4F4IA

Crystal structure of thymidylate kinase from staphylococcus aureus in apo-form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
204
structure length
193
Chain Sequence
b'MSAFITFEGPEGSGKTTVINEVYHRLVKDYDVIMTREPGGVPTGEEIRKIVLEGNDMDIRTEAMLFAASRREHLVLKVIPALKEGKVVLCDRYIDSSLAYQGYARGIGVEEVRALNEFAINGLYPDLTIYLNVSAEVGRERIIDQEDLKFHEKVIEGYQEIIHSQRFKSVNADQPLENVVEDTYQTIIKYLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Crystal structure of Thymidylate Kinase from Staphylococcus aureus in apo-form
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 74
structure length 193
sequence length 204
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f4iA00
2C98A 1QF9A 2GCOA 2ZANA 4MYUA 2RGGA 2ZRAA 4PSKA 5DI3B 3TK1A 4TMXA 4DLRA 4ARZB 3AP3A 4PO8A 3T1OA 8OHMA 4DDWA 1QHHA 4A1FA 1OF1A 5J4VA 1S9DA 4HAUA 1NN0A 4ABYA 1MABB 2GCNA 1OXTA 1M8PA 2PT7A 3WYAA 1WBBA 1M2OB 4ZDJA 1E9DA 1JB1A 3FHTA 2RHMA 1OKKD 3FKQA 4JVLA 2VO1A 4MGIR 2IYWA 5DE3A 5FBVB 2FSHA 4LJYA 4LCBA 4DSOA 2OCPA 3DL0A 4F4JA 2FFAA 4JBXA 2VSOA 4E09A 3PJRA 3IEUA 2WJYA 1PLJA 2H57A 1R5NA 3RABA 1ZNZA 4TLAA 4OQXA 3TUZC 3KQKA 1TF7A 2NO6A 4V0OA 3DMDA 3MWLA 2D62A 3DDCA 2SHKA 1D2MA 3BORA 3K0FB 1XP8A 1AK2A 4ARZA 2DBYA 4HAZA 2QTFA 4D6PA 2I1QA 3HU2A 3FMFA 1A2KC 3EWAA 4YMWA 3GEIA 3SN6A 2VF7A 1MABA 3KXKA 4LV5B 4Y0AA 2WOOA 2O8FB 2CK3D 4B76A 1AJEA 4LJ6A 2BKUA 1LW7A 4TSFA 4Q9IA 2C8VA 2ATXA 1TL7C 1OLOA 3P1JA 2R9VA 4UJ5A 3BFXA 4ZKDA 3ZVMA 3ZVRA 3W6OA 1OV4A 1XEWX 4C4PA 2QU8A 2VHTA 1JAHA 3FWYA 1WXQA 3K0FA 1SVMA 2ZJAA 2Q3MA 1GIAA 1TADA 2NZJA 1OFIA 1T0JB 2BHRA 2YC2C 1IN4A 4PQRA 4S35A 3AVUA 2BMJA 4DT1B 3ZVNA 4CEJB 2OFWA 3W5JA 1W7AA 4OK3A 1UDWA 4DCUA 1E2JA 1EESA 3A8TA 4HAYA 1TUIA 1A2BA 2JASA 3K70B 1AA9A 4B2LA 1UKEA 5FOSA 2JJ2A 4A6PA 1E3MA 2DWOA 2ORIA 4BFVA 4JLMA 2Z4SA 2IYTA 3B7GA 3BD9A 1W0JA 3FVQA 3BH7A 4ZI2A 2JJ8A 4RVCA 1Z83A 3FB4A 4RD2A 2C95A 4JT2A 2G83A 4B44A 3NBZC 1F48A 1CR2A 3P4YA 4QKQA 1PLLA 3AEZA 2W6ID 4RZ3A 1Z6XA 1E0KA 4YMVA 2HF9A 3WBJA 1R8QA 4NCJA 2RH5A 4DT1A 4CEJA 2GILA 4BLQA 1D5CA 3KDSE 1NG1A 3QKUA 3GCGA 3EZ6A 5KSPA 3HR7A 421PA 1R5BA 3MLEA 2W2XA 1NLFA 2AWOA 4TL7A 1XPRA 2PMDA 2DYKA 2WJJA 2EWVA 1MKYA 4IHQA 4LYAA 1YZKA 2A5DA 1NVXQ 2IBMA 2QRZA 4C7OB 4OI1A 4DHEA 4UNQA 4TYYA 4FMDB 2VSFA 4NZYA 4NL4H 5EP4A 4GOJA 2IXFA 4RZUA 3GLFE 3SC3A 4RZXA 3QVUA 1Z29A 4AC9A 1Q57A 2ONJA 1KJWA 3KB1A 3L0IB 1Q1EA 1FUKA 1G291 3QQ5A 1Z06A 5H70A 1E98A 1XXHB 3R7WB 2CEAA 1NRJB 1EFHA 2EFEB 4EPYA 3F8TA 5EUQB 1OFHA 1P73A 1CF4A 4AKGA 4Q66C 3EIHA 3T5GA 5J5CA 4JLBA 1UBGA 2P5SA 2ERXA 1S3GA 2R62A 1L4UA 4GZMA 4JLJA 1XX6A 3NBXX 4C7OA 3ASYA 3FHCB 2LKDA 1UEIA 2F43B 2XOKA 2FEMA 2DHRA 4Q1DA 4QHSA 2ZRFA 2AD1A 5EE3A 3VR2A 2VP6A 3VKHA 3G82C 1T91A 4FMDF 2QMOA 4CT4B 3C16C 3Q3JB 1SULA 1QBKC 1G7TA 1JEDA 4L5BA 3W6PA 1OH8A 1KO4A 2ZREA 4PX9A 1ZD1A 4TYQA 2WSMA 2RGAA 1XMJA 3VU9B 1NP6A 1XXHA 1KI6A 4UNPA 2ZJ2A 3LDAA 3R7WA 3ZD6A 1HH4A 3C5CA 4Z1MD 4OQLA 2YWFA 3H1TA 1GP2A 4EQ6B 3UG7A 2FGKA 2FG5A 2OCBA 3SEAA 2HYIC 2CLCX 3IPXA 1PV4A 3AF1A 2AX4A 3I3SR 1FZQA 2F7SA 2EYUA 3W8NA 1YR7A 3QXHA 2F43A 1RKBA 1OHHA 4BECA 3KUCA 3OE7D 5GJWC 2AFIE 3VFDA 4S2EA 4B35A 2HUPA 3KKQA 4A0HA 4ZCLA 1TEVA 2R6DA 2AFHE 3LBHA 3CX6A 4MKHA 1XDBA 1KSGA 2JLSA 2WWYA 2Z6VA 1KK2A 4OK6A 1ZVQA 3VU9A 5CJ2A 4DVGA 4BFZA 1T6NA 1R0YA 2QN6A 3VQTA 5JS8A 3ND8A 2O8BB 2Z4RA 1YKSA 1M34E 1U8YA 4WAUA 1SHZA 4DSNA 3U7FB 721PA 4EQ6A 2V8OA 3D7MA 3IQXA 2A5JA 2VYFA 3IIMA 1GSIA 1Q1BA 4W5JA 3QXCA 1KSFX 5EP1A 2GJSA 2VP2A 4GNKA 2WJVA 5TMPA 1S9HA 1KI7A 1HY3A 3SR0A 3K0SA 1N6PA 1Z0FA 2HXSA 3Q72A 1JAIA 1G3MA 1X6VA 3ZIAD 4BLTA 4Q4HA 5UKDA 1D9XA 5JEEA 3U61B 1XD8A 2WWFA 1X86B 1ZC4A 3AF3A 1OFTA 5EE0A 1N0WA 5DHFA 4GI7A 1YR9A 2IT1A 1IM2A 1W5SA 3CB4A 4BFSA 2O8BA 2MSEB 4BLSA 4UXHA 3UMSA 4EPTA 1P3JA 4BLOA 2NOAA 4P32A 4EFLA 1M7BA 4U7DA 2J0SA 5KHOC 4EPVA 2C5LA 4CEIB 2NO1A 1S4QA 1TU4A 1PUIA 1QHYA 2DWQA 1LS1A 4PPFA 3IBYA 4LHWA 4LHZA 4G5OA 4H1UA 5CJPA 4AYTA 2QAJA 4DRZA 4Q02A 2ZITA 1G6HA 3LAWA 2RGXA 4ESVA 5CB6A 4KBFA 1AKYA 1KAOA 5JFGA 2EU8A 2KSQA 2ZEJA 3NHBA 5FR1A 3B78A 3U7GA 2WVJA 3EC1A 3PUXA 4MA4A 1HEIA 2FE4A 5CIQA 3CKLA 4EUNA 4NHOA 2BJVA 3CBQA 4LZZA 3ZYCA 4FIDA 3EPJA 2W6JD 4YQFA 1S1MA 2BJWA 4CEIA 3TGPA 2NZ8A 3UKDA 1JR3A 1P7CA 2BBWA 2ZXUA 1ZNXA 1VMAA 3EARA 1QVRA 2QI9C 1NN3A 3X2SA 1OH7A 3KJGA 4RY2A 1W0KA 1E9BA 4PZLA 2GF0A 3A1VA 4DCVA 3B5JA 3D3QA 4OL0A 4A15A 1FFHA 2V3CC 2QP9X 4A8JC 1G7RA 1P61B 4OJKA 1U9IC 3TW8B 2VHJA 4JLAA 5BYJA 3RWOA 1XB2A 3IIJA 4UNSA 4L16A 2O0JA 4RSGA 5KO2A 2IYYA 1E9SA 4QG7A 4A36A 4Q1FA 4M1TA 2HT1A 2A7QA 4EJSA 2P65A 4HUQA 4V02A 2XNDA 2VIIA 1NL3A 1FL9A 3B13B 2KBFA 4B2PA 1FPMA 4BWYA 1X8JA 1W44A 1XMVA 5A0FA 3LQQA 2CNWD 4IFEA 1VDZA 5AJVB 4M9ZA 2F55A 5FL3A 4OHXA 4QOSA 4CZ2A 2ZJZA 4QHTA 1I4DD 1ZD9A 2HEIA 4CW7A 4MRNA 3CF0A 3QEOA 4BZPA 4QJ3A 1W4CA 4PSAA 1MRSA 2BCGY 5HCIA 4QC2A 1NN5A 4TT3D 2D06A 5CB8A 2GF9A 2BEKA 5LD2B 4URVR 4Q1CA 1QHIA 2YWHA 1E2HA 3U44B 3NDBB 3TVTA 3AVVA 1AKEA 1KO1A 3TW4A 3P27A 4Q19A 1Y3AA 4IDOA 3OEHD 3RSLA 4LSGA 5EZ6B 1VCIA 3LQRA 1ETUA 2GJ9A 2QORA 4TL9A 1BYIA 2G88A 2GCPA 4NONA 3LRPA 3TVDA 4GFDA 3WNDA 2ZAOA 2QG6A 4IVQA 4M1KA 