4F4OC

Structure of the haptoglobin-haemoglobin complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
314
structure length
309
Chain Sequence
CPKPPEIPKGYVEHMVRYHCQTYYKLRTAGDGVYTLDSNKQWTNKVTGEKLPECEAVCGKPKNPVIMGGSLDAKGSFPWQAKMISHHNLTSGATLINEQWLLTTAKNLRLGHKNDTKAKDIAPTLRLYVGKKQEVEIEKVIFHPDNSTVDIGLIKLKQKVPVNERVMPICLPSKDYVNVGLVGYVSGWGRNANLNFTEHLKYVMLPVADQEKCVQYYEGSTVPEKKTPKSPVGVQPILNEHTFCAGLSKYQEDTCYGDAGSAFAVHDKDDDTWYAAGILSFDKSCRTAEYGVYVRVTSILDWIQTTIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemoglobin subunit alpha
publication title Structure of the haptoglobin-haemoglobin complex.
pubmed doi rcsb
molecule tags Oxygen transport/transport protein
total genus 68
structure length 309
sequence length 314
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4f4oC01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4f4oC03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4f4oC02
2H2ZA 4Y8ZA 4LOSA 2XC5A 3PO1B 2HOBA 3SU4A 4B73A 2HNTF 2XYAA 1FLEE 1AGJA 5CHAC 4ZROA 2GT8A 3DFJA 3SNDA 3A81A 3P8FA 1AUJA 2W3KA 2AH4X 4I8KA 2BD3A 3GDSA 1T32A 1SFQB 1PJPA 1QL8A 2UWOA 3FP7E 1W3CA 4X0WU 1QR3E 2ZU3A 1TBQH 2KRIA 3BTFE 1KY9A 3A7YA 1OK3A 4I8JA 2JH5D 1O2WA 1TA6A 2VJ1A 2BZMA 1ACBE 2B9LA 1IQFA 4WH6A 1RGQA 4FU8A 1O32A 2ZZUH 3D65E 1FIWA 2QA9E 2R0LA 3M5LA 2MCZA 2ZFRH 2WPJS 4ZHAA 3TJOA 3T27A 1KXEA 2UUYA 1SSXA 3PWBA 2FP7B 4B74A 3GY7A 5DP7A 2GCHG 1DLKB 1C5TA 3RXPA 3UTUH 1QBNA 3TNTA 3NPSA 1NTPA 3INBC 4RSPA 5ABWA 1O2KA 4NFFA 2QF0A 1BJUA 2UWPA 2RA0A 1AB9C 1EB1H 1W7XH 3C1KA 4XBBA 3UFAA 4K5ZA 5JB8S 4OS6A 2ZDVH 1C1RA 3AVZA 5AHGH 4BAOB 2J4IA 4LK4A 2GCHF 2GTBA 4THNH 1BBRH 3EAJA 3RMOH 4AYEA 3GCHC 3K65B 4B71A 3LGIA 3GOVA 5GIBA 4I8HA 1NC6A 1EJAA 1UVTH 4WVPE 1O2NA 1SGRE 4ESTE 1QURH 4UFEH 5IDKA 3ZVAA 1OWEA 1WCZA 2VGCC 3S0NA 5BPEA 1C4U2 2SFAA 2DE8A 1C2FA 3URCA 3CALA 1V3XA 2Z9LA 1ANBA 1D3TB 1ZHMA 2QC2A 3S7KB 3ZVCA 2WPKS 1GBCA 1WTHD 4FU9A 2RKZA 1TABE 4XOJA 5K7RA 2FOMB 2HPPH 1BT7A 1YPEH 1EP5A 4I8GA 1T8LA 4MUCA 3ZVDA 3SJ8A 2GDEH 2NU4E 1A4WH 4CH2B 2QYIA 3MOCA 2RDLA 4GAWA 2Y5HA 2PKAB 3RXAA 1A2CH 3A8CA 1OWJA 1VVCA 2AGIX 1A61H 4BAQB 4LOTA 4C16A 5EXLA 1AHTH 5FCRA 2BVRH 4O3TA 4R8TB 3SGAE 2ZEBA 1AKSB 4CRDA 1UMAH 5C5OA 2ZDNA 2MCYA 3E1XB 2FTMA 1FONA 1GJ9B 1DUAA 2BDGA 4UFDH 2BLOA 1QHRB 1K1JA 1K9OE 2TGPZ 4AORA 3NZIA 1ELBA 1DLEA 3GCHB 3SI4H 2FOAA 1AO5A 1O5BB 1XVMA 3TH2H 2BYAX 3RXHA 2XCNA 3UNQA 7ESTE 3AW1A 1P9UA 4DCDA 1P57B 1SPJA 2OC8A 2FODA 3OTJE 6CHAC 1MKWK 2QIQA 3SU1A 2JGWA 4X1RU 2VGCB 3M3SA 1IQIA 1C5UA 1LQDB 4Y8XA 5L2ZH 1OP2A 1TBRH 1VJ9U 2Y82A 1XX9A 1P04A 3RU4D 4FUFA 5C1UA 1ZTJA 3M5MA 1OYQA 1V2UT 2ZTZA 4H42U 4J38B 1G3DA 4Q80A 2NU1E 2BD9A 3QO6A 3SBKA 1S83A 3SV8A 1TGTA 1S82A 3PWCA 2XBWA 2R3UA 3E0NB 3E8LA 4JZDH 3SHAH 1GBAA 4CSYA 1SGYE 1W8BH 5AVDA 4U01A 1DWCH 1MTSA 2PLXA 1TQ0B 3LT3A 2OQ5A 1O2LA 3LOXA 3M5NA 1OS8A 3F68H 1VITG 3ZVBA 1E0FD 1P09A 1O5GH 2RLPA 1D4PB 3NK8A 1FY5A 5B6OA 1FAKH 1ELGA 1GCTC 4K8BA 8LPRA 1OP0A 3GY5A 4ZH8A 2YNBA 4ZXYH 1H2QP 2Q6GA 2BY7X 1Z8IB 3ZZ3A 3MH5A 1O3JA 1W10U 2QY0A 4FUJA 3RUOA 2Z9KA 3KQCA 9ESTA 1B0EA 1GHWH 4A92A 1ZOMA 2IZ4A 3LGTA 4OS4A 2Y7ZA 3R0FA 3SN8A 1KDQB 1HUTH 3GY3A 3U69H 1YF4A 1Z71A 1YLDA 4NA9H 1JIRA 3ZYDA 3D49H 1IQEA 4AFZA 1FN8A 1BTWA 4RKOB 1FY1A 1SGTA 3I77A 4X8VH 1EQ9A 3UY9A 3UIRA 1IQNA 2H5CA 3A8AA 1TX6A 1SGQE 1H9IE 1UTQA 1FMGA 3TK9A 3MTYA 1OXGA 2BY8X 3HKIB 1O3HA 5L2YH 1THPB 1HCGA 1KXAA 3F9HA 1UK2A 1MU8B 1OSSA 2UUJB 3DT0H 1XUFA 4DURA 3JZ2B 3UREA 2TIOA 3GOVB 2TGAA 3HATH 3PMHB 1P2OA 1BQYA 1C1QA 2BX4A 3QGNB 2F3CE 1C5MD 1XUGA 3M7QA 4ZXXH 1YGCH 1SL3A 2AYWA 1A5HA 3A88A 1EAWA 3BTKE 1C5PA 3P6ZB 1QIXB 3GCTG 3SZNA 4NZQA 3T5FH 3OSYA 1C5ZB 4E05H 1GI3A 3SUGA 3QGJA 1QGBA 1GBEA 3HK6B 3M37A 4DIHH 1IHSH 3F9EA 1AD8H 1FPHH 3VGCC 2A0QB 3MYWA 5JBTA 1S5SA 1YCPH 3AW0A 1HJAC 2H9HA 2ZDAH 5ETXA 1A0HB 4ABEA 3ZZCA 1ZTKA 1NFUA 1EAUA 4K12A 1LHCH 2YOLA 1MMJN 4Y7BA 1ZSLA 3RMNH 1LVBA 1SGNE 5ESTE 1UCYK 4TWYA 5I46H 3KL6A 5EGMA 1AVWA 3GY2A 1OPHB 2ZDKA 1DM4B 4F4OC 2QXJA 1AFQB 2Z94A 1M9UA 2FI3E 5C67A 1XKAC 4ABHA 2O8MA 1W13U 3B9FH 2PR3A 4ZKNU 1EPTB 5LPRA 1AN1E 1S6HA 3GY6A 2BQ7B 2Z3DA 1CE5A 2JH6D 1PPFE 3K2UA 4AYVB 1G36A 3ZZ7A 5T3HA 2AIQA 2A31A 2J38A 3K6ZA 1NS3A 3OY6U 3UOUA 4MNXA 1XKBC 1BCUH 1Z8GA 1IQMA 1ZJDA 3HGPA 1PPQA 1F5KU 1WAYB 2M5TA 5EW2H 4A6LA 1ZZZA 2D8WA 1GVZA 3KNXA 1DSTA 3TK5A 2BDIA 1AE8H 2J92A 1FPCH 1E38B 1TPOA 2G81E 3H5CB 2J34A 3VGCB 3QTVH 1EB2A 2ZCKP 4AFQA 1CQQA 1HJAB 1D3QB 1GGDB 1F92A 3EGKH 3A7XA 4MVNA 4OGXA 2FX4A 2K1QA 3E90B 3V3MA 3SUEA 1P2QA 2WV5A 3SQHE 3PROA 4F49A 1IQHA 1UTLM 2XWBI 1UO6A 4XDEA 3SJIA 1SS2A 1YPKH 2J95A 3QX5H 1TQ7B 1OK2A 1GMDF 1ZGVA 1C4V2 1XXFA 1BMNH 1GL0E 2CMYA 1KIGH 1C2LA 1TRMA 3SV7A 3PM3A 5I25A 3LH3A 5GWZA 2B7DH 2ZCLP 1O3IA 4PROA 4WXIA 1NO9H 5A09A 4UONA 1ZMLA 3PV4A 2G4UA 3QK1A 2QY0B 1F7ZA 1THSH 3F1SB 1OOKB 4B2BA 3OX7U 2G00A 3TJNA 1ZSJA 2J9NA 2DUCA 2BM2A 3RU4T 1T8MA 2GP9B 4MLFB 2EI7A 2NU2E 1P2IA 2OCVB 4TY6A 3VXFH 3GCOA 4NIVA 1O2OA 3LGWA 5C2ZA 4YESB 4NGAH 1QUBA 1TNKA 3KZJA 1K28D 1L1GA 2ZA5A 4SGBE 1ELFA 3VB3A 1O33A 5HGGA 5HM2A 5A8XA 1OWKA 6ESTA 2P59A 4MNVA 1LPGB 4AG2A 4CRBA 1NU7B 1LMWB 3SU6A 1TPAE 1V6DA 