 A;  3MAF A;  3WKR A;  5M4B A;  3K28 A;  1FG7 A;  4OBV A;  1M0N A;  2YOB A;  1GBN A;  1Z7D A;  3A9Y A;  1C7G A;  1ORD A;  2JJG A;  3EI8 A;  3ZRP A;  1IX6 A;  5G4I A;  3FDD A;  1MDO A;  3DR4 A;  3DU4 A;  4F5M A;  2HOZ A;  4WYF A;  3FQ8 A;  4J8L A;  3USF A;  1TAT A;  1WYU B;  1GC3 A;  2G6W A;  4MKJ A;  5FT6 A;  2ZC0 A;  2QMA A;  1CQ6 A;  1ASD A;  2GMU A;  2W8U A;  3LVJ A;  3LVL B;  3MAD A;  4AZJ A;  4M2M A;  3HLM A;  4UHO A;  2NMP A;  3UWC A;  4B98 A;  4WP0 A;  1GC0 A;  1M7Y A;  3AOV A;  1U08 A;  4QGR A;  3AEN A;  2BIE A;  3ASB A;  4LC3 A;  1EJI A;  2R5C A;  1UU1 A;  2VMX A;  3ECD A;  4TMR A;  3G7Q A;  1I43 A;  3G8M A;  3EZ1 A;  4L0O A;  4ZSY A;  2EZ2 A;  1AHF A;  1SF2 A;  4ZDL A;  3FFR A;  3ZRR A;  4K2M A;  1AHY A;  1PFF A;  4WXG A;  4W1V A;  1C9C A;  2O1B A;  3G0T A;  2ZSL A;  3GZD A;  2AY3 A;  1JS3 A;  2V0Y A;  2FKI A;  4OT8 A;  1TPL A;  2BKW A;  4JF0 A;  4E3Q A;  1S08 A;  4Y0D A;  4GE7 A;  1X2A A;  1SZK A;  1WYU A;  5G0A A;  4N0W A;  1Y4I A;  1QIR A;  2QB2 A;  3KKI A;  1CS1 A;  1SPA A;  3OKS A;  3F6T A;  4XQ2 A;  4DQ6 A;  2ZY3 A;  1AJS A;  3GZD C;  1D7S A;  1TOK A;  1O62 A;  2DR1 A;  3VK2 A;  4GE4 A;  4PVF A;  3EZS A;  2D61 A;  1DFO A;  4UHM A;  4B9B A;  4F5J A;  1S0A A;  3DC1 A;  1TOI A;  2W7I A;  1V2F A;  2E7U A;  4IY7 A;  2W7L A;  4W1W A;  1X28 A;  4WYG A;  1IX7 A;  1B4X A;  3FD0 A;  5AX8 A;  3ZZK A;  3NYT A;  3NYS A;  1TOJ A;  5IWQ A;  4LNJ A;  3IHJ A;  2AY1 A;  3QN6 A;  4ZDP A;  1N31 A;  1I41 A;  4IXO A;  4XK1 A;  4WYA A;  4XJM A;  3OP7 A;  2BI3 A;  1IAX A;  4F4E A;  1GEW A;  4ZWV A;  3TCM A;  3ATH A;  3JWB A;  1ASE A;  1OHY A;  3JW9 A;  1AKA A;  5EUE A;  3EUC A;  5F9S A;  3LVK A;  1ASM A;  2HUF A;  4M2J A;  5G2Q A;  2PO3 A;  4XJL A;  1O69 A;  4RIZ A;  1G4X A;  3CBF A;  1B9H A;  2C0R A;  1D7U A;  2EO5 A;  3AAT A;  4LW2 A;  3BWO A;  2CB1 A;  2VMV A;  4GRX A;  4A6T A;  4F5G A;  3RUY A;  1OXO A;  2BIG A;  4R5F A;  2QB3 A;  1XEY A;  3LG0 A;  1G7W A;  3E77 A;  3QGU A;  5FT5 A;  2W7G A;  4FFC A;  2VGS A;  4JF1 A;  4OYT A;  2FNU A;  1AJR A;  3EI5 A;  3MKJ A;  2CST A;  5G2P A;  3COG A;  2CH2 A;  1TOE A;  2AY8 A;  2X8U A;  3E2F A;  3HT4 A;  4R5Z A;  4H63 Q;  3H7F A;  1DGD A;  1DJU