4F4IA

Crystal structure of thymidylate kinase from staphylococcus aureus in apo-form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
204
structure length
193
Chain Sequence
MSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIDQEDLKFHEKVIEGYQEIIHSQRFKSVNADQPLENVVEDTYQTIIKYLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in apo-form
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords Thymidylate kinase
total genus 74
structure length 193
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f4iA00
4OQMA 1Z2AA 2GF0A 3PUWA 2PEZA 4DRZA 4ZPXA 1FQJA 2CCKA 2OM2A 4CEIB 3W5JA 2IHBA 1NKSA 2NO7A 4Z8XA 3WRXC 2ZRBA 3IQWA 4M22A 2UKDA 1SKYE 2KWIA 3RNLA 4NONA 5K8IA 4V0OA 3SHFA 2QMEA 3LW8A 1Z0IA 3GLIE 5LD2B 1P2VA 1S1CA 3TK1A 2PX0A 4ILEA 3SE0A 4M1KA 4BLPA 4D0LB 4QM7A 4JKIA 1GSIA 4FCTA 3AQ4A 1XD2B 1TU3A 3DZDA 3KXIA 4JLNA 2X77A 2WKQA 4CYMA 3LY5A 2YC4C 3QJYA 4LI0A 3ZVLA 5EP4A 4DXAA 5JZVA 3EC2A 4MQBA 1ZNYA 1NG1A 2C8VA 2ODBA 1E9BA 2YWHA 2C04A 4XVQA 2PJRA 1JR6A 1S3SA 4M1MA 3GLIA 4LWZA 4Q4AB 3CPHA 4QBFA 2PH1A 4OHWA 1W36D 3CX6A 2CK3D 4IOMA 4FIDA 4JL5A 5DYGA 1OW3B 3FPAA 2P6RA 1YR7A 2IYUA 1T5IA 3EC1A 5L3SA 3K09C 2P0EA 5F3WB 3QKRB 3MWYW 3DDCA 2F1HA 2GTPA 1LS1A 1MABB 2F7SA 4RZXA 1OXXK 3VNVA 3QUSA 1JR3E 1TU4A 2BMFA 3A4MA 4XVRA 1ZM9A 4JS0A 1PLJA 3ZQJA 4US1R 4YMVA 2ZE6A 4TQ9A 1OH8A 2OAQ1 2GXSA 2O8DB 3BERA 3FGNA 3KFVA 3SOPA 1T5LA 2VP0A 1NIPA 4PC6A 1Z3IX 1M7BA 3B1YA 4LHZA 5FBWB 4A0GA 2QMUA 1IM2A 2WWGA 5FOUA 4YQFA 4PHGA 2WSSD 2XXAB 2WWFA 4TLAA 1DARA 2R44A 1G8HA 2VTKA 4B48A 3WNDA 2ZYTX 3GJ7A 5HE9A 1CU1A 1K6MA 3SYKA 3EZFA 3WYFA 1TEXA 1LTQA 4FCWA 1NLFA 3CZPA 2FPMA 5EXSA 3WYAA 5SZKB 3FOZA 1R6BX 4ASUA 2G88A 3OIUA 5C4GB 2EW1A 2ZJZA 4KYIB 5C1BA 1R0XA 1E2FA 1CR1A 3FDIA 4PPNA 4RKFA 4TMTA 121PA 4NKRA 2DFLA 1QHIA 3CZQA 2RGDA 2VP9A 4Q1CA 5BN3A 2OE2A 2ERYA 2QZ4A 2ZAOA 4J0QA 4NU0A 2AKAB 3EZ9A 4NBSA 1QG4A 3VQTA 3ICQB 3THOA 3HP1A 2FSGA 1W0JD 2F9MA 3GFPA 2J0VA 3JVVA 5JEEA 4P32A 3TSZA 4C3ZA 4A8JB 3TKLA 2H5EA 1E0JA 1KNQA 5HKKA 2A5GA 3IILA 2A5YB 5BYJA 1TTTA 2VP4A 3BJIC 1R0WA 5KSYA 1AS3A 4YDSA 1QHNA 3BRWD 5BWMA 1P2SA 1JPNA 4B3BA 1G3MA 1XPUA 4JLPA 1MV5A 2AX4A 3RWMB 1DELA 1QDEA 4U5XA 3LQRA 4B44A 2ODWA 3B7GA 4BFWA 3T34A 2N42A 3KQUA 3IKJA 4JJZA 2GJ8A 4HEJA 2GNOA 1JECA 1XTRA 2FN4A 1RRFA 4WXPA 2GZDA 1UBCA 2BJVA 2V1XA 3VTKA 2QBYB 4C7OA 3MFYA 2ANBA 2QAJA 4M9XA 1IXZA 3QKTA 5FTNA 3GFTA 4R98A 4RJLA 1YZKA 1ZCAA 2IC5A 4Q03A 2B7BA 1IN4A 4QKQA 1ZC3A 3KUDA 5KSPA 1M6NA 2O8CB 3S1AA 4IXMA 1KI4A 1D5CA 1CR2A 2CL0X 3BAFA 3IBGA 4RD3A 1T8UA 2GETA 1OH6A 5GJCA 2VPPA 3QKSB 1COWA 3N2EA 1NSFA 2GCOA 4AC9A 3T1QA 5EXXA 1N25A 1T3HA 1DBSA 1DS6A 3NXSA 2HLDA 4FD2A 5KDOA 4IDNA 3CNOA 1G17A 1FP6A 5KTYA 4V0MA 3VHLB 1G8PA 3QEJA 1M8PA 1Q44A 4TLCA 4IRUB 1QRAA 1X3SA 1CF4A 5DO9A 2QI9C 3CLVA 1FOEB 2X2FA 1OE0A 5EE5B 5KYKA 4HAWA 4DIDA 4HAYA 3REGA 1E69A 3DEFA 4H1VA 4EUNA 3ASZA 2AFHE 3DMNA 5JWHA 1N0WA 1E2GA 1MOZA 3TLXA 5DNYB 4KSCA 1W0KA 5FBRB 2GCOB 3CPJB 3CR7A 1ZNXA 4Q00A 4Z8YA 2G3YA 2NG1A 1UADA 4IDQA 1Q3TA 5EUQB 5J40A 4OK3A 1P5ZB 3DOEA 2ORWA 3MSXA 2OV2A 1JQLB 3I5XA 2IUSA 3N2IA 4KLZA 3K70B 4CEJB 3Q7QA 2HF9A 2XZLA 4GMDA 1OFHA 1RVDA 2HLDD 3ZZ0A 3OEHD 2FJUA 3LNCA 4JLKA 3T5DA 2GWHA 2D2EA 2O8EB 4HB4A 3ADBA 5CLLA 1JJVA 4HUTA 3TMKA 1NMYA 3OAAA 2EFHB 1PUIA 1J7KA 2VRWA 4H9GA 5CK5A 1HT2E 2F3TA 1CR4A 1OPXA 2ATVA 1Q20A 4TQAA 4Y0VA 3TR5A 1N6PA 2F9LA 4KHZA 4B34A 4O0MA 1ZIPA 2PJZA 4PAMA 4C0HA 3LW7A 1A5TA 3HPRA 4Z54A 3PEWA 4DSUA 4KJZA 3I61A 1SQ5A 1VG8A 1YZLA 1ZNWA 3GEHA 2IEYA 4UJ3A 4LV8B 3J81k 1E9SA 3EIEA 3WY9A 4DC9A 2PL3A 1JAHA 3R9XA 3ZIAA 1GP2A 2ONKA 2DB3A 5DH9A 4OYHA 2GEUA 4PPGA 2JLWA 2ZUBA 2GESA 4BLRA 4DT1B 2OAP1 3BXZA 4B2PA 1HQCA 2OESA 1WA5A 4YONB 1E99A 1UPTA 4LBYA 1HUQA 3AUXA 2V7QA 3NVAA 2WIBA 5CM8B 5KHOC 1E2HA 1T0HB 2QT1A 2C2HA 4IDPA 3SC3A 2ORVA 4PO8A 2N46A 1G7TA 4IDOA 3L43A 1Q1ZA 3LLMA 2ZRDA 2MSEB 2IK8A 4Q9KA 4XTCS 3UANA 4F91B 4AY2A 1KTVA 1ODFA 1I4DD 4BLSA 1T3LA 4C9BA 1GRRA 1N6HA 3VR4A 2ODNA 4BRWA 4LC0A 2ZJBA 4RZUA 4KFTA 5AUNB 1KI7A 4AKEA 1C4OA 2WZQA 3IPYA 1W36C 3KUCA 2VP5A 5J4YA 1P60A 1XCMA 5FUWA 3ZH9B 4TMXA 5GJWC 1CIPA 3B9PA 3THWB 2WSMA 3TR0A 4ESVA 2OG2A 4US2R 2FV8A 2LCFA 5E7IA 1AS0A 3ZGXA 1YJ5A 4NHOA 1MO4A 1LW7A 3RYTC 1XEXA 4JLVA 2RGCA 2P6UA 3SDZA 1UKVY 3VX4A 1FNMA 1OHHA 1SVIA 1KAGA 1TQ6A 3QI2A 4EJSB 1L4UA 2XITA 4IVQA 2ZITA 3BIFA 4FWIB 2PCLA 5E7JA 1NSTA 2G0NA 3GLHB 2CHVA 1OFUX 1S1MA 4HDCA 5D3QA 4HUQA 3KKPA 4Z51A 1S8FA 1X6VA 1EWQA 4NDZA 3E5HA 3TUJC 5BQ5A 1XPOA 1KDOA 1W4AA 1L8QA 5UKDA 2EFCB 2I1QA 4D81A 2BBTA 2QT0A 3I32A 4DLVA 4JL8A 3AH8A 4GSYA 4NYJQ 4CEIA 2MMCA 4D0GA 1EFUA 4NPHA 1BMFD 2WKPA 1KI8A 1E98A 2BCGY 2CBZA 2P2LA 4TYQA 2J5XA 2PLRA 3HYRA 2ZYUX 4CDGA 2A78A 4S2EA 5FR2A 3IO5A 2D06A 1NMZA 3OFND 1KI1A 4FN5A 2AK2A 4ZI2A 3OF5A 4TTQA 3QXCA 1C1YA 4Q18A 3THYB 2QNRA 1XD2A 4BLTA 4QHSA 4CEHB 2J87A 4EKDA 1KSJA 3H1TA 5JI2E 2MMGA 3FHCB 4G5QA 2J46A 3AV0B 3K0SA 3TUZC 2XZPA 2QSYA 1SVKA 3CF6R 4B2LA 3AKYA 1IN6A 2RHDA 3BB1A 2Z4SA 4AKIA 3QF4B 3FHOA 3LO5A 2CXXA 1GITA 2R6AA 2VHUA 1K5GA 1ZUIA 1B0UA 2ZVPX 3BORA 1VECA 2HXYA 1JQJC 2V9PA 2O52A 