3LIWA 2XRBA 1V2KT 4ZHLU 4JYUH 1LVMA 2TRMA 1V2LT 1CHGA 3O8RA 3U8TH 3BTHE 4BTIB 4X1QU 4GHTA 4CHAC 3LGUA 1S81A 1NZQH 2GCTB 2A4GA 4M7GA 4IC5A 3MU8A 1HAGE 4AX9H 3BTQE 2XC4A 1UTNA 1MKXH 1L4ZA 1O5EH 1DITH 5FPYA 5HXFA 4NWLA 1E36B 3RXMA 1WUNH 2XNIA 1UK3A 4PZ5A 2VINA 1TMBH 1PQ8A 2BQ6B 3U1JB 4IN1A 2FI4E 3S9AA 1GMHG 3BTGE 4NSYA 3N7OA 1ETTH 2XCFA 1J15A 1V2VT 3P70B 1GG6C 1DY8A 2FMJA 2P3FH 2PGQB 3T62A 1AIXH 1BTXA 3FANA 1Z7KA 1O38A 2KAIA 3GICB 1ELEE 4DGJA 2XWAA 2A4RA 4YOJA 3SGQE 1SGIB 1HAZB 1QA7A 3PMJA 4YOIA 4D8NA 1ZSKA 2ZPRA 1NPMA 1HAYB 3MU1A 5F8TA 1P0SH 1P8VC 2STAE 3UOPA 1E8BA 2R2WU 3RXRA 5F8XA 7KMEH 3GCNA 1YPLH 3JZ1B 1C1ZA 2CHAB 1C2DA 3D62A 3QDZB 2B8OH 1ESAA 1TPPA 5TCCA 1DOJA 4D7GA 1MBMA 3EA7A 4AGJA 2ULLA 3RLWH 1QRWA 1XVOA 5FPSA 2NU3E 2HGTH 1GMCF 2Z3EA 1RD3B 3A84A 1TNHA 2FXRA 3TK6A 1DT2A 4LOYH 4TYDA 4AG1A 2WPHS 4A1VA 1DVAH 1D3DB 2SGFE 2OC0A 4HFPB 1Y5UT 3O8CA 1CHOG 3NCLA 3EJHA 2ZQ2A 2ZNKH 3ATIA 1P2KA 1JIMA 4LXBH 1NU9A 1EZXC 1HDTH 4FUEA 3B23B 3MMGA 4CRCA 3PYHA 3M3TA 1SQTA 5DP9A 3P95A 1EZUC 3MH4A 2A5IA 4TY7A 4Y10E 1BTHH 4CBOA 1W0ZU 1QNJA 1TAWA 1GJBB 1MUEB 1XUIA 3A83A 4JCNA 2Y80A 1JBUH 4B75A 1INCA 1QJ1B 1TB6H 4ONTD 2RCEA 2UWLA 3QLPH 3U98H 3KF2A 3ZZ9A 3T26A 3LJOA 2VNTA 3G01A 3OXUD 1MH0A 2GV6A 1E34B 1ID5H 1MU6B 4IMQA 4X6NA 1NFYA 4IW4E 4DVAU 1KXDA 1V2JT 2ANKH 1D3PB 1C1SA 3MWIU 4KTCA 2VH6A 3HKJB 2HRVA 1HAOH 3QN7A 3O8EB 2XBVA 1DUEA 2GD4B 3BTME 2LNCA 3BSQA 4K60A 1JOUB 2LPRA 1CGHA 1ELCA 1C2MA 4ABBA 4BXWA 1VCQA 1OJYA 2HNTC 3TIUA 2QAAA 1RTFB 2VWMA 4ABFA 3SUDA 3P8OA 7LPRA 1NY22 4IMZA 1UCYE 3KXVA 1CA8B 1HJ8A 2V6NA 2H5DA 1EJMA 4NFEA 1N8OC 1DSUA 2WPIS 4MPVA 1K1NA 3EE0B 1C2JA 2OINA 1C5SA 4ZKOU 3RJ3D 3GYLB 1FIZA 1JWTA 3SHCH 2W7SA 1MTVA 1O2MA 3E0PB 1F2SE 1FV9A 1VCPA 3T29A 1ESTA 2A7HA 2ZFPH 1WBGB 2ZC9H 1NROH 1B5GH 1FY8E 1GJ4H 1TOMH 1O31A 1O3PB 2XQWC 3LGYA 1ZYOA 1B0FA 4WXVA 1DE7H 4TWWA 3P17H 2ODYB 4UEHH 2YBYA 1WV7H 1GI1A 3H7OA 1TMTH 2RL0A 1QJ6B 2W5EA 4O97A 2QXIA 1UVPA 2XRDA 2FOCA 2SGPE 5C5NA 1O2SA 1ZHRA 5CHAB 4MG3A 1E5GA 9LPRA 2PSYA 4BTTB 4LZ1H 3U1IB 1B7XB 2ZF0H 2FOBA 4JYTA 4DT7B 3FZZA 1OP8A 1RTKA 5EXNA 5EPNA 3ATWA 4B1TA 1FI8A 1DWBH 1O3KA 1PFXC 2IOTA 4ABAA 3H7TA 1SLXB 2FYQA 4BAKB 2KMSA 3ZV9A 1A3EH 1BJVA 1NFXA 2FM2A 2FOEA 1GKNA 2W80A 1TE0A 3O8BA 1GHBG 1QRZA 3F9FA 3ZZAA 1OWHA 1VGCC 1QB1A 3F9GA 1FUJA 2WUBA 3SQEE 1IAUA 3S9CA 1P12E 1LO6A 3RXLA 3DUXH 3A7WA 2F9OA 1RRKA 1PQAA 4I31A 1GHBF 1GBBA 4K1TA 1TPNA 1GI5A 3AAVA 1HAPH 4A7IB 1W14U 2JKHA 2O8UA 4HTCH 1TOCB 1C2EA 1UOTP 1BMMH 3NWUA 4JZEH 3ATMA 4Y0ZE 4Q7XA 5LH8A 1GBMA 2ZGXH 1AB9B 3RM2H 2F9UA 3ZD2A 1SB1H 2FESH 1AY6H 2BHGA 4BANB 2BOHB 2ZHWH 1EASA 3RXKA 1KYNA 1AMHA 4CREA 5DO4H 2ESTE 1SMFE 1FJSA 3RXVA 1C2HA 4TPIZ 1KXCA 2XXLA 4VGCC 1YM0A 3IITA 3ATLA 2GMTC 5A0BA 4Y8YA 3TNSA 4E7RG 3TGKE 2OP9A 1EUFA 1XXDA 2C8WB 2H9EH 4GSOA 1CGJE 3MO3A 2C8ZB 4AFSA 4KELA 1O3LA 3M7UA 2WUCA 2GV7A 1VGCB 3M7PA 5EXMA 1OWIA 4RN6A 5TJXA 2CXVA 2YRAA 1E37B 4Z6AH 2UWNA 1IOEA 1DS2E 4OS5A 4A1XA 3VB5A 1C1PA 2GX4A 2WYJA 4ISLA 4ISNA 5T6GA 1F0TA 3DD2H 3V7TA 3PLKA 2P94A 3ZZBA 4FUHA 1ELVA 1Z92B 4CR9A 1ZRKA 2ZO3H 3L33A 3RDZA 4HZHA 3RC6A 3UWIA 4AYDA 1G3CA 3EA8A 4Y7AA 5E0JA 1O30A 1FBRA 2BZAA 3EA9A 1SLWB 2AGGX 2BY9X 2JRAA 3U8OH 3SJKA 2VIWA 1O0DH 4YO9A 1O37A 3ZVFA 3A8DA 3E91A 4ZKRU 2ZU4A 6GCHG 3SNCA 2PKSC 2SNVA 2OC7A 3IU3I 4AYYB 1HAXB 1TNIA 3BEFB 2NU0E 1T8OA 4I7YH 1GHAF 2Y6TA 4VGCB 6CHAB 3ODDA 1C2IA 3TGJE 1O2IA 3UR9A 2H1UA 4FVDA 2J2UA 2VIOA 1XM1A 2ZI2H 1XUJA 4H6TA 4ABGA 6GCHF 1MCVA 1C4Y2 4I8LA 4IBLH 3KQEA 2B0FA 1AWFH 1HLTH 1CT4E 2WPLS 1NRQH 2FS9A 2SGEE 1A7SA 3ZVGA 3SW0X 1K1IA 1YBWA 2O9QA 4H6SB 1Z6EA 1DICA 1QTFA 3ZVEA 1DANH 1C5XB 2XWBF 3CS7A 5FBEA 1P03A 1K21H 1IQJA 3A87A 5AFZH 2HWLB 2GGVB 1GI4A 2RLQA 2PTNA 1BOQA 3KCGH 3MU4A 2P16A 3RXTA 1HFIA 1C1MA 1TFXA 3C27B 1J9CH 1GCTB 4WMEA 3W95A 1GI9B 1N1LA 1CU1A 1YPHE 1BUIA 2ZWLH 1OKXA 3PMBB 4FXGH 3SGBE 3VB4A 4MPXA 4YT7H 1EOJA 2PKSB 1O2JA 4GUXA 4Y79A 2B5TB 3BG4C 4JK5A 4IC6A 5CE1A 1WYKA 4H4FA 5CMXH 1XUKA 3BTWE 3SNEA 1C5OH 4BAMB 1CBWC 3SU0A 4K3JA 1Q2WA 4ZKSU 3UQVA 1O5DH 4X2YA 1O3MA 1AVGH 2ALVA 1GVKB 1O3EA 3BF6H 5F8ZA 5HYUB 5DG6A 4FUDA 3VB6A 1QB9A 1HAVA 3V0XA 2PHBA 1H8DH 8KME2 1BTPA 2FDAA 4DJZA 2DE9A 1LKBA 2VIQA 1K2I1 4Z0KA 1XUHA 3KEEA 1U5MA 1QA0A 1KXFA 1VJAU 4AYMA 1IQGA 1H1BA 3ATKA 1SHHB 1SLUB 1CSOE 1E35B 3TU7H 2ZECA 1WQVH 5LPEA 2A7CA 4CRGA 4OS1A 1GBHA 4X1PU 1SGPE 1SQAA 4X8UH 2EC9H 3RLYH 4INHA 1FY4A 4FU7A 1SI5H 7GCHF 3QZQA 3DA9B 1O39A 1FXYA 1O36A 2H6MA 4Y11E 3NXPA 4XBCA 3BG4B 1LQEA 1UHBA 2BDBA 1C5WB 1S84A 4NZLA 2PUQH 3HK3B 2OC1A 1Y8TA 2A4QA 1LCYA 2PTCE 1L1JA 4YLUA 3PLPA 1ANCA 4A5WB 2G52A 1MKWH 2ZFQH 4QT8C 1GMDG 5EQSA 1ANDA 4WH8A 1KLIH 2R9PA 4DW2U 2BDHA 3TJVA 2VIDA 2JETC 2ANMH 2BLWA 3V12A 3VB7A 1S85A 1IQLA 1ZJKA 2A45B 1O2TA 1MAXA 2ODPA 1Z8JB 1EAIA 1YPMH 1HFHA 1UTKA 1P2NA 2R3YA 4WJG2 1DXPA 3SI3H 3A7TA 1F0SA 1CA0C 1HAHH 2W3IA 3U8RH 1AI8H 3KIDU 1V2TT 1UK4A 1H04P 1GI7B 1S6FA 1TPGA 1OJVA 8GCHF 5GJ4B 1QJ7B 5F6MA 1H9LB 2A1DB 1P2MA 2O8LA 1MQ6A 2STBE 1DPOA 5FX5A 2CGAA 1UVUH 2LOJA 2OQUA 2AEIH 1EZSC 1QL9A 1O9AA 1PPHE 1EAXA 1SBWA 4NIXA 1TALA 2A7JA 1SGFG 2GZ7A 3A82A 1ZLRA 4DIIH 1RXPA 1MZDA 