A;  3P1T A;  1BQA A;  2AY4 A;  1BT4 A;  2BIA A;  3CQ6 A;  1ZOB A;  4ZSW A;  4WLH A;  1ASA A;  2HP1 A;  1KAF A;  4XEW A;  2FNI A;  4TN4 A;  5DJ1 A;  2YCN A;  1H0C A;  1LW4 A;  2WK9 A;  2FN6 A;  4RM1 A;  1RVY A;  2CJG A;  5DB5 A;  4A72 A;  4DGT A;  1V2E A;  3WX9 A;  2BWN A;  1UKJ A;  4ZM3 A;  2HUU A;  3VOM A;  5F8V A;  3HMU A;  3W1H A;  1B8G A;  2DGM A;  2EPJ A;  2HZP A;  2VIA A;  1EG5 A;  2D5Y A;  2YKX A;  3GSB A;  3PJ0 A;  3WCN A;  1BQD A;  1AIC A;  1OHV A;  3HDO A;  4F5L A;  1N8P A;  2O0R A;  3DZZ A;  3B1D A;  5EQC A;  4Q76 A;  1AMQ A;  1KMK A;  2VMO A;  2BI5 A;  4DBC A;  2Z61 A;  4TV7 A;  4BA5 A;  3ASA A;  3N4R A;  2E7J A;  3RCH B;  3BS8 A;  1G4V A;  4RJ0 A;  4XAU A;  2CJH A;  2OAT A;  2VMQ A;  2WKA A;  3QI6 A;  5E4Z A;  1G7X A;  2AY6 A;  4WYC A;  1AMR A;  4M2K A;  3TAT A;  2ZP7 A;  4GEB A;  1GEY A;  1GD9 A;  3BCX A;  4ITG A;  2DKJ A;  3PPL A;  1T3I A;  1CJ0 A;  1AX4 A;  1SZU A;  4UQV A;  4R8D A;  4OBU A;  1ARH A;  1B9I A;  1LC7 A;  3N5M A;  1D2F A;  4OMA A;  4EMY A;  3FVU A;  2WK8 A;  3FZ6 A;  3KGW A;  4ZWM A;  2XH1 A;  3AEO A;  3FKD A;  1AAW A;  4MQP A;  1BJ4 A;  1ELQ A;  1UU2 A;  3BCB A;  1LS3 A;  3PIU A;  2DKB A;  3NYU A;  1AKB A;  5G09 A;  3N75 A;  1QJ3 A;  3FCR A;  4K2B A;  3K7Y A;  3NUI A;  4PFF A;  4ZAH A;  1YJZ A;  2CTZ A;  2R5E A;  1QJ5 A;  3TQX A;  3VK4 A;  1AY8 A;  2D64 A;  4KAM A;  3RCH A;  1PMM A;  1LKC A;  1PMO A;  3MAU A;  2ZSM A;  3BB8 A;  1MGV A;  2YKV A;  3B1E A;  3PGY A;  1D7V A;  1W23 A;  2BWO A;  1IAY A;  3WGC A;  1S09 A;  4GDY A;  1D7R A;  3JTX A;  2ZY2 A;  1LC8 A;  4WXB A;  4WYE A;  1W7M A;  2YCP A;  1DKA A;  3LWS A;  2YKY A;  4MSO A;  2VGW A;  4N0B A;  2C7T A;  2E7I A;  3QPG A;  2W7D A;  4IYO B;  4MGR A;  3F9T A;  1V2D A;  4A6U A;  1TOG A;  3FTB A;  4GE9 A;  4JEY A;  3B1C A;  2JG2 A;  2BWP A;  1M0P A;  3NX3 A;  4JEZ A;  1ASL A;  5EUD A;  3I4J A;  5HDM A;  2AY9 A;  3BN1 A;  3WY7 A;  2V1P A;  1IBJ A;  4F5F A;  3F0H A;  1AMS A;  4BMK A;  3PA9 A;  1ART A;  1JF9 A;  4EB7 A;  2GB3 A;  1OAT A;  1VP4 A;  2AY7 A;  4F5H A;  3GJU A;  2CAN A;  2JIS A;  3R9A A;  1MAP A;  4ADE A;  2OQX A;  2HP2 A;  1ASN A;  1P3W A;  1TAR A;  2VGV A;  4JEW A;  3DOD A;  4ATQ A;  3FZ8 A;  