3FKSA 3TAHA 5FUXA 4WAUA 4B71A 2PZFA 2IX3A 3THYA 1NY6A 3CRW1 5F9HA 3NC0C 2GA8A 3RS3A 1QHHA 4M1OA 4Q1EA 5H70A 3U7FB 4B2IA 4AG5A 3VKGA 4LJ8A 4M1SA 3QPVA 4NH0A 4BRUA 4HLQB 4LCBA 3C41J 4YXWD 1PUJA 5EUMA 1EX7A 5TY0A 4C0SA 1Z83A 3MJHA 3QVVA 2JJ1D 2W6JA 2OCAA 4KYUA 4KSBA 3VR6A 5JJLA 1SHKA 4L8GA 1COWD 2O8FB 4DLSA 3THXB 4HZIA 3T12A 2OLJA 3OEEA 3K70C 4PZLA 1XTQA 2HCBA 3G82C 3MUFA 4C30A 3C14C 3W5IA 4DDVA 1XTSA 1QHHB 3D3QA 3UG7A 2BBOA 4Q5IA 1IY0A 2IYXA 3M6AA 4P4SA 5H8WA 2EYUA 5JJKA 2VLIA 1PJRA 1ZU5A 3GLIB 3F3YA 1YU9A 1G18A 1R5BA 2PZEA 3MRSA 2WJVA 4L15A 1G291 4ACAA 1FMLA 2UZ3A 2WOJA 5TARA 1W49A 1KKMA 3LD9A 3MWJA 5A0FA 2JASA 3VHXA 5ANRB 1VG0B 1E2MA 2CJWB 2ZUCA 3THXA 1XTJA 4DJTA 4IHQA 1KOFA 4E5UA 2IWRA 1AKEA 1UAAA 1NVUQ 2CMKA 2ZJAA 3IGFA 3AP1A 3B82A 2CEAA 5FTMA 3IEVA 1MABA 3B2EA 3TSOA 2PT7A 4A15A 4OQLA 3G0HA 1YZUA 4U00A 1RYHA 3AVTA 1MKYA 4GI7A 4N1AA 4MUBA 5KNBA 3R8FA 4B47A 5J4HA 2Z5FA 2Q21A 1NLYA 2ZYVX 3EAQA 2C9YA 3QG1A 2GJKA 5FUYA 1W44A 2QROA 2EVWX 2QUZA 3QXSA 3UKDA 4C0LA 3MMPA 4QHTA 1YRAA 2ZRGA 3T61A 3TAUA 2K5UA 1GDDA 3KJGA 4PO9A 1X8KA 1OIVA 1E2JA 1VG1A 4MGZR 4GFDA 5EE1A 2EYQA 3IUYA 3U7EB 1X86B 3HU1A 4BECA 1ZMXA 2HCJB 2XB2A 4F7WA 1D2NA 1E2QA 4C2TA 1Z0FA 2O8CA 3SS8A 5SZHB 4FMBB 1F2UA 4POAA 3P4XA 3FMFA 521PA 2WAXA 1GWNA 3C8UA 5DSZA 1GL9B 5CLQA 4TMVA 3W3ZB 2OLKA 2D3WA 1GTVA 4PSVA 2X1VA 4JLAA 2BMJA 4AWXA 1G6OA 4DCTA 3LVQE 4W5JA 4HLCA 2DPXA 4B74A 3RC8A 2GXUA 1RKBA 2BBWA 2ZAMA 1DTSA 3LWNA 1XD8A 1W46A 1JI0A 1TX4B 4A8JA 1C9KA 1UDWA 2EFGA 3EA5A 4GNKA 3F5FA 3N5CA 2GK7A 1HH4A 2R6FA 4PO1A 1O3YA 1Q1BA 3B60A 1DAEA 1WXQA 1T8TA 2J7PD 5EP2A 2J59A 3BH7A 5EXPA 1U9IA 4DSOA 1XTIA 3GJ6A 3VR2A 3DM5A 5JECA 2JJ1A 2W6JD 4URXR 2R9VA 5FL3A 4I1SA 2QMOA 3VR1A 2QMHA 2WWYA 2ZRLA 1DAIA 1U2RA 1VYUA 3EWAA 3IBYA 3UWOA 5C46F 3BH0A 4B3CA 1KI9A 1AA9A 4HB0A 1ZM4A 3KB2A 4NYIR 5AJWA 4MGKR 3GP8A 2AL7A 4QC2A 3NBXX 4HAZA 1CJTC 4EPRA 4B6EA 4CEJA 1ZD1A 3HWSA 1NN0A 3GJ4A 1EK0A 3AF4A 3Q5DA 4TZ0A 1QVRA 1W5TA 2YVUA 5JBQA 2OT3B 2RGGA 1GM5A 2QP9X 1DG1G 5FFMA 4LGMA 2P5SA 1KO1A 2OEPA 5B30A 1MO6A 3L8YA 4CZ2A 3O8BA 1N6IA 3AVQA 4PC1A 3ZS8A 1ZD9A 2AN9A 3BH6A 2WOOA 2C98A 4WZAE 3RANA 3B9QA 3SZRA 1QZXA 1H8HA 2R6GA 5FTLA 1VPLA 4PQYA 1YZQA 1U8YA 2GXQA 2KJQA 3L0SA 4LC1A 1PV4A 3CPEA 1A7JA 2QPAA 1E3MA 3WP1B 1CBUA 2C78A 4A0RA 1M34E 1G64A 4ZV4A 5HCNA 3ND9A 1VTKA 3MG9A 2ANCA 4O25A 1VHTA 5LB2A 1XDBA 2RAPA 2QE7D 3KJHA 4HB2A 3PIRA 1ESMA 1JEEA 1GFIA 4QGAA 4C0KA 3U4QA 2BMDA 3I72A 1CKEA 1JBKA 5EZ5A 2C99A 1F2TB 4C4PA 1XTKA 2EU8A 1FL9A 1DAGA 1WF3A 4FW9A 4Q1FA 4Q9HA 4A36A 2BVNA 4QM6A 1GIAA 1J8MF 5FI1B 4QOSA 1FP7A 3TUIC 1G7RA 2GCPA 5TDHA 2VBCA 1IJFA 3DOFA 2GAOA 4GDFA 2D7DA 1ANKA 2IS2A 1G1MA 3VU9A 5CYPA 4MRPA 1FMJA 3AF0A 3IIJA 2C5LA 4BFSA 4II7A 2VHJA 1SVOA 4W5HA 721PA 3CM0A 3AF1A 4RKEA 4ZIRB 4AURA 821PA 5P21A 3U44B 4ITRC 4A0FA 3THWA 1G6HA 5B57C 1E1QA 3ONWA 4JVMA 1NG9A 4RFSA 3Q5EA 4IW3B 2JLYA 2DHRA 2N1BA 3U4QB 2CHQA 3CRQA 3PVSA 1E1QD 5CK4A 2V54A 4Q9JA 5KSOA 2NMVA 1J99A 5C18A 3SQWA 2ZJ2A 1FX0B 4BFZA 1R5OA 4B32A 1IONA 2J9RA 3GLHA 2ECKA 2L0XA 4XWKA 1RW4A 2B6HA 4MYUA 3R8CA 1X1RA 1KO5A 5CJPA 3VU9B 5K8TA 1D2MA 4ZDJA 1GILA 2J3EA 2JLVA 4K81B 5EP3A 2B92A 4TL6A 1XFAA 4OI2A 3FYHA 3ZZUA 4DT1A 2NOAA 3ZD7A 3H4MA 2ZS9A 5J4VA 3MLEA 4MITA 4D82A 1SVWA 4NCNA 4M1WA 4IFEA 4QJ4A 5EZ6B 1XMVA 3KKMA 4BZXA 3R20A 3KQKA 5FBVB 1N0UA 3HU2A 1W0KD 4RY2A 3H86A 4TYYA 1UBGA 1IXSB 3CB4A 4M8NE 1IY1A 1JXMA 1KAOA 3ZZTA 4LYHA 2ZU0C 1SVMA 2QAGA 3T06B 1Z47A 1SXJD 3GCGA 4I1OA 2QM8A 5EE9A 2ZVQX 1XZQA 5JWRA 1Z0JA 3A1UA 2IUUA 3K0FA 3ZD6A 4TT3A 4E07A 2JLUA 1G4AE 1NBME 4UNPA 1BMFA 2AWNA 4A6XA 1DVRA 4NCKA 2FFBA 1VCIA 1UM8A 4TSFD 2F1IA 2B8WA 1XEXB 3DHWC 3U3KA 1WMSA 4N0DA 5LDDC 5DYIA 3WMFA 3TGPA 5KO2A 4D25A 4HAXA 1CEEA 3K9HA 4FMDF 1G3QA 3A1WA 5CIWA 3IO3A 1SXJB 2XNDD 3U3OA 4R2IA 5HTKA 3QSYA 1RJ9B 3GLFA 2WKRA 3W6NA 3PENA 4S35A 3DZ8A 3RDPA 5IF9A 4XTRA 2XSZD 2D74A 4ZDWA 2J0QA 3N70A 2J1LA 2OSBA 1XD9A 4A82A 3FTQA 5FBQB 3SU8A 2V3CC 4TWZA 1TUEA 1W5SA 2H1LA 1IN7A 4L16A 3SNHA 1Q1EA 4Q9IA 3H84A 3CRRA 1E94E 1H8ED 1TMKA 1N6LA 2QL6A 3GJ3A 3T5GA 2FEOA 1M1YE 1N5IA 2Q3MA 3W9YA 2Q9BA 3P27A 4PHHA 4TL7A 3I73A 5L3SB 5FOWA 2P5TB 3BBPA 4XD7D 4URZR 3W34A 4PANA 3V4FA 4MDEA 4CF7A 3Q8XB 5AUQA 4UQOA 3LH5A 2EWWA 3KFXA 1FUUA 2FH5B 3O47A 1HQYE 4ESHA 5DIFA 1OH5A 2AXPA 3NHAA 3GMTA 3L8ZA 2QY9A 1XCGB 4XIGS 4CT5A 3ETLA 2HV8A 1HE1C 3TBKA 1R8SA 1GAJA 4Q4JA 1N2CE 2IA5A 3UXMA 1AM4D 1U99A 1Q1QA 4KVGA 1JALA 4QNRA 1XRJA 3MCAA 3LAWA 5FOVA 3H2YA 1ESNA 4DSNA 5E7MA 2ZREA 2XXAA 2R65A 2AFIE 4EIWA 2TMKA 1K8RA 2OZEA 1UBFA 1BKDR 1KJZA 2A30A 1GL7A 1XJCA 4JYBA 4PX9A 2ZI3A 4X8MA 3RVBA 4KV9A 4X8LA 4OJKA 4XSHA 4YDHB 2IYZA 1NJFA 3CO5A 4MRNA 2QM7A 2HDNB 1R0ZA 1I4TD 4ZKEA 4LJ6A 1YVDA 2W58A 3B5JA 4OQXA 2QTHA 1KGDA 2QQ0A 3CONA 1P9WA 3P1JA 1SXJC 2RGBA 2ZI6A 4KFUA 4L9WA 1VCNA 4MRSA 4V0NA 5KSZA 1YR8A 1P4SA 4C2UA 3R7WB 3R9WA 2V1UA 3NIBA 2KB0A 4E22A 3W8NA 2FSHA 4ZDIA 2ASEA 4PSAA 2ZS7A 2CL6X 4D2IA 1YR9A 2H18A 1Q22A 1NN3A 4JSTA 4PR0A 2JJ2D 4D0NA 3I1FA 4U7DA 1AN0A 1T4GA 4YC7A 1SVSA 4AYTA 2FWRA 2XGJA 3AEZA 5CM9C 1U94A 3CW2A 5C4MA 3B13B 