5HYOA 1Y5BT 1GKGA 4WMDA 1LVYA 1GBKA 1MZAA 2A2XH 3M61U 3Q3KA 5JBBS 3HGNA 1SOTA 1TGSZ 1TNJA 1G2LA 1TBZH 1BITA 2AIPA 1P3EA 3TITA 2VVCA 4X2WA 4NSVA 1K1OA 3URDA 2CG6A 1Y3XA 1SQOA 1H4WA 3EDXB 1TIOA 1Y59T 4XFQA 1ZR0A 1BRCE 2ZGJA 1ORFA 3LKWA 2ZHQH 3TLOA 2Z9IA 1H2PP 2OXSA 2RG3A 2GDDA 2FX6A 4AZ2B 1BTYA 4WMFA 3WY8A 1C9TA 1XMNB 1JMOH 1GJ8B 4JMYA 5DP4A 1BBRK 4FXGG 1YPJH 2P93A 3HPTB 2C3SA 2VVUA 2BDCA 1KSNA 2IPHA 4X6PA 1AVXA 1O35A 1GJ7B 4BOHA 3ZV8A 1L0ZA 4TPYA 4YM9A 4D7FA 3FVFB 2Q1JA 2F83A 1TGNA 4INKA 1SC8U 1V2ST 4B76A 5JB9S 3SNAA 1HAVB 3M5OA 3SV2H 1CGIE 5T6DA 1MTNC 4DJZB 3ZZ8A 5DKMA 4O03A 3EQ0H 3Q77A 5E2PA 2Q6FA 2ZQ1A 2IZ3A 2BDAA 2B5ID 1LHFH 1LTOA 3RXEA 4D9QA 1LHEH 4U30A 8ESTE 2PSXA 1OX1A 1BHXB 2BLVA 2I6QA 1QY6A 2XTTB 3S69A 1GMCG 4KKDA 2QN5T 3PTBA 1GJCB 1HCCA 2JGXA 1FAXA 2WPMS 1DWDH 1ZGIA 1V2NT 2TPIZ 2P8OC 2QF3A 3CENA 4CRFA 3MI4A 1BRUP 3L6PA 5SGAE 1O2ZA 2CV3A 4CHAB 1ESBA 1J8AA 3IWMA 3UNRA 1PPBH 2BY6X 1UCYH 2HALA 4FUIA 4GLYA 2FZZA 1C9PA 3MH7A 3OU0A 3SU3A 2H9TH 4NA7A 3PO1C 3TH3H 4O9VA 4CR5A 3IG6B 1GJ6A 1RFNA 4K8YA 4X2VA 2FYRA 1KLJH 4B2CA 5EQQA 1AZ8A 4X6MA 2ZGHA 1PPEE 2IN2A 1ELAA 1T4UH 2G4TA 1GI8B 1CT2E 1JRTA 4JHSA 2F9PA 3FP8E 5ESBA 1IQKA 1GG6B 4UFFH 2Z6BD 2QCYA 1O2HA 3KQBA 4HI3A 2TGTA 1AKSA 3UQOA 1LPKB 2FIRH 2R0KA 1G30B 4FVBA 3ZD1A 3TH4H 3DFLA 5I0QB 2FOGA 2CKUA 1QGFA 2O8WA 5E0HA 5L30H 1O2QA 4Q7YA 3NUMA 4J2YB 2SGDE 3BG8A 1P3CA 1QB6A 1O3DA 5DGJA 1CO7E 3ESTA 2Q6DA 2Y5GA 4KTUA 3SNBA 4K2YA 4MNWA 2C4FH 1FQ3A 1V2OT 2BD8A 2CG7A 2HPQH 3A85A 3FZDA 1HPGA 1W0YH 4LZ4B 1UVSH 3ODFA 1GJDB 4OGYA 1Y3YA 4D9RA 2W81A 3KGPA 4GCHF 1O5CB 5HM9A 3SW2B 2GVFA 3UWJH 4JZFH 1O2XA 1T8NA 1TGBA 3ZZ4A 2A2QH 2FLBH 3MU5A 1C1UH 1ELDE 2F9BH 4FUGA 2XBXA 2IJOB 2VU8E 3ZYEA 2SGQE 1THRH 1D9IA 2ZDMA 2ZHFH 1QFKH 3M7TA 4X1SU 4XE4A 3AAUA 2BDYA 4I32A 2FO9A 2PFEA 2WIIC 1DDJA 5JBCS 1PPCE 1SVPA 2F9VA 2WYGA 3M3VA 4A1TA 1ZTLA 1UVOA 1SHYA 3PTNA 4Y76A 1WU1A 3TGIE 2AMPA 3MQLA 1P05A 2D26C 1HV7A 1H03P 4NCYA 3ZZ5A 4RKJB 1UJ1A 3TPIZ 3R3GB 3FFGA 3UPEA 5J4SA 2FTLE 3RXUA 5A8ZA 2BD5A 4U32A 4NIYA 1ZMNA 1U6QA 1P02A 1GJ5H 1HIAA 1PPGE 5JDUB 3S7HB 4Q2KA 1ANEA 1O3NA 3LJJA 4I33A 1KDQA 2O8TA 1QL7A 3DHKH 1WQSA 5HYPA 1GHQB 2Z9JA 5HMAA 1QQ4A 5DK1A 3TVJA 4ISOA 1NT1A 1A5GH 2A4OA 4KP0A 1A5IA 2KAIB 1GHZA 2AFQB 2BOKA 2V3HH 1HNEE 5E2OA 4YNXA 2ODQA 1N8OB 3E16B 4IGDA 5A8YA 3SU5A 5JBAS 3ENSB 2VWOA 1DX5M 1G9IE 2ZIQH 2ZPQA 5GCHG 1TRYA 5HZPB 1BMAA 5C20A 2BQWB 2BXTH 1P2JA 3LONA 4WY3A 4U2WA 3GDUA 1MD8A 3SUFA 1O3AA 3MHWU 2Z9GA 1YCPK 2G5NA 4D76A 5K0HA 4Y71A 2A5KA 4ASHA 2AGEX 4ISHH 1HRTH 3M35A 1EX3A 3MO9A 2XWJI 5GCHF 1K22H 1V2MT 1C1NA 5JPMH 1O2YA 4Q7ZA 2ZGCA 1TNGA 3MNCA 2Z3CA 3MU0A 1BDAA 2C8YB 3RXSA 3D23A 4Y6DA 3ZZDA 3RC4A 1Y3VA 1J16A 4BTUB 1G2MA 1LPZB 2BTCE 1YCPM 3SO3A 1Q31A 3GYMA 5C1XA 3MNXA 2XW9A 1HGTH 2BD2A 2YNAA 1Y3WA 1UTJA 3SOSA 1Z6JH 1K1PA 1A46H 2V0BA 2HVXA 4OS2A 2EA3A 1RS0A 3PLBA 5BRRE 1O5FH 4E7NA 3U9AH 2PGBB 2ZCHP 4NWKA 1NWVA 2A55A 4NIWA 2BD4A 1OYTH 1O3FA 1WSSH 3BIUH 1FY3A 2ZTXA 3LU9B 1J14A 1KXBA 2A32A 2GZ9A 4AB8A 1K1MA 1BBRE 5FCKA 1OK9A 1EPTA 5FPTA 5EG4A 1QO6A 5GDSH 2ZFFH 3KN2A 1RTLA 1DWEH 2OTVA 5EODA 4AYIA 3AASA 3O8DA 3RU4E 1O2RA 1C5QA 4UD9H 5G4BA 1TPSA 2R2MB 1O2PA 5A2MH 2FEQH 1C1TA 4DG4A 1Z1JA 1HXFH 3QWCH 4WWYA 1GVLA 1P06A 3KHVA 1A3BH 2BD7A 3SJOA 1GJAB 1LKAA 2PWXA 4FUBA 3R62A 3SV6A 2W7UA 3A89A 1T7CA 1W2KH 2V35A 2UUKB 1GHAG 3A86A 4IN2A 3Q3XA 1UTMA 1Z1IA 4A5TS 1MTUA 1TYNA 4WF8A 4ZH1D 3SU2A 5DPAA 5FBIA 1P11E 3EYDA 2TBSA 3UUZA 1GDUA 5EU8A 4X8TH 1TONA 2CF8H 4CBNA 1O3OA 1UTOA 1VITF 1QCPA 2GMTB 4ISIH 1CT0E 2VIPA 1HXEH 1PQ7A 1DY9A 1HYLA 2ZU2A 3MNBA 3P8GA 1YKTA 1HAIH 5TCAA 3A8BA 1ABIH 5EW1H 1L4DA 1F5RA 3LC5A 3RMLH 3PB1E 5FO8C 4XSKU 2P95A 1BA8B 5H4IB 3A7VA 3QUMP 1TX8A 3BN9A 2ANYA 3LC3A 5DJ7A 1HBTH 5FAHA 1HIAB 2ASUB 2EHFA 2EC3A 1ZPZA 1PYTD 1QBOA 1ZRBA 2OBOA 1OJWA 2BVSH 2Y81A 1LVOA 4R0IA 3GY4A 2OD3B 3VFEA 4X2XA 1AZZA 3RM0H 1SOZA 2PW8H 2F9NA 1SRZA 1TA2A 1GI0A 1GHVH 3L89M 2VH0A 3Q00A 1G4FA 1TGCA 3TVJB 1MCTA 2AS9A 1O3CA 2ZHDA 3A7ZA 1V2PT 1YPGH 2VIVA 1EXFA 4X6OA 3SORA 1ZHPA 1P9SA 1NRSH 3MO6A 3RC5A 2BZ6H 3QZRA 1QBVH 4ZMAH 1VZQH 1GL1A 1MKXK 1NRNH 2OBQA 2XC0A 1V2WT 4K1EA 1EZQA 3OP8A 1BMLA 3E6PH 1AFQC 3CP7A 3I78A 3GISB 2C90B 1BB0B 1MAYA 5F03A 2QGRA 3MFJA 3NKKA 2ZFSA 4Y0YE 3W94A 2XBYA 2O39C 2RKYA 1EPTC 2VB0A 4MPUA 4UDWH 4X1NU 1AWHB 3QTOH 2A5AA 1HB0B 1NRPH 4K69A 4XBDA 1NN6A 3NFPI 4MDSA 4JYVH 1GHYH 5AFYH 5FHTA 2ZU1A 5C3NA 4O3UA 4YT6H 4AOQA 2HLCA 4J1YA 4K1SA 1ARCA 1OWDA 3STIA 4B2AA 1PQ5A 2NWNA 2AMQA 5GPIB 1E88A 1AQ7A 1GDQA 1T4VH 3OY5U 5A0CA 3BEIB 5JPMG 1S0QA 3GCTF 3VEQB 4MNYA 3RXBA 3GXEA 1K1LA 2G51A 1FDPA 1GGDC 3M36A 1D6RA 5E0GA 2J94A 3ZZ6A 1DFPA 7GCHG 1YP9A 2PV9B 1ZMJA 1GWAA 3BTTE 1SGDE 5LGOA 1MQ5A 5DP6A 4ZHMU 1GBTA 1CVWH 1QRXA 4B2RA 2RA3A 4DOQA 1TPMA 1GBLA 5FXLA 2BB4A 1SGFA 3UNSA 1G3EA 1SLVB 2GT7A 2V3OH 2GKVE 4GVUA 1SGCA 2THFB 1MD7A 3B8JA 1JRSA 2WV4A 3P8NA 3P92A 4UFGH 1KLTA 3BEUA 1C5VA 3V13A 3SV9A 1CBWB 2XRCA 5DP8A 4DY7B 1F5LA 4X8SH 4ZAEA 1BTUA 2CF9H 4BNRA 1DXWA 1TNLA 1EJNA 4AFUA 3OEDC 1ETRH 5A0AE 1SGEE 3PMAB 5FX6A 3LPRA 1GDNA 2FWWA 2P3UB 2ZU5A 1TX7A 4YLQH 2FI5E 1MTWA 1RJXB 1NM6A 2P3TB 5E8EH 