5EAV A;  2F8J A;  1ECX A;  2RFV A;  2DGK A;  3ZRQ A;  3EI9 A;  1CZC A;  1B5O A;  1AMA A;  2Z1Z A;  3EIB A;  3CQ4 A;  1X29 A;  1GDE A;  2DOU A;  3MC6 A;  4ZAS A;  1AHX A;  1QIS A;  2E54 A;  2VMR A;  5M4D A;  4IYO A;  3BC8 A;  2ZY5 A;  3ACZ A;  4ADC A;  2GSA A;  1SFF A;  3R4T A;  2Z1Y A;  2AEV A;  1BJN A;  3UAK A;  4AZK A;  1LK9 A;  4JE5 A;  3FVS A;  1WYV B;  3D6K A;  1E5F A;  1EQB A;  1I29 A;  4U2H A;  1BJO B;  2R2N A;  5J8Q A;  2JJE A;  3K40 A;  4E3R A;  4ZDO A;  3MC6 C;  4F5K A;  2HUI A;  2DGL A;  5I92 A;  1ASG A;  1MLZ A;  1KKJ A;  4LNM A;  2CJD A;  4KXK A;  1KL1 A;  2HOX A;  2YRR A;  4UOY A;  4XJO A;  1J04 A;  4CVQ A;  1BW0 A;  1XI9 A;  2BI2 A;  1GC4 A;  3T32 A;  1YIZ A;  1ASB A;  2W7E A;  4ADD A;  5BJ4 A;  5D95 A;  4AH3 A;  2Z9X A;  3FRK A;  4ZLV A;  2O7C A;  1QZ9 A;  1C7O A;  3NUB A;  2ZUK A;  5JAY A;  1YOO A;  2BI1 A;  2VMY A;  3ISL A;  2WB6 A;  1H1C A;  5DX5 A;  4JE5 D;  3E2Z B;  1VJO A;  2A1V A;  3NU7 A;  4A0H A;  2QLR A;  2G7J A;  3PDB B;  2AEU A;  4A00 A;  2OKJ A;  1ZC9 A;  2Q7W A;  2Z9W A;  2OGA A;  2FYF A;  1WYV A;  1O4S A;  4BQ0 A;  4HF8 A;  2W8T A;  1DGE A;  1BJO A;  1W3U A;  2JJF A;  2VGZ A;  1CZE A;  1YIY A;  4WD2 A;  2BYL A;  2ZYJ A;  5EUN A;  5TF5 A;  4P7Y A;  4UHN A;  3TFU A;  1YJY A;  4ATP A;  2D7Y A;  3GZC A;  1OXP A;  3PD6 B;  1CQ8 A;  2X5D A;  4ISY A;  1MAQ A;  2AAT A;  3NRA A;  4IXS A;  2VI9 A;  4A0R A;  4BHD A;  4W8I A;  1O61 A;  2VIB A;  4CXR A;  1ARI A;  2W8J A;  1ASF A;  1KMJ A;  4AO4 A;  3MBB A;  4BA4 A;  1E5E A;  1FG3 A;  2EZ1 A;  3I16 A;  4ADB A;  4AO9 A;  2VMT A;  2Z9U A;  3DRD A;  2Z20 A;  3FQ7 A;  2AY2 A;  3JU7 A;  4IXZ A;  1IX8 A;  4PIW A;  1B5P A;  5LH9 A;  4Q75 A;  4AOA A;  3KE3 A;  2Z67 A;  2FM1 A;  2BYJ A;  1M6S A;  3E2Z A;  2GQN A;  3DR7 A;  2PB2 A;  3PDB A;  4WB0 B;  1AKC A;  2CFB A;  3N4S A;  1CQ7 A;  3AEM A;  4FL0 A;  5FT4 A;  1AAM A;  2W7M A;  3AEL A;  4W1X A;  3WGB A;  3ZZJ A;  1WKH A;  3QM2 A;  2VGU A;  2ORD A;  3WLX A;  1I48 A;  3PD6 A;  4Y0H A;  2EH6 A;  1MLY A;  2FQ6 A;  3NTJ A;  4WLJ A;  2R0T A;  1ASC A;  2YHK A;  3B46 A;  1Z3Z A;  3BV0 A;  3M5U A;  4I8A A;  3HL2 A;  3E2Y A;  1AY5 A;  2W7J A;  1ARG A;  1AY4 A;  3GR9 A;  1RV3 A;  