2IF2A 4A2WA 1YKSA 2DYKA 4IOJA 2GBLA 3QBVA 3PUYA 1I2DA 3LX5A 4LZZA 1XBTA 1V5WA 4BFTA 4YMTA 3AVXA 3HR7A 2QTFA 1ZAKA 1YRBA 2JJ8A 1ZYUA 5J4LA 2ZRAA 3AM1A 4C0JA 3DL0A 5SZJA 1VCMA 3BFXA 3CKLA 2XJ9A 3GEEA 3KXLA 5G40A 3ICEA 1LV7A 1OIWA 4I81A 3I92A 3K0AB 3FMIA 2EWVA 3OEHA 3SI7A 2ZYWX 2FZLA 4ARZA 5BXQC 5AWFC 2BBSA 2BOVA 2XTNA 5GJBA 4Z1MA 4DDUA 2F6RA 5EJEA 1G5PA 2DR3A 3SBEA 1G21E 4LV6A 4Q7KA 1NY5A 5AJZA 3EZ7A 1W2GA 3KTAA 3OHMA 3Q72A 4ZO4A 2NZJA 4KODA 1H65A 1EFRA 3ADKA 3BFVA 3KL4A 3QKSA 3WXMA 4DDWA 5AUOB 1OIXA 3QENA 1P73A 4NYJR 4QGHA 3O8RA 4Q1BA 3A37A 4AD8A 1XB2A 3ZDQA 2BKEA 1DEKA 3TH5A 1W48A 3L2OB 3MAAC 2HF8A 1XEWX 4Q1DA 1IN5A 2G9NA 3NBFA 1XMSA 2Q6TA 2GK6A 4BUJA 4MGIR 3LX8A 3OE7A 1FQKA 3PEUA 3QIAA 1E9AA 1A2KC 2ZR9A 1N6OA 4PZZA 2JLZA 4LK2A 4GOXA 4JMPA 5DLQC 4IKEA 1F2UB 2V6JA 3AVOA 5ELXA 1KK2A 1U98A 4WVFA 2AR7A 3QBTA 3IHWA 2UZIR 2Q9AA 1D9ZA 1P9RA 2WBLC 3W3AA 2QN6A 2AD5A 2NPIA 3TQFA 1XXHB 2LWIA 2O5VA 2QGNA 1VYVA 2F1RA 4JVNA 3PCRB 4LYJA 2KE5A 1XEFA 4BZPA 2VO1A 4LBZA 1BOFA 1FPMA 4P33A 4UXIA 1LB1B 1RRPA 2ZQ5A 1P72A 2ZROA 5E4FA 3I3SR 1SKQA 4JLJA 4K46A 4R7ZA 4CT4B 4XOIA 2IYWA 2RHMA 3VFDA 5TMPA 2ZE8A 4RD4A 1E79A 5AJVB 2O8EA 4HB3A 4M4SA 1EFTA 2FZ4A 1DO0A 1XMIA 2ZUDA 3P20A 4JJKA 1MH1A 4LPKA 4CIDA 4V0ME 2GILA 3LRPA 2PMDA 4B43A 2X19A 1E9RA 4N3NA 4PAOA 3TIFA 1JPJA 4G5OA 2OO7A 1M74A 3ADCA 3GJ8A 4OBEA 2ZM5A 4TMWA 2VF8A 2DWPA 5TV2A 2J0UB 3SYLA 4DHEA 1ETUA 3NKVA 4LRWA 4M0LA 3UPUA 5FPHA 2QENA 1SXJE 4HI0E 4KFSA 3MJRA 4TMKA 4A8JC 5JMTA 4GBMA 2XNDA 1E6CA 2AD1A 2DWQA 1EGAA 1JAIA 4PC2A 2OILA 1UJ2A 3R9IA 4RSGA 2G83A 1XMJA 3UMSA 3U44A 2J0SA 3ZQ6A 3NBYC 5CYOA 1ZC4A 3QY0A 2NGRA 2VEDA 4QL3A 2F55A 4RFSB 1II0A 3A1SA 4Q9LA 1P6XA 1VKJA 4FXPA 1PLKA 5GJVC 2FEMA 4BEJA 4DSTA 2HUPA 1H8HD 3NWJA 4AIIA 2Q3FA 5IRCD 2A3RA 1U8ZA 5FPTA 3AVVA 1B23P 4TL9A 1KHTA 2FNAA 2WICA 4JKYA 3L0PA 4M9QA 2JGNA 3EPKA 2OXRA 2YYZA 4LY6A 2GVDC 1E2EA 4RZ2A 2ZRNA 1UEJA 1TQ4A 1Z28A 2HYIC 1KMQA 3C5HA 2RCNA 3ZVMA 1TQDA 4JLOA 3PEYA 5FOSA 4D80A 1YZGA 5M04A 1IY2A 5J5CA 3LBHA 1F2TA 1T3SA 3QF7A 1YHNA 4ZDKA 3WBJA 3CRMA 5DN6A 3CF2A 2Z6VA 5LB4A 1XEWY 1Z2CA 1KY3A 4LOAA 1OF1A 3ZIAD 4LYAA 4M1YA 4ZI3A 3EX7C 4TTRA 1CRPA 1G19A 1RRGA 2JA1A 3FWYA 2HJGA 4IVPA 4P31A 3Q3JB 1Q21A 1BIFA 1NVWQ 4ZIRA 1SZPA 1TEVA 2B7CA 1G3UA 1ONBA 1Z6YA 2WJIA 4HSEA 1I4LD 4KXFB 1LVGA 1NN5A 1Q3HA 2MSDB 1ZBDA 4MKIA 2OBLA 1IOZA 3BK7A 2KBEA 1E9DA 2VP6A 4BFVA 5EXTA 2E1RA 4MKFA 1LS6A 3ASYA 1KI2A 3HJNA 1P3JA 4FI3C 3UG6A 1RJ9A 4US0R 4UKDA 2GEDA 3AB3A 1G9XA 2FF7A 1CJKC 4G5SA 5EE3A 2J45A 2NTYC 3D6TB 2FFAA 4KU4A 3MGCA 1F48A 1NIJA 4V0LA 1KDRA 3KB1A 5JJIA 2I4IA 1YZNA 4NCHA 1NL3A 2YOGA 2AHOA 4NE2A 5BN4A 1G3IA 1Z0DA 4Q4HA 5K8UA 2ZJ5A 4MUAA 2HT1A 4IOKA 4NTZA 3U2QA 2DBYA 2EFEB 1OB5A 3AVWA 5H1YA 2CE2X 1S3GA 1AIPA 3A4LA 5E95A 4CRWB 1W47A 4BFYA 2QAGB 2QG6A 2IYVA 1II8A 4JVSB 3FMPB 5LBIA 5KUTA 3TVTA 2IW3A 3HPQA 4B3FX 1D9XA 3IIMA 2BKUA 2VIIA 3NC1C 4P3YA 2CVFA 3KQHA 4MKHA 1G3RA 3EARA 1HURA 4OI1A 2YHSA 5HR5A 2XZOA 3M4YA 1MT0A 5JRZA 1G8GA 2B21A 1KKLA 1GNPA 1FNNA 5EQTA 4Q4JB 3ECCA 4DCUA 3BC1A 1R0YA 1HA3A 2RMKA 1Z08A 1N6NA 4K8OA 4GL2A 1Z0KA 8OHMA 3RS7A 4DB4A 3PITA 2AKYA 1GKYA 1OXSC 1QF9A 2NIPA 3X1WA 1DADA 1Q0UA 2QE7A 3A4NA 1FTSA 4NCJA 2O0HA 2O0KA 3FHTA 2BIFA 2WJYA 2KBFA 3X1ZA 3SQXA 1TF7A 2J7PA 1G20E 1OSNA 2QRNA 4DLZA 3HU3A 1CP2A 4OKSA 1KYIA 1P9NA 2BHRA 4F4CA 2ZANA 4NYIQ 4Q48A 3QXXA 3NDPA 3EIHA 1KJWA 4IFBA 2E9SA 2GKSA 2FSIA 1JR3D 2ZETA 2FX3A 4MH0R 2WVJA 5FPSA 3R7WA 4LHWA 1EX6A 2VHCA 4NCIA 4TTPA 5DISB 2ZE5A 2CJWA 1XWIA 4B3DA 3A58B 4UNRA 5DHAA 5CB8A 3SR0A 3X1DA 2XOKD 1OKKD 3U7HB 5CJ2A 1FW6A 3VKHA 2JIZA 1XPRA 2JLSA 1ELOA 3ZVRA 4LPSA 2A7QA 5DHFA 3U3MA 1T0JB 1U81A 2CCGA 5HKKD 4CW7A 3CNLA 3SJZA 2REOA 2YWEA 4RD6A 2CDNA 5KPDA 3WHLA 3F0TA 1QHSA 3U61B 4TT3D 1NVVQ 621PA 2W83A 4V03A 3BWDD 4UXHA 3QPWA 1E0KA 2VQSA 3K0CC 4BPBA 2MSCB 1FZQA 4G5RA 3WBKA 2ZR0A 3K0EA 5C2JB 3UATA 4HDQB 1OXTA 3GFOA 3I8SA 2WWHA 1T91A 3C4JA 3QXJA 3QQ5A 3AP2A 1HTWA 4EFMA 1K5DA 4N0EA 4OK6A 2CL7X 2IXFA 1R7RA 2IYTA 4M53A 4OQNA 3CWQA 2HXSA 1U0LA 2WMNB 4HATA 4R9UC 3A1VA 1N5LA 3VR3A 1NKTA 3PR1A 1A1VA 5B64A 3AP3A 3SFZA 3KTAB 5CDFA 2V55B 5J47A 5JEDA 2YC2C 4LYFA 1S4QA 2DFKB 1UKEA 4EJSC 4ZCLA 3NEYA 1YE8A 1M7HA 1TQ2A 3C5CA 4LBVA 2A5FA 5EP1A 3QE0A 3AKCA 4O3MA 1Z63A 1W1WA 1N0VC 4WIAA 4BLOA 3EW9A 4ZKDA 2YWFA 4LX0A 4TL8A 4EQ6A 1X8LA 1G5TA 3ZJYA 3OIVA 4H1UA 1NJGA 2DFNA 3U6KA 4TYWA 4U02A 3VMFA 3WNBA 2WMOB 3BS4A 3RHFA 2C9CA 3LA6A 5BN5A 3IDQA 2I1VB 1KK3A 3LLUA 4QXAA 3BB4A 1F3OA 2ZXUA 2AK3A 3OAAD 1SGWA 1G16A 1W7AA 2OFOA 3ZVNA 4WA7A 4WZBE 3DM9B 3HDTA 2ZSEA 1NP6A 1UKYA 1VIAA 4DUGA 3AVYA 4LHYA 4LUCA 1DG3A 2IS4A 1T6NA 1CR0A 1KDTA 1TPZA 1KK0A 3B85A 5A5GA 1CULC 2LKCA 2ZRKA 1L4YA 4EQ6B 5JLJA 2O8BA 1OXVA 3RSLA 2J7KA 4TLBA 2X8AA 3SJCA 3UWKA 3A1TA 3P4YA 4B3GA 1E2KA 1Z07A 1GKIA 3B78A 3NH9A 2ZPTX 2WM9B 3K1JA 4JYCA 2VHQA 2OFXA 2Q9CA 4Y0AA 4WW0A 1W0JA 2G1JA 1XU4A 1HT1E 2FSFA 4MRRA 4WBSA 4DKXA 1P7CA 1S9HA 3FKSD 1EFRD 2OCBA 2RGNC 1ZU4A 4PHTA 5DGXA 2D62A 5JRJA 5CDFE 1ZM2A 1TNDA 5KNCA 2DY1A 1XJ0A 5G41A 3NEJA 2BEJA 3KX2A 4F38A 2CNWA 2BMEA 2RGNA 4KVAA 4LSGA 