4DIDA 4WZ6A 3QG1A 3AVPA 3CNOA 4PTLA 3REFA 5HKKA 2DCUA 4HATA 2FA9A 3JZAA 4O2LA 1VCMA 3NBYC 3BGWA 1G8GA 2GXQA 1NLYA 4A2QA 3RS7A 1KKLA 3PCRB 2C9CA 3RS2A 2FF7A 5FR2A 1KI1A 2N46A 1DTSA 4ZDIA 3GP8A 1DVRA 2CLDX 1U2RA 1OPXA 3SFZA 3U44A 1VG9B 5JMTA 5EE9A 2G0NA 5IK2D 1N0UA 3RANA 3JVVA 1E99A 1UBEA 1HV8A 2GDJA 2REBA 4US1R 1G9XA 1JECA 3AUYA 4PC2A 4JSYA 1VG0B 3AH8A 4M22A 2QMEA 4LYFA 3C4JA 2D3WA 2FPMA 5IRCD 1L4YA 3TQCA 2PEYA 3U3OA 3NEYA 3ICEA 3BRWD 4D80A 2IUTA 2A78A 1G3RA 5C4GB 4L9WA 2I1VB 5KOYA 3A4NA 3T15A 3VR4A 1WMSA 1KSHA 1UBFA 3CW2A 3K0CA 1KKMA 1M6NA 3I8XA 1ODFA 3OIYA 4X8LA 1PVOA 1GKUB 5BW8A 1IXSB 2QZ4A 3U6BA 4DLSA 2ZAMA 5G3YA 1DAGA 3VX4A 1ZIPA 1G3UA 2H8KA 2HT6A 3RVBA 5KSOA 1T5LA 4LV8B 121PA 2F9LA 3GLFB 3T61A 1M7GA 2XSZD 4IDHA 3ZQ6A 3TSWA 4LDJA 3FFBA 3GJ7A 3SDZA 2JCSA 1TQ6A 1UPTA 3DEFA 3CPEA 4Q01A 1KZGB 1OXXK 4DCSA 4DLXA 3R9WA 4Q7LA 3KZ1E 1PLKA 2ZR0A 4I1SA 3KQHA 3A37A 5FPHA 2IYVA 4YXWA 2P6RA 1T4GA 4QJ5A 5TDHA 2VLIA 4X8MA 4F91B 5JWOA 4HYYA 3K9GA 2V4ZA 2ZUCA 4MYCA 5D3QA 3G5UA 2IEYA 4B47A 3VHLB 3KB2A 4EDHA 1K6MA 3I5XA 5FTNA 1ZM7A 1QHSA 1KO7A 5DSZA 2G9NA 1N6HA 4JIMA 4YMUA 1JI0A 2B8WA 2FU5C 2E9SA 2WWWA 5LB2A 5L3RA 1OH5A 4MUBA 1HE8B 5EXXA 1FX0B 3WP0A 1TMKA 3UANA 3WBKA 4ZI3A 3SJBA 2FV8A 1II0A 3CONA 4FXPA 5FBWB 3TE6A 2ZVPX 4AYWA 4C0KA 3GLFA 4TTQA 1DG1G 4KITB 3GD7A 2AWNA 4ZDWA 4I99A 4ASUD 2X19A 1E6CA 2A2ZA 2XJ9A 2QY9A 2B7BA 3EZ7A 1WRBA 2RB4A 1E2PA 2CE7A 2OBMA 1WA5A 1ZIOA 1G19A 1QVAA 1B0UA 1E9AA 3Q7QA 3QBTA 4GP6A 1T0HB 3RC8A 4KI0A 1G8PA 4TMWA 1ONBA 2W0SA 2ZI6A 4XIGS 4O0MA 1KGDA 2VSXA 4F4IA 3K0AA 1CRPA 2VH5R 3GJ8A 4LK2A 5FPSA 3GLHE 1UM8A 1ZC3A 3BFKA 3L8YA 1ESNA 2KBEA 2XB2A 2V6JA 4NYIR 2GRJA 1MR3F 5DIFA 1ELOA 4DDVA 1FX0A 1Z8FA 2FNAA 2XJ4A 2ZI5A 3TNFA 1WB9A 1QHXA 2A5GA 1IAQA 2J87A 5HZHA 3K9LA 4QFMA 1Z6YA 1EWRA 3PV0A 2F1IA 2ZUBA 5C18A 4QBFA 2ZRLA 2QBYB 4JYBA 1T3LA 4HZIA 1SZPA 2E87A 3RSOA 5A4JA 1HT1E 4LHYA 1IY2A 1ZM9A 5CK4A 2KWIA 1KMHB 3LLUA 3ZH9B 1Q22A 1VYUA 2REOA 1WP9A 3RRMA 4TYPA 2QP3A 1RZ3A 1CJTC 2FWRA 1XCMA 4NYIQ 521PA 4B6EA 1UAAA 4FMCB 1EG7A 2V54A 4RD1A 3HP1A 2OLJA 5FOXA 2QPOA 3PITA 2F1HA 5C1BA 2ZSAA 3RWMB 1VECA 4D82A 1N6OA 4CT5A 3AGQA 1ZJ6A 4HLUC 3VKGA 1AS2A 4U02A 3KXLA 3QXXA 3LXRA 2ZPTX 2GXAA 4JJZA 2QBYA 2X2EA 1CJKC 1R2QA 2JGNA 1N5KA 1YE8A 2VL7A 1GKIA 1JQJC 2Q0HA 1GM5A 2EFDB 2J41A 4ITRC 4NDZA 4JJKA 3REGA 1KMHA 2CHVA 2BBTA 3FOZA 1DELA 2CDNA 2IXGA 2IYQA 2CBZA 4G1UC 3MJRA 3VMFA 1VIYA 1P2SA 1Z0DA 4DBLC 3W6NA 1KNQA 2DFNA 3L8ZA 3A1UA 3MJHA 2F9MA 5HTKA 4FMCF 3LD9A 5E95A 1GL6A 1YRAA 2XGJA 2RGNC 4KO8A 4P0TA 5JBQA 5CLQA 4P33A 2ODEA 4D2IA 2F1JA 2VTKA 3AQ4A 3GFOA 2EFGA 1GOTA 3Q9LA 1GRRA 5C4MA 2GEDA 5JHGB 3SHWA 1L2TA 1YHNA 2QROA 2YOFA 4HEJA 3V4FA 2QT0A 3I5YA 3IHLA 1DAKA 1EFTA 1KOFA 1UF9A 2DFKB 2I3BA 4HAVA 3ZD7A 4RD4A 3U6KA 1Z0KA 3PUWA 4JKYA 2XB4A 5IDVA 2DR3A 2EFHB 2WMNB 3PFIA 4B71A 1T8TA 3IBGA 4B3FX 3K09C 2QA5A 2CL7X 2J7PD 2UZ3A 5AR1A 4KAXA 3UG6A 1TPZA 1XFAA 5SZHB 3VR1A 5M04A 3THYA 1NJFA 2CVFA 1LY1A 4F7WA 1TAGA 4PHHA 5FTKA 2ZJBA 4DLVA 4ERNA 4N1AA 5DISB 5FL7D 5E7JA 2G0TA 4NTZA 2AR7A 5LB4A 3OZXA 3FE2A 4F38A 4EFNA 2ZQ5A 5C2JB 3D8BA 2Q6TA 2QMUA 2C9OA 3DZ8A 5KYKA 1F2TB 1GILA 1XCPA 3LY5A 4B75A 1VG8A 4NYMR 3TLXA 3WNCA 1J99A 1CJUC 4KU4A 3OFND 2OT3B 5J40A 4QGHA 1HQCA 2ERYA 2PZEA 5CM8B 5FPKA 2NO0A 1Q0UA 4PR0A 5AJXA 4D81A 4EKDA 3UWKA 2ZI7A 4W5WA 1GKYA 2Z43A 4HDQB 2XX3A 4E07A 1YZNA 1E1RA 4N0EA 1VYTA 4HSEA 2ZRNA 2QQEA 2ZI3A 1US8B 1Q44A 2Z83A 2JLUA 3UIEA 3GQBA 2OSBA 3JZMA 1Q3HA 1DAIA 2P5TB 5DI3A 5HPYB 1J90A 4A0GA 4RCZA 2DFTA 3IKJA 1F2UB 4NYMQ 4A2PA 3BE4A 3LO5A 2V6IA 4PO1A 3TR0A 2HLDA 1F2TA 2ZROA 4KBGA 2OV2A 3T5DA 4OK5A 2VEDA 1RYFA 2ZU0C 4C0AC 1E79A 2QSZA 4LWZA 4M0LA 1G5PA 2KE5A 4RD3A 4A2WA 3LVRE 3ADDA 3BH0A 5CYOA 4LX0A 1H8HD 4AI6A 1E2IA 2R8RA 4KFSA 5CIWA 5LPNA 2BEJA 4IDQA 4DB2A 4LBVA 4CF7A 1JNYA 1VCOA 1QDEA 1US8A 4ZCIA 3B6EA 3OAAD 3CF6R 4JVMA 2BIFA 3HWSA 2AKAB 4V03A 3DZDA 5KNDA 1LVGA 3CWQA 5BN3A 3M1IA 1ZM3A 1QHGA 2NQ2C 1F2UA 3OIVA 1LFDB 2GK7A 3WMGA 3UXMA 1G64A 4AYXA 1XTSA 5KU1A 4XWAA 4QM6A 1W47A 1Z0AA 4BRUA 1G1MA 1KZ7B 3FKSA 2Q9CA 3FTQA 2A30A 3I8SA 2O8FA 1XU4A 4TQAA 3OEED 4XWOA 2RCNA 1EWQA 2WZQA 4PHGA 2YWEA 4NCIA 1BS1A 1DE0A 4BPBA 4LPSA 4JZKA 3I92A 3PXGA 1VCNA 1O3YA 1ZYUA 4CEHB 4JVSB 1UKZA 5BXQC 5JECA 2WSSD 1P60A 4Z54A 4DUGD 3TR5A 2P6UA 2Q3FA 2CHQA 4A8JB 4DKXA 3DM5A 4HB2A 1G5TA 3I4LA 4C0BA 3KJHA 1Y63A 1SVKA 5K8IA 2VHCA 3LBIA 1AQYA 5ANRB 1R5OA 5B2ZA 3TSZA 4ZIRB 3ICQB 3AUXA 4URZR 4WOPA 3C8UA 1WF3A 1DO0A 4ZV4A 1SVLA 2ZE7A 1W36C 2OG2A 1Q1ZA 4IKEA 1DO2A 3M4YA 1KY3A 4BGDA 1OYWA 2AN9A 3CR7A 2FDCA 1J8MF 1Z2CA 3ND9A 2O52A 4JT4A 1RRGA 3O8RA 3V4RA 3KTAB 4TL8A 1P5ZB 2JLYA 1ZAKA 2ZS8A 3I72A 1IN6A 1IN7A 4Q03A 3AKDA 3K1JA 4K8OA 1IOZA 3QUSA 1Z22A 3ADKA 4UXIA 1U8AA 4DZZA 2IA5A 3AVYA 1KY2A 1E9FA 2WAXA 3KKPA 1U9IA 2QNRA 4V0KA 2OAQ1 2H16A 3RRYA 5SZIA 3LH5A 3TH5A 3BJIC 4XJXA 3VR3A 5L3QB 3A6PC 2ECKA 5DN6A 2D7CA 4ZIRA 4XD7A 1MT0A 3ONWA 3SBEA 2ZU6A 2CE2X 2FX3A 3U3MA 4P4TA 1GVNB 1VKJA 2WOJA 5H1YA 1TEXA 3HU3A 1DAMA 1G4UR 4BFYA 1YU9A 1UDXA 4K81B 1Z0JA 2V7QA 2ZRDA 4HUTA 3KTAA 3GLHB 5GJBA 4W9MC 1YZTA 5FUXA 2W58A 3V9PA 