4MPWA 1AUTC 1V2QT 1BZXE 1UTPA 5GXPA 1AE5A 1RIWC 1LHDH 5LPFA 3ZRZA 2ILNA 1HFDA 1PYTC 1W7GH 1F0UA 1GI2A 1F0RA 8GCHG 2BXUH 2OUAA 2FPZA 3RXFA 1GBFA 1O3BA 1VCWA 2Y7XA 2C8XB 1LY2A 1N6XA 2PUXB 5PTPA 2ALPA 4BXSA 1L2EA 3MH6A 4GPGA 2GCTC 3T25A 1EKBB 2AMDA 2QXHA 3BIVH 1NESE 2ZKSA 2ZGBH 3T5OA 5J4QA 3K6YA 5JYIA 5T6FA 1WTGH 1YPHC 1GHXH 3RP2A 1L1NA 2D1JA 4IS5A 1EOLA 1GBDA 1SR5C 4AB9A 2ZP0H 4NG9H 1GCDA 2Y5FA 1FNIA 4INLA 4CH8B 3VPKA 2SNWA 3FAOA 1NRRH 3RXDA 1IHTH 1P01A 3T2NA 2VWNA 2I6SA 1ABJH 2BLQA 5EOKA 3STJA 2V8EA 2QXGA 5DP3A 5IYTA 1AFEH 1NFWA 1AU8A 1BHXF 2Z7FE 4E06H 1C1OA 2JETB 3RMMH 1G32B 1RIWB 2ZTYA 4MTBA 1ZPCA 1O2VA 1KTSB 1TMUH 1D6WA 2BMGB 3KQDA 1ARBA 3A80A 1YLCA 2EEKA 4JK6A 5EPYA 1P10A 1WOFA 2CHAC 1C1WH 1YC0A 3VXEH 1CA0B 2FOFA 2HNTE 3Q3YA 3E3TA 5DP5A 3ITIA 2ZG0H 3BTEE 1A0JA 1HJ9A 4OS7A 3LDXH 2FLRH 2BX3A 1BRBE 2VVVA 2AERH 4MQAA 2C93B 2BY5X 1Y5AT 1C5LH 1LDTT 3LGVA 2ANWA 1GBJA 3OYPA 1C5NH 3RXIA 1KTTB 1TRNA 2ERJA 3RXGA 2D2DA 2FOHA 3FP6E 3T28A 1C1VH 2WINI 4KTSA 2EI6A 2ZDLA 1OK1A 1T31A 3K9XB 3GDVA 1Z8RA 1BRAA 2G5VA 1O2GH 1SFIA 1O5AB 1Y3UA 1GMHF 1Q3XA 4ZUHA 3LH1A 2SGAA 1QQUA 3CS0A 1C5YB 2ZPSA 1C2KA 2W26A 4KGAA 3UR6A 4YOGA 4FUCA 2OLGA 3RXJA 1A0LA 6LPRA 2G8TA 2CN0H 4AN7A 2BVXH 1O2UA 2ZHEH 1V2RT 1GPZA 4NA8A 1G37A 4UE7H 3RXCA 1UHBB 1G3BA 1MBQA 2GZ8A 3ERBA 1W11U 1CKLA 1VR1H 5AF9H 2G7IA 1W12U 4ABJA 4CRAA 1GI6A 1O3GA 1G4GA 3F6UH 1ETSH 1C2GA 1ZPBA 2PKAA 1BIOA 3TJUA 3RXQA 3RXOA 1TLDA 1PPZA 4BAHB 1SG8B 5L6NH 1BTZA 1X7AC 3BTDE 1YYY1 3L3TA 4AGKA 1S0RA 2FS8A 1H9HE 2G55A 2EI8A 3I29A 3SJ9A 3IX0A 2JH0D 3S9BA 4ABDA 1C5RA 1MTNB 1H8IH 3GY8A 1O34A 4JZIA 3ELAH 1TWXB 3BV9B 2TGDA 4ABIA 4GHQA 4HGCA 1LHGH 1J17T 2CJIA 1N6YA 5C1YA 3MNSA 4B2SA 1CHOF 1EATA 1FN6A 1GBIA 1ELTA 4GCHG 3Q76A 2F91A 4JZ1A 2VWLA 2UUFB 5EQRA 2P8OB 4YZUA 1VVDA 4YTAA 1EP6A 1A1RA 2QV1A 1JXPA 4SGAE 1VITH 1FZZA 2ZFTA 5HYTB
chains in the Genus database with same CATH superfamily
5KECA 2H2ZA 4Y8ZA 4LOSA 2XC5A 4TSFD 3PO1B 1FX0B 2HOBA 3SU4A 4B73A 2HNTF 2XYAA 1FLEE 1AGJA 5CHAC 5B6LA 4ZROA 2GT8A 2KFWA 3DFJA 3SNDA 3A81A 3P8FA 3N7EA 1AUJA 2W3KA 2AH4X 4I8KA 3WWBA 1MABB 2BD3A 3GDSA 1T32A 1SFQB 1PJPA 1QL8A 2JDID 2UWOA 3FP7E 1W3CA 4X0WU 1QR3E 2ZU3A 1TBQH 2KRIA 3BTFE 1KY9A 3A7YA 1OK3A 3FKSD 4I8JA 4FOUC 5HIZA 2W6ID 2JH5D 1O2WA 1TA6A 2VJ1A 2BZMA 1ACBE 2B9LA 1IQFA 4WH6A 1RGQA 4FU8A 1O32A 2ZZUH 3D65E 1FIWA 2QA9E 2R0LA 2XOKD 3M5LA 1SQRA 2MCZA 2ZFRH 2WPJS 4ZHAA 3TJOA 3T27A 1KXEA 2UUYA 1SSXA 3PWBA 2FP7B 4ACAA 4B74A 3GY7A 5DP7A 2GCHG 1DLKB 1C5TA 3RXPA 3UTUH 3MQKC 1QBNA 3TNTA 2Y8SA 3NPSA 5HKKD 1NTPA 3INBC 4RSPA 5ABWA 1O2KA 4NFFA 2QF0A 1BJUA 2UWPA 2RA0A 1AB9C 1EB1H 1W7XH 3C1KA 4XBBA 3UFAA 4K5ZA 5JB8S 4OS6A 2ZDVH 1C1RA 3AVZA 5AHGH 4BAOB 2J4IA 4LK4A 2GCHF 2GTBA 4THNH 1BBRH 3EAJA 3RMOH 4AYEA 3GCHC 3K65B 4B71A 3LGIA 3GOVA 5GIBA 4I8HA 1NC6A 1EJAA 1NBMD 1UVTH 4WVPE 1O2NA 1SGRE 4ESTE 1QURH 4UFEH 5IDKA 3ZVAA 1OWEA 1WCZA 2VGCC 3S0NA 5BPEA 1C4U2 2SFAA 2DE8A 1C2FA 3URCA 5KEDA 3CALA 1V3XA 2Z9LA 1ANBA 1D3TB 1ZHMA 2QC2A 3S7KB 3ZVCA 2WPKS 1GBCA 1WTHD 4FU9A 2RKZA 1TABE 4XOJA 5K7RA 2FOMB 2HPPH 1BT7A 1YPEH 1EP5A 4I8GA 1T8LA 4MUCA 3ZVDA 3SJ8A 2GDEH 2M2AA 2NU4E 1A4WH 4CH2B 2QYIA 3MOCA 2RDLA 4GAWA 2Y5HA 2PKAB 3RXAA 1A2CH 3A8CA 1OWJA 1VVCA 2AGIX 1A61H 4BAQB 4LOTA 4C16A 3OEHD 5EXLA 1AHTH 5FCRA 2BVRH 4O3TA 1YLNA 4R8TB 3SGAE 2ZEBA 1AKSB 4CRDA 1UMAH 5C5OA 2ZDNA 2MCYA 1UW7A 3E1XB 2FTMA 1FONA 1GJ9B 1DUAA 2BDGA 4UFDH 2BLOA 1QHRB 1K1JA 1K9OE 2TGPZ 4AORA 3NZIA 1ELBA 1DLEA 3GCHB 2YMSD 2FOAA 3SI4H 1AO5A 1O5BB 3F0PA 1XVMA 3TH2H 2BYAX 3RXHA 2XCNA 3UNQA 7ESTE 3AW1A 1P9UA 4DCDA 1P57B 1SPJA 2OC8A 2FODA 3OTJE 6CHAC 1MKWK 2QIQA 3SU1A 2JGWA 4X1RU 2VGCB 3M3SA 1IQIA 1C5UA 1LQDB 4Y8XA 5L2ZH 1OP2A 1TBRH 1VJ9U 2Y82A 1XX9A 1P04A 3RU4D 4FUFA 5C1UA 1ZTJA 3M5MA 1OYQA 1V2UT 2ZTZA 4H42U 4J38B 1G3DA 4Q80A 2NU1E 2BD9A 3QO6A 3SBKA 1S83A 3SV8A 1TGTA 1S82A 3PWCA 2XBWA 2R3UA 3E0NB 3E8LA 4JZDH 3SHAH 1GBAA 4CSYA 1SGYE 1W8BH 5AVDA 4U01A 2F43B 1DWCH 1MTSA 2PLXA 1TQ0B 3LT3A 2OQ5A 1O2LA 3LOXA 3M5NA 1OS8A 3F68H 1VITG 3ZVBA 1E0FD 1P09A 1O5GH 2RLPA 1D4PB 3NK8A 1FY5A 5B6OA 1FAKH 1ELGA 1GCTC 4K8BA 3KYFA 8LPRA 1OP0A 3GY5A 4ZH8A 2YNBA 4ZXYH 1H2QP 2Q6GA 2BY7X 1Z8IB 3ZZ3A 3MH5A 3UAIC 1O3JA 1W10U 2QY0A 4FUJA 3RUOA 2Z9KA 3KQCA 9ESTA 1B0EA 1GHWH 4A92A 1ZOMA 2IZ4A 3LGTA 4OS4A 2Y7ZA 3R0FA 3SN8A 1KDQB 1HUTH 3GY3A 3U69H 1YF4A 1Z71A 1YLDA 4NA9H 1JIRA 3ZYDA 3D49H 1IQEA 4AFZA 1FN8A 1BTWA 4RKOB 1FY1A 1SGTA 3I77A 4X8VH 2F4LA 1EQ9A 3UY9A 3UIRA 1IQNA 2H5CA 3A8AA 1TX6A 1SGQE 1H9IE 1UTQA 1FMGA 3TK9A 3MTYA 1OXGA 2BY8X 3HKIB 1O3HA 5L2YH 3FGTA 1THPB 1HCGA 1KXAA 3F9HA 1UK2A 1MU8B 1OSSA 4RI0A 2UUJB 3DT0H 1XUFA 4DURA 3JZ2B 3UREA 2TIOA 3GOVB 2TGAA 3HATH 3PMHB 1P2OA 1BQYA 1C1QA 2BX4A 3QGNB 2F3CE 1C5MD 1XUGA 3M7QA 4ZXXH 3ZLEA 1YGCH 1SL3A 2L6OA 3UB0A 2AYWA 1A5HA 3A88A 1EAWA 3BTKE 1C5PA 3P6ZB 1QIXB 3GCTG 3SZNA 4NZQA 3T5FH 3F2HA 3OSYA 4YIZA 1C5ZB 4E05H 1GI3A 3SYJA 3SUGA 3QGJA 1QGBA 1GBEA 3HK6B 3M37A 1H8HD 2YMSC 2QE7D 4DIHH 3OFND 1IHSH 3F9EA 1AD8H 1FPHH 3VGCC 2A0QB 3MYWA 5JBTA 1S5SA 1YCPH 3AW0A 1HJAC 3W1EA 2H9HA 2ZDAH 5ETXA 1A0HB 4ABEA 3ZZCA 1ZTKA 1NFUA 1EAUA 4K12A 1LHCH 2YOLA 