5HPYB 4I1UA 1AGRA 2ZJYA 4GMXA 4TLDA 4A6PA 1BYIA 4NZYA 2GZAA 3EIQA 1GVNB 4Q4AA 3A8TA 2HYDA 5G53C 3RC3A 1WQ1R 4DEYA 4PC3A 2XJ4A 3MD0A 2QGZA 3P26A 4PFSA 2IWHA 3QKUA 4DLWA 4X8OA 3PQCA 1QBKC 1J70A 2BM0A 2C9OA 3PFIA 4L5BA 4OHVA 4MGYR 5JS8A 3FKQA 3T1VA 2JLXA 2Q0HA 2REXB 4JBYA 4WOPA 3CIOA 2YINC 4PQRA 2PT5A 3TW4A 2JDID 1XXHA 3IHLA 1DAFA 2WHXA 1S2MA 3FVQA 3QVUA 2KSQA 1CJMA 3B6EA 1E4YA 3CH4B 3KKQA 3LBIA 5FPYA 3RABA 4LJ5A 4YMUA 2REBA 3KQNA 1OXUA 3VAAA 4QJ3A 4PHFA 4AYWA 3EA0A 3I5YA 2O0JA 1ZVQA 3X1YA 4Q66C 1KO7A 3GLGA 1E9FA 1G41A 4KFRA 4Q01A 2ZSAA 2O8DA 2C96A 1BH2A 5AJXA 2QP4A 3QEOA 1UDXA 4JBWA 3A36A 2R8RA 2ZJ8A 1XXHE 3D31A 3LV8A 3B1ZA 2NPFA 2ZI9A 6Q21A 2GRJA 4PSKA 2R6CA 1OB2A 1KI6B 2RGEA 4JVLA 1E2PA 3OZXA 5DN6D 4G01B 4G3XA 4IDHA 3IIKA 2FU5C 5L3VA 1A82A 2J0UA 3RRMA 2BEKA 2OXCA 2W0MA 2BCJQ 1DE0A 2R62A 1FX0A 4IJMA 1W4CA 2BV3A 4TN1A 4V02A 2WPDA 2BDTA 1N5KA 3GLHE 1MO5A 2ZS8A 4A0HA 2P67A 2P3SA 3IQXA 3DKVA 4MDFA 2YJTD 4A2QA 3PG5A 1ZJ6A 1G7CA 4XWAA 1QG2A 3EWSA 5JHGB 5SZIA 1FUKA 1II9A 2IYRA 3EPHA 5FTKA 3KKOA 3V4RA 4DCNA 1KI6A 3AKEA 3RLFA 4BWYA 1M2OB 1JNYA 2WJGA 4DZZA 2FOLA 4DLUA 2CCJA 1KSHA 1E9CA 1U0HC 1VYTA 2Y8EA 3K53A 4QFMA 221PA 4FCVA 3GEIA 4E03A 3L0OA 1F60A 1SVLA 4AYXA 5J4KA 1J8YF 3WMGA 5FL7A 3NH6A 1J90A 3OIYA 2ZI5A 4LJ4A 2CLCX 1Y63A 3CR8A 3K0FB 2XB4A 2WPDD 2P6NA 4ACBA 1E4VA 2H57A 4OHXA 4P4UA 3MWLA 4Q4LA 1AZTA 5IDVA 4A4DA 4L4UA 2GEVA 1U8AA 2IYYA 2FGJA 2IXEA 1NLZA 2B8TA 3LBNA 2AWOA 4GZLA 3TNFA 4FWTA 4PC7A 5D3MA 4QNMA 2IF0A 2QBYA 3U7GA 4Q47A 1Z8FA 3V00A 1G4UR 5DI9A 1E1RA 3QOFA 2ZRCA 4BFXA 2O8FA 1DAKA 1SXJA 4IEEA 3GQBA 4JZKA 4F4JA 3OFNA 4D4MA 1YQTA 2ZJOA 1CLUA 1HYQA 5F9FA 1AZSC 1VG9B 2XEXA 1KZGB 2ZU6A 2CK3A 4OK5A 5GADl 3D7MA 1XF9A 2BWJA 1KO8A 1Z29A 4OL0A 4DVGA 2FPLA 3HYTA 1R5NA 1AKYA 2D4HA 4DLYA 4QGGA 2JATA 2YWGA 2FFHA 4Q7LA 3O8CA 3ADDA 3CX7A 4PPFA 4W9MC 2QU8A 3NG1A 1LFDB 2ZRMA 5LPNA 1DO2A 1E0SA 2IYSA 2CHGA 4EAQA 4HAUA 2A9KA 3KJIA 1LY1A 1TUIA 3LQQA 3TVDA 4QG7A 4URYR 4ZCMA 4W5WA 1WP9A 4JBXA 1KSGA 4GT1A 1RZ3A 5H68A 1O87A 1E1RD 1D8TA 4AKHA 4ASUD 2XNSA 1N5JA 3EZ6A 1UF9A 1LF0A 2FMXA 3LXXA 2ERXA 4NL4H 4RFVA 4HLUA 5FOTA 2XTZA 4M1TA 1HV8A 4C0AC 2H7VA 4B33A 3G5UA 1RC8A 2ZRPA 4HAVA 3QPUA 3SHWA 1S0UA 3B8HA 2JDIA 3Q85A 3K9LA 3FB4A 1IXRC 2W2VA 1U90A 1X1SA 2IYQA 4MA4A 4B75A 2R2AA 2PMKA 1KI3A 2KI5A 1US8B 3EG5A 3SJAA 1NF3A 3U5ZB 4EDHA 1II8B 2RGXA 4URVR 1NMXA 4OHZA 1M7GA 1EWRA 5IK2A 5CB6A 5KU1A 4JIMA 5AR1A 1YR6A 4A2PA 4QGFA 4R71A 4F4IA 4KBFA 4LJYA 2UVQA 1E2IA 1S96A 5DE3A 3U3RA 2H92A 2ODEA 3TJZA 2R6DA 2XOKA 5FI0B 2PCJA 4B6FA 1IJEA 4DLTA 2ATXA 2JCSA 3BOSA 3RAPR 1EG7A 3NTUA 4EPTA 1SULA 4NYMQ 3GD7A 1US8A 3OESA 1WRBA 2WJJA 2XX3A 4URUR 3VX3A 4BASA 4B73A 1QHYA 2FGKA 1Y3AA 3K9GA 4YXWA 4HDOB 3FMOB 2P65A 2IHYA 5L3RA 1BS1A 1UFQA 3DVLA 1MO3A 3NHBA 2QORA 2WWIA 3NBZC 1NBMD 3SFVA 4CVNA 2GJAA 1RIFA 1AS2A 1NN1A 1T9HA 4KO8A 2VF7A 4RVCA 1JJ7A 5BW8A 4Q7JB 2H16A 2QPTA 2IYLD 2QQEA 5IK2D 1WBBA 4JLBA 2CE7A 2PLFA 4E09A 2X2EA 3AVPA 3ND8A 3WRYC 3C15C 3JVUA 3LFUA 5HE8A 1CJVC 3K0AA 2G77B 1FFHA 3W6OA 2JAQA 4LBWA 4M9ZA 3SBDA 4ARZB 1NVXQ 1RYFA 1GRQA 2ZR7A 4Q1AA 5JS7A 2NO6A 3QG5A 4MKGA 2IUTA 4URWR 3SYNA 4Q19A 3I62A 2FG5A 2A5JA 2ZE7A 1JXOA 1E2DA 4TYPA 4A92A 1WBDA 3AUYA 1QHGA 3CUEF 4MYHA 4WZ6A 3L0IB 1KO4A 3AVUA 4LJAA 5FUVA 2Z43A 5GVSA 3SN6A 4EJSA 2A2ZA 4KI0A 1GRNA 2W2XA 1KMHA 4LHVA 4EPVA 4RCZA 4EPXA 1E2NA 3JZMA 5JCZA 3SJBA 4BZQA 4QBGB 3UK6A 1GNRA 4OI4A 1TL7C 3NDBB 3JZAA 3K09A 3UMRA 5BYKA 4D26A 4RD1A 2JEOA 1Z5ZA 5JCPA 3M0EA 2G0TA 1G8FA 4TMZA 2V4ZA 4D4LA 1RE0A 2ONJA 1HE8B 3UIEA 3O8DA 2IXGA 4DWJA 2VL7A 2Q3HA 2OUKA 5KPJA 4EFNA 2GHIA 2Z0MA 4HLUC 4LJ7A 1D2EA 4P0TA 2W00A 3HR8A 1KMHB 4BQSA 4M9SA 3QKRA 3IEUA 1X8JA 3W90A 4IXNA 4OI0A 4CEHA 5CITA 3GJ0A 4F92B 1F5NA 1NNEA 1QVAA 2QP3A 3AGPA 2GJ9A 2DWOA 1KDPA 2NZ8A 1WDTA 2CVHA 4JLDA 4EFLA 1CJUC 3TW8B 4GOKA 3RRYA 1UBEA 2ORIA 4DIEA 4AKGA 1D6JA 5KDLA 4G1UC 5TB5A 4TZ6A 4QHYA 3EASA 5JFGA 1OH7A 1LNZA 2W0SA 2F1JA 4LV5B 4DB2A 4DUGD 1E0AA 2GVZC 1CTQA 1R2QA 2VH5R 3SEAA 5A4JA 3EPLA 3BGWA 3REFA 1EFCA 1XCPA 5KNDA 2YKGA 4XSGA 5L8VA 2GF9A 2VSFA 4TYNA 4DLRA 1IHUA 4OHYA 1IAQA 2WIAA 2O8BB 2JLQA 1XNJA 1Q57A 4PPQA 4ON9A 1P75A 4YMSA 1NBMA 2YOFA 2VSXA 3H0KA 4KAXA 4L9SA 4TLEA 2FPKA 2FDCA 2CLDX 4FMCF 2PBRA 1GG2A 3AF2A 3KKNA 4PZYA 4LHXA 1AQUA 1E96A 4NYMR 4Q7MB 3K8YA 3CF0A 1H8EA 1XJQA 1IN8A 4UXJA 1W36B 1FTNA 3GJXC 1GUAA 2H17A 3LXRA 3RSOA 4EPWA 4AI6A 2IEZA 3CH5A 2C95A 1E9EA 2WWWA 5TXGA 1KNXA 1S9DA 3EXAA 1N6KA 4M21A 3W6PA 1DPFA 3GLFE 3W8RA 2JLRA 4JT4A 4P4TA 2WWXA 3AGQA 4ABYA 4P4SB 1GZSA 1WCV1 3M1IA 2EQBA 4AK9A 3WNCA 3E1SA 1QHXA 3PUXA 3TRFA 1W4RA 1DAMA 4C0BA 1E2LA 3QXHA 5E3HA 1AQYA 1YZTA 5EE0A 2AXNA 2C77A 4GPTA 2CLSA 1TADA 4Q21A 3DO6A 2GCNA 3OE7D 5AJYA 1HEIA 1MRSA 1V43A 2XAUA 3QNUA 1ZRHA 2RGAA 3BE4A 2D2FA 4GZMA 4I4LA 4XJXA 5B58C 4W7SA 1R10A 5FBLB 4B76A 1KSFX 3L82B 3EZ2A 4MYTA 3LDAA 4O2LA 2E87A 4UNNA 4TQUS 1ZUNB 1IBRA 4F93B 2XSZA 1ZNZA 4DBLC 2NO9A 1U9IC 2PZGA 3GLGB 1MR3F 2JIZD 1XP8A 2SHKA 3DMDA 3TE6A 2ZSBA 4PXAA 4NP6A 3X1XA 4D6PA 4LJ9A 1E79D 1ZIOA 2BJWA 4JSYA 3RWOA 4BGDA 1E32A 4ZCIA 5JWOA 1ZM7A 