4BFUA 1VTKA 5KDOA 4QM7A 3Q5DA 4LV6A 2PMKA 4WVFA 2EVWX 1NSTA 4P4UA 3GEEA 4HB4A 2WMOB 1NF3A 2JIZA 3H2YA 3S1AB 1H8EA 3B9QA 2ZR9A 1S96A 5L3QA 4CDGA 3ADCA 3BB1A 2GJAA 1GWNA 2FGJA 4A0RA 4MDEA 2JLQA 2W83A 1VHLA 4YXWD 1YVDA 3F5FA 4RFSB 2HJVA 1ZNWA 1COWD 2W2TA 1VIAA 3SI7A 4G5SA 4XVUA 4B43A 3ZQJA 4LJAA 4NCNA 2VQSA 1SXJC 1E2EA 1ZUIA 4JL6A 1ZU5A 1GITA 1DAFA 2PCJA 2PT5A 1CR1A 1OIVA 1XJQA 3NXSA 5B58C 3GFTA 3GLHA 2IXEA 2JJ1D 2QGZA 1CRQA 3VR5A 2FSIA 1QG4A 4OQMA 2GEVA 3O8DA 4JBWA 4Q00A 3AVOA 3WMEA 4LJ5A 3ZJYA 1SKYB 2J7KA 3S1AA 4GP7A 2MSCB 3BS4A 3QJYA 3VR6A 1Z6TA 5B64A 4TQ9A 5AJWA 4M1SA 5DH9A 3U5ZB 1N3BA 4F93B 5JLJA 3K53A 4EFMA 4DLUA 1JXOA 3KKMA 2WPDD 2VP0A 3A58B 3ZZTA 3EG5A 3L0PA 4ZDKA 2FMXA 4M9QA 2MSDB 1CR0A 3OF5A 3NWJA 2JLXA 2CJWB 2X77A 4JVNA 4URUR 4L8GA 1XZQA 5FH9A 1E2FA 4LOAA 4XVRA 3O8CA 1KI8A 2JLRA 1EFRA 4PAOA 1II9A 3PEVA 1IY1A 3AKYA 2AKYA 1R0WA 4LI0A 1IJFA 1G7CA 1BOFA 3X1WA 3TMKA 1W4BA 2H5EA 2ZSFA 4XOIA 3PENA 1D2EA 4TMVA 4B2IA 1FNNA 4N0DA 3B1ZA 3H0KA 5JWHA 3EPLA 1G21E 1Q21A 4HAXA 2ASEA 2RAPA 4G0NA 1GAJA 3IUYA 3NBFA 4PQFA 2HCJB 2R6CA 4GMXA 2YOGA 1IN5A 1OT3A 4WIAA 2QTHA 5D3MB 2ZSDA 4UQOA 5FUWA 3MSXA 3UK6A 1WDTA 2CJWA 4FCVA 2OUKA 4PPGA 1S0UA 2ZYUX 3H86A 4L4UA 4AY2A 1NIJA 3CPHA 4M1OA 1M74A 1BMFD 1R4AA 4WBSA 1SVWA 1U98A 1OXSC 3E1SA 3O8BA 5E7IA 1N6IA 4AG5A 1P75A 1OW3B 2JDID 5DO9A 3RS5A 2V1XA 5CDFE 3CZPA 1KAGA 4TMTA 2WJHA 2NMVA 2O8EB 3QE0A 2FFHA 4QXAA 3TUJC 2FZLA 1RRCA 4R9UC 1W36D 3DKVA 4Z8YA 5AWFC 1Z5ZA 2GVDC 2C03A 1J8YF 2UVQA 2WIBA 3CZQA 1E32A 3F3YA 1X1RA 3CUEF 5D3MA 4AURA 3DOFA 3PUZA 5G3ZA 4DLTA 4FCTA 3B1WA 3EZ2A 2QM8A 3A1TA 5EZ5A 4KLZA 5HCNA 4G5QA 3EW9A 4KCGA 3THWB 2H18A 2ZYWX 1OKKA 3EA0A 3SNHA 3NHAA 4ACBA 1BO6A 5J4YA 1XEWY 2N42A 3IQWA 1SVOA 1E2LA 2KI5A 4MYTA 4QJ4A 4MQBA 2O8EA 2FEOA 3T35A 4PANA 2GTPA 4PQYA 1E1QD 1MO5A 4TZ0A 3FYHA 1HA3A 2ZRKA 4UXJA 4ZKEA 2O0HA 1G6OA 1NBMD 1Q20A 3GJ6A 1OJLA 2CXXA 2BVNA 1GL7A 4URYR 2DY1A 1E94E 1E4YA 1Z6GA 2REXB 2FJUA 4FW9A 3U60B 3CNNA 3EZFA 2QGNA 5DYGA 4NE2A 3IPYA 4MRVA 2RHDA 5HR5A 1CJMA 1GL9B 1Z63A 2EQBA 3CPJB 4M21A 3R8FA 3B1VA 4OQNA 3THWA 1G7SA 4U00A 2K5UA 3I73A 2O5VA 2CK3A 2J1LA 3H4MA 2ZR7A 5AJZA 4G5RA 2OXCA 2IYXA 3BERA 1HUQA 2R6AA 1W46A 4MKGA 5FOWA 1HQYE 1SXJD 3QNUA 4TMKA 4JLDA 2WKRA 4DSTA 4I1VA 4HLUA 4DLYA 2ZRMA 4RD0A 3QBVA 1NIPA 4TMZA 5BWMA 3EX7C 4C0LA 2W2VA 4Q4AB 2V55B 1Z6AA 3ASZA 3V00A 1TQ2A 2VP5A 4KVAA 1GZSA 1KK1A 2GZAA 2OCYC 2F1RA 5DHAA 3SHFA 5E7MA 4NMMA 2JAQA 3THXB 5EE1A 2QEQA 2X8AA 2B21A 3LBNA 3LW7A 1U0HC 2GNOA 2KJQA 3QF4B 4B48A 4NU0A 5JEDA 3GLIB 3AGPA 4NYJR 1E2NA 2L0XA 2Z0MA 3DPUA 2QUZA 3U7HB 2OM2A 1OXUA 4ZCMA 2W6IA 2YINC 5EE5B 4P4SB 1G3IA 2VF8A 1K8RA 2B8TA 2Q3HA 4RZ2A 5KPJA 3E2IA 3IILA 4MUAA 5JHHB 4B73A 3ZLJA 4YDSA 1NKTA 4OHZA 4JS0A 3X1DA 2IS4A 3LVQE 5JJKA 2DWPA 4JLKA 3RLFA 2HV8A 2FPKA 5B30A 5C46F 1P62B 2O8CB 4QNRA 4CIDA 3THXA 2C96A 2XNSA 3BFVA 4TLCA 2IYLD 4J0QA 4NYJQ 2RGCA 3QF4A 5CYPA 1SQ5A 4TSFD 3TSOA 1GNRA 2XZPA 3P32A 4LHXA 1I4TD 2ZE6A 1JALA 1VYVA 1F3OA 2ZE5A 2Q9BA 4BRWA 2FFQA 4Q5IA 2YHSA 4LPKA 1KDPA 1X1SA 5FBRB 4P4SA 4QBHA 4WA7A 4B6FA 4POAA 3H84A 2D2FA 5K8TA 4FWTA 1A1VA 3Q7PA 1KK0A 2J9RA 1OIXA 4QGFA 4B3CA 1P4SA 3W9YA 2GVZC 2NPIA 1DAHA 1A7JA 3UMRA 1RIFA 2YVUA 3P4XA 2PH1A 4KODA 3EZ9A 2QL6A 3MUFA 5GVRA 1D2NA 1ZRHA 3LFUA 2O8CA 1KI3A 1RRPA 3SJZA 4OI4A 1M7HA 1TF5A 2P2LA 4UKDA 3R8CA 5L3VA 1U99A 5JI3E 1NMZA 5TV2A 1DARA 2JJ2D 4NPHA 3PVSA 2AXPA 1U81A 3I61A 2QPAA 2B6HA 2ZS9A 1W0JD 4JLPA 4MRRA 1XBTA 2GKSA 2ZETA 4A4DA 4B33A 1I4LD 3QKSB 2OILA 2XTNA 2C78A 3WNBA 3WRYC 2EYQA 1JJ7A 2FSGA 2Z5FA 3GJ0A 3MGCA 1T3SA 3ZS8A 4II7A 4DXAA 5JRJA 3KQLA 1XPUA 4WXPA 4OQFA 3AP2A 1TUEA 3SYLA 3X1ZA 2ORVA 4Z1MA 1R0ZA 2V9PA 2RMKA 4KFUA 1ZMXA 1U94A 3ZZUA 3IHWA 3SU8A 1GG2A 2PEZA 2UKDA 1S1CA 1E2KA 2R6GA 1Z3IX 1FTNA 2FSFA 1D9ZA 6Q21A 2WAYA 2Q21A 1BH2A 1P72A 1KIMA 2IW3A 3OE7A 3VAAA 3AVTA 4KXFB 3U3RA 4HI0E 4TTPA 1CTQA 3EPKA 4KYIB 1G8FA 4TL6A 2DPXA 3BH6A 3B1XA 2ZRHA 2FPLA 1MO4A 4DIEA 1IJEA 2ZRGA 4Q9LA 2VA8A 1R6BX 2CMKA 2FFBA 4MGKR 4TQUS 3I32A 2AD5A 4HDCA 1ZUNB 2ZRIA 1EX7A 4LBWA 4AWXA 3A1SA 1KSJA 5CITA 3QXJA 1GDDA 2BCJQ 1XD9A 2IWHA 1UJ2A 3BOSA 3Q85A 4EPXA 3U4QB 4JYCA 2PZGA 4IEIA 2OAP1 4C0JA 1ZW6A 5AK0A 4GOXA 4IOKA 3X1XA 2D4HA 3SS8A 1Z28A 4WXRA 2WICA 2XOKD 2JLVA 2H17A 2J45A 4BFWA 3KFXA 4FN5A 4P3YA 1AIPA 4EJSC 3ZIAA 1FMLA 4AIIA 4RKEA 1GNPA 4HAWA 2O8DB 3AP1A 2QSYA 4BEJA 1W36B 1E9RA 4M8NE 4MDFA 1GRNA 1LNZA 3E5HA 4XSGA 1SKYE 3HU1A 4OHYA 1D8TA 1CJVC 4IOMA 4GRAA 1CKEA 1ZCAA 2LWIA 2P6NA 1C1YA 4TWZA 3SYNA 3TAUA 3L2OB 2C04A 3EXAA 4BLRA 1R8SA 3LXXA 2QENA 5EXSA 2MMGA 2A9KA 1OXVA 2VP9A 3B2EA 5FOVA 2IS2A 2ZM5A 2B92A 3QEJA 2R44A 1ESMA 4M1MA 3C7KA 1O87A 1N25A 2IYSA 3JVUA 3TJZA 3D6TB 1BKDR 1GNQA 2GBLC 3W8RA 1QG2A 3EPHA 1OHHD 3DM9B 3MCAA 4G01B 5GADl 4BEBA 5F2EA 1JJVA 3NKVA 2O8DA 2HDNB 4F92B 4QGGA 4KYUA 4KFTA 5TY0A 1W1WA 4GZLA 3BB4A 1TU3A 2WKQA 2XITA 2OEPA 3PEYA 1SVIA 4MYHA 2OFOA 2WV9A 3D31A 3FFAA 3WYFA 2IL1A 4I4LA 1NLZA 1T5IA 4TLBA 1S8FA 1E9CA 4UNNA 5AUOB 2W6JA 1NY6A 2WBLC 4LHVA 3T1QA 2WM9B 4BFTA 3GJ3A 3BB3A 4D4KA 4MKFA 1N6LA 4OHVA 1CU1A 3TUIC 3OIUA 4YDHB 4A9AA 4GMDA 