4WBT A;  2W7H A;  3AV7 A;  4P3M A;  5HXX A;  3AEM C;  3HBX A;  1X0M A;  4JEV A;  2PB0 A;  2XBN A;  4RKC A;  4RLG A;  3LVM A;  4ITX A;  3W1I A;  2VMP A;  4CBR A;  1QGN A;  3E9K A;  3RQ1 A;  3FSL A;  3IF2 A;  2CIN A;  4WB0 A;  3DYD A;  1IJI A;  4OTL A;  3UE8 A;  1AJS B;  3VAX A;  3TFT A;  3FDB A;  4MY5 A;  2VYC A;  3CAI A;  4NOG A;  1BS0 A;  2D66 A;  2VI8 A;  4HVK A;  5LHA A;  3A9Z A;  3RBF A;  5G4J A;  4Q6R A;  2W7K A;  3HQT A;  4XJP A;  4Q31 A;  4W91 A;  1M0Q A;  2C44 A;  1LW5 A;  3EI7 A;  3L44 A;  1QIT A;  4A6R A;  2TPL A;  3KGX A;  4E1O A;  5BJ3 A;  1YAA A;  1GCK A;  3WZF A;  4LNL A;  2X5F A;  3H14 A;  2OKK A;  5C6U A;  3BCA A;  2QBT A;  1AHG A;  3MEB A;  2WK7 A;  3EIA A;  2D63 A;  2YCT A;  1GC2 A;  4MQQ A;  3WCO A;  1KL2 A;  1W7N A;  3RI6 A;  8AAT A;  2W8V A;  2QA3 A;  3FQA A;  1RV4 A;  1N2T A;  2VLH A;  4RIT A;  1CL1 A;  1YNU A;  3GBX A;  1C7N A;  4KYO A;  1ARS A;  4K2I A;  4RAE A;  2JJH A;  1PG8 A;  4MKK A;  2HOR A;  2W7F A;  2VLF A;  2CY8 A;  2ZJG A;  4RKD A;  3EI6 A;  2CH1 A;  3DXV A;  4OC9 A;  1M4N A;  2VMS A;  3NU8 A;  1BJW A;  3AOW A;  3E6G A;  4CBS A;  3NNK A;  2VMU A;  3PDX A;  5D5S A;  4Y0I A;  4PFN A;  2C81 A;  5KTB A;  2VMZ A;  5E3K A;  2X3L A;  1GEX A;  2QSR A;  1BKG A;  4E77 A;  4EFF A;  2AY5 A;  3H9X A;  4CXQ A;  2EYQ A;  1DJE A;  2ZY4 A;  2VMN A;  2YKU A;  3JZL A;  3N0L A;  2OGE A;  3FVX A;  1AIB A;  5E5I A;  2KFP A;  5EFS A;  5EIG B;  1SVV A;  1J32 A;  1FC4 A;  1JG8 A;  3GWP A;  1S07 A;  5EAA A;  1UU0 A;  1AIA A;  3BWN A;  3W1J A;  1OHW A;  7AAT A;  4GSA A;  4MQR A;  1RVU A;  4WXF A;  3N7N A;  4U1T A;  3VP6 A;  3QHX A;  1M32 A;  3LY1 A;  4OCA A;  1KKP A;  3A9X A;  1C0N A;  1C4K A;  4H51 A;  4O6Z A;  4ZM4 A;  1WKG A; 
#chains in the Genus database with same CATH homology
 2W8W A;  1JS6 A;  1WYT B;  1YJS A;  2VGT A;  1ZOD A;  1CL2 A;  2VMW A;  3BWN C;  3AEJ A;  3DXW A;  3ELP A;  3L8A A;  3MAF B;  3NDN A;  4EB5 A;  2HOY A;  1WST A;  1M0O A;  3I5T A;  3P6K A;  4IX8 A;  3LV2 A;  1IVR A;  2Z9V A;  3VK3 A;  9AAT A;  1ELU A;  2D65 A;  3JWA A;  4W5K A;  1MDX A;  3AEP A;  2YRI A;  4JEX A;  5DJ9 A;  5K8B A;  1AHE A;  2BI9 A;  2GMS A;  3B8X A;  1IUG A;  3FFH A;  5EIG A;  3WKS