1KZ7B 2W6IA 1ZW6A 3AF3A 2BM1A 1OYWA 1AGPA 4I99A 1OLOA 2XTMA 4FMDB 1AJEA 2PX3A 4HLDA 3VNUA 3WYGA 1Z22A 5CIQA 5JI3E 2GAAA 3GLGE 3Q7PA 1PLLA 2I3BA 3RS4A 2WV9A 5JSZA 2RB4A 4RZ3A 4I1VA 3X2SA 3LVRE 2OHFA 1NVVR 4XD7A 2QPOA 1SHZA 1Z0AA 5DI3A 1DOAA 2WJHA 4LDJA 1VDZA 4XVUA 1ZP6A 5G3YA 2F43A 2IL1A 2ZI7A 2IS1A 3TSWA 4YMWA 4UNSA 4RD0A 2QEQA 4G5GA 4D4JA 5FR1A 2Z4RA 2VA8A 4GOJA 4IEIA 3KJEA 1WE2A 1G7SA 5JHHB 1EESA 4DEXA 2V6IA 1U0JA 2IS6A 5L3QB 1TF2A 4JT2A 4Q4HB 1JEDA 3PXGA 4BLQA 3BB3A 4RCYA 2YV5A 3PV0A 2JJ2A 2NQ2C 4MYCA 3V9PA 4C7OB 1NI3A 2FE4A 3RS0A 3C16C 5JSZB 2D7CA 1DAHA 2VYFA 3OEED 1W2HA 2YOHA 5IT5A 1OT3A 5GVRA 1OV4A 2GJSA 4A9AA 2OBMA 1N6RA 1HY3A 2YZ2A 5FL7D 1P62B 2RH5A 3FE2A 3S1AB 5DI3B 3B1VA 2F43B 3U60B 3PEVA 3B1XA 1ZD8A 4KITB 2FA9A 4FMCB 5K8LA 1A4RA 4PTLA 1OHHD 3MWKA 4B35A 3CRVA 2ZRHA 4CGZA 2ZI4A 4KCGA 2CNWD 2LKDA 2OBNA 2YNMA 4PQFA 1LF5A 3TQCA 5L3QA 4DCSA 1BO6A 1W4BA 5D3MB 1P2TA 4KLNA 4WXRA 2VP2A 1I2MA 2C03A 1KIMA 3CNNA 2VSOA 3ZLJA 4PAQA 1AK2A 2BC9A 2H8KA 5KOYA 2QRZA 5FOXA 1MRNA 4YLGA 5HZHA 1EFHA 1WB9A 1Z6GA 3PJRA 3IPXA 1Z6XA 1Z6TA 4IOLA 3RRZA 1PZNA 4C0QC 1OJLA 1VCOA 2ZRIA 4JLMA 1VHLA 4O2RA 2W2TA 5TVKA 1IQPA 2J41A 2ZSFA 4R2HA 3RS5A 1UKZA 3FFAA 421PA 3RRNA 4DCVA 4XH9B 1Q12A 3KQLA 4MRVA 1Z6AA 1SKYB 1OFIA 4RD2A 1G8YA 3A6PC 4QBIA 2WTUA 5HCIA 2RKOA 3DKPA 3P32A 5B2ZA 3AKDA 1RPZA 3DPUA 4KBGA 5IHPA 4X8HA 1GNQA 1CS4C 3RS2A 3Q9LA 1R4AA 2OCYC 3ZYCA 2OCPA 3E2IA 3PUVA 2A5DA 1P2UA 4NMMA 4B3XA 2OFWA 1KY2A 2ZRJA 4DLXA 4G0NA 4A1FA 3CBQA 2GDJA 1P61B 4V0KA 5FPKA 2PEYA 2DFTA 2V7QD 3T1TA 2WSSA 2QSZA 4UNQA 3T15A 2IBMA 4AG6A 1TF5A 4HYYA 1OKKA 3UMFA 4GP6A 4GP7A 1BYUA 2ZEJA 1ZINA 1NRJB 3K9NA 3C7KA 4EPYA 3I8XA 2VHTA 3D8BA 1VIYA 3FFBA 5FTJA 5HZKA 3VR5A 2NO0A 2HEIA 3CWZA 1PVOA 5FH9A 3F8TA 1OYYA 5G3ZA 2ZIAA 3OIWA 4BE7B 1KJYA 3GJ5A 4TSFA 2F3RA 3KXKA 1XZPA 1CRQA 2NO1A 2QTVB 3KZ1E 4Q02A 1F6BA 4QBHA 3T1OA 2W6ID 4UJ5A 3EPJA 2ZRFA 4XWOA 4BFUA 1GKUB 1OFTA 3K0CA 2GZHA 4HZUA 1GOTA 4ERNA 1R8QA 1G5RA 3GPLA 2EFDB 1TAGA 1J2JA 3KDSE 5F98A 2G6BA 3E70C 3U6BA 1JB1A 2GXAA 1KK1A 2WAYA 3GLFB 4JL6A 2FFQA 5F2EA 2ZSDA 4FINA 1ZM3A 4OJQA 2Z83A 4BEBA 1GL6A 2QA5A 2G1KA 2ZTSA 1Z06A 3I4LA 2V8OA 3QF4A 3WHKA 4Z1MD 4DDTA 3CX8A 1RRCA 4QRHA 2IT1A 2HJVA 3U3JA 3VKWA 3B1WA 5AUPB 4M2LA 2DCUA 1L2TA 1CXZA 4OQFA 3T35A 4HZUB 3WMEA 1A2BA 3BD9A 3WP0A 1EXMA 1N3BA 1VMAA 2GBLC 3ZS9A 4D4KA 5KDDA 1JR3A 4QJ5A 4HUQB 2QAGC 3BFKA 2HT6A 5LD2C 4GRAA 1ZCBA 5AK0A 1XX6A 3PUZA 1RFLA 1ZUHA 1UEIA 3K70D 4IVRA 1L7VC
chains in the Genus database with same CATH superfamily
5EWLA 1CUFA 3ETEA 5IF3A 2R00A 4DRZA 3PUWA 4PBRA 3SX2A 2G5TA 2WAOA 4ZPXA 1FQJA 4QWWA 2Z1NA 4CEIB 4F5YA 3W5JA 1NKSA 3VOBA 2F8LA 3WRXC 2ZRBA 1TK9A 4TRMA 3FTFA 5E6SA 3M81A 1GAWA 2KWIA 4KHPB 2IVZA 1J39A 5C5EA 1HNXB 2HWKA 3HZZA 2C2XA 2BFDB 3OM9A 1J0EA 2CC2A 3ZK8A 2MR5A 1Z0IA 3GLIE 2JK1A 2HA4A 1S1CA 1UWKA 1BGVA 5T4EA 3WRYA 1NW9B 4UVDA 2AI1A 5BSEA 5LOVB 1UWLA 4FCTA 4IICA 2WFMA 1IMOA 3QEMB 1R50A 1EE9A 1QTNA 4CKBB 3W2TA 5KOHA 3SSMA 1FFWA 1L3IA 5EFZA 3BMCB 3WLSA 3R0VA 1X14A 1L5HB 3OLZA 1NG1A 2CJXA 2C8VA 2ODBA 1E9BA 1RI2A 2C04A 2QLJA 5GONF 2PJRA 2W6PA 1E8NA 1IG0A 3SJ7A 4M1MA 3FGOA 4JX8A 3GLIA 4LWZA 4UFPA 4PYMA 2AMYA 4X1IB 3CPHA 1YA4A 4EW1A 4YYEA 2PH1A 2FN7A 3B6ZA 4B8WA 5LP6A 4OHWA 1W36D 1A2OA 3CX6A 2K6GA 3HCCA 3HDGA 3NEAA 5MFZA 4YDQA 1M2WA 2ZIZA 3FPAA 3NC4A 4LE1A 4ZYVA 1T5IA 3L5KA 2CVZA 1MDFA 2P0EA 2TSYB 4C04A 2FPXA 3LQFA 4GBED 3JYLA 3MWYW 3QYFA 1DKRA 3DDCA 2F1HA 1Z6ZA 1P17A 2CKDA 5GY7A 3VNVA 4XX0B 3QUSA 1UFOA 4QTYA 3OIFA 4C6RA 4PTZA 4BB5A 3FBGA 2P1RA 1PLJA 4D8YA 1Q15A 1P6UA 2GBIA 3KLNA 4YMVA 2ZE6A 4HYTA 5KOIA 2GXSA 5HNKA 1EFLA 2CW5A 5FNVF 5LLTA 5CLFA 2UYCA 3UC9A 2VP0A 5I7VA 1NIPA 4GD3Q 1Z3IX 4PC6A 3N87A 5EMLA 2NU7A 5FBWB 3H6GA 4X1YB 2QMUA 2DTDA 2O1EA 2WWGA 5FOUA 3BKXA 2OK8A 3UCEA 2H48A 3KWMA 3KLOA 2ZYTX 3GJ7A 5ALMA 5HE9A 1CU1A 4RDCA 2VHZA 2FP4B 5A3SA 4W7HA 5HA5A 4J7UA 1N4DA 2C5BA 3EZFA 1R27A 1U11A 3PI7A 3WYFA 3NHYA 4MP6A 4QASA 4A8TA 3N7AA 2PSHA 5IJ9A 4FCWA 4MVJM 3DMFA 3WLOA 2WSBA 1R6BX 4DKJA 3L01A 3N8IA 4NFLA 3TLKA 4DR4B 3HU5A 2EW1A 2FXIA 3GA7A 1E2FA 4PVDA 2CLLB 3FDIA 4RAOA 4RKFA 1QB8A 4TMTA 3WLRA 2GH1A 3I2GA 2ZAOA 3DE4X 3C6MA 3LQKA 3VU3A 2AKAB 4KRGA 3DLAA 1TK3A 3VQTA 4Q3EA 3ICQB 2YMPA 5AI5A 1T8YA 2J0VA 5JEEA 5EZYF 5FF9A 2RHHA 4WN9A 3DGFC 3GO4A 3ZBTA 2NV0A 3GRCA 3NX4A 4B83A 4D3XA 1FFDA 5G0TA 2MIIA 2H5EA 3EH1A 5AW4A 5K0FA 4RTSA 3F6CA 2A5YB 5KTTA 1YE3A 4JU9A 1V5GA 1R0WA 2HCTA 2QAIA 3IJRA 3R3VA 3IRVA 5AD1A 5TQ0A 4EO4A 2A4MA 1OBCA 1ZGBA 2JFPA 2AX4A 2HPVA 3EGEA 3RREA 1DELA 1PWZA 3Q7SA 3RWMB 3NPAA 4C20A 2AG6A 3QV1A 2L18A 3I0MA 3KIPA 3PYXA 3Q3EA 4LOKA 3U4CA 3B7GA 1SUAA 1SQGA 1VBFA 3THSA 3T34A 1SC9A 2I3GA 2N42A 3ED1A 5HQTA 3OLXA 4HEJA 3SGLA 1JECA 3F98A 2FN4A 3IMGA 2GZDA 2XQGA 4EL0A 3CEAA 5FA8A 4OOEA 3L6CA 4PBTA 3ZLTA 2R1VB 4M46A 3QKTA 5H3HA 3RYHB 4JEIA 4CCYB 3KT8A 1L5ZA 1T2EA 3VISA 1T1IA 3X44A 2W8BB 4IH1A 1KYQA 4WADA 3ZGNA 1U3TA 4AS1A 1AQ6A 4Q0MA 1N2EA 5KSPA 2IYEA 4H0CA 1Z73A 2O8CB 2FVYA 4OL9A 2CUTA 4K40A 1D5CA 2CL0X 1L5YA 2ISCA 4DPMA 5CFNA 1QOQB 2GETA 1OH6A 3GN1A 3Q15C 1NSFA 