3CX7A 1YZQA 1Q1QA 4EAQA 1XWIA 1Q12A 5EP2A 4BZXA 3CH5A 2GWHA 4IXNA 3W3AA 5GJVC 1QZXA 2AL7A 4KV9A 2GHIA 5J4HA 3LW8A 4PAMA 5JJIA 1KDTA 1AS0A 1R10A 3RHFA 4UJ3A 5CDFA 3EASA 5FOUA 1W2HA 1SXJB 3K9HA 4AKHA 3C41J 2H92A 3LA6A 2QAGC 1UFQA 2BOVA 5G53C 5GJCA 1EXMA 4LYJA 1ZU4A 5JCPA 4X8HA 3SYKA 3K8YA 2PBRA 4B74A 1FTSA 4RKFA 4QHYA 5HZKA 3K0CC 2GXSA 2IYZA 2GZHA 3QVVA 2ANBA 4KJZA 1ZBDA 4Q7MB 5FTJA 2IHBA 2IUUA 2CCKA 1DAEA 2CNWA 4GDFA 3X1YA 1XCGB 2YJTD 3GJ4A 4PHFA 2MMCA 3FPAA 4TYNA 4AK9A 4PC1A 3RS4A 1NVVR 3CWZA 3QY0A 2IEZA 4C9BA 2ZJOA 4M2LA 4TT3A 4DLZA 1XZPA 4MRSA 5AJYA 4V0ME 1IQPA 4BZQA 4C0SA 1MO6A 3OEHA 2BC9A 5CLLA 1XJ0A 3EIQA 4ON9A 5KNCA 2ZI4A 1FNMA 2H1LA 5IF9A 3K9NA 4FMBB 1XJCA 3L43A 1H65A 4IDPA 1KJZA 4EIWA 4D4LA 1P9WA 4DCTA 1JR3D 2J0QA 1NVVQ 1ZNYA 2ONKA 3KKOA 3QIAA 2WWXA 1W0KD 2FH5B 4C3ZA 2ZRBA 1G20E 4HB0A 4AKEA 4LY6A 2IYUA 1W49A 3EAQA 2C2HA 3L0SA 2VBCA 4IVRA 5JSZB 4YC7A 1RW4A 1AM4D 2VHQA 4OYHA 4Z8XA 4HZUB 4Q47A 3ZGXA 3SZRA 4C2UA 2PX0A 2PCLA 1ANKA 3CRRA 5CM9C 3U3KA 3CRVA 2JA1A 4Y0VA 1KHTA 4Q48A 4EPRA 5IK2A 1X8KA 4DEYA 1E2MA 1P9RA 2ZRPA 3AB3A 4LBZA 2PJZA 3P26A 5DYIA 2XNDD 2JLZA 1RVDA 3TQFA 1XTKA 2CHGA 3M0EA 3NTUA 2ODBA 5AUQA 4IXMA 3EIEA 1UEJA 4LC0A 1CR4A 2R6FA 3P20A 4IOJA 5P21A 3IO3A 4XVQA 1JXMA 2P67A 2NTYC 4XTCS 3HPRA 3WP1B 2XTZA 4KSBA 3CRW1 1U0JA 3CO5A 2BDTA 1XEXB 3GLIE 1E2QA 2GXUA 2J5XA 5JI2E 4TYWA 2YWGA 3ZVLA 5JSZA 2GAOA 4GSYA 5J4KA 4GBMA 2HYDA 4YLGA 1OYYA 3R20A 2BM1A 1FP6A 4HZUA 5BN5A 3W3ZB 5JZVA 4LJ9A 1VHTA 2GEUA 4IOLA 1II8B 4A92A 2G3YA 4PPQA 2XSZA 3LV8A 5EJEA 1RRFA 1NVWQ 3G0HA 3PEWA 1LTQA 2IF0A 4OJQA 3ETLA 4Q4LA 4NH0A 2HCBA 4V0NA 1FUUA 3L0OA 4PO9A 4DEXA 1XTIA 1C9KA 1UKVY 2I4IA 1CULC 3KQNA 1EX6A 4FCWA 1D6JA 5HE9A 3LX5A 1JBKA 2HJGA 2YOHA 3QF7A 4URWR 1HURA 1Z07A 5HKKD 2XEXA 2NG1A 2NPFA 3VX3A 4JL8A 1ZM2A 1XEXA 4JL5A 4QBIA 3DVLA 3TIFA 1E0JA 2D7DA 4A6XA 2OFXA 3NH6A 2KB0A 2ZS7A 1X3SA 2IC5A 3PQCA 4MH0R 1ZUHA 4MGZR 3TRFA 1W4RA 4MGYR 1KO8A 3EA5A 5KNBA 1II8A 4RJLA 1N5JA 1U90A 3RC3A 4H9GA 4CEHA 1E69A 1AS3A 1EFUA 4X8OA 3NG1A 5ELXA 1N6RA 1HTWA 1NI3A 4ASUA 1M1YE 2WHXA 4TZ6A 3SJCA 2OLKA 2RKOA 1J7KA 4A8JA 2O0KA 1DEKA 5AUPB 2OESA 2BV3A 2J0VA 1E9EA 5FUYA 1YQTA 4GL2A 1RE0A 2G1KA 4H1VA 2ZJYA 2GAAA 3B85A 4LJ7A 5BN4A 1AGRA 4E5UA 2ZJ8A 1TX4B 3RRZA 3B8HA 4Q1AA 1AZSC 2N1BA 3BIFA 1T9HA 2XXAB 1W48A 4R2IA 1IHUA 5JCZA 3CLVA 1TNDA 2CLSA 3QPWA 3MFYA 1G18A 4RD6A 3T06B 1BIFA 1VPLA 2ATVA 4LBYA 4W7SA 4A0FA 4PZZA 1CS4C 3U7EB 4AKIA 2FOLA 1P2UA 3HR8A 1KI6B 2YZ2A 2QQ0A 1KK3A 1ZCBA 3CRQA 5FFMA 1OSNA 2G1JA 3UWOA 1KTVA 2QP4A 3N2EA 1KI4A 4CYMA 1G17A 3KL4A 2BKEA 5K8LA 3SE0A 4D0GA 1G5RA 4FINA 5KPDA 4M53A 4Q7JB 1RJ9B 4ZO4A 4OI2A 1P9NA 3MRSA 2XXAA 5EP3A 1F60A 4QRHA 2J59A 5SZKB 3WY9A 5L3SB 4IW3B 2ZYVX 1T3HA 4F4CA 1DS6A 1XTQA 2G77B 3CR8A 3EWSA 3KUDA 3O47A 4PC7A 2IS1A 1JEEA 2D2EA 4HLDA 4YONB 2G6BA 1MRNA 4I1OA 2GETA 1J70A 1YJ5A 4MRPA 4IDNA 1WE2A 3SQWA 3I62A 1G4AE 1JPJA 5CK5A 1P2VA 3WMFA 2J0UB 3BK7A 2YKGA 3GJ5A 4JBYA 4RFSA 3GLGB 1RJ9A 1ZP6A 5E3HA 3T1TA 4WZBE 1E4VA 2BBSA 1IN8A 2IHYA 4UNRA 3J81k 3HPQA 5BQ5A 5L3SA 3L82B 5B57C 3MWYW 3VKWA 4OKSA 4Q4HB 5FPTA 1A5TA 1TF2A 2AXNA 2NO9A 2W0MA 3KJEA 3CH4B 2J46A 2QRNA 5BYKA 1LF0A 3NC1C 4BQSA 1IY0A 1SHKA 2PJRA 5TARA 2BBOA 4XWKA 3QPUA 3M6AA 1LS6A 1JQLB 2ZRJA 2J0UA 3PUYA 1A82A 2ZIAA 3RRNA 2PZFA 2GA8A 4BASA 4O2RA 3T1VA 3CRMA 2QE7A 4XH9B 4C0QC 3GLGA 1G8YA 3RYTC 1QHNA 4MITA 1TTTA 1FOEB 2P3SA 3C15C 4O3MA 3A4LA 5DLQC 3PIRA 2DB3A 1U8ZA 3IIKA 4HLQB 2J7PA 3MMPA 3HYRA 1F6BA 1IXZA 3GMTA 1TQ4A 4RCYA 3ADBA 2XZLA 3PUVA 3NC0C 1NJGA 1NBME 1RFLA 3B9PA 3KKNA 5LBIA 4R7ZA 4PC3A 2XZOA 1XTRA 3E70C 4L15A 2YYZA 3AKCA 4JKIA 4OHWA 3TKLA 2YV5A 2IS6A 5FL7A 4GOKA 5HE8A 4LJ4A 2RGDA 3IEVA 2LKCA 4D0LB 3DKPA 2YNMA 2WKPA 3GFPA 4PSVA 2BMDA 4HLCA 2RGEA 3FMIA 3QKTA 2BM0A 1E0AA 1LF5A 4Q4JB 3KQUA 4EPWA 3SQXA 3CNLA 3OFNA 1K5GA 3Q8XB 4Q9KA 2C77A 3PEUA 2IYRA 2WIAA 4PXAA 5EUMA 3EC2A 4CGZA 4KHZA 5KSZA 1KI2A 4M9SA 4XSHA 3UPUA 4E22A 2WWIA 5DGXA 5FBQB 4JSTA 1SXJE 2NGRA 4O25A 1YR6A 5FTMA 2EW1A 1CIPA 3IO5A 5TXGA 2A5YB 3PR1A 4IRUB 1ZD8A 4D4MA 3MAAC 4G5GA 1PJRA 3MD0A 3RS0A 2JLWA 1JPNA 2OHFA 4DJTA 4EJSB 4HUQB 1YZLA 5G41A 3K70C 4KFRA 1KMQA 5SZJA 5DNYB 4GPTA 1RYHA 3SJAA 1F5NA 2QM7A 2BMEA 4Q4JA 3CM0A 1XMSA 1KDRA 2WWHA 3OIWA 4C0HA 4TLEA 2WWGA 1H8HA 621PA 2RGBA 1HYQA 1IBRA 3QI2A 2F6RA 4N3NA 1UADA 2PLFA 2WJGA 2CL0X 3HDTA 1V5WA 5IHPA 4NKRA 5E4FA 3NIBA 1U0LA 3OAAA 4HDOB 1Z2AA 5JJLA 3FDIA 1DPFA 2YC4C 4V0MA 1SGWA 2VHUA 3AF0A 3AM1A 2ZJ5A 1V43A 4DCNA 5AUNB 2QTVB 2C99A 5FPYA 5TVKA 3BBPA 1YR8A 1NG9A 1IXRC 3KJIA 1WBDA 2J3EA 1Z47A 1NKSA 2FN4A 1HT2E 1YZUA 3OEEA 1X8LA 1XF9A 3OESA 5KTYA 4D25A 1N5IA 1TQDA 4Q9JA 1OH6A 4BFXA 2GBLA 2WTUA 3CX8A 4DWJA 3A1WA 4LC1A 3U3JA 4M1WA 1S3SA 1E1RD 2OBNA 3WXMA 2WSSA 3OHMA 4DSUA 1W5TA 3MG9A 221PA 2W00A 4NBSA 3LWNA 4DUGA 1C4OA 1PZNA 2BMFA 5IT5A 2C9YA 2RGNA 3DOEA 5KUTA 2PX3A 2JATA 1I2MA 3U2QA 1ZM4A 1EFCA 3WHLA 1FP7A 3BAFA 1E2DA 4R98A 3VNVA 2QAGB 1MO3A 3SFVA 4ACAA 4L9SA 2LCFA 2HLDD 1MOZA 4FWIB 1KJYA 3SBDA 3UMFA 1GTVA 2OBLA 4Q4AA 3FHOA 1E0SA 1G16A 2X2FA 1CP2A 4CVNA 1E79D 3AF4A 3QPVA 4PFSA 5JWRA 1G8HA 4IEEA 5TB5A 