A;  3N4X A;  1VEF A;  3HVY A;  4RJY A;  4A0G A;  5M46 A;  2D7Z A;  1LC5 A;  2JGT A;  3PAA A;  4J5U A;  1W7L A;  4A0F A;  4K05 A;  5M49 A;  3AEJ C;  3II0 A;  3GET A;  1DTY A;  1MDZ A;  1TAS A;  3A8U X;  1DJ9 A;  3Q8N A;  1S06 A;  3RBL A;  2EGY A;  1SZS A;  4EU1 A;  3AEN B;  2BHX A;  5FT8 A;  3QBO A;  4LW4 A;  5HHY A;  4F5I A;  3A2B A;  2R5C B;  3FZ7 A;  4R2N A;  4WYD A;  3ELE A;  4IW7 A;  1V72 A;  1WYT A;  3CQ5 A;  3MAF A;  3WKR A;  5M4B A;  3K28 A;  1FG7 A;  4OBV A;  1M0N A;  2YOB A;  1GBN A;  1Z7D A;  3A9Y A;  1C7G A;  1ORD A;  2JJG A;  3EI8 A;  3ZRP A;  1IX6 A;  5G4I A;  3FDD A;  1MDO A;  3DR4 A;  3DU4 A;  4F5M A;  2HOZ A;  4WYF A;  3FQ8 A;  4J8L A;  3USF A;  1TAT A;  1WYU B;  1GC3 A;  2G6W A;  4MKJ A;  5FT6 A;  2ZC0 A;  2QMA A;  1CQ6 A;  1ASD A;  2GMU A;  2W8U A;  3LVJ A;  3LVL B;  3MAD A;  4AZJ A;  4M2M A;  3HLM A;  4UHO A;  2NMP A;  3UWC A;  4B98 A;  4WP0 A;  1GC0 A;  1M7Y A;  3AOV A;  1U08 A;  4QGR A;  3AEN A;  2BIE A;  3ASB A;  4LC3 A;  1EJI A;  2R5C A;  1UU1 A;  2VMX A;  3ECD A;  4TMR A;  3G7Q A;  1I43 A;  3G8M A;  3EZ1 A;  4L0O A;  4ZSY A;  2EZ2 A;  1AHF A;  1SF2 A;  4ZDL A;  3FFR A;  3ZRR A;  4K2M A;  1AHY A;  1PFF A;  4WXG A;  4W1V A;  1C9C A;  2O1B A;  3G0T A;  2ZSL A;  3GZD A;  2AY3 A;  1JS3 A;  2V0Y A;  2FKI A;  4OT8 A;  1TPL A;  2BKW A;  4JF0 A;  4E3Q A;  1S08 A;  4Y0D A;  4GE7 A;  1X2A A;  1SZK A;  1WYU A;  5G0A A;  4N0W A;  1Y4I A;  1QIR A;  2QB2 A;  3KKI A;  1CS1 A;  1SPA A;  3OKS A;  3F6T A;  4XQ2 A;  4DQ6 A;  2ZY3 A;  1AJS A;  3GZD C;  1D7S A;  1TOK A;  1O62 A;  2DR1 A;  3VK2 A;  4GE4 A;  4PVF A;  3EZS A;  2D61 A;  1DFO A;  4UHM A;  4B9B A;  4F5J A;  1S0A A;  3DC1 A;  1TOI A;  2W7I A;  1V2F A;  2E7U A;  4IY7 A;  2W7L A;  4W1W A;  1X28 A;  4WYG A;  1IX7 A;  1B4X A;  3FD0 A;  5AX8 A;  3ZZK A;  3NYT A;  3NYS A;  1TOJ A;  5IWQ A;  4LNJ A;  3IHJ A;  2AY1 A;  3QN6 A;  4ZDP A;  1N31 A;  1I41 A;  4IXO A;  4XK1 A;  4WYA A;  4XJM A;  3OP7 A;  2BI3 A;  1IAX A;  4F4E A;  1GEW A;  4ZWV A;  3TCM A;  3ATH A;  3JWB A;  1ASE A;  1OHY A;  3JW9 A;  1AKA A;  5EUE A;  3EUC A;  5F9S A;  3LVK A;  1ASM A;  2HUF A;  4M2J A;  5G2Q A;  2PO3 A;  4XJL A;  1O69 A;  4RIZ A;  1G4X A;  3CBF