1MMJN 3OEED 3FOAA 4Y7BA 1ZSLA 3RMNH 1LVBA 5CHBA 1SGNE 5ESTE 1UCYK 2V3MA 4TWYA 5I46H 3KL6A 5EGMA 1AVWA 3GY2A 1OPHB 2ZDKA 1DM4B 4F4OC 2QXJA 3N99A 1AFQB 2Z94A 1M9UA 2FI3E 5C67A 1XKAC 4ABHA 2O8MA 1W13U 3B9FH 1EFRD 2PR3A 4ZKNU 1EPTB 5LPRA 1AN1E 1S6HA 3GY6A 2BQ7B 2Z3DA 1CE5A 2JH6D 1PPFE 3K2UA 4AYVB 1G36A 3ZZ7A 5T3HA 2AIQA 2A31A 2J38A 3K6ZA 1NS3A 3OY6U 3UOUA 4MNXA 1XKBC 1BCUH 1Z8GA 1IQMA 3KYGA 1ZJDA 3HGPA 1PPQA 1F5KU 1WAYB 2M5TA 5EW2H 4A6LA 1ZZZA 2D8WA 1GVZA 3KNXA 1DSTA 3TK5A 5DN4A 2BDIA 1AE8H 2YMSB 2J92A 1FPCH 1E38B 1TPOA 2G81E 3H5CB 2J34A 3VGCB 3QTVH 1EB2A 2ZCKP 4AFQA 1CQQA 1HJAB 1D3QB 1GGDB 1F92A 1E79D 3EGKH 3A7XA 4MVNA 4OGXA 2FX4A 2K1QA 3E90B 3V3MA 3SUEA 1P2QA 2WV5A 3SQHE 3PROA 4F49A 1IQHA 1UTLM 2XWBI 1UO6A 4XDEA 3SJIA 1SS2A 1YPKH 2J95A 3QX5H 1TQ7B 1OK2A 1GMDF 1ZGVA 1C4V2 2QF4A 1XXFA 1BMNH 1GL0E 2CMYA 1KIGH 1C2LA 1TRMA 2W6JD 3PM3A 3SV7A 5I25A 3LH3A 5GWZA 2B7DH 2ZCLP 1O3IA 4PROA 4WXIA 1NO9H 5A09A 4UONA 1ZMLA 3PV4A 2G4UA 3QK1A 2QY0B 1F7ZA 1THSH 3F1SB 1OOKB 4B2BA 3OX7U 2G00A 3TJNA 1ZSJA 2J9NA 2DUCA 2BM2A 3RU4T 1T8MA 2PP6A 2GP9B 4MLFB 2EI7A 2NU2E 1P2IA 2OCVB 4TY6A 3VXFH 3GCOA 4NIVA 1O2OA 3LGWA 5C2ZA 4YESB 4NGAH 1QUBA 2Y8TA 1TNKA 3KZJA 1K28D 1L1GA 2ZA5A 4SGBE 1ELFA 3VB3A 1O33A 5HGGA 5C0UA 5HM2A 5A8XA 1OWKA 6ESTA 2P59A 4MNVA 1LPGB 3NJAA 4AG2A 4CRBA 1NU7B 1LMWB 3SU6A 1TPAE 1V6DA 3LIWA 2XRBA 1V2KT 4ZHLU 4JYUH 1LVMA 2TRMA 1V2LT 1CHGA 3O8RA 3U8TH 3BTHE 4BTIB 4X1QU 4GHTA 4CHAC 3LGUA 1S81A 1NZQH 2GCTB 2A4GA 4M7GA 4IC5A 3MU8A 1HAGE 4AX9H 3BTQE 2XC4A 1UTNA 1MKXH 1L4ZA 5EJZA 1O5EH 1DITH 5FPYA 5HXFA 4NWLA 1E36B 3RXMA 1WUNH 2XNIA 1UK3A 4PZ5A 2VINA 1TMBH 1PQ8A 2BQ6B 3U1JB 4IN1A 2FI4E 3S9AA 1GMHG 3BTGE 4NSYA 3N7OA 1ETTH 2XCFA 1J15A 1V2VT 3P70B 1GG6C 1DY8A 2FMJA 2P3FH 2PGQB 3T62A 2K8IA 1AIXH 1BTXA 3FANA 1Z7KA 1O38A 2KAIA 3GICB 1ELEE 4DGJA 2XWAA 2A4RA 4YOJA 3SGQE 1SGIB 1HAZB 1QA7A 3PMJA 4YOIA 4D8NA 1ZSKA 2ZPRA 1NPMA 1HAYB 3MU1A 1BMFD 5F8TA 1P0SH 1P8VC 2STAE 3UOPA 1E8BA 2R2WU 3RXRA 5F8XA 7KMEH 3GCNA 1YPLH 3JZ1B 1C1ZA 2CHAB 1C2DA 3D62A 3QDZB 2B8OH 1ESAA 1TPPA 5TCCA 1DOJA 4D7GA 1MBMA 3EA7A 4AGJA 2ULLA 3RLWH 1QRWA 1E1QD 1XVOA 5FPSA 2NU3E 2HGTH 1GMCF 2Z3EA 1RD3B 3A84A 1TNHA 2FXRA 3TK6A 1DT2A 4LOYH 4TYDA 4AG1A 5DN5A 2WPHS 4A1VA 1DVAH 1D3DB 2SGFE 2OC0A 4HFPB 1Y5UT 3O8CA 1CHOG 3NCLA 3EJHA 2ZQ2A 2ZNKH 3ATIA 1P2KA 1JIMA 4LXBH 1NU9A 1EZXC 1HDTH 4FUEA 3B23B 3MMGA 4CRCA 3PYHA 3M3TA 1SQTA 5DP9A 3P95A 1EZUC 3MH4A 2A5IA 4TY7A 4Y10E 1BTHH 4CBOA 1W0ZU 1QNJA 1TAWA 1GJBB 1MUEB 1XUIA 3A83A 4JCNA 2Y80A 1JBUH 4B75A 1INCA 4N7EA 1QJ1B 4ONTD 1TB6H 2RCEA 2UWLA 3U98H 3KF2A 3QLPH 3ZZ9A 3T26A 3LJOA 2VNTA 3G01A 3OXUD 1MH0A 2GV6A 1E34B 1ID5H 1MU6B 4IMQA 4X6NA 1NFYA 4IW4E 4DVAU 1KXDA 2JJ2D 1V2JT 2ANKH 1D3PB 1C1SA 4P00A 3MWIU 4KTCA 2VH6A 3HKJB 2HRVA 1HAOH 3QN7A 3O8EB 2XBVA 1DUEA 2GD4B 4XD7D 3BTME 2LNCA 3BSQA 4K60A 1JOUB 2LPRA 1CGHA 1ELCA 1SKYE 3VG8A 1C2MA 4ABBA 4BXWA 1VCQA 1OJYA 2HNTC 3TIUA 2QAAA 1RTFB 2VWMA 4ABFA 3SUDA 3P8OA 7LPRA 1NY22 4IMZA 1UCYE 3KXVA 1CA8B 1HJ8A 2V6NA 2H5DA 1EJMA 4NFEA 1N8OC 1DSUA 2WPIS 4MPVA 1K1NA 3EE0B 1C2JA 2OINA 1C5SA 4ZKOU 3RJ3D 3GYLB 5CDFE 1FIZA 1JWTA 3SHCH 2W7SA 2WSSD 1MTVA 1O2MA 3E0PB 1F2SE 4APLA 1FV9A 1VCPA 3T29A 1ESTA 2A7HA 2ZFPH 1WBGB 2ZC9H 1NROH 3ZIAD 1B5GH 1FY8E 1GJ4H 1TOMH 1O31A 2X2ZA 1O3PB 3OE7D 2XQWC 3LGYA 1ZYOA 1B0FA 4WXVA 5HIYA 1DE7H 4TWWA 3P17H 2ODYB 4UEHH 2YBYA 1WV7H 1GI1A 3H7OA 1TMTH 2RL0A 1QJ6B 2W5EA 4O97A 2QXIA 1UVPA 2XRDA 2FOCA 2SGPE 5C5NA 1O2SA 1ZHRA 5CHAB 4MG3A 1E5GA 9LPRA 2PSYA 4BTTB 4LZ1H 3U1IB 1B7XB 2ZF0H 2FOBA 4JYTA 4DT7B 3FZZA 1OP8A 1RTKA 5EXNA 5EPNA 3ATWA 4B1TA 1FI8A 1DWBH 1O3KA 1PFXC 2IOTA 4ABAA 3H7TA 1SLXB 2FYQA 4BAKB 2KMSA 3ZV9A 1A3EH 1BJVA 1NFXA 2FM2A 2FOEA 1GKNA 2W80A 1TE0A 3O8BA 1GHBG 1NBME 1QRZA 3F9FA 3ZZAA 1OWHA 1VGCC 1QB1A 3F9GA 1FUJA 2WUBA 3SQEE 1IAUA 3S9CA 1P12E 1LO6A 3RXLA 3DUXH 3A7WA 2F9OA 1RRKA 1PQAA 4I31A 3FN8A 1GHBF 1GBBA 4K1TA 1TPNA 1GI5A 1W0JD 3AAVA 1HAPH 4A7IB 1W14U 2JKHA 2O8UA 4HTCH 1TOCB 1C2EA 1UOTP 1BMMH 3NWUA 4JZEH 3WSXA 1OHHD 3ATMA 4Y0ZE 4Q7XA 5LH8A 1GBMA 2ZGXH 1AB9B 3RM2H 2LP6A 2F9UA 3ZD2A 1SB1H 2FESH 1AY6H 2BHGA 4BANB 2BOHB 2ZHWH 1EASA 3RXKA 1KYNA 1AMHA 4CREA 5DO4H 2ESTE 1SMFE 1FJSA 3RXVA 1C2HA 4TPIZ 1KXCA 2XXLA 4VGCC 1YM0A 3IITA 3ATLA 2GMTC 5A0BA 4Y8YA 3TNSA 4E7RG 3TGKE 5DSFA 2OP9A 1EUFA 1XXDA 2C8WB 2H9EH 4GSOA 3F6KA 1CGJE 3MO3A 2C8ZB 4AFSA 4KELA 4OM9A 1O3LA 3M7UA 4ZCNA 2WUCA 2GV7A 1VGCB 3M7PA 5EXMA 1OWIA 4RN6A 5TJXA 2CXVA 2YRAA 1E37B 4Z6AH 2UWNA 1IOEA 1DS2E 4OS5A 4A1XA 3VB5A 1C1PA 4Z1MD 2GX4A 2WYJA 4ISLA 4ISNA 5T6GA 1F0TA 3DD2H 3V7TA 3PLKA 2P94A 1QZ8A 3ZZBA 4FUHA 1ELVA 1Z92B 4CR9A 1ZRKA 2ZO3H 3L33A 3RDZA 4HZHA 3RC6A 3UWIA 4AYDA 1G3CA 3EA8A 4Y7AA 5E0JA 1O30A 1FBRA 2BZAA 3EA9A 1SLWB 2AGGX 2BY9X 2JRAA 3U8OH 3SJKA 1YWUA 2VIWA 1O0DH 4YO9A 1O37A 3ZVFA 3A8DA 3E91A 4ZKRU 2ZU4A 1KMHB 6GCHG 3SNCA 2PKSC 2SNVA 2OC7A 3IU3I 4AYYB 1HAXB 1TNIA 3BEFB 2NU0E 1T8OA 4F48B 1GHAF 2Y6TA 4VGCB 6CHAB 4I7YH 3ODDA 1C2IA 3TGJE 1O2IA 3UR9A 2H1UA 4FVDA 2J2UA 2VIOA 4AC9A 1XM1A 2ZI2H 1XUJA 4H6TA 4ABGA 6GCHF 1MCVA 5EJLA 1C4Y2 4I8LA 4IBLH 3KQEA 2B0FA 1AWFH 1HLTH 1CT4E 5IK2D 2WPLS 