1NSFA 4Q9HA 4KVGA 5FTLA 2F3RA 1CBUA 1NY5A 2ZE8A 4DLWA 3GLIA 1N0VC 4QGAA 4Z51A 4BLPA 2ZSBA 4A82A 1BYUA 4LYHA 4R71A 3MWJA 3BC1A 3K09A 4PHTA 4NCHA 2UZIR 4Q1EA 2F3TA 5KSYA 4D26A 5DI9A 2Y8EA 3B82A 3NVAA 2V1UA 1Z0IA 1HE1C 2OE2A 4BE7B 4D0NA 2QAGA 1EK0A 3NH9A 3QSYA 5K8UA 2NO7A 1NVUQ 4LGMA 2HF8A 3QOFA 2FZ4A 2P0EA 2X1VA 3DMNA 3BXZA 1JR6A 3IGFA 4AD8A 2ZI9A 3FKSD 3I1FA 4D4JA 1XD2B 4FI3C 1RPZA 4B32A 1WQ1R 4B34A 4E03A 3AKEA 1N6NA 4NCKA 3MWKA 2IUSA 3UATA 2A3RA 4OI0A 4M9XA 2ZVQX 2R2AA 3C5HA 1E2GA 4JMPA 3N70A 3TAHA 3ZS9A 2XAUA 5J47A 1XPOA 1R0XA 2E1RA 2AHOA 1DG3A 1E96A 2GK6A 1OIWA 4LUCA 5FUVA 1Q3TA 1NN1A 1WCV1 4M4SA 4Q1BA 5EXTA 5FOTA 3AVWA 3B1YA 4B3DA 1YZGA 3GEHA 3BWDD 5H68A 1NMYA 2H7VA 2OZEA 4RFVA 3HYTA 1B23P 4IFBA 3CIOA 2CCJA 1EGAA 3K0EA 1KI9A 4PPNA 1KYIA 5FI1B 3W90A 1COWA 3N5CA 3CF2A 2VRWA 3K0AB 1XD2A 4BUJA 3NDPA 2GESA 4ZPXA 5KDDA 3K70D 2QPTA 1SKQA 1XTJA 1MH1A 1FMJA 2JJ1A 4JLOA 3WYGA 4CRWB 1G41A 2IX3A 4US0R 1G3QA 4B3XA 3QKSA 4PZYA 4DDUA 2EFCB 1NMXA 4B3BA 4URXR 1OB5A 1R7RA 1S2MA 1XXHE 3LLMA 4HB3A 5J4LA 4TN1A 3FMPB 4OBEA 4TTRA 2CL6X 4QNMA 2WPDA 4V0LA 3LNCA 3C14C 4QBGB 1W2GA 3DHWC 5DN6D 4XD7D 2WJIA 3AVXA 1T8UA 1OE0A 4NP6A 3WHKA 1L8QA 5LDDC 3R9XA 1OB2A 1XMIA 2GJ8A 5G40A 3AVQA 2A5FA 2ZTSA 4YMSA 3ZDQA 1UBCA 4TLDA 1P6XA 1AZTA 1FW6A 1Z08A 2AK2A 5L8VA 3AF2A 3GPLA 1UKYA 1XEFA 2V7QD 2ZUDA 4YMTA 4M1YA 4PC6A 2OO7A 1N5LA 4JLVA 2CCGA 1FQJA 1DADA 2ZRCA 4PAQA 3HJNA 3VNUA 2ODWA 5FI0B 1N6KA 3N2IA 3Q5EA 2ANCA 3VHXA 3FMOB 2JIZD 1GRQA 1H8ED 4C2TA 1K5DA 1PUJA 2PLRA 1LB1B 3T34A 1DOAA 2VP4A 3RAPR 5JRZA 1KDOA 2QT1A 1P2TA 1QRAA 3PG5A 4R2HA 3AV0B 2OCAA 3GJXC 3GLGE 4DC9A 3U4QA 2VPPA 3T12A 5H8WA 2D74A 5GVSA 3WRXC 1BMFA 4IVPA 3W34A 4Q21A 3W5IA 5JS7A 5F3WB 4C30A 2GJKA 2JDIA 2ORWA 3LX8A 3RS3A 2ODNA 3QENA 4MKIA 1N2CE 1ZINA 3QG5A 1OFUX 2PL3A 3DO6A 4I1UA 1KNXA 3ZZ0A 3A4MA 1CLUA 1XNJA 5A5GA 5F9FA 3FGNA 2OXRA 4LRWA 4Q7KA 1J2JA 2IF2A 4QL3A 3SOPA 2TMKA 4ILEA 3KXIA 4WZAE 3IDQA 1VG1A 4JLNA 5KDLA 5EXPA 4ESHA 1RC8A 2HXYA 3TBKA 2EWWA 2ZYTX 1EFRD 3QKRB 1YRBA 5EQTA 2XTMA 5LD2C 4WW0A 1MV5A 2B7CA 2GZDA 1NNEA 1SVSA 4FD2A 4K46A 2JEOA 2CVHA 2QMHA 2BWJA 1I2DA 3THYB 5FBLB 1E1QA 3THOA 3A36A 4IJMA 4DB4A 4G3XA 4DDTA 1NBMA 2AK3A 1CXZA 3KX2A 2IWRA 3QXSA 2Q9AA 2GCOB 2DFLA 3RDPA 1XRJA 3NEJA 1FQKA 1AN0A 4KLNA 821PA 2QE7D 1A4RA 1GFIA 1QHHB 4W5HA 3VTKA 1JR3E 1L7VC 1DBSA 4I81A 2R65A 4Q18A 4GT1A 1AGPA 3KFVA 2NIPA 5F98A 2ZSEA 4AG6A 3ECCA 3QKRA 3RNLA 1W4AA 1AQUA 4B3GA 1KO5A 4KSCA 4LJ8A 5F9HA 4US2R 4U5XA 1GUAA 3B60A 1LV7A 3F0TA 3R9IA 4P31A 1SXJA 4XTRA 1IONA 2IK8A 1CEEA
chains in the Genus database with same CATH superfamily
4U6NA 5HF5A 3J7AC 2C4NA 2V7WA 2GYYA 2RGGA 2VSNA 2ZRAA 4L57A 1P4AA 1UKCA 4ARZB 2VZLA 1N8SA 1USGA 5EMKA 4PO8A 8OHMA 1RQLA 3O8OA 2QD2A 5ALXA 3C1UA 4IWXA 4U2KA 1YFJA 4YI5A 1NN0A 3T3IA 1WDKA 1T9KA 4P58A 1SC1A 3ZHSA 1OXTA 1M8PA 4Q4CA 1WBBA 3HJBA 4X84A 5F76A 2QUHA 1JB1A 1HT0A 1PEAA 3BMNB 3PFFA 3FKQA 4IG9A 1EM8B 1HSZA 4OQDA 5LDGA 5B7GA 2JNWA 5KMGB 2DCMA 5G4KB 5IMBA 4F4JA 3N8KA 3P4UA 1ODCA 1LSOA 3CH6A 2WJYA 1ZJ5A 2Y68A 4K9LA 4R81A 5E9QA 3KOOA 2ONYA 3TUZC 3KQKA 2VG8A 3M83A 2ZUEA 4G0MA 4V0OA 1NJ1A 5F35A 4PLCA 3T7KA 5F3WB 1AK2A 3G2HA 4R2MA 1EK2A 5C80A 2RI6A 4XM1A 1V11B 4NVRA 3I1JA 4ALJA 1VL6A 5K6AC 4Z4GA 3Q2OA 4YPFA 1IBCA 1C7FA 3IE0A 2B5OA 3P7MA 2VF7A 5DOZA 2WPNA 1ZCJA 4Q3CA 3KSUA 3HSSA 1K08A 2MWMA 3F73A 4D9EA 1S7GA 5HNKA 5D1HA 1Z45A 2WOOA 3A7EA 1P1BA 4X64B 2C3PA 5L53A 3I01A 3QTTA 4L3VA 4CT0A 3S2YA 1DQZA 2BKUA 1IE3A 4EA6A 3P1JA 4QD3A 2FN8A 2QJRA 3GFVA 1M8KA 3LSYA 3AETB 3BFXA 3W6OA 3PA8A 2IH4A 1OV4A 3LGAA 4DA7A 3VH3A 5E0KB 2G76A 1DDIA 2VWQA 2VYVD 4YQYA 1B00A 2HCFA 4IH1A 4MQLA 3T9CA 3TX2A 1T8WA 4EHAA 4F71A 3UJNA 3BQ9A 2W22A 1M8FA 1IN4A 1I3MA 1NC1A 1U3GA 3M6XA 3T7DA 3P0JA 4HFMA 4C04A 3IP5A 4PGHA 3AVUA 3TQQA 2II6A 3DXFA 4XLTA 3N0VA 4FNMA 3LLSA 2YVLA 1E2JA 4MB0A 4QO8A 3A6FA 5IYZB 1TUIA 1EP2B 2HJHA 3FPJA 4PX5A 2JASA 3UXYA 1R74A 2ATCA 2YIJA 4YUAA 1AA9A 4B2LA 2YJNA 3WWZA 3FPGA 3KQOA 3N86A 2Z98A 3E03A 3H19A 3RSFA 4A6PA 5BR7A 2I9KA 2ORIA 3R9KA 2Z4SA 1D6NA 2XGOA 3BD9A 3K71B 1YR2A 1QDLB 2JJ8A 2PWPA 4RVCA 3VGPA 2APJA 3GL9A 3OM8A 2PL5A 2W71A 3AR2A 4RD2A 5E1MA 3RO7A 4BQQA 5CT9A 4E5PA 1ILWA 3U26A 4P34A 5FNVA 1XPJA 4FYKA 4YCNA 1PLLA 1QRRA 3D2CA 1M8GA 2BTQA 5FNVF 4EKYA 4RZ3A 1AUQA 2I4TA 2CFIA 4PNZA 3UH0A 1R8QA 3ZCUA 4NCJA 3QLEA 2RH5A 4DT1A 5SV2A 3PE4A 1YIOA 4XM0A 1D5CA 3UZUA 1A50B 4YP7A 2B3TA 4U6SA 5KSPA 3TLZA 1CCWA 5ICEA 1A1SA 2D2IA 1O1YA 4KO4S 5C9ZA 4I9NA 2PYDA 2J8ZA 2VEOA 2W2XA 2YXNA 3M3PA 2AWOA 3MLEA 4MWEA 1R0SA 1XPRA 2PMDA 1LBSA 3NHWA 4N5HX 1MKYA 4LYAA 3HJAA 4NFHA 3U3XA 3PDCA 1NVXQ 2IBMA 2A7XA 3BILA 2QRZA 2AMFA 4I9GA 4JCCA 4DHEA 4UNQA 3QWIA 3AW8A 4Q3LA 1XA3A 3GLFE 3VO9A 3SC3A 4HPWA 3IQDB 4BBZA 4D9IA 1Z29A 5KQSA 1Q57A 3OICA 1ATZA 4YFYA 1KJWA 3L0IB 1Q1EA 5CCXA 3B7WA 3D64A 4ECEA 3L8CA 3QQ5A 2P1ZA 4P6VF 5AO9A 5JFOA 5T4FA 5H70A 3RUEA 4QDOA 1Z7YA 2CEAA 1ST2A 1XWFA 3NHPA 4EPYA 2XWQA 3WIBA 5EUQB 1P73A 4AKGA 4XPIB 1SOMA 3ITNA 4RA9A 1E6EA 2NYUA 2RIRA 3MC1A 3RC1A 2H2FA 2RGUA 3JWHA 3OCYA 1SM4A 1UBGA 1L4UA 1A4UA 2I8AA 2NSLA 4ZMSA 5A5EA 4C7OA 