A;  1B9H A;  2C0R A;  1D7U A;  2EO5 A;  3AAT A;  4LW2 A;  3BWO A;  2CB1 A;  2VMV A;  4GRX A;  4A6T A;  4F5G A;  3RUY A;  1OXO A;  2BIG A;  4R5F A;  2QB3 A;  1XEY A;  3LG0 A;  1G7W A;  3E77 A;  3QGU A;  5FT5 A;  2W7G A;  4FFC A;  2VGS A;  4JF1 A;  4OYT A;  2FNU A;  1AJR A;  3EI5 A;  3MKJ A;  2CST A;  5G2P A;  3COG A;  2CH2 A;  1TOE A;  2AY8 A;  2X8U A;  3E2F A;  3HT4 A;  4R5Z A;  4H63 Q;  3H7F A;  1DGD A;  1DJU A;  3P1T A;  1BQA A;  2AY4 A;  1BT4 A;  2BIA A;  3CQ6 A;  1ZOB A;  4ZSW A;  4WLH A;  1ASA A;  2HP1 A;  4XEW A;  2FNI A;  4TN4 A;  5DJ1 A;  2YCN A;  1H0C A;  1LW4 A;  2WK9 A;  2FN6 A;  4RM1 A;  1RVY A;  2CJG A;  5DB5 A;  4A72 A;  4DGT A;  1V2E A;  3WX9 A;  2BWN A;  1UKJ A;  4ZM3 A;  2HUU A;  3VOM A;  5F8V A;  3HMU A;  3W1H A;  1B8G A;  2DGM A;  2EPJ A;  2HZP A;  2VIA A;  1EG5 A;  2D5Y A;  2YKX A;  3GSB A;  3PJ0 A;  3WCN A;  1BQD A;  1AIC A;  1OHV A;  3HDO A;  4F5L A;  1N8P A;  2O0R A;  3DZZ A;  3B1D A;  5EQC A;  4Q76 A;  1AMQ A;  1KMK A;  2VMO A;  2BI5 A;  4DBC A;  2Z61 A;  4TV7 A;  4BA5 A;  3ASA A;  3N4R A;  2E7J A;  3RCH B;  3BS8 A;  1G4V A;  4RJ0 A;  4XAU A;  2CJH A;  2OAT A;  2VMQ A;  2WKA A;  3QI6 A;  5E4Z A;  1G7X A;  2AY6 A;  4WYC A;  1AMR A;  4M2K A;  3TAT A;  2ZP7 A;  4GEB A;  1GEY A;  1GD9 A;  3BCX A;  4ITG A;  2DKJ A;  3PPL A;  1T3I A;  1CJ0 A;  1AX4 A;  1SZU A;  4UQV A;  4R8D A;  4OBU A;  1ARH A;  1B9I A;  1LC7 A;  3N5M A;  1D2F A;  4OMA A;  4EMY A;  3FVU A;  2WK8 A;  3FZ6 A;  3KGW A;  4ZWM A;  2XH1 A;  3AEO A;  3FKD A;  1AAW A;  4MQP A;  1BJ4 A;  1ELQ A;  1UU2 A;  3BCB A;  1LS3 A;  3PIU A;  2DKB A;  3NYU A;  1AKB A;  5G09 A;  3N75 A;  1QJ3 A;  3FCR A;  4K2B A;  3K7Y A;  3NUI A;  4PFF A;  4ZAH A;  1YJZ A;  2CTZ A;  2R5E A;  1QJ5 A;  3TQX A;  3VK4 A;  1AY8 A;  2D64 A;  4KAM A;  3RCH A;  1PMM A;  1LKC A;  1PMO A;  3MAU A;  2ZSM A;  3BB8 A;  1MGV A;  2YKV A;  3B1E A;  3PGY A;  1D7V A;  1W23 A;  2BWO A;  1IAY A;  3WGC A;  1S09 A;  4GDY A;  1D7R A;  3JTX A;  2ZY2 A;  1LC8 A;  4WXB A;  4WYE A;  1W7M A;  2YCP A;  1DKA A;  3LWS A;  2YKY A;  4MSO A;  2VGW A;  4N0B A;  2C7T A;  2E7I A;  3QPG A;  2W7D A;  4IYO B;  4MGR A;  3F9T A;  1V2D A;  4A6U A;  1TOG A;  3FTB A;  4GE9 A;  