1IK4A 1CZLA 1NW6A 1TO6A 1QGOA 5KDOA 4Q39A 2ZSKA 3KOUA 2OV4A 4GR4A 5HS6A 4II2A 3NRCA 1WB4A 4M38A 3KK0A 3T9BA 4K9KA 3TTTA 3NRBA 4TLCA 3F7MA 4ZOBA 2E7ZA 1X3SA 3BQ9A 4CGYA 1YBMA 4G4IA 1CF4A 2BHSA 3CPSA 3MT7A 5KYKA 4Q9AA 4K6HA 1E6WA 3U56A 1JWBB 1Y3BE 4JFAA 4HAWA 3GAAA 6REQA 1S2OA 1WXHA 2GLTA 3FNHA 4QYIB 2MYNA 5A05A 2ACWA 2CSUA 4EUNA 5LZ9A 3VYWA 4RTKA 1XHLA 2IHNA 3I6MA 1NATA 1PWHA 4MW9A 2XWJI 1D2GA 3HKDB 4JGGA 4RGBA 4QU5A 5TS3A 2WQ7A 1ZNXA 3WK7A 1C0PA 1M9NA 4Z8YA 1K92A 1FTWA 3FLBA 4IDQA 4IHAA 2UXCB 1XRNA 3GRAA 1EJ2A 3KZNA 3O38A 4OK3A 3AHJA 1JQLB 3N2IA 2Y68A 2WM2A 3P96A 2CJPA 3Q7QA 4BMOB 1LH0A 3AETB 3PT5A 3ZWYA 2FJUA 4GQBA 4BVFA 4A73A 2GWHA 3M1YA 1YO6A 5C1IA 3KALA 2YQZA 1D03A 1R0KA 4UTZA 2O8EB 2OBBA 3ZGLA 3PYMA 3K2BA 1K6IA 1NMYA 2CD9A 2XT6A 4WCFB 1OCEA 2BFAA 1PUIA 2YY5A 4NC9A 1P29A 2VRWA 3ZU3A 3KOOA 1FFEA 1HT2E 2F3TA 1T5TA 1PYOA 2VJMB 2A84A 4AECA 4CM8A 3W4JA 4Z1OA 4RVOA 4KHZA 3C3MA 1A9QA 1ZIPA 3GRUA 4PPFA 2CJYA 4OH1A 1AKTA 5EEHA 3BMOA 4C0HA 4HWRA 5EZYB 2NU8A 3O90A 4KJZA 3I61A 3X1KA 1ECLA 1SMKA 3R4VA 1YZLA 4Z5XA 2ZWMA 3GEHA 4UJ3A 5CBPA 1T24A 1E9SA 2P5UA 4IJQA 3KEMA 2HI0A 3KD2A 4DC9A 5F4ZA 1JAHA 4H7DA 4JOBA 2PMBA 4P34A 5LLDA 2H4YA 2ONKA 1JA1A 1ZCJA 1OGYA 1AGNA 3B3JA 5H59A 3D6UA 5M29A 4BLRA 2OAP1 2PGDA 2VJBA 4Y6LA 4B2PA 4MUKA 1XU7A 1ZMRA 3ZKWB 2P6MA 4OHUA 1NBAA 2QLBA 4LBYA 1BFDA 3MB8A 1IEVA 3NVAA 2FKNA 5AI9A 2WIBA 1KWKA 4NQRA 2IRWA 5I7HA 2VK8A 3GNTA 1T0HB 4TRNA 1KDVA 3TFWA 4AN1A 3CVXA 2C2HA 3QUAA 4U39A 1H2XA 2N46A 1WETA 4LDNA 4WZBA 1YQUA 2CFTA 3BTUA 3LCUA 3AIIA 1Q1ZA 3LLMA 4MEBA 4ZALA 4NMHA 2YHIB 1A50B 2BTQA 4AY2A 4XPIB 4LVOA 1ODFA 1HMPA 4F2HA 5E8JA 3VR4A 4YRDA 3CINA 4BRWA 4RZUA 1MGOA 3ILYA 3STXA 1H4QA 2AI3A 1C4OA 2WZQA 5KJEA 3P9CA 3MA0A 3KUCA 1A9PA 2XQJA 1DXOA 4EHKA 1P60A 3RSHA 4DG5A 4TMXA 3G13A 1CIPA 3B9PA 3THWB 1A5AB 1QGYA 3OG9A 3IAUA 3QWBA 4BY9E 1KEWA 1MJGM 2FV8A 2LCFA 4CQMD 3QPDA 4K0KB 4RHXA 4K6CA 3CLTD 3N7UA 4CIBA 3RYTC 1QF7A 1XEXA 1P6QA 3EXFA 4XFKA 5BQOA 1FNMA 1QLWA 1XAIA 1SVIA 4L3WA 1U04A 3ORHA 4RGVA 2PCLA 5E7JA 2YHIA 4JXKA 2WIDA 4RELA 2OYRA 4NFHA 4EOGA 5E9AA 3KKPA 1EWQA 3U1VA 1RWVA 2FQ1A 1P7WA 4ILKA 3TUJC 5BQ5A 1JXQA 2H1VA 1PQ4A 3OHPA 5UKDA 2VA9A 2I1QA 4D81A 2QT0A 4PS1A 3DFMA 1TVMA 4DLVA 1U2DC 2X6QA 1G66A 1QUEA 2MMCA 4ZEMA 4NPHA 1GPWB 5L45A 2WKPA 1Y4DE 4MXDA 2Z6AA 1E98A 2P9YA 3ZY5A 2CBZA 2P2LA 3IJ5A 2J5XA 1FS6A 1BHO1 4FUQA 1RS0A 4CDGA 1CETA 2PXCA 1Y1LA 2RBGA 1QRDA 1J09A 4FZ3A 3IO5A 4B3IA 2W2OA 3HLKA 4AICA 8ADHA 5I51A 5ICMA 5NULA 4F4DA 4N5MA 2AK2A 3C3PA 3OFSA 4ZI2A 1JIIA 3OF5A 3AZOA 2WA2A 3THYB 4R7GA 3FCAA 1XWWA 4XDYA 5HFAA 4ETIA 4Y7CA 2BSQA 4AYWA 2MMGA 4K87A 4CM6A 2I4RA 3AV0B 2NUBA 3GZNA 1NI4A 1RMQA 2XZPA 3COSA 1MB9A 4H60A 3ADOA 4B2LA 4AVYA 2RHDA 4Q3AA 2DUMA 5JASA 3FHOA 5C3UA 4PF1A 2I03A 2SBTA 4IKPA 2R6AA 5A6SA 4YQEA 3E9EA 1TGYA 1VECA 2ADOA 2HXYA 1H6DA 1JQJC 2V9PA 2PT9A 3DD5A 3DONA 3VH4A 3OOJA 1FBNA 3A4TA 3TAHA 4EHDA 3COZA 4FDLA 1V7QA 2PZFA 3JQBC 2ZGVA 4WINA 1NY6A 1WOYA 2HU2A 3UXEA 5F9HA 2GT1A 3CT6A 1J24A 1QHHA 3NM5A 3H11B 4M1OA 1VKOA 4JHXA 5EYPB 1JQEA 1FMCA 3MB5A 4Q1EA 3R6GA 5WRFA 4F86A 4MARA 2Q6VA 3PS9A 1VMDA 1MC8A 4CCWA 4RKQA 1M67A 4NH0A 4DTCA 3MF4A 1F0PA 2HRRA 4MVJP 4LCBA 2ZTVA 4OFZA 4WCFC 4LSWA 5DFAA 2QTNA 2RJOA 4FNGA 3R7LA 1NNI1 1QRSA 1GN8A 3M4ZA 4DWWA 1TA9A 4OQQA 3I1JA 4KSBA 4B3JA 1SHKA 2C9BA 3P9YA 4XRGA 4M0CA 4E5SA 1TM7E 1ADYA 4DLSA 5E1MA 3MXOA 3OHSX 1VJDA 3R23A 4FR2A 5AOAA 1FRZA 1RHUA 5H9WA 1GTSA 3C87A 5FJJA 2OLJA 3OEEA 5CLJA 1TUBA 4QTTB 1T2FA 4R81A 4EMBA 1XAHA 3P8ZA 3PQDA 4C30A 2C8LA 1LZLA 1Z74A 3JQQA 3LXMA 1TVKB 4RIHA 3ROTA 2E1PA 4DQVA 5FORA 3R5XA 4AJHA 4FPXA 2PH7A 3D2LA 5CR9A 3FETA 5CB0A 1CQIA 1IY0A 1OOEA 4NQZA 4UBOA 2VEOA 1J00A 4ROTA 4Y2PA 3TZHA 3RVDA 2ATEA 1WXEA 2FUKA 1PJRA 3UGTA 4I3FA 5A9RA 5LBUA 2X3YA 4CLXA 3KQMA 4R5HA 2BDEA 1ZU5A 3R74A 1JE1A 3PNLA 5ELMA 1N2OA 2WJVA 3U62A 4NBLA 3QITA 2XCOA 3HGTA 3I5MA 5HGJA 3NS7A 1FMLA 2UZ3A 3IOCA 4BCDA 1A5BB 1W49A 2BH9A 2RD2A 2GEFA 1F9EA 5T41A 2PUTA 3VHXA 2CJWB 3PWKA 3PX2A 1Q7EA 2NU9B 4KYTA 1V37A 1XTJA 2IZ0A 3ANMA 4J7XA 1WHTA 2Z08A 1HL3A 3JQFC 4E5UA 2IWRA 1AKEA 2VAPA 4MOWA 1NVUQ 2CMKA 3LQYA 1TVKA 4UBNA 5FTWA 1U63A 5BYAA 4O4IF 4QXOA 3TQTA 2PR2A 3B2EA 1A8HA 1YZYA 3AUSA 4N65A 3ZK7A 3A6JA 1YZUA 3G0HA 1P5RA 2DT8A 2YS6A 3Q3HA 1K0FA 1XA0A 4I5DA 3WI7A 2Z2XA 5B7PA 4DRXB 4XI9A 3O26A 2PKYX 3DUFA 2EL7A 3R09A 4F71A 4YFVA 1UT5A 3JD3A 1NLYA 2QL5A 2V59A 4BMPB 4KXVA 2Y1XA 3K16A 2BONA 3CH6A 2NU7B 2WHRA 2ONCA 4UVHA 2XB2A 4EX7A 3MS2A 5M5BA 1F4LA 1U3FA 2OHXA 5DB4A 3KHTA 3LGAA 2ZRGA 1DQSA 2KM1A 3TAUA 3G0DA 1ML4A 2K5UA 3CZ5A 5JYBA 4LDAA 3T41A 5KYGA 4K9MA 1RAHA 4GFDA 5KMGA 1PR4A 5K03A 2R0QC 1ODLA 2YMMA 3U7EB 3EMDA 4G0WA 1KJNA 3WLHA 5IJ9B 2CXUA 3W1EA 1SK9A 1RDFA 1JPVA 1KJJA 2H1RA 1Z0FA 2B69A 2O8CA 4G84A 4RL6A 2EOAA 4FYXA 2R47A 4U6NA 5LFAA 1KE1A 3P4XA 3FCYA 3FMFA 3EJWA 4MRMB 521PA 5KVSA 4TMVA 2OLKA 3STWA 2CXNA 2GD1O 3Q1KA 2JFGA 4JLAA 2O6HA 2BMJA 4R01A 3VM6A 4RVFA 1IXYA 2EBWA 2PYZA 1FJ2A 5J2TA 2NWQA 5A02A 2XMCA 4IMPA 2DPXA 3RC8A 2GXUA 2EIXA 2BTEA 1W46A 4RXMA 4DJDC 1TX4B 4O29A 1I32A 4V3BA 4GNKA 1C3OA 2VAXA 