3IXQA 2XOKA 4ZYXA 4NEQA 4KXQA 1HLFA 4DS3A 4HNAA 4HRAA 1RHKA 3PE3A 4AY4A 3LY8A 4M0DA 2BD0A 2H48A 1P45A 3EDOA 4FOPA 4FP9A 4FMDF 5T5QA 3CLTD 4CT4B 3Q3JB 1XYGA 1Y81A 1SULA 3A28A 2ZUWA 3OWXA 5EYPA 5J9FA 1X7HA 1UPFA 2QX9A 3UT6A 1KO4A 3AC0A 3CSUA 1XMJA 1Y37A 1UJ4A 3HJRA 3H5TA 4UCFA 4EVQA 5FUMA 3ENNA 3PQ8A 1J1ZA 3IQEA 3ZQ4A 3ZD6A 1HH4A 1IPHA 4Z1MD 5DT2A 1IZYA 2XE7A 2QYOA 4JJFA 4CG2A 3V4ZA 5IMSA 1D4OA 1GP2A 3DXYA 4F04A 3H2GA 2FGKA 3EVEA 4QO7A 4WEOA 4Y7DA 3SEAA 2CLCX 1UJNA 1RI4A 1YONA 1PV4A 5FHQA 2AX4A 1KPHA 1GZ6A 3I3SR 3AUFA 4J2OA 1ZK3A 2F7SA 2GSDA 2IDKA 3LT4A 2DU8A 4KVFA 1ORDA 4U7FA 1YR7A 3SZOA 1FNSA 3MWEB 1XRQA 4TVSA 5C8DA 4BECA 1U1CA 1ACJA 1WW3A 3OE7D 3RIGA 1DCKA 1HC7A 1XAJA 2PYZA 4YJKA 2NXJA 4FJ0A 4MEAA 3VR4H 2BJHA 4A0HA 4ZCLA 1L9XA 4IIBA 2P11A 4GL4A 2Y99A 3BRCA 1VHDA 1E60A 2BEWB 2VC2B 2LPMA 4L5YA 5REQA 3FI9A 1Q0SA 4EI9A 4LTNA 3O8QB 3HR4A 5TGZA 1WB5A 1KEUA 1RR6A 2XA2A 2JLSA 2W2KA 2Z6VA 1KK2A 3UMJA 4FSHA 4OK6A 3ROPA 3WL6A 2J3KA 5CJ2A 4F21A 3NP7A 4BFZA 5HX7A 3VQTA 1QG0A 1HOTA 1QTIA 2Z4RA 1YKSA 2ONCA 2Q5IA 3QW2A 3UGQA 3FWNA 3D5EA 2V8OA 4QU5A 3WL3A 2ODQA 4YIHA 2VJBA 5L4SA 5LXTB 3LOUA 4YRZA 1WU8A 3CGWA 4MTLA 1Q1BA 3BHNA 4KTVE 1RMQA 1O7JA 3N53A 3OX4A 4B75A 4YLYA 1N9ZA 3RREA 2XXBA 3SDBA 2ZYRA 2H52A 4QVKA 3WL4A 5KTPA 2W8ZA 3OOHA 2A58A 3ZZMA 4A27A 4YMGA 3T7IA 1CZUA 1S9HA 1V35A 1KI7A 4BU0A 1HY3A 1BDHA 1R00A 5TPWA 1NI4B 3FTNA 1FRVA 3Q72A 1B15A 4PYJA 2UZ4A 1LFAA 1X6VA 3ZIAD 1E2BA 1YNOA 3DVQX 1ID1A 5IHXA 3EZGA 4BBJA 3OJLA 3EAFA 1T10A 3CC8A 1QJ4A 1CUVA 2OA0A 1H85A 3I4CA 5DHFA 4GWKA 1UZAA 3RUCA 5ECWA 5L95A 4BFSA 2PFSA 4BLSA 4XQCA 3UC5A 4DC1A 4UXHA 4EPTA 2CXRA 1CY4A 3WSWA 3F47A 4FGJA 1RNLA 4G1MB 1NHWA 4XE5A 1GPNA 5KHLB 3F71A 3GO4A 4QEDA 4CUZA 1J0CA 3IVCA 2J0SA 1N32B 3TNYA 3AG6A 2INGX 1A8PA 2NO1A 2DERA 1PUIA 4WHMA 4CMKA 1QHYA 4I6EA 2AG0A 1SC3A 2JIQA 2HY7A 1W87A 1PGJA 4PPFA 1CY2A 4LHWA 4LHZA 5CDSA 2BFOA 3R6WA 2YVQA 1C0EA 2A86A 3IP7A 3SHVA 2PS9A 4R0MA 3OO0A 1Q5PA 3B2QA 3KQYA 3LAWA 3DNMA 4YP9A 9GPBA 4ESVA 1E62A 2BF7A 4R31A 1TAHA 2Q5EA 2KSQA 4FSDA 4QT0A 5AW4A 4P5DA 3U7GA 1SBNE 1ZR2A 3L79A 2P5UA 1J2UA 4LSWA 3W1EA 3BICA 3L6UA 3PXXA 3HTXA 3CKLA 1UOQA 3TNDA 4FIDA 1B93A 5I4IA 1V5FA 1GSOA 2J3LA 3AHCA 2P9QA 3FWKA 4BN4A 2NZ8A 2H11A 3DOOA 4YP6A 3UKDA 1IZZA 1JR3A 1QKIA 2ZXUA 3ZZNA 2P0AA 1N5OX 2Q3DA 1QVRA 3EARA 1NN3A 3AJEA 5I8WA 4G81A 1M6VA 3KJGA 4GPEA 5E8JA 3MEQA 2DGDA 3JATA 4YASA 3OZEA 2VHEA 4LXQA 5LN1A 3FB1A 3KQPA 4ARVA 2J5RA 3B5JA 3D3QA 3GUHA 1DDOA 2O7NA 4ZANA 1Q7GA 4BN5A 2WU4A 3AOEA 4ZAFA 1KC1A 5CAEA 5HOEA 2OFPA 5KTOA 2EWMA 4GE3A 4JLAA 5BYJA 4LFCB 2X0RA 2C57A 5KO2A 4DA0A 1V4BA 1E8DA 1E9SA 3AUAA 4GI3A 4NMLA 1FK8A 1QF7A 3OCVA 4QG7A 4PINA 4A36A 3KJFA 2VKQA 3L7DA 2A7QA 5BO5A 3X43A 3MTJA 5FA6A 1PFQA 2K4MA 3BIWA 1TK9A 3PYXA 4RHXA 1DX4A 2OOKA 5LZ9A 4LS3A 4CM8A 1FPMA 1YSCA 3HDVA 2ST1A 4BWYA 1X8JA 1PFKA 3V55A 4Z9FA 2ZRQA 3O75A 5TJHA 2ZBFA 5FWXB 3MN1A 1U63A 5COAA 5GONB 4EQZA 1IB0A 2ZKLA 1YS7A 2ZDHA 3PJDA 4IFEA 4X54A 4XM2A 2YQ5A 2F55A 2I66A 4S12A 2XTAA 1DIRA 1MIOB 2DLDA 2B4YA 2C4WA 2VRCA 3N3AC 4L2IB 4OGKA 3TCXB 4CZ2A 5JROA 3ZWKA 1XZBA 1ZD9A 2HEIA 2VJQA 4ETNA 3D3KA 3IAM1 4MRNA 4XPZA 5BN1A 3TW8A 4QJ3A 1WDLA 1TIKA 4JP2A 4HZGA 3I52A 4OV6B 4YR7A 1EVIA 2D06A 4TT3D 2RDMA 4WFKA 2GF9A 5K3SA 3TPCA 1K5HA 3MJEA 4BQRA 4CTMA 2YWHA 1E2HA 3G7UA 4LE2A 5CBPB 1AKEA 5HBRA 3TW4A 2JFZA 3U39A 3OJEA 5FX2A 3PYLA 1NVDA 4IDOA 2PMEA 1G2QA 1RYEA 3OX3A 3RSLA 1G9TA 5EZ6B 3LQRA 5IZ4A 1USVA 2XXJA 4YGXB 1NFRA 1SUPA 3SVZA 1I9CA 1BYIA 4NONA 5IBPA 2HIMA 2PUEA 4PEVA 3GP3A 4U9UA 3QSGA 1BFKA 3KYDB 2D00A 3IULA 4B3SB 3CNOA 4NV0A 2H4JA 5EAIA 2PQMA 4FLEA 3FUWA 3M49A 3H99A 3JZAA 4QUBA 4C7KA 1VCMA 2WJZB 3T9AA 4U2CA 3V8VA 5BYBA 4A2QA 1EINA 5ADHA 2YWJA 1UPXA 1C3VA 1KKLA 2C0QA 4H17A 2G25A 3GGCA 3SDSA 4ZDIA 1DVRA 3SFZA 4BCBA 4F2DA 2A0UA 4E2ZA 3PGVA 2PWBA 3WGVA 2J5BA 1CHNA 5EE9A 1JFVA 5FD8A 3NTOA 1PJSA 1PT8A 3PEWA 1NVGA 2GYWA 3EVGA 1E6WA 4EKGA 4EX6A 3JVVA 4QARA 2WJAA 3V8QA 2Y6VA 2FCRA 4FOSA 4KMMA 1G9XA 5EJAA 2H9AA 3CUVA 2XECA 3HCCA 2DULA 2OHHA 3DW1X 3GGDA 4PC2A 4WN9B 4Z3KA 4DUYB 5IVIA 2QMEA 3WBFA 1A9QA 2D3WA 1SUFA 2FPMA 4H7IA 4JEIA 3CXUA 4RHYA 4IJWA 3M3HA 5DWQA 4WOCA 4EB0A 3P96A 4IZ6A 4L9WA 3PPWA 4UVHA 2HQSA 3A4NA 3VR4A 4UC0A 1KSHA 3K0CA 2H1WA 3GEPA 3DL2A 5M3BA 3C1TA 5BSWA 1RQGA 4X8LA 2AJCA 1IXSB 1Z2DA 2WU8A 1EZZA 3K3PA 2NXNA 2ZAMA 4M8SA 5F64A 1J56A 3U6BA 1MJGA 1GNTA 4M6WB 3SK0A 1K7SN 5I7UA 2EX1A 121PA 1UC9A 2F9LA 2JH9A 3IAAA 2XSZD 4RKQA 3ZQ6A 3HKBB 3TSWA 1JDZA 3A6ZA 2JCSA 1UPTA 2FI1A 5E9JA 3UENA 4MUKA 1OXXK 4UE3S 4DLXA 3IAUA 3R9WA 4XIJA 4MIKA 1C0KA 1FDVA 5BSMA 3EGXB 3G3EA 3VC7A 2B1JA 4G0VA 1JP7A 1MJNA 3TQSA 1MOPA 3CEJA 4EJ6A 4E5VA 3K9GA 5ESXA 3DFIA 3I9NA 1A5AB 1JIJA 1FDWA 3PC4A 3G5UA 3I5XA 2EG5A 3X44A 3CKYA 1XI2A 4NZMA 3FZNA 5DSZA 4C7XA 4TKUB 4YMUA 4JIMA 1JI0A 1XF1A 5BOVA 5EMLA 1Z0SA 4Y6OA 5E2IA 4PHCA 5EXXA 3UXHA 5AW0A 3DE6X 4BEVA 5DM2A 5IM5A 3MMNA 4KGDA 2H1RA 3BWYA 1X3LA 4YRRA 3UANA 4YRGA 4C0KA 5AICA 4OATA 1ZCFA 3L49A 3V1KA 4TTQA 3WLEA 3GD7A 2AWNA 3AF6A 3RSSA 4RHCA 3P9NA 2HCTA 4I99A 3K4PA 3STVA 1NUPA 3CU5A 1IFXA 3K72B 2XJ9A 3R6DA 2QY9A 