1NRQH 2FS9A 2SGEE 1A7SA 3ZVGA 3SW0X 1K1IA 1YBWA 2O9QA 4HG6A 4H6SB 1Z6EA 1DICA 1QTFA 3ZVEA 1DANH 1C5XB 2XWBF 3CS7A 5FBEA 1P03A 1K21H 1IQJA 3A87A 5AFZH 2HWLB 2GGVB 1GI4A 2RLQA 2PTNA 1BOQA 3KCGH 3MU4A 2P16A 3RXTA 1HFIA 1C1MA 1TFXA 3C27B 1J9CH 1GCTB 4WMEA 3W95A 1GI9B 1N1LA 1CU1A 1YPHE 1BUIA 2ZWLH 1OKXA 3PMBB 4FXGH 3SGBE 3VB4A 4MPXA 4YT7H 2J98A 1EOJA 2PKSB 1O2JA 4GUXA 4Y79A 2B5TB 3BG4C 4JK5A 4IC6A 5CE1A 1WYKA 4H4FA 5CMXH 1XUKA 3BTWE 3SNEA 1C5OH 4BAMB 1CBWC 3SU0A 4K3JA 1Q2WA 4ZKSU 3UQVA 1O5DH 4X2YA 1O3MA 1AVGH 2ALVA 1GVKB 3DSGA 1O3EA 3BF6H 5F8ZA 5HYUB 5DG6A 4FUDA 3VB6A 1QB9A 1HAVA 3V0XA 5C17A 2PHBA 1H8DH 8KME2 1BTPA 2FDAA 4DJZA 2DE9A 1LKBA 2VIQA 1K2I1 4Z0KA 1XUHA 3KEEA 1U5MA 1QA0A 1KXFA 1VJAU 4AYMA 1IQGA 1H1BA 3ATKA 1SHHB 1SLUB 1CSOE 1E35B 3TU7H 2ZECA 1WQVH 5LPEA 2A7CA 4CRGA 4OS1A 1WDIA 1GBHA 4X1PU 1SGPE 1SQAA 4X8UH 2EC9H 3RLYH 4INHA 1FY4A 4FU7A 1SI5H 7GCHF 3QZQA 3DA9B 1O39A 1FXYA 1O36A 2H6MA 5FL7D 3WWFA 4Y11E 3NXPA 4XBCA 3BG4B 1LQEA 1UHBA 2BDBA 1C5WB 1S84A 4NZLA 1RLHA 2PUQH 3HK3B 2OC1A 1Y8TA 2A4QA 2HLDD 1LCYA 2PTCE 1L1JA 4YLUA 3PLPA 1ANCA 4A5WB 2G52A 1MKWH 2ZFQH 4QT8C 1GMDG 5EQSA 1ANDA 4WH8A 1KLIH 2R9PA 4DW2U 1K0HA 2BDHA 3TJVA 4DT4A 2VIDA 2JETC 2ANMH 2BLWA 3V12A 3VB7A 1S85A 2AHME 1IQLA 1ZJKA 2A45B 4B6EA 1O2TA 1MAXA 2ODPA 1Z8JB 1EAIA 1YPMH 1HFHA 1UTKA 1P2NA 2R3YA 4WJG2 1DXPA 3SI3H 3A7TA 1F0SA 1CA0C 1HAHH 2W3IA 4M9FA 3U8RH 1AI8H 3KIDU 1V2TT 1UK4A 1H04P 1GI7B 1S6FA 1TPGA 1OJVA 8GCHF 5GJ4B 1QJ7B 5F6MA 1H9LB 2A1DB 1P2MA 2O8LA 1MQ6A 2STBE 1DPOA 5FX5A 2CGAA 1UVUH 2LOJA 2OQUA 2AEIH 1EZSC 1QL9A 3F2GA 1O9AA 1PPHE 1EAXA 1SBWA 4NIXA 1TALA 2A7JA 1SGFG 2GZ7A 3EE7A 3A82A 1ZLRA 4DIIH 2QF5A 1RXPA 1MZDA 5HYOA 1Y5BT 1GKGA 4WMDA 1LVYA 1GBKA 3WW7A 1MZAA 2A2XH 3M61U 3Q3KA 5JBBS 3HGNA 1SOTA 1TGSZ 2LELA 1TNJA 1G2LA 1TBZH 1BITA 2AIPA 1P3EA 3TITA 2VVCA 4X2WA 4NSVA 1K1OA 3URDA 2CG6A 1Y3XA 1SQOA 1H4WA 3EDXB 3CNRA 1TIOA 1Y59T 4XFQA 1ZR0A 1BRCE 3PV2A 2ZGJA 1ORFA 3LKWA 2ZHQH 3TLOA 2Z9IA 2J98B 1H2PP 2OXSA 2RG3A 2GDDA 2FX6A 4AZ2B 1BTYA 4WMFA 3WY8A 1C9TA 1XMNB 1JMOH 1GJ8B 4JMYA 5DP4A 3K3TA 1BBRK 4FXGG 1YPJH 2P93A 3HPTB 4XRNA 2C3SA 2VVUA 2BDCA 1KSNA 2IPHA 4X6PA 3ZLDA 1AVXA 1O35A 1GJ7B 4BOHA 3ZV8A 5C0TA 1L0ZA 4TPYA 4YM9A 4D7FA 3FVFB 2Q1JA 2F83A 1TGNA 4INKA 1SC8U 1V2ST 4B76A 5JB9S 3SNAA 1E1RD 1HAVB 3M5OA 3SV2H 1CGIE 5T6DA 1MTNC 4DJZB 3ZZ8A 5DKMA 4O03A 3EQ0H 3Q77A 5E2PA 2Q6FA 2ZQ1A 2IZ3A 2BDAA 2B5ID 1LHFH 4BWCA 1LTOA 3RXEA 1LHEH 4U30A 4D9QA 8ESTE 3DSOA 2PSXA 1OX1A 1BHXB 2BLVA 2I6QA 1QY6A 2XTTB 3S69A 1GMCG 4KKDA 2QN5T 3PTBA 1GJCB 1HCCA 2JGXA 1FAXA 2WPMS 1DWDH 1ZGIA 1V2NT 2EY4C 2P8OC 2TPIZ 2QF3A 3CENA 4CRFA 3MI4A 1BRUP 3L6PA 5SGAE 1O2ZA 2CV3A 4CHAB 1ESBA 1J8AA 3IWMA 3UNRA 1PPBH 2BY6X 1UCYH 2HALA 4FUIA 4GLYA 2FZZA 1C9PA 3MH7A 3OU0A 2KCYA 3SU3A 2H9TH 4NA7A 3PO1C 3TH3H 4O9VA 4CR5A 3IG6B 1GJ6A 1RFNA 4K8YA 4X2VA 2FYRA 1KLJH 4B2CA 5EQQA 1AZ8A 4X6MA 2ZGHA 1PPEE 2IN2A 1ELAA 1T4UH 2G4TA 1GI8B 1CT2E 1JRTA 4JHSA 2F9PA 3FP8E 5ESBA 1IQKA 1GG6B 4UFFH 2Z6BD 2QCYA 1O2HA 3KQBA 3CI0J 4HI3A 2TGTA 1AKSA 3UQOA 1LPKB 2FIRH 2R0KA 4RT0A 1G30B 4FVBA 3ZD1A 2KM0A 3TH4H 3DFLA 5I0QB 2FOGA 2CKUA 1QGFA 2O8WA 5E0HA 5L30H 1O2QA 4Q7YA 3NUMA 4J2YB 2SGDE 3BG8A 1P3CA 2HVYB 1QB6A 1O3DA 5DGJA 1CO7E 3ESTA 2Q6DA 2Y5GA 4KTUA 3SNBA 4K2YA 4MNWA 2C4FH 1FQ3A 1V2OT 1W0KD 2BD8A 2CG7A 2V7QD 2HPQH 3A85A 3FZDA 1HPGA 1W0YH 4LZ4B 1UVSH 3ODFA 1GJDB 4OGYA 1Y3YA 2JJ1D 4D9RA 2W81A 3KGPA 4GCHF 1O5CB 5HM9A 2KCOA 3SW2B 2GVFA 3UWJH 4JZFH 1O2XA 1T8NA 1TGBA 3ZZ4A 2A2QH 2FLBH 3MU5A 1C1UH 1ELDE 2F9BH 4FUGA 2XBXA 2IJOB 2J97A 2VU8E 3ZYEA 2SGQE 1THRH 1D9IA 2ZDMA 2ZHFH 3NRLA 1QFKH 3M7TA 4X1SU 4XE4A 3AAUA 2BDYA 4I32A 2FO9A 2PFEA 3F0OA 2WIIC 1DDJA 5JBCS 1PPCE 1SVPA 2F9VA 2WYGA 3M3VA 4A1TA 1ZTLA 1UVOA 1SHYA 3PTNA 4Y76A 1WU1A 3TGIE 2AMPA 3MQLA 1P05A 2D26C 1HV7A 1H03P 4NCYA 2WV9A 4FETA 3ZZ5A 4RKJB 2L74A 1UJ1A 3TPIZ 3R3GB 2K0QA 3FFGA 3UPEA 1VKYA 5J4SA 2FTLE 3RXUA 5A8ZA 2BD5A 4U32A 4NIYA 1ZMNA 1U6QA 1P02A 1GJ5H 1HIAA 1PPGE 5C94A 5JDUB 3S7HB 4Q2KA 1ANEA 3KQ5A 1O3NA 3LJJA 4I33A 1KDQA 2O8TA 1QL7A 3DHKH 1WQSA 5HYPA 1GHQB 2Z9JA 5HMAA 1QQ4A 5DK1A 3TVJA 4ISOA 1NT1A 1A5GH 2A4OA 4KP0A 1A5IA 2KAIB 1GHZA 2AFQB 2BOKA 2V3HH 1HNEE 5E2OA 4YNXA 2ODQA 1N8OB 3E16B 4IGDA 5A8YA 3SU5A 5JBAS 3ENSB 2VWOA 1DX5M 1G9IE 2ZIQH 2ZPQA 5GCHG 1TRYA 5HZPB 1BMAA 5C20A 2BQWB 2BXTH 2KCPA 1P2JA 3LONA 4WY3A 4U2WA 3GDUA 1MD8A 2CK3D 3SUFA 1O3AA 3MHWU 2Z9GA 1YCPK 2G5NA 4D76A 5K0HA 4Y71A 2A5KA 4ASHA 2AGEX 4ISHH 1HRTH 3M35A 1EX3A 3MO9A 2XWJI 5GCHF 1K22H 1V2MT 1C1NA 5JPMH 1O2YA 4Q7ZA 3SZEA 2ZGCA 1TNGA 3MNCA 2Z3CA 3MU0A 2WZQA 1BDAA 3AK5A 2C8YB 3RXSA 3D23A 4Y6DA 3ZZDA 3RC4A 1Y3VA 1J16A 4BTUB 1G2MA 1LPZB 2BTCE 1YCPM 3SO3A 1Q31A 3GYMA 5C1XA 3MNXA 2XW9A 1HGTH 2BD2A 2YNAA 1Y3WA 1UTJA 3SOSA 1Z6JH 1K1PA 3FGRA 1A46H 2V0BA 2HVXA 4OS2A 4YXWD 3DSPA 2EA3A 1RS0A 3PLBA 5BRRE 1O5FH 4E7NA 3U9AH 2PGBB 2ZCHP 4NWKA 1NWVA 2A55A 4NIWA 2BD4A 1OYTH 1O3FA 1WSSH 3BIUH 1FY3A 2ZTXA 3LU9B 1J14A 1KXBA 2A32A 2GZ9A 4AB8A 1K1MA 1BBRE 5FCKA 1OK9A 5KGOA 1EPTA 5FPTA 5EG4A 1QO6A 5GDSH 2ZFFH 3KN2A 1RTLA 1DWEH 2OTVA 5EODA 4AYIA 3AASA 3O8DA 3RU4E 2WHXA 1O2RA 1C5QA 4UD9H 5G4BA 