4JEY A;  3B1C A;  2JG2 A;  2BWP A;  1M0P A;  3NX3 A;  4JEZ A;  1ASL A;  5EUD A;  3I4J A;  5HDM A;  2AY9 A;  3BN1 A;  3WY7 A;  2V1P A;  1IBJ A;  4F5F A;  3F0H A;  1AMS A;  4BMK A;  3PA9 A;  1ART A;  1JF9 A;  4EB7 A;  2GB3 A;  1OAT A;  1VP4 A;  2AY7 A;  4F5H A;  3GJU A;  2CAN A;  2JIS A;  3R9A A;  1MAP A;  4ADE A;  2OQX A;  2HP2 A;  1ASN A;  1P3W A;  1TAR A;  2VGV A;  4JEW A;  3DOD A;  4ATQ A;  3FZ8 A;  5EAV A;  2F8J A;  1ECX A;  2RFV A;  2DGK A;  3ZRQ A;  3EI9 A;  1CZC A;  1B5O A;  1AMA A;  2Z1Z A;  3EIB A;  3CQ4 A;  1X29 A;  1GDE A;  2DOU A;  3MC6 A;  4ZAS A;  1AHX A;  1QIS A;  2E54 A;  2VMR A;  5M4D A;  4IYO A;  3BC8 A;  2ZY5 A;  3ACZ A;  4ADC A;  2GSA A;  1SFF A;  3R4T A;  2Z1Y A;  2AEV A;  1BJN A;  3UAK A;  4AZK A;  1LK9 A;  4JE5 A;  3FVS A;  1WYV B;  3D6K A;  1E5F A;  1EQB A;  1I29 A;  4U2H A;  1BJO B;  2R2N A;  5J8Q A;  2JJE A;  3K40 A;  4E3R A;  4ZDO A;  3MC6 C;  4F5K A;  2HUI A;  2DGL A;  5I92 A;  1ASG A;  1MLZ A;  1KKJ A;  4LNM A;  2CJD A;  4KXK A;  1KL1 A;  2HOX A;  2YRR A;  4UOY A;  4XJO A;  1J04 A;  4CVQ A;  1BW0 A;  1XI9 A;  2BI2 A;  1GC4 A;  3T32 A;  1YIZ A;  1ASB A;  2W7E A;  4ADD A;  5BJ4 A;  5D95 A;  4AH3 A;  2Z9X A;  3FRK A;  4ZLV A;  2O7C A;  1QZ9 A;  1C7O A;  3NUB A;  2ZUK A;  5JAY A;  1YOO A;  2BI1 A;  2VMY A;  3ISL A;  2WB6 A;  1H1C A;  5DX5 A;  4JE5 D;  3E2Z B;  1VJO A;  2A1V A;  3NU7 A;  4A0H A;  2QLR A;  2G7J A;  3PDB B;  2AEU A;  4A00 A;  2OKJ A;  1ZC9 A;  2Q7W A;  2Z9W A;  2OGA A;  2FYF A;  1WYV A;  1O4S A;  4BQ0 A;  4HF8 A;  2W8T A;  1DGE A;  1BJO A;  1W3U A;  2JJF A;  2VGZ A;  1CZE A;  1YIY A;  4WD2 A;  2BYL A;  2ZYJ A;  5EUN A;  5TF5 A;  4P7Y A;  4UHN A;  3TFU A;  1YJY A;  4ATP A;  2D7Y A;  3GZC A;  1OXP A;  3PD6 B;  1CQ8 A;  2X5D A;  4ISY A;  1MAQ A;  2AAT A;  3NRA A;  4IXS A;  2VI9 A;  4A0R A;  4BHD A;  4W8I A;  1O61 A;  2VIB A;  4CXR A;  1ARI A;  2W8J A;  1ASF A;  1KMJ A;  4AO4 A;  3MBB A;  4BA4 A;  1E5E A;  1FG3 A;  2EZ1 A;  3I16 A;  4ADB A;  4AO9 A;  2VMT A;  2Z9U A;  3DRD A;  2Z20 A;  3FQ7 A;  2AY2 A;  3JU7 A;  4IXZ A;  1IX8 A;  4PIW A;  1B5P A;  5LH9 A;  4Q75 A;  4AOA A;  3KE3 A;  2Z67 A;  2FM1 A;  2BYJ A;  1M6S A;  3E2Z A;  2GQN A;  3DR7 A;  