3B6ZA 3O1HB 4HP8A 4QAJA 5GV7A 5F78A 3RVDA 2UAGA 4K88A 2HIHA 4AB1A 4C4TA 2CE7A 2OBMA 3NRBA 4QSHA 1B0UA 4GP6A 1EFVA 4U3JB 3GBVA 4KI0A 1G8PA 5DXFA 6ABPA 2HPVA 2UZ1A 2ZI6A 1H0RA 2NAFA 3L1KA 5C1IA 2VH5R 4R8MA 5CA1B 1LQTA 2ZSUA 3O73A 4LK2A 5HKLA 3BFKA 1FYDA 4BAUA 1I4EB 1R37A 3S81A 1U6KA 1E18A 2NO4A 1G9SA 5DIFA 4KXMA 2NAPA 1T6ZA 5KVAA 3T1HB 3PX7A 1Q83A 2AFIB 1TVEA 2XQVA 1ZH8A 5HWSA 5KJFA 2A5GA 5C1DA 5HZHA 3A06A 2AFHB 3JQRA 1XZCA 3IXMA 1QFXA 1Z6YA 3PV0A 8ABPA 4QBFA 2ZRLA 4D92A 4DRXB 4HZIA 1SZPA 4MULA 3G13A 5A4JA 2DH5A 1PR2A 4O4JA 4ZZ1A 4MMZB 5DIZA 5CH8A 2WE8A 2HTFA 1ZM9A 3I1IA 1F8YA 1YBHA 2VRBA 4NARA 4O4JF 4QATA 5CK4A 1KRHA 3GELA 3ZH9B 4E46A 4RTRA 4KZKA 1JA0A 1KFEB 2NQTA 5HK9A 3OVMA 3I01M 3OTIA 2AS0A 1UFRA 4FEGA 1Y4SA 1GADO 4TV8B 2X40A 2MCFA 3ABQB 2XOXA 1TVMA 1XCMA 1UAAA 3FFXA 1QMPA 4EG4A 3WLPA 1KJ8A 1X1QA 4OAOA 1QAMA 2NZ2A 3HP1A 2GEJA 2FRVA 1RYBA 1WUYA 2QPOA 2F1HA 2VAVA 3LZ6A 2VJYA 3QUTA 6CHYA 5JAHA 1I3NA 4D82A 2JIMA 4EMBA 4R68A 5JW6A 1JGTA 2R6R1 1CNFA 4HLUC 3KT0A 1NW4A 1QTRA 2G4CA 3LBAA 2GXAA 4JJZA 1N5RA 2J4CA 5AMXA 4Y2PA 2QBYA 2Y67A 3KIPA 1N5KA 3AM5A 4LKOA 1PQPA 1REQA 1JQJC 1Y1SA 2V7XA 1FNCA 3UFXA 1VQ1A 2B9EA 2EFDB 3LP5A 2J41A 4LJSA 4ITRC 3T0FA 1PHPA 2AHRA 4QSMA 2G4LA 2NQ8A 3VPGA 1MP0A 4Q3EA 1KERA 4F4UA 2UYHA 2XMBA 1B7GO 1YK1A 3FOZA 4UDYX 2AKEA 4KPFC 1M34A 2P4EA 4NENB 3ZXXA 2OCDA 3H3JA 5FORA 1T5OA 1GDHA 3ZXIA 1QNFA 3KQQA 4OH7A 1Y48E 3EG9B 3JRNA 1KNQA 2DFNA 1I01A 4JA0A 5DM1A 4X3PA 3QWBA 4ZVNA 5E95A 2IHZA 4I6JA 1WXHA 4FD3A 3ESQA 2NUBA 2RGNC 3O26A 4KO8A 4P0TA 2FUKA 3IQGX 3HB4X 2ODEA 5CLQA 3SS9X 3TB4A 3ZWWA 2D5AA 5EMMA 2PX4A 1TEHA 4ZC8A 4CU2A 3N9IA 3P0HA 4XGNA 2OORC 1EK6A 3Q9LA 4EYEA 3IP6A 3PSAA 1MNAA 1DQNA 3EY4A 3IVXA 1GRRA 5ER9A 5AW9A 3K30A 5DNDA 3WLNA 2J9XB 5KX5F 5JHGB 4L78A 1L2TA 5TJ9A 4ERXA 2AOVA 2ES4A 2QROA 3I2GA 4HEJA 3V4FA 5TQ2A 3WTBA 4EBBA 1Y1LA 2Q1UA 1GJRA 3ZVKA 1KOGA 2I7TA 2CC2A 2J3MA 3IHLA 2I3BA 1RBYA 1RAFA 3PFBA 4RD4A 3UCEA 1M6YA 3GXOA 5KYTA 3S1SA 3DEYX 4CM7A 4CQLA 3KZNA 3QEKA 2WMNB 4AL4A 1J0AA 2OQRA 1T8TA 4B71A 4CKCA 2EJVA 4O4HF 2UV8A 3K09C 4B79A 1QIIA 2H1IA 3A2KA 4B6RA 1ABBA 2OAGA 3WBBA 2PKQO 4KR6A 3WGMA 2QA5A 1OBCA 2CL7X 4M8IA 4WOJA 1N4AA 3T54A 4ZV9A 2UZ3A 4ZCTA 2P6OA 1PHRA 5B3KA 7ADHA 3BDAA 2O7VA 2CF6A 1J5PA 1EIZA 1IRXA 3WB2A 2FR8A 5SZHB 3QLTA 2EIHA 4RWEA 1T3GA 2WMDA 2CVFA 1FMCA 2FF5A 3DE7X 1VKHA 3Q7EA 3HXMA 5DCWA 4PHHA 3KLOA 5FTKA 3QMMA 2ZJBA 4RK1A 4ROTA 4DQDA 2I8CA 3P9XA 5DCYA 3GQBB 4HADA 4DIUA 3FA2A 4NTZA 1GN9A 1S2IA 2XWJI 5LB4A 3OZXA 3FE2A 5C8ZA 3A9TA 1KQOA 2V4UA 1JAZA 2QXUA 4MQEB 3L0BA 1UINA 3GRPA 5B2EA 3HEBA 4ND4A 5IC5A 4X62B 3IAM6 1RJDA 5KYKA 4LXTA 3DXZA 3TLXA 1PDVA 4ND5A 3QQPA 4A26A 4IP0A 1KIFA 1XCBA 3IEIA 4X97A 5J40A 3U4DA 2OMEA 4RH0A 4BKRA 2PZEA 2ERYA 3EJWA 3N2KB 2R1VA 1T2CA 1CUCA 2PKCA 3H4IA 3IB3A 4CR6A 3DVAA 3UWKA 4GAEA 5AVSA 2ZI7A 4V1CA 2Z43A 5AESA 3F90A 2WHYA 1MAAA 1YZNA 1WCWA 3EYWA 4N39A 3I9V6 2JFNA 1JBQA 2QQEA 3ZW7A 5GIOE 1JHZA 1K88A 4HTAA 4Y2SA 1NV9A 2ZUVA 1KBZA 3W2IA 3JD4A 2JHCA 2PXHA 3L7LA 4B8WA 3IUJA 3WAJA 3C3JA 4G0WA 3QVGB 1YJAA 3OX1A 4Q6WA 1GPUA 2A5LA 4H60A 1JDPA 1ZKDA 3U19A 3IKJA 5FQOA 3V7WA 5AM4A 1JMYA 1G5FA 3LO5A 3GT4A 3TR0A 3T5DA 1Q0TA 4BZWA 2JB9A 2OV2A 1KXZA 4OK5A 3KOMA 4GPAA 5ICSA 4LGVA 2R6ZA 4N8DA 5J1SB 1U0BB 1DRJA 1H4VB 2ZU0C 1WVIA 1J2TA 1YL6A 2B1QA 2LZ0A 2QSZA 4YHBA 4C0AC 4EB3A 4KLRA 2KE5A 2PAAA 1ORIA 5CYOA 3DULA 4LX0A 4GLFA 1RMTA 3SF8B 4B6SA 2IJGX 4RACA 2R8RA 4KFSA 1G8MA 4YECA 4LY9A 5D51S 3LHDA 1OWNA 3MUEA 2JIOA 2C2MA 1OZHA 2A1TR 3LX6A 1Z35A 4O8CA 1VCOA 3B6EA 5AD1A 1K3UB 2WUFA 3KJQA 4ZEOA 3GGSA 2BIFA 3WO0A 5CFZA 2AKAB 1Z6QA 2GPBA 2PKWA 3DZDA 1X70A 3RFFA 3HWRA 1QO9A 1I7LA 1JR2A 1JLSA 5FTWA 5BN3A 4D9HA 1GKKA 2G1PA 2HSEA 2W4IA 1N57A 2ID9A 2GK7A 2H4WA 2PMWB 3AF5A 2QQ5A 4KQXA 1L5KA 3UXMA 1ZMTA 4ABTA 1TM3E 1ZVKA 3BGVA 4QM6A 1QLJA 3FNQA 4J7CA 1XP5A 1W47A 2IEIA 4K40A 5EINA 3X3HA 1KZ7B 4BRUA 2C7RA 5CTAA 4HXFB 1A76A 1P1CA 4MQFA 2M1ZA 3KR2A 1XU4A 4RVGA 3OEED 1CUIA 2C1ZA 4B3IA 2RCNA 1GZHB 1PTKA 1WW8A 1XTUA 2VA9A 4PHGA 4F7DA 5TEWA 1EBBA 3ROMA 2YWEA 2Z56A 1ISPA 2I22A 1L5QA 4OBBA 1FXWA 4O1HA 4RDIA 3PXGA 1VCNA 4A6EA 4ZK2A 1FXWF 1NXVA 1ZYUA 1C7EA 1JHDA 2GZRA 4PQGA 4C5CA 1AB6A 2OZLA 3D1VA 4GZ5A 3VO2A 4DR4B 4EW1A 1P60A 1RRVA 4NK4A 3E9RA 5KYYA 1M6WA 2Q5HA 2PU7A 4WCDA 1T2NA 4I55F 1E3TA 4TGLA 3EC7A 4QDJA 2BKXA 1W6RA 4JB0A 4JQYA 2KW5A 1BHJA 1ZVJA 2LVBA 5K8IA 3LBIA 4Y6SA 2D5BA 5ANRB 1CNEA 2HFJA 4S0XA 1VPWA 3AFOA 2KYRA 3AUXA 3Q8WA 4URZR 3WJ2A 1DO0A 1CQJA 2AQKA 4QVIA 1Q1ZA 3OZDA 3PDJA 1XRRA 3ZZ1A 1Z26A 16PKA 1Z62A 1DO2A 5K1ZA 1QONA 2GN9A 4BGDA 4FDAA 3CR7A 2XF8A 4EL5A 2FDCA 4CI0B 5L9AA 1QUEA 4G25A 4K5QA 3KTAB 1YF3A 4TL8A 5A02A 3QFSA 4BNZA 1ZAKA 4R3WA 1IN6A 2BGIA 4ZCQA 3AKDA 1WQ4A 4FJ2A 4ANFA 4YT4A 4X5OA 3JQAD 1Z22A 4CQMD 4UXIA 3H1PA 3F4KA 4WNAB 4KWEA 3AVYA 1E9FA 2WAXA 3E2PA 3DT8A 3KKPA 3ROKA 3AESB 5H5JA 2YVKA 4DCJA 2NZXA 1C1XB 3AIOA 3RRYA 3GRFA 5FQNA 5SZIA 3LH5A 4EEZA 3BJIC 4XJXA 4AF8A 5JNRA 5L3QB 2ECKA 5DN6A 3A6PC 4XD7A 5KQRA 3SBEA 3J81A 3WK4A 2WFLB 2VNAA 4GBJA 3ICOA 2VK1A 3PCTA 3U3MA 4EZEA 1QUFA 4YACA 1VKJA 2WOJA 3QVOA 4BAGA 