1TPSA 2R2MB 1O2PA 5A2MH 2FEQH 1C1TA 4DG4A 1Z1JA 1HXFH 3QWCH 1COWD 4WWYA 2GJGA 1GVLA 1P06A 3N7DA 3KHVA 1A3BH 2BD7A 3SJOA 1GJAB 1LKAA 2PWXA 4FUBA 3R62A 3SV6A 2W7UA 3A89A 1T7CA 1W2KH 2V35A 2UUKB 1GHAG 3A86A 4IN2A 3Q3XA 1UTMA 1Z1IA 4A5TS 1MTUA 1TYNA 4WF8A 4ZH1D 2XNDD 3SU2A 5DPAA 5FBIA 1P11E 3EYDA 2TBSA 3OTPA 3UUZA 1GDUA 5EU8A 4X8TH 1TONA 2CF8H 4CBNA 1O3OA 1UTOA 1VITF 1QCPA 2GMTB 4ISIH 1CT0E 2VIPA 1HXEH 1PQ7A 1DY9A 1HYLA 2ZU2A 3MNBA 3P8GA 4ASUD 1YKTA 1HAIH 5TCAA 3A8BA 1ABIH 5EW1H 1L4DA 1F5RA 3LC5A 3RMLH 5F53A 3PB1E 5FO8C 4XSKU 2P95A 1BA8B 5H4IB 2OK5A 3A7VA 3QUMP 1TX8A 3BN9A 2ANYA 3LC3A 5DJ7A 1HBTH 5FAHA 1HIAB 2ASUB 2EHFA 2EC3A 1ZPZA 1PYTD 1QBOA 1ZRBA 2OBOA 1OJWA 2BVSH 2Y81A 1LVOA 4R0IA 3GY4A 2OD3B 3VFEA 4X2XA 1AZZA 3RM0H 1SOZA 2PW8H 2F9NA 1SRZA 1TA2A 2RDEA 1GI0A 1GHVH 3L89M 3F2FA 2VH0A 3Q00A 1G4FA 1TGCA 3TVJB 1MCTA 2AS9A 1O3CA 2ZHDA 2KX4A 3A7ZA 4B6FA 1V2PT 1YPGH 2VIVA 1EXFA 3F3BA 4X6OA 3SORA 1ZHPA 1P9SA 1NRSH 3MO6A 3RC5A 2BZ6H 3QZRA 1QBVH 4ZMAH 1VZQH 1GL1A 1MKXK 5EJ1A 1NRNH 2OBQA 2XC0A 1V2WT 4K1EA 1EZQA 3OP8A 1BMLA 3E6PH 1AFQC 3CP7A 3I78A 3GISB 2C90B 1BB0B 1MAYA 5F03A 2QGRA 3MFJA 3NKKA 2ZFSA 4Y0YE 3W94A 2XBYA 2O39C 2RKYA 1EPTC 2VB0A 4MPUA 4UDWH 4X1NU 1AWHB 3OAAD 3QTOH 2A5AA 1HB0B 1NRPH 4K69A 4XBDA 2VBCA 1NN6A 3NFPI 4MDSA 4JYVH 4Q63A 1GHYH 5AFYH 5FHTA 2ZU1A 5C3NA 4O3UA 4YT6H 4AOQA 2HLCA 4J1YA 4K1SA 1ARCA 1OWDA 3STIA 4B2AA 1PQ5A 2NWNA 2AMQA 2J5UA 5GPIB 1E88A 1AQ7A 1GDQA 1T4VH 3OY5U 5A0CA 3BEIB 5JPMG 1S0QA 3GCTF 3VEQB 4MNYA 3RXBA 3GXEA 1K1LA 2G51A 4P02A 1FDPA 1GGDC 3M36A 3WSYA 1D6RA 5E0GA 2J94A 3ZZ6A 1DFPA 7GCHG 1YP9A 2PV9B 1ZMJA 1GWAA 3BTTE 3DCLA 1SGDE 5LGOA 1MQ5A 5DP6A 4ZHMU 2EQNA 1GBTA 1CVWH 1QRXA 4B2RA 2RA3A 4I86A 4DOQA 1TPMA 1GBLA 5FXLA 2BB4A 1SGFA 3UNSA 1G3EA 1SLVB 2GT7A 2V3OH 2GKVE 4GVUA 2I2LA 1SGCA 2THFB 1MD7A 3B8JA 1JRSA 5DN6D 2WV4A 3P8NA 3P92A 4UFGH 1KLTA 3BEUA 1C5VA 1H8ED 3V13A 1CBWB 2XRCA 5DP8A 4DY7B 3SV9A 1F5LA 4X8SH 4ZAEA 1BTUA 2CF9H 4BNRA 1DXWA 2Y8RA 1TNLA 1EJNA 2KZ4A 4AFUA 3OEDC 1ETRH 5GNDA 5A0AE 1SGEE 3PMAB 5FX6A 3LPRA 1GDNA 2FWWA 2P3UB 2ZU5A 1TX7A 4YLQH 2FI5E 1MTWA 1RJXB 1NM6A 2P3TB 5E8EH 4MPWA 1AUTC 1V2QT 1BZXE 1UTPA 5GXPA 1AE5A 1RIWC 4ACBA 1LHDH 5LPFA 3ZRZA 3H09A 2ILNA 1HFDA 1PYTC 1W7GH 1F0UA 1GI2A 1F0RA 8GCHG 1WXRA 2BXUH 2OUAA 2FPZA 3RXFA 1GBFA 5T1VA 1O3BA 1VCWA 2Y7XA 2C8XB 1LY2A 1N6XA 2PUXB 4TT3D 5PTPA 2ALPA 4BXSA 1L2EA 3MH6A 4GPGA 2GCTC 3T25A 1EKBB 2AMDA 2QXHA 3BIVH 1NESE 2ZKSA 2ZGBH 3T5OA 5J4QA 3K6YA 5JYIA 5T6FA 1WTGH 1YPHC 1GHXH 3RP2A 4RT1A 1L1NA 3PRBA 2D1JA 4IS5A 1EOLA 1GBDA 1SR5C 4AB9A 2ZP0H 4NG9H 1GCDA 4Q4LA 2Y5FA 2IPQX 1FNIA 4INLA 4CH8B 3VPKA 2SNWA 3FAOA 2ZYCA 1NRRH 3RXDA 1IHTH 1P01A 3T2NA 2VWNA 2I6SA 1ABJH 2BLQA 5EOKA 3U28C 3STJA 2V8EA 2QXGA 5DP3A 5IYTA 1AFEH 1NFWA 2JIZD 1AU8A 1BHXF 2Z7FE 4E06H 1C1OA 2JETB 3RMMH 1G32B 4MSLA 1RIWB 2ZTYA 4MTBA 1ZPCA 1O2VA 1KTSB 4F55A 1TMUH 1D6WA 2BMGB 3KQDA 1ARBA 3A80A 1YLCA 2EEKA 4JK6A 5EPYA 1P10A 1WOFA 2CHAC 1C1WH 1YC0A 3VXEH 1CA0B 2FOFA 2HNTE 3Q3YA 3E3TA 1YY3A 5DP5A 3ITIA 2IJD1 2ZG0H 3BTEE 1A0JA 1HJ9A 4OS7A 3LDXH 2FLRH 2BX3A 1BRBE 2VVVA 2AERH 4MQAA 2C93B 2BY5X 1Y5AT 1C5LH 1LDTT 3LGVA 2ANWA 1GBJA 3OYPA 1C5NH 3RXIA 5EIYA 1KTTB 1TRNA 2ERJA 3RXGA 2D2DA 2FOHA 3FP6E 3T28A 1C1VH 2WINI 4KTSA 2EI6A 2ZDLA 1OK1A 1T31A 3K9XB 3GDVA 1Z8RA 2KCAA 1BRAA 2G5VA 1O2GH 1SFIA 1O5AB 1Y3UA 1GMHF 1Q3XA 4ZUHA 3LH1A 2SGAA 1QQUA 3CS0A 2RFKC 1C5YB 2ZPSA 1C2KA 2W26A 4KGAA 3UR6A 4YOGA 4FUCA 2OLGA 3RXJA 1A0LA 6LPRA 3VWOA 2G8TA 2CN0H 4AN7A 2BVXH 1O2UA 2ZHEH 1V2RT 3PV5A 1GPZA 4NA8A 1G37A 4UE7H 3RXCA 1UHBB 1G3BA 1MBQA 2GZ8A 3ERBA 1W11U 1CKLA 1VR1H 5AF9H 2G7IA 1W12U 4ABJA 4CRAA 1GI6A 1O3GA 1G4GA 3F6UH 1ETSH 3FO8D 1C2GA 1ZPBA 2PKAA 1BIOA 3TJUA 3RXQA 3RXOA 2KR7A 1TLDA 1PPZA 4BAHB 1SG8B 5L6NH 1BTZA 1X7AC 3BTDE 1YYY1 3L3TA 4AGKA 1S0RA 2FS8A 1H9HE 2G55A 2EI8A 3I29A 3SJ9A 3IX0A 2JH0D 3S9BA 4ABDA 1C5RA 4PO7A 1H8IH 1MTNB 3GY8A 1O34A 4JZIA 3ELAH 1TWXB 3BV9B 2TGDA 4ABIA 4GHQA 4HGCA 1LHGH 1J17T 2CJIA 1N6YA 5C1YA 3MNSA 4B2SA 1CHOF 1EATA 1FN6A 2WPDD 1GBIA 1ELTA 4GCHG 3Q76A 2F91A 1S6LA 4JZ1A 2VWLA 2UUFB 5EQRA 2P8OB 3PRDA 4YZUA 1VVDA 4YTAA 1EP6A 1A1RA 3GS9A 2QV1A 1JXPA 4SGAE 1VITH 1FZZA 2ZFTA 5HYTB
chains in the Genus database with same CATH topology
2H2ZA 4Y8ZA 4LOSA 2XC5A 3PO1B 2HOBA 3SU4A 4B73A 2HNTF 2XYAA 1FLEE 1AGJA 5CHAC 4ZROA 2GT8A 3DFJA 3SNDA 3A81A 3P8FA 1AUJA 2W3KA 2AH4X 4I8KA 2BD3A 3GDSA 1T32A 1SFQB 1PJPA 1QL8A 2UWOA 3FP7E 1W3CA 4X0WU 1QR3E 2ZU3A 1TBQH 2KRIA 3BTFE 1KY9A 3A7YA 1OK3A 4I8JA 2JH5D 1O2WA 1TA6A 2VJ1A 2BZMA 1ACBE 2B9LA 1IQFA 4WH6A 1RGQA 4FU8A 1O32A 2ZZUH 3D65E 1FIWA 2QA9E 2R0LA 3M5LA 2MCZA 2ZFRH 2WPJS 4ZHAA 3TJOA 3T27A 1KXEA 2UUYA 1SSXA 3PWBA 2FP7B 4B74A 3GY7A 5DP7A 2GCHG 1DLKB 1C5TA 3RXPA 3UTUH 1QBNA 3TNTA 3NPSA 1NTPA 3INBC 4RSPA 5ABWA 1O2KA 4NFFA 2QF0A 1BJUA 2UWPA 2RA0A 1AB9C 1EB1H 1W7XH 3C1KA 4XBBA 3UFAA 4K5ZA 5JB8S 4OS6A 2ZDVH 1C1RA 3AVZA 5AHGH 4BAOB 2J4IA 4LK4A 2GCHF 2GTBA 4THNH 1BBRH 3EAJA 3RMOH 4AYEA 3GCHC 3K65B 4B71A 3LGIA 3GOVA 5GIBA 4I8HA 1NC6A 1EJAA 1UVTH 4WVPE 1O2NA 1SGRE 4ESTE 1QURH 4UFEH 5IDKA 3ZVAA 1OWEA 1WCZA 2VGCC 3S0NA 5BPEA 1C4U2 