4IQ0A 4R3NA 1XOIA 2GK7A 4OGFA 4F5DA 1CNEA 5C5DA 3AC0A 2PUVA 3L8HA 1PDWA 3I9OA 1FDRA 1UT8A 3HP7A 3LCCA 2QRVA 2XUAA 1X87A 4IDFA 4OU4A 4D43A 2ZWOA 1UP4A 5FB3A 1T8TA 3M8KA 4NABA 3EAGA 3T9CA 5EP2A 1L7DA 2J59A 5EXPA 3GJ6A 1Y82A 4HGNA 1M2VB 3ANSA 1L5RA 2I1WA 3R7BA 1Y34E 4C4SA 5HKOA 4URXR 2R9VA 3WLQA 2OQIA 2QMOA 4I1SA 5BMVA 3LZCA 1EKXA 4HD8A 3FDJA 1U2RA 1VYUA 4U7PB 2WWYA 1LLUA 2CXPA 2DF8A 3IELA 4RV5A 3ST7A 4MO9A 3DMTA 3C43A 3ECSA 4B3CA 4PFJA 5AJWA 1AB6A 2Q3EA 4MGKR 1KY5A 1T25A 2GRAA 2RHGB 3L7NA 4PO3X 5IUKC 5A4MS 1RLMA 1PT5A 2AOTB 3I52A 3HWSA 1NN0A 3GJ4A 3K8QA 4IJVA 4MIYA 4GM1A 1QVRA 4QOEA 5EMJA 4IWYA 4DV2B 1H22A 2BFFB 5KWIA 1J0XO 1FX1A 3IFSA 3GRZA 2V6MA 3TJRA 3GB9A 4JJ8A 3ESCA 4QULA 5CA1A 1ULHA 2ADMA 4V3CA 2ZYSA 1BN6A 3IT0A 2RI1A 3ZHZA 5HKBA 4ZQFA 1QTIA 2MINA 5AI4A 3PJDA 4CIVA 5B30A 3M7IA 1JP7A 3I2KA 4I1PA 3WB1A 1QLHA 3O9VA 1JA9A 4ZCSA 1B4DA 3O8BA 5J1TB 1UPUA 3AVQA 3X1JA 1M2GA 4B4DA 3A7EA 1ZD9A 2W90A 1LTHR 4QOIA 1E7MA 4WZAE 4YAJA 3RANA 3RI3A 5BSFA 3F6BX 1UWCA 4QUHA 2V7PA 5E1OA 1VPLA 5FTLA 1IYZA 1NU6A 1WY7A 1JFFA 4TRJA 1L5LA 1NTOA 2AOTA 4HQFA 5HDBB 1QP7A 3G0OA 4CXMA 5I47A 3IJEB 2QPAA 1UC9A 4GPD1 1FDTA 1G64A 2TS1A 2UYHA 5HCNA 3L1UA 1V26A 4WN3A 3D59A 2HMAA 2GN2A 5A1JA 1SO8A 1YR3A 1TVEA 2QE7D 4EI8A 3HABA 1HFWA 1MENA 3PZRA 2W6OA 1JG6A 2OC4A 3O5AA 5EPOA 4AF7A 1KQGA 1DBWA 1USKA 5IAOA 1IXKA 3HVIA 4QGAA 1HFKA 3SF8A 4O63O 2BMDA 1BC5A 4C0KA 3D1VA 4ZJPA 1JBKA 2YZ7A 3R4CA 2OGWA 2C99A 3PNMA 4C4PA 1XTKA 2DEUA 1FL9A 1ESZA 2HOQA 3H3JA 4M89A 4Q1FA 2BVNA 1GIAA 1J8MF 2QYOA 3SQMA 4F4HA 2ZBQA 1W75A 3DOOA 1G7RA 1Y8QA 4WLOA 5TEVA 3FCUB 3TNJA 2XD9A 1K89A 4LYDA 3ZHVA 2D7DA 4TWAA 2IS2A 3DYBA 3MCWA 4RACA 5CYPA 2QRQA 4LRYA 2PTGA 2JBAB 1YCGA 4GE0A 4NIMA 4BVGA 3T1NA 3MWDB 4II7A 4W5HA 3T38A 2Q9UA 3CM0A 5ALVA 5C7OO 3TF5A 7ABPA 5K0CA 5IJZA 2ZT6A 1ORIA 1Y5RA 2IEIA 4M7RA 1W52X 3RAGA 1W5FA 1E4OA 4RZHA 1KZ4A 4JVMA 4G2TA 1XQ6A 3RJZA 3TQHA 5IAAA 1U2PA 4IW3B 5BYBA 3W4IA 2D8AA 2JLYA 2LZ0A 4BMYA 1Y4UA 2CHQA 2NVBA 2ZZMA 3C7DB 4JSRA 2V54A 4Q9JA 2PO7A 1J99A 5C18A 5AM2A 3CEHA 5B36A 1FRNA 3C1OA 4DBZA 4EG8A 4QFBA 1YTLA 2E4VA 3OY7A 4ZQGA 3RTGA 4B8YA 2J9RA 5TJ9A 2JPDA 2AOXA 3PPWA 5EIHA 2L0XA 3ZDFA 2FRDA 2B6HA 3GMIA 1YQEA 3R8CA 4L08A 4UTPA 1RCTE 3WIVA 2ZIVB 2J3EA 1BXKA 2I7XA 4HTAA 4K81B 1SWVA 4ZVPA 1SRRA 1YBFA 4TWBA 2VF4X 4FYPA 5FNZA 3ZZUA 3ZD7A 1KL7A 4WOCA 5LP6C 3WIBA 4D79A 5JATA 3W5UA 3MLEA 1LPSA 5G1OA 3NDJA 4PYIA 4MITA 5BVHB 1GYPA 4IWNA 2HWUA 1SOUA 1X70A 2HZ7A 1O8CA 1JHMA 3M49A 4M1WA 4QJ4A 4BZXA 2WKWA 3AOGA 3LUPA 4FFPA 3R20A 1EXDA 1ZN9A 3UW3A 2QYSA 1PE0A 3ANTA 3HU2A 4RY2A 3H86A 3DXYA 4LJLA 3ZLBA 4J0HA 4TYYA 5KQMA 5JZMA 3NOXA 2BHLA 3S0JA 4XUGB 1IY1A 1JXMA 1MCZA 4KBYA 1U0SY 1WMBA 4HZGA 3K71B 3TLGB 1TO2E 1D1TA 4YWJA 2ZU0C 3NXKA 3JX9A 6LDHA 3U4IA 3IE2A 3LGXA 4I1OA 3L04A 1O96A 3FSJX 5A7FA 5JO0A 3JATA 1VFPA 5JWRA 1F2VA 2VPZA 1Z0JA 1Z7GA 5K3DA 4ADSG 2DY0A 4X1OA 3RK4A 1Y4AE 2FFJA 2SKEA 3RFXA 5GV7A 4YAFA 4UAGA 5I9NA 1G4AE 2YFKA 1VJGA 2H9YA 4MA0A 3HA5A 1D4FA 2AWNA 3OOWA 4JKOA 4Q3NA 4A03A 5KIAA 3AINA 2IXAA 3D4OA 3D8UA 5JPCA 1UWVA 4HTFB 5FUQA 4LYGA 4GI5A 1EXNA 3KOWA 3DHWC 5KO2A 1UINA 5DYIA 3V33A 5LDDC 4QVIA 1BN7A 1CC1S 3H3FA 2GOYA 3K9HA 1EZ4A 1G3QA 3K0HA 4HAXA 3HL0A 3BVPA 3I1YA 3IO3A 4J2HA 4D74A 1UKBA 1QTRA 4X41A 1ECCA 1WUYA 4XQ0A 1BCSB 1F1BA 3S44A 4O5OA 5AP9A 1JQ3A 2HJ9A 3SSNA 5DGIA 3PENA 1TYCA 3AI2A 3RDPA 2OFFA 5IH7A 3L4SO 3N2LA 3PNSA 3BSWA 3D8RA 1ZOSA 1MEEA 3BQMB 4NOMA 5ALLA 5F3DA 4ZDWA 3NDRA 4GYWA 3W5AA 1L5HA 1QLJA 3I6BA 4V1CI 1WKVA 2L19A 4GU5A 2OSBA 1XD9A 4M86A 4GXQA 3JVEA 5F73A 4EWLA 2V3CC 5FRDA 1EAMA 1VPDA 2D54A 4TWZA 1FDSA 1YIOA 1UOEA 1U7DA 5FWAA 3SNHA 1XKXA 4KE8A 4Q9IA 4Y1RB 1QGUB 4GW3A 3H84A 4ZYLA 4G0QA 4Q4CA 1TMKA 4PE5B 4M9RA 4G25A 1N6LA 3GJ3A 1XI2A 3LOPA 2DX7A 2QTRA 1XT6A 3W9YA 5IN4A 1MU0A 3BRSA 1N2CB 1JG1A 4F3RA 5DMHA 5L3SB 4XD7D 3BBPA 4PANA 2R96A 4PG7A 4MDEA 1MX9A 4MQEB 4P3PA 4ZQBA 1SHLA 5AUQA 5TPZD 4UQOA 1IBLB 1KARA 2H8GA 1YFJA 3JVDA 3LH5A 3KFXA 2XCRB 2VYVD 4YCCA 3HXMA 3PWZA 1HQYE 2A0YA 1GU1A 3GZNB 1VC2A 2P62A 1XCGB 2C8KA 2P1DA 2HV8A 2YDYA 3ETLA 3SEZA 4D3FA 5EJ4A 3ERCA 1N2CE 2IA5A 5HS4A 3NTVA 1QGUA 3CUUA 3QPCA 2NO5A 1JALA 3KYCA 3WR5A 1E92A 1NLUA 2H4WA 1PKEA 4BVLA 2ZREA 3HJBA 3RVPA 3SY8A 1BKDR 3K8ZA 1KJZA 3PGA1 1T3ZA 4ZQEA 4EB8A 2W2MA 4L95C 4L50A 1MDBA 4JBLA 3H9UA 4PQGA 1SOWA 3BCRA 4XSHA 1XYGA 3CO5A 3GJSA 2QM7A 4MRNA 1U7TA 4MR9B 2QM3A 2BFOA 4Z49A 3EXHA 1EEXB 1R0ZA 1QDLB 3JQ8B 2G5GX 3IE0A 4GLOA 2ZSUA 2R85A 2NYRA 1SOVA 2W58A 1E1NA 3CLUC 1ZJZA 3LBAA 5F7ZA 2VATA 4MWBA 4KFUA 4L9WA 1YULA 4MRSA 1QIGA 3E3OA 1UMBB 4MUJA 5LLSA 1USIA 4B4KA 2VPXA 3DUWA 4OSEA 2JAOA 2G72A 2I29A 4QDUA 1CS0B 4CI9A 2C88A 2XH8A 1Z16A 2CL6X 3VYRB 3PUIA 5IJWA 4ALLA 3CXUA 2G1AA 1V11B 1EVYA 1YIDA 4JSTA 1VB3A 4Y18A 3ZNPA 3L8FA 2WIGA 1BJRE 3S2SA 2VPQA 4YX9A 1PWYE 3ZIUA 5LMCA 2FLVA 5THQA 1SVSA 3B53X 3OZSA 1L9XA 3V8NA 1GG8A 3MMXA 3ZNOA 3UWSA 1AG9A 1WCIB 3SIPA 5IABA 3AEZA 1G55A 5KYWB 1RQXA 5BSTA 4J4BA 1Q7GA 4WCVA 2OCIA 1OD6A 1SHTX 2O7VA 2ZT7A 3KQYA 4IOJA 5EGNA 3JAKA 3QBVA 1IWPB 1I2DA 2H9IA 3LX5A 1BNCA 1O94A 1V5WA 2Q2WA 