1BJKA 5H1YA 4J0IA 4EB6A 5BY2A 1GGNA 2RE8A 3CUUA 1UDXA 3ZU6A 4P22A 5IH7A 2AI2A 1NYLA 3TTYA 3HWWA 5GJBA 3OCXA 2F90A 3PF9A 4RTQA 3V9PA 1EJ2A 2P9EA 4UOZA 1VTKA 1QRTA 4WFIA 5EIOA 3VPFA 1QNLA 3W5VA 4GD3Q 1UFKA 3Q5DA 2PMKA 1QYIA 2EVWX 4P4UA 1V5IA 3O1JC 1IQUA 1NF3A 1Y8QA 3I28A 5ITSA 2Z95A 4OG2A 3H2YA 2H7CA 1S96A 3GRUA 2HA5A 3BWEA 4O63O 4A0RA 4HTFB 2FGJA 4C03A 4DNXA 1XPUA 2RKBA 1PJ2A 2BZSA 2W83A 2WJ6A 4XEUA 4ZT5A 3WHIA 2WZCA 3AINA 5HILA 2P75A 3SC2A 2DP4E 3EUEA 1VIAA 1XTPA 4AN1A 4G5SA 4BOYA 5AVWA 1J7JA 4XVUA 1SXPA 3ASVA 4G2TA 5DM0A 4NCNA 2MOKA 2VYCA 1BDMA 1ZUIA 3RHSA 3GLUA 2ODTX 1ZU5A 3V5NA 4BKUA 3CKMA 1QQ7A 4LK3A 1YQGA 4ER6A 2AIRA 3GIDA 5B58C 3GFTA 3GLHA 1RLJA 1SK9A 4UFNA 2FEKA 2JJ1D 4TUYA 4L08A 4UBLA 3COWA 1ULTA 2BW0A 1CRQA 1P6UA 2FB9A 1G8SA 1XZ8A 2FSIA 4TUYF 4LFAB 2GEVA 3O8DA 1O0BA 2VQDA 3CQ9A 4JBWA 4BWFB 4Q00A 4BNXA 2IOFK 3AVOA 3EWIA 3OKAA 1Z73A 3WMEA 2PWAA 3S1AA 5B64A 4B8YA 4IMPA 1SUWA 4LDAA 4PX3A 1UBRS 4M1SA 5DH9A 3GUUA 5DYNA 3HKDB 1Z2OX 4QTTB 3Q3EA 4HNHA 2XYVA 3E35A 3KKZA 4RF4A 2R60A 5AH0A 3ZZTA 3I6IA 5C8VA 1GQFA 1O9HA 3Q0TA 1PDOA 2IQ5A 4ZDKA 4Z49A 2MSDB 5LNK1 3NWJA 2D0DA 1K06A 1F1JA 5LYJA 5FH9A 3B3QA 5M5BA 3BIJA 2HO4A 3I76A 4K6HA 2JLRA 4URHA 4XVRA 3O8CA 2P2GA 5LYJF 1IY1A 4X95A 2XYPA 5EKUA 3F46A 2XIJA 8MHTA 2H4XA 1X7YA 3H2ZA 4O3FA 4RA6A 3RCBA 5EJ2A 2FPIA 3NHZA 1Q91A 1GFZA 4QFDA 3X1WA 1Z82A 1PNVA 2H5EA 2HQBA 2ZSFA 3PENA 3DPSA 4XOIA 4HVCA 5KYXB 1NP7A 3ABRB 5FP0A 1JLMA 5HFJA 2DZDA 5IH3A 1RKXA 1FNNA 3RJZA 2Z1NA 3BQMB 1RBMA 4ZOEA 4CLDA 5K3BA 3EPLA 4DA8A 3D5TA 4WBNF 2GHRA 4H7EA 2TRSB 2C92A 4XA8A 3IQHX 4BMZA 1Q19A 3B1KA 1J00A 4KRXA 1O96A 2Z5LA 3BTVA 2JIRA 5D3MB 4BQOA 4Y9UA 3PRJA 5FPQA 5CNJA 3KUXA 5DASA 4A5OA 2P79A 2X4GA 1E8MA 2OUKA 3I9MA 1S0UA 3WAGA 4ND1A 4YJFB 4DTCA 1NF8A 3GYBA 2E4UA 4LWQA 3O6VA 4AY2A 4GWLA 4LIPD 2E89A 2RBGA 5AHKA 1M74A 1R16A 3W5DA 1BMFD 1R4AA 1AB5A 1RZVA 1U98A 2WAMA 4AG5A 3KSMA 5FULA 5MN4A 1MJGM 1RC1A 4ALIA 5DO9A 3BQNB 4BMSA 2DQKA 1KAGA 2WJHA 2ESRA 2G09A 3QE0A 2FFHA 1QGED 4QDUA 2ENUA 3TN7A 1Z4LA 4H59A 1CUUA 2OLEA 3QYJA 1A9TA 2BP7A 3E84A 1GTJ1 5A4IS 4BUCA 2BEVB 3LGSA 4ADSG 5C5EA 1U2SA 2O2EA 3PQ5A 4RK7A 5HIJA 3ZUGA 2FW8A 5DM60 2UVQA 1E32A 4H6XA 1KEWA 1JXQA 5KJEA 3DOFA 3OU6A 3M2TA 4WKPA 5G3ZA 4E13A 1PYOA 2QG4A 3NRCA 5HFAA 4WUVA 1H2RS 3B1WA 2CNNA 2QM8A 3C8ZA 3GJTA 3ICCA 4L0QA 3A1TA 3WLHA 1EXVA 2DKOA 3CISA 4FBGA 4KLZA 5EPEA 4BIMA 3BXOA 5M34A 2VT6A 2H18A 3U7JA 2ZYWX 2JFQA 3EA0A 3SNHA 1AG9A 2PZBA 5CA0F 5IUNC 1BO6A 3Q3VA 1XEWY 3IV7A 2JFPA 3CLHA 3LXUX 4TLMB 2A33A 5IVKA 3A6LA 3MTQA 1K4KA 3UPDA 3R7BA 4ZYZA 3K20A 3HRKA 5K01A 4P54A 2GTPA 3DMFA 4G63A 4GM0A 4QULA 1A9SA 1HA3A 3L9XA 1QZUA 1RXSA 3W9UA 1G6OA 1KVRA 2K2QB 4LQCA 4TVOA 3WWOA 1YQUA 1LK7A 2YS7A 1JLHA 2OVBA 4H0FA 4ZO7A 3VHRA 1PZXA 2FJUA 2GWRA 2SECE 2MYTA 2VUHB 5DYGA 1FQWA 2GCIA 5BV2P 2KPOA 1CF2O 3E3OA 2EBUA 1CJMA 5JSUA 1FVOA 2VPIA 4KN9S 3R8FA 3G7SA 2GF2A 2GAIA 3B1VA 4IIXA 4KO1S 4OQNA 1BA2A 1G7SA 1D1SA 1UAYA 3W5CA 3HZHA 4HQNA 4RK0A 1U8UA 2O5VA 5EZSA 1PJ4A 2CK3A 2ZR7A 5AJZA 3EVZA 3PCXA 3EEYA 4XIIA 2H2GA 5K8CA 3EOZA 1I2AA 2X7JA 3HN2A 2DFVA 2W6QA 3RSGA 3HB5X 4ME6A 3BERA 4CKWA 3CT6A 1LRJA 3ORYA 4PQEA 4JGBA 4E2WA 2XBLA 1GGMA 4WCFB 2Q6KA 2XTJA 1W19A 4MKGA 3NKLA 1X1DA 4K03A 2FPGA 3B48A 3IMCA 1BXGB 1L7XA 5FHRA 3WA6A 2I4NA 2Z1DA 2WKRA 3HU5A 3PI6A 3FIUA 5IKXA 5TE9A 1Y4ZA 2WK1A 4HLUA 5CB4A 8GPBA 4B6OA 2QTTA 4WKBA 1DWQA 2SNIE 4B4KA 4CLRB 1RWOA 4RD0A 4J4TA 5BRAA 1NIPA 2AF3C 2Q5LA 1QM5A 4HN9A 3ASZA 4L28A 1RIIA 3FCXA 1TQ2A 4RBNA 2VP5A 2ZB3A 1GZSA 1TLFA 1K2VN 3H1GA 2OCYC 2F1RA 4BU1A 1Q7CA 3PUHA 4MWTA 1PJ8A 1RKQA 4NMMA 4L85A 3MXOA 2E1PA 5EE1A 5I7EA 3OM0A 2B21A 2D1TA 3LBNA 1PBTA 4EYGA 4X7MA 4ZWNA 3HY6A 5JEDA 3MBIA 1RWWA 1Z0ZA 3KHKA 2VHWA 1OILA 2RHCA 1E2NA 2AC4A 2Z0MA 1AC5A 2XUJA 5FWDA 3IBSA 3DB2A 4LNUA 5EE5B 3ENQA 2Y0CA 1AGXA 1U9YA 2VF8A 4RV4A 4LMPA 1A8QA 1LLUA 3E2IA 3VDRA 5JHHB 2ZXFA 5ALNA 1UOEA 1T9AA 4YH1A 5ALWA 4OHZA 1QOQB 5IT4A 4BGIA 1H94A 1RI2A 1PL7A 2XCQA 2IS4A 3MVEA 3E8XA 4QTZA 2DWPA 3RLFA 1D1PA 2HV8A 4QZVA 2FPKA 3E1GA 1QQ5A 1JBEA 3H83A 4ITVA 4K2AA 5LJLA 4IHJB 3THXA 2C96A 3N5KA 3BFVA 3H9JA 2EJWA 2IYLD 3G2PA 3K0HA 3R40A 2QZPA 1LVUA 3VU1A 1WAMA 3INNA 2XZPA 4FQ8A 4LHXA 5G0VA 4BE9A 1I4TD 4MA0A 2ZE6A 4DCPA 3INYA 3P5SA 1QX3A 3AHEA 1F3OA 1K0UA 3LPDA 2PWZA 3ROQA 1KEEA 3J80A 4AJ9A 2YHSA 1XZHA 3PC6A 4BLUA 1XRPA 2V7GA 4QAQA 4Y1FA 5EHQA 3SX4A 4JNKA 1RWVA 1A1VA 1TUBA 3TECE 4DEVA 3UAVA 4YRBA 4IUBS 3UK1A 3I9JA 4OGFA 1JQDA 4OYYA 2QUAA 5DDIP 2NPIA 3THSA 1DAHA 1A5BB 1M5RA 1BC5A 2E4VA 1FJHA 1YOVA 2G9ZA 2FRXA 2QW1A 2PH1A 2YVUA 3P4XA 1ODSA 4IDEA 5DYTA 5JQGA 1JG3A 1YIDA 3MUFA 4P9NA 1LSUA 1YRWA 3DEIA 4Y2QA 5JQGF 2HSDA 5J2TB 1KI3A 3UB4A 1RRPA 3G9TA 1M7HA 5DT9A 3QX7A 4CV2A 3R8CA 1DEXA 1JJIA 4RSRA 1RQRA 5IJZA 3OHPA 3L6OO 3C8DA 4W8GA 3KR0A 1MZPA 2ZETA 3KPJA 1VKZA 4BVGA 3FVTA 3QKSB 2OILA 2JCBA 2C78A 2XTNA 5LWHA 4EF4A 2AB0A 2QVXX 1I7SB 4QPPA 5KKCA 3PGLA 1I32A 3QOXA 4MI1A 1VMEA 3LPAA 4OQFA 1ADYA 3AP2A 3ZNOA 5I9NA 1FTQA 4KACA 3PDUA 1YKGA 1VLQA 4MVJE 3V4SA 3VTZA 3RT7A 1ZMXA 2QTAA 2ZIXA 2IGBA 2IPLA 1FS5A 1U94A 2P27A 2A67A 5AJTA 1DLJA 3IHWA