2PB2 A;  3PDB A;  4WB0 B;  1AKC A;  2CFB A;  3N4S A;  1CQ7 A;  3AEM A;  4FL0 A;  5FT4 A;  1AAM A;  2W7M A;  3AEL A;  4W1X A;  3WGB A;  3ZZJ A;  1WKH A;  3QM2 A;  2VGU A;  2ORD A;  3WLX A;  1I48 A;  3PD6 A;  4Y0H A;  2EH6 A;  1MLY A;  2FQ6 A;  3NTJ A;  4WLJ A;  2R0T A;  1ASC A;  2YHK A;  3B46 A;  1Z3Z A;  3BV0 A;  3M5U A;  4I8A A;  3HL2 A;  3E2Y A;  1AY5 A;  2W7J A;  1ARG A;  1AY4 A;  3GR9 A;  1RV3 A;  4WBT A;  2W7H A;  3AV7 A;  4P3M A;  5HXX A;  3AEM C;  3HBX A;  1X0M A;  4JEV A;  2PB0 A;  2XBN A;  4RKC A;  4RLG A;  3LVM A;  4ITX A;  3W1I A;  2VMP A;  4CBR A;  1QGN A;  3E9K A;  3RQ1 A;  3FSL A;  3IF2 A;  2CIN A;  4WB0 A;  3DYD A;  1IJI A;  4OTL A;  3UE8 A;  1AJS B;  3VAX A;  3TFT A;  3FDB A;  4MY5 A;  2VYC A;  3CAI A;  4NOG A;  1BS0 A;  2D66 A;  2VI8 A;  4HVK A;  5LHA A;  3A9Z A;  3RBF A;  5G4J A;  4Q6R A;  2W7K A;  3HQT A;  4XJP A;  4Q31 A;  4W91 A;  1M0Q A;  2C44 A;  1LW5 A;  3EI7 A;  3L44 A;  1QIT A;  4A6R A;  2TPL A;  3KGX A;  4E1O A;  5BJ3 A;  1YAA A;  1GCK A;  3WZF A;  4LNL A;  2X5F A;  3H14 A;  2OKK A;  5C6U A;  3BCA A;  2QBT A;  1AHG A;  3MEB A;  2WK7 A;  3EIA A;  2D63 A;  2YCT A;  1GC2 A;  4MQQ A;  3WCO A;  1KL2 A;  1W7N A;  3RI6 A;  8AAT A;  2W8V A;  2QA3 A;  3FQA A;  1RV4 A;  1N2T A;  2VLH A;  4RIT A;  1CL1 A;  1YNU A;  3GBX A;  1C7N A;  4KYO A;  1ARS A;  4K2I A;  4RAE A;  2JJH A;  1PG8 A;  4MKK A;  2HOR A;  2W7F A;  2VLF A;  2CY8 A;  2ZJG A;  4RKD A;  3EI6 A;  2CH1 A;  3DXV A;  4OC9 A;  1M4N A;  2VMS A;  3NU8 A;  1BJW A;  3AOW A;  3E6G A;  4CBS A;  3NNK A;  2VMU A;  3PDX A;  5D5S A;  4Y0I A;  4PFN A;  2C81 A;  5KTB A;  2VMZ A;  5E3K A;  2X3L A;  1GEX A;  2QSR A;  1BKG A;  4E77 A;  4EFF A;  2AY5 A;  3H9X A;  4CXQ A;  2EYQ A;  1DJE A;  2ZY4 A;  2VMN A;  2YKU A;  3JZL A;  3N0L A;  2OGE A;  3FVX A;  1AIB A;  5E5I A;  2KFP A;  5EFS A;  5EIG B;  1SVV A;  1J32 A;  1FC4 A;  1JG8 A;  3GWP A;  1S07 A;  5EAA A;  1UU0 A;  1AIA A;  3BWN A;  3W1J A;  1OHW A;  7AAT A;  4GSA A;  4MQR A;  1RVU A;  4WXF A;  3N7N A;  4U1T A;  3VP6 A;  3QHX A;  1M32 A;  3LY1 A;  4OCA A;  1KKP A;  3A9X A;  1C0N A;  1C4K A;  4H51 A;  4O6Z A;  4ZM4 A;  1WKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...