2SFAA 2DE8A 1C2FA 3URCA 3CALA 1V3XA 2Z9LA 1ANBA 1D3TB 1ZHMA 2QC2A 3S7KB 3ZVCA 2WPKS 1GBCA 1WTHD 4FU9A 2RKZA 1TABE 4XOJA 5K7RA 2FOMB 2HPPH 1BT7A 1YPEH 1EP5A 4I8GA 1T8LA 4MUCA 3ZVDA 3SJ8A 2GDEH 2NU4E 1A4WH 4CH2B 2QYIA 3MOCA 2RDLA 4GAWA 2Y5HA 2PKAB 3RXAA 1A2CH 3A8CA 1OWJA 1VVCA 2AGIX 1A61H 4BAQB 4LOTA 4C16A 5EXLA 1AHTH 5FCRA 2BVRH 4O3TA 4R8TB 3SGAE 2ZEBA 1AKSB 4CRDA 1UMAH 5C5OA 2ZDNA 2MCYA 3E1XB 2FTMA 1FONA 1GJ9B 1DUAA 2BDGA 4UFDH 2BLOA 1QHRB 1K1JA 1K9OE 2TGPZ 4AORA 3NZIA 1ELBA 1DLEA 3GCHB 3SI4H 2FOAA 1AO5A 1O5BB 1XVMA 3TH2H 2BYAX 3RXHA 2XCNA 3UNQA 7ESTE 3AW1A 1P9UA 4DCDA 1P57B 1SPJA 2OC8A 2FODA 3OTJE 6CHAC 1MKWK 2QIQA 3SU1A 2JGWA 4X1RU 2VGCB 3M3SA 1IQIA 1C5UA 1LQDB 4Y8XA 5L2ZH 1OP2A 1TBRH 1VJ9U 2Y82A 1XX9A 1P04A 3RU4D 4FUFA 5C1UA 1ZTJA 3M5MA 1OYQA 1V2UT 2ZTZA 4H42U 4J38B 1G3DA 4Q80A 2NU1E 2BD9A 3QO6A 3SBKA 1S83A 3SV8A 1TGTA 1S82A 3PWCA 2XBWA 2R3UA 3E0NB 3E8LA 4JZDH 3SHAH 1GBAA 4CSYA 1SGYE 1W8BH 5AVDA 4U01A 1DWCH 1MTSA 2PLXA 1TQ0B 3LT3A 2OQ5A 1O2LA 3LOXA 3M5NA 1OS8A 3F68H 1VITG 3ZVBA 1E0FD 1P09A 1O5GH 2RLPA 1D4PB 3NK8A 1FY5A 5B6OA 1FAKH 1ELGA 1GCTC 4K8BA 8LPRA 1OP0A 3GY5A 4ZH8A 2YNBA 4ZXYH 1H2QP 2Q6GA 2BY7X 1Z8IB 3ZZ3A 3MH5A 1O3JA 1W10U 2QY0A 4FUJA 3RUOA 2Z9KA 3KQCA 9ESTA 1B0EA 1GHWH 4A92A 1ZOMA 2IZ4A 3LGTA 4OS4A 2Y7ZA 3R0FA 3SN8A 1KDQB 1HUTH 3GY3A 3U69H 1YF4A 1Z71A 1YLDA 4NA9H 1JIRA 3ZYDA 3D49H 1IQEA 4AFZA 1FN8A 1BTWA 4RKOB 1FY1A 1SGTA 3I77A 4X8VH 1EQ9A 3UY9A 3UIRA 1IQNA 2H5CA 3A8AA 1TX6A 1SGQE 1H9IE 1UTQA 1FMGA 3TK9A 3MTYA 1OXGA 2BY8X 3HKIB 1O3HA 5L2YH 1THPB 1HCGA 1KXAA 3F9HA 1UK2A 1MU8B 1OSSA 2UUJB 3DT0H 1XUFA 4DURA 3JZ2B 3UREA 2TIOA 3GOVB 2TGAA 3HATH 3PMHB 1P2OA 1BQYA 1C1QA 2BX4A 3QGNB 2F3CE 1C5MD 1XUGA 3M7QA 4ZXXH 1YGCH 1SL3A 2AYWA 1A5HA 3A88A 1EAWA 3BTKE 1C5PA 3P6ZB 1QIXB 3GCTG 3SZNA 4NZQA 3T5FH 3OSYA 1C5ZB 4E05H 1GI3A 3SUGA 3QGJA 1QGBA 1GBEA 3HK6B 3M37A 4DIHH 1IHSH 3F9EA 1AD8H 1FPHH 3VGCC 2A0QB 3MYWA 5JBTA 1S5SA 1YCPH 3AW0A 1HJAC 2H9HA 2ZDAH 5ETXA 1A0HB 4ABEA 3ZZCA 1ZTKA 1NFUA 1EAUA 4K12A 1LHCH 2YOLA 1MMJN 4Y7BA 1ZSLA 3RMNH 1LVBA 1SGNE 5ESTE 1UCYK 4TWYA 5I46H 3KL6A 5EGMA 1AVWA 3GY2A 1OPHB 2ZDKA 1DM4B 4F4OC 2QXJA 1AFQB 2Z94A 1M9UA 2FI3E 5C67A 1XKAC 4ABHA 2O8MA 1W13U 3B9FH 2PR3A 4ZKNU 1EPTB 5LPRA 1AN1E 1S6HA 3GY6A 2BQ7B 2Z3DA 1CE5A 2JH6D 1PPFE 3K2UA 4AYVB 1G36A 3ZZ7A 5T3HA 2AIQA 2A31A 2J38A 3K6ZA 1NS3A 3OY6U 3UOUA 4MNXA 1XKBC 1BCUH 1Z8GA 1IQMA 1ZJDA 3HGPA 1PPQA 1F5KU 1WAYB 2M5TA 5EW2H 4A6LA 1ZZZA 2D8WA 1GVZA 3KNXA 1DSTA 3TK5A 2BDIA 1AE8H 2J92A 1FPCH 1E38B 1TPOA 2G81E 3H5CB 2J34A 3VGCB 3QTVH 1EB2A 2ZCKP 4AFQA 1CQQA 1HJAB 1D3QB 1GGDB 1F92A 3EGKH 3A7XA 4MVNA 4OGXA 2FX4A 2K1QA 3E90B 3V3MA 3SUEA 1P2QA 2WV5A 3SQHE 3PROA 4F49A 1IQHA 1UTLM 2XWBI 1UO6A 4XDEA 3SJIA 1SS2A 1YPKH 2J95A 3QX5H 1TQ7B 1OK2A 1GMDF 1ZGVA 1C4V2 1XXFA 1BMNH 1GL0E 2CMYA 1KIGH 1C2LA 1TRMA 3SV7A 3PM3A 5I25A 3LH3A 5GWZA 2B7DH 2ZCLP 1O3IA 4PROA 4WXIA 1NO9H 5A09A 4UONA 1ZMLA 3PV4A 2G4UA 3QK1A 2QY0B 1F7ZA 1THSH 3F1SB 1OOKB 4B2BA 3OX7U 2G00A 3TJNA 1ZSJA 2J9NA 2DUCA 2BM2A 3RU4T 1T8MA 2GP9B 4MLFB 2EI7A 2NU2E 1P2IA 2OCVB 4TY6A 3VXFH 3GCOA 4NIVA 1O2OA 3LGWA 5C2ZA 4YESB 4NGAH 1QUBA 1TNKA 3KZJA 1K28D 1L1GA 2ZA5A 4SGBE 1ELFA 3VB3A 1O33A 5HGGA 5HM2A 5A8XA 1OWKA 6ESTA 2P59A 4MNVA 1LPGB 4AG2A 4CRBA 1NU7B 1LMWB 3SU6A 1TPAE 1V6DA 3LIWA 2XRBA 1V2KT 4ZHLU 4JYUH 1LVMA 2TRMA 1V2LT 1CHGA 3O8RA 3U8TH 3BTHE 4BTIB 4X1QU 4GHTA 4CHAC 3LGUA 1S81A 1NZQH 2GCTB 2A4GA 4M7GA 4IC5A 3MU8A 1HAGE 4AX9H 3BTQE 2XC4A 1UTNA 1MKXH 1L4ZA 1O5EH 1DITH 5FPYA 5HXFA 4NWLA 1E36B 3RXMA 1WUNH 2XNIA 1UK3A 4PZ5A 2VINA 1TMBH 1PQ8A 2BQ6B 3U1JB 4IN1A 2FI4E 3S9AA 1GMHG 3BTGE 4NSYA 3N7OA 1ETTH 2XCFA 1J15A 1V2VT 3P70B 1GG6C 1DY8A 2FMJA 2P3FH 2PGQB 3T62A 1AIXH 1BTXA 3FANA 1Z7KA 1O38A 2KAIA 3GICB 1ELEE 4DGJA 2XWAA 2A4RA 4YOJA 3SGQE 1SGIB 1HAZB 1QA7A 3PMJA 4YOIA 4D8NA 1ZSKA 2ZPRA 1NPMA 1HAYB 3MU1A 5F8TA 1P0SH 1P8VC 2STAE 3UOPA 1E8BA 2R2WU 3RXRA 5F8XA 7KMEH 3GCNA 1YPLH 3JZ1B 1C1ZA 2CHAB 1C2DA 3D62A 3QDZB 2B8OH 1ESAA 1TPPA 5TCCA 1DOJA 4D7GA 1MBMA 3EA7A 4AGJA 2ULLA 3RLWH 1QRWA 1XVOA 5FPSA 2NU3E 2HGTH 1GMCF 2Z3EA 1RD3B 3A84A 1TNHA 2FXRA 3TK6A 1DT2A 4LOYH 4TYDA 4AG1A 2WPHS 4A1VA 1DVAH 1D3DB 2SGFE 2OC0A 4HFPB 1Y5UT 3O8CA 1CHOG 3NCLA 3EJHA 2ZQ2A 2ZNKH 3ATIA 1P2KA 1JIMA 4LXBH 1NU9A 1EZXC 1HDTH 4FUEA 3B23B 3MMGA 4CRCA 3PYHA 3M3TA 1SQTA 5DP9A 3P95A 1EZUC 3MH4A 2A5IA 4TY7A 4Y10E 1BTHH 4CBOA 1W0ZU 1QNJA 1TAWA 1GJBB 1MUEB 1XUIA 3A83A 4JCNA 2Y80A 1JBUH 4B75A 1INCA 1QJ1B 1TB6H 4ONTD 2RCEA 2UWLA 3QLPH 3U98H 3KF2A 3ZZ9A 3T26A 3LJOA 2VNTA 3G01A 3OXUD 1MH0A 2GV6A 1E34B 1ID5H 1MU6B 4IMQA 4X6NA 1NFYA 4IW4E 4DVAU 1KXDA 1V2JT 2ANKH 1D3PB 1C1SA 3MWIU 4KTCA 2VH6A 3HKJB 2HRVA 1HAOH 3QN7A 3O8EB 2XBVA 1DUEA 2GD4B 3BTME 2LNCA 3BSQA 4K60A 1JOUB 2LPRA 1CGHA 1ELCA 1C2MA 4ABBA 4BXWA 1VCQA 1OJYA 2HNTC 3TIUA 2QAAA 1RTFB 2VWMA 4ABFA 3SUDA 3P8OA 7LPRA 1NY22 4IMZA 1UCYE 3KXVA 1CA8B 1HJ8A 2V6NA 2H5DA 1EJMA 4NFEA 1N8OC 1DSUA 2WPIS 4MPVA 1K1NA 3EE0B 1C2JA 2OINA 1C5SA 4ZKOU 3RJ3D 3GYLB 1FIZA 1JWTA 3SHCH 2W7SA 1MTVA 1O2MA 3E0PB 1F2SE 1FV9A 1VCPA 3T29A 1ESTA 2A7HA 2ZFPH 1WBGB 2ZC9H 1NROH 1B5GH 1FY8E 1GJ4H 1TOMH 1O31A