3LS2A 4BFTA 4CV2A 3AVXA 1S2GA 4Y8VA 3PICA 1ZAKA 4P92A 4DSTA 5BRNA 2PANA 2V58A 3AM1A 2CVQA 3GZ4A 1LPBB 4N40A 3DL0A 3Q0TA 3K7EA 2YN0A 2OGSA 2XJ9A 4UM9B 3K2QA 2NU9A 3O4RA 4HDKA 3JU3A 1VDMA 3PPYA 1DPGA 1ML3A 3FMIA 2YMQA 3A2MA 1O95A 2EWVA 3I04A 4MULA 5F3RA 3SI7A 3T6KA 2ZYWX 5JNWA 5BXQC 1H6AA 3ONNA 5AWFC 3QM1A 4ZZ1A 1OILA 4K3VA 4H7EA 2QHXA 3NUGA 2X5NA 1WDKA 4LZPA 4S3MA 5EJEA 1MC4A 2HQRA 3SBEA 1H2BA 1G21E 3QJ5A 4GVPA 1IHPA 1NGSA 1WLSA 3HBMA 5AJZA 2BF7A 3JWPA 3N58A 3Q72A 3OHMA 1U6IA 3H19A 4QRDA 5AJUA 5GIPE 4MV7A 1RHRA 3KL4A 4DDWA 1RM3A 3Q2IA 3QENA 3FUWA 2BGRA 4CLEA 4QGHA 1E7RA 1JDBC 2YYSA 1ZOOA 2RC5A 4Q1BA 4XX1A 3WJ1A 5CBKA 3E9CA 4RK0A 3JQFA 4AD8A 3VAYA 2FN3A 1OFVA 4HNQA 4KAAA 4ZU3A 2BKEA 1B8PA 1AHHA 3ZOZA 3OD5A 4DMFA 1W48A 3GNSA 3MAAC 1TQHA 4XYBA 4R05A 4BUZA 1Y5NA 3NBFA 4XCQA 4GGMX 3TX2A 3EPRA 1KU6A 3JSAA 4BO7A 4CCAA 5B4TA 1HDYA 4BUJA 4UOZA 2Z3ZA 3UM9A 3PEUA 2Q29A 2C42A 1YNSA 2DKFA 1E9AA 3JQ7B 5E7QA 3DLCA 1KQFA 2IH5A 4CMCA 1NYRA 4PZZA 1QQBA 1VL6A 2CZQA 4HWPA 4GOXA 4HDRA 2HC9A 2O2DA 2V6JA 4JMPA 3AVOA 2W8ZA 3RUDA 3WKDA 5ED4A 1KK2A 4RMNA 3WX0A 2WD9A 3E4CA 4XQEA 3RCBA 5AW2A 2AR7A 3QBTA 3IHWA 2Q9AA 1H2RS 2ZAYA 2NX2A 2VSNA 4FLEA 2QN6A 2NPIA 2RGUA 2O5VA 2D4AA 2GYWA 1E63A 1VYVA 3EF3A 3R5KA 4CMGA 5KWJA 5J2TB 4V2IA 1L4BA 2C3MA 3D3EA 1QYIA 2PPLA 1T9AA 3MBOA 4GXNA 5AHOA 1FPMA 5LQJA 4UXIA 4DA6A 2GX6A 1LB1B 2G9UA 1DC8A 2C7OA 2IBSA 2BTOA 1WWKA 3I3SR 1BE8A 4K46A 3RKSA 1Z4PX 2OB2A 2IYWA 2RHMA 3VFDA 3MXTA 1AK1A 3PC4A 5TMPA 4YRZA 4I5FA 3G8YA 5F5NA 4RTNA 2O8EA 5I3CA 1DIAA 2IHJA 3LUFA 1RCFA 2FI1A 2IOYA 4OMUA 1BE1A 4CIDA 1GU7A 4OH7A 1MH1A 3HDJA 1T4CA 1BE0A 3CH7A 1MEJA 4QOJA 1X80B 4V0ME 3LL4A 3RHTA 1S8NA 3TL2A 1JPJA 1G8MA 1RADA 1HLDA 4G5OA 1Q7CA 3DE5X 5D00A 5A9SA 4RE6A 1T2VA 3K0KA 1X77A 2DWPA 3KR1A 1KZ6A 2OMEA 2PTHA 4TMWA 1C9YA 1I9GA 1N9GA 2D5CA 2ZIFA 3O3CA 1JHQA 3P2OA 3D6VA 1Q7TA 5IN5A 3ROQA 1DEXA 2PX2A 3SYLA 1EYZA 5FUMA 2ZJ7A 5A7GA 4WJKB 2QENA 3BF7A 1RWMA 2HLNA 4TMKA 2BFFA 4F9FA 2E55A 1JLKA 1IEWA 1NP7A 2XNDA 4V2UA 4TKVA 3C7CB 2AD1A 5K2MA 2DWQA 4PC2A 2ISQA 2OVBA 3L1JA 2OILA 3RG8A 3OOHA 5CPBA 4I9UA 1U0GA 2XT0A 1FVFA 1XPJA 2PU5A 4RKWA 3DDHA 2OGZA 1ZC4A 2W2QA 3ZKWA 2VEDA 4YUZA 5K6AC 5CA1F 4TN5A 4Q9LA 1P6XA 3M9WA 4HQRA 4X7PA 3W7AA 1PLKA 4TV8A 2X2PA 4JD5A 3A1EA 3BWMA 4PS0A 4JUBA 1E4EA 1H0KA 5K8JB 2VJKA 2I4OA 2D1SA 1D4OA 3PC6A 1TOAA 3BFPA 1U8ZA 3NJ8A 5FPTA 3DCJA 1GPBA 4TTIA 3PXEA 1GCUA 3L4KA 1QCDA 3WWOA 4R2KA 1ZH8A 1MVNA 1YBHA 2DQSA 4H0NA 1QFZA 3EPKA 1WL8A 1KC3A 2YYZA 2V4UA 3RK0A 4HN4B 4EHHA 1E2EA 1G6Q1 4XUDA 2ZRNA 1P1RA 3E6AA 3FD8A 1SR8A 1TQ4A 2WV7A 4UEKA 3V3KA 2QLLA 1CUZA 1D3AA 4XYGA 2EKZA 4Y6PA 4B7XA 3HJUA 5K5EA 4NBKA 2I9PA 1J7JA 2OM6A 2HWXA 2P79A 4NK4A 1YZGA 3H16A 4OD0A 1R8JA 1VGVA 3WBFA 2GS9A 3WGJA 2F59A 5CX1A 1FS5A 1F2TA 1T3SA 1T26A 2XB6A 3QF7A 4FYWA 5FWXA 2FQYA 3M1LA 3VDRA 1EINA 1TZJA 2PMWB 1DMSA 2BGIA 3D7SA 3TLGA 3WBJA 4EYQA 5KINB 2PZ8A 3P97A 4ISCA 4LOAA 1KY3A 1ZJJA 3ZIAD 1KH3A 1UFRA 4LYAA 3ESYA 3GUCA 3OZWA 4ZI3A 2IPOA 4JV5B 2DG2A 4HPXB 1CFJA 1JQBA 2HJGA 1VGQA 1NVWQ 1RMTA 3WGZA 2QRMA 4IIYA 3WL7A 2Q1XA 2B7CA 1G3UA 1AN9A 1ZOPA 2WJIA 3PRHA 4BEWA 1GNSA 1NN5A 1Q3HA 4MKIA 4WOJA 2OBLA 3H87A 1AA6A 4CV1A 7MHTA 1ATZA 1GEGA 2J5KA 2IDZA 2KBEA 4MP3A 4UTXA 4BFVA 4G81A 4PGFA 1UJMA 4YRIA 3P9KA 2W4QA 4R9VA 2XNKA 4KDCA 2HIHA 3BG5A 3ASYA 3C3KA 1ZJWA 4MVJA 1SUIA 3VGPA 3GP3A 3I4FA 3BXOA 1I3OA 1NZFA 3PFHA 1CFZA 3HB1A 2GEDA 3JYNA 3AB3A 5FUBA 2NZYA 4KTVE 4MV8A 1JDTA 3DW3X 3EMVA 3B2NA 2B30A 3Q3GE 5H4HA 1ZRNA 4KU4A 1NDHA 3KB1A 5EIAA 2O59A 5IWCA 1XTVA 1F20A 2I4IA 3OCXA 1NL3A 2CXRA 2YOGA 3G88A 3AB8A 3HDYA 3O2SB 3Q7IA 4M3NA 4P4GA 1J25A 1G3IA 3AK4A 5CAEA 1PRYA 1XZIA 4EG1A 3DE7X 2F9FA 4FR0A 3RU2A 1XQYA 4PGAA 5LDHA 5FHRA 4R1LA 2O7SA 2DBYA 1K8YB 3Q0IA 3C98A 1TZ2A 4ETMA 2VJQA 5KHLB 1U7XA 2P1ZA 2PKQO 3AVWA 1F0KA 1S3GA 5E95A 3HCFA 1W47A 2IYVA 5BW5A 1XLTC 2Q4DA 4GKVA 1JEAA 3NTRA 2JFNA 3N0WA 3RJMA 4I8XA 3TVTA 2IW3A 3HPQA 3IR6A 2R6JA 4FU0A 1K75A 3KQHA 1PK8A 4MKHA 1HURA 1WG8A 3OJFA 2QUIA 2UV8A 3QWAA 4WGGA 5DTJA 3U1TA 3M4YA 2WZBA 1W85A 5IMBA 3AHEA 1BDIA 2ZW9A 3TKYA 1VZ2A 1FNNA 1J4AA 2BFEB 2IDJA 3BE6A 1CIVA 2EARA 1ZL0A 2O2HA 4C3UA 4M0FA 1Z0KA 1BDBA 2MHCA 5HUJA 4DB4A 3CN9A 2AKYA 1ADBA 1CHNA 1QF9A 3ZVKA 1DADA 1D2RA 4CTOA 3ICCA 3GLQA 1Q0UA 4IV5A 3A4NA 1FTSA 4NCJA 3TL3A 5KTPA 2F3UA 2P9EA 3NIGB 2Q3CA 3SQXA 5CEFA 1G20E 1OAAA 4FC6A 2E49A 1H2AS 3VNBA 2F17A 1R9JA 3VSDA 3X0DA 2XE6A 5FAXA 2BHRA 2R25B 2E5WA 4HQ6A 3UAWA 3RROA 1N3YA 1O5TA 4NYIQ 2HM7A 4R1MA 1TAQA 4AZ0B 3VDXA 4UHJA 3NDPA 3ZN2A 3LYUA 2VHXA 4LZNA 5JAUA 1FFCA 1D2CA 2FSIA 1B7GO 1E3JA 2FG7C 2WWRA 5JE8A 1PSDA 5KAMA 1MRZA 2AH5A 4IFIA 1CQXA 1Z25A 2QZJA 3HFSA 4MH0R 1EX6A 2B8JA 1S2NA 5FPSA 3R7WA 3F2VA 1ISMA 1NQOA 2YV2A 3ZCRA 4B3DA 1LJLA 1VL8A 3FTCA 1B76A 2G08A 2C4TA 2DR0A 3QVKA 4NNOA 3WLJA 3U7HB 1FW6A 2WD8A 2B4RO 3AR5A 3VSAA 3ZVRA 3HCEA 4LPSA 1RXCA 1LI7A 2CCGA 3DLBA 2AXQA 2WP0A 1J22A 2J3IA 4H6XA 4QELA 4WKCA 1YDHA 2UXBB 2WYHA 2D5BA 5FLEX 2V6FA 3THRA 4DW8A 3OQHA 5LB4A 3RC9A 2OENG 2VN8A 3I42A 4N9QA 4V03A 3T7JA 4M1ZA 1BEUB 2YIDA 2B99A 4R9RA 3PHHA 3BWDD 2P3QA