4F4OC

Structure of the haptoglobin-haemoglobin complex
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
314
structure length
309
Chain Sequence
CPKPPEIPKGYVEHMVRYHCQTYYKLRTAGDGVYTLDSNKQWTNKVTGEKLPECEAVCGKPKNPVIMGGSLDAKGSFPWQAKMISHHNLTSGATLINEQWLLTTAKNLRLGHKNDTKAKDIAPTLRLYVGKKQEVEIEKVIFHPDNSTVDIGLIKLKQKVPVNERVMPICLPSKDYVNVGLVGYVSGWGRNANLNFTEHLKYVMLPVADQEKCVQYYEGSTVPEKKTPKSPVGVQPILNEHTFCAGLSKYQEDTCYGDAGSAFAVHDKDDDTWYAAGILSFDKSCRTAEYGVYVRVTSILDWIQTTIAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemoglobin subunit alpha
publication title Structure of the haptoglobin-haemoglobin complex.
pubmed doi rcsb
molecule tags Oxygen transport/transport protein
total genus 68
structure length 309
sequence length 314
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4f4oC01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4f4oC03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4f4oC02
2SGFE 3SBKA 1P9UA 2ZGXH 4ABEA 1O34A 4ISHH 1HNEE 4AFSA 4GAWA 2RLQA 2YOLA 1GHZA 1HXEH 4ZXXH 2GCHG 4XSKU 2G7IA 1FDPA 1FN8A 1SGYE 3ODDA 4JYVH 1EPTB 2AMPA 4CHAB 3OEDC 2FTMA 3SUFA 1U5MA 3TH2H 5GCHG 1AY6H 1E34B 2J4IA 2QXHA 3RDZA 1K1IA 4ZHAA 1O35A 4TPIZ 3KL6A 3QUMP 3OYPA 4FU9A 3T28A 1C2FA 1O5AB 1UTJA 3DFJA 2BQ6B 5EXMA 3QDZB 1VGCB 1TBRH 5EXLA 3LJOA 5A2MH 3I77A 2Z9GA 4JK5A 1QFKH 2KAIA 1OX1A 3NZIA 5AFZH 1V2PT 2AYWA 1P2NA 1TX7A 2ZFPH 2ZHFH 1XUHA 2AS9A 4KTSA 4YZUA 3K6ZA 3ZZCA 3SUDA 2B8OH 7ESTE 2TRMA 1IQIA 2F9PA 9LPRA 2GCTC 2ZZUH 1KIGH 3RM0H 4X6PA 4KTCA 1O3PB 1DPOA 1BTZA 3LT3A 4XBCA 4BTUB 4AZ2B 1ZPCA 4THNH 1NO9H 2VVUA 3V12A 1H8IH 5LPRA 1ESBA 4U30A 1NTPA 5DG6A 2IN2A 4LZ4B 4TWYA 4CRCA 2HRVA 5E2PA 4D9RA 3SUEA 1B0EA 1DOJA 3BG4C 3URCA 1DWEH 5E0GA 3OU0A 2XCNA 2Y7XA 4CRBA 1O3EA 4CR5A 1O2VA 2A5AA 2J94A 3HGPA 2BVRH 1TMUH 4CRAA 1P2JA 4Y0ZE 5A8ZA 1SLUB 2QXJA 5EGMA 1HBTH 1A0JA 3C1KA 2H9HA 2CF8H 2VGCC 2W26A 1QUBA 3UFAA 2WINI 1GI5A 3UIRA 2BDYA 5DP6A 3KQEA 1O3DA 1CO7E 1QJ7B 1ZSJA 3PO1C 3PTNA 3PWCA 1T31A 2A2QH 1F92A 1PPGE 3RC4A 3MH4A 1V2JT 2J92A 1ELCA 1TIOA 3PLPA 1QGFA 3M61U 1Y59T 1HPGA 1D3QB 1C1TA 1EAIA 5ETXA 2Z9IA 5FPYA 1TNKA 1W12U 1OJWA 2FXRA 2JGXA 1DDJA 3D62A 2QY0B 1AWFH 2EA3A 3SV9A 1GCTC 1UMAH 8ESTE 1GVLA 2WV5A 3BG4B 1TPPA 3MNBA 1AGJA 1C1PA 1C2GA 1O32A 2PTCE 3MOCA 1BQYA 1ZJKA 1KLIH 1EPTA 3PTBA 2XWBF 4F49A 2F9VA 2G55A 5I0QB 1ELDE 4CRGA 1AO5A 2ILNA 1C1RA 1AI8H 1O3JA 1UTMA 2XBXA 5F8TA 1DWBH 4UFDH 4HGCA 1YM0A 1DITH 1SG8B 1FNIA 1ACBE 3SV8A 1SGFG 3RXTA 1L2EA 3F9EA 5I46H 1MAXA 2A31A 2ZU2A 2ZEBA 4Z6AH 1BZXE 2QC2A 3F9HA 3SU1A 1F5KU 7GCHF 3TPIZ 2GV7A 1AIXH 3M5NA 2FOCA 4SGBE 5GPIB 3E1XB 1LQEA 1KXDA 2Y5HA 2EC3A 1C4V2 2C8XB 1ZLRA 1P2MA 2Y80A 1EZXC 1O5DH 2ZQ2A 1EJMA 3PROA 2GT8A 3UWJH 3BTFE 1TPGA 2WPIS 1O2TA 2XW9A 1YCPK 4Y79A 4ABFA 1IQMA 3M5OA 1OWJA 2G4TA 2PR3A 1B5GH 1GI8B 1JXPA 1NFWA 4WXIA 3GDSA 1ELVA 1A2CH 2BD8A 1ARBA 2YBYA 1S81A 1UTPA 4YLQH 2W3IA 3H7OA 5F8XA 1EX3A 1OJVA 3O8BA 1GDUA 2UWLA 1OP0A 4FU7A 4X2VA 3RXPA 1OKXA 3ZYDA 3W94A 1C2LA 5DJ7A 2FZZA 1GBHA 1YPLH 5AF9H 5EODA 2H1UA 3ZZ7A 3Q00A 1TPMA 1AN1E 2FOEA 3SU5A 4ZKOU 1NRQH 4TPYA 1PQAA 2CKUA 2ZGHA 1ZPBA 2Z9KA 4IC6A 3PMAB 4ISOA 3VXFH 1ZRKA 5BPEA 4K12A 3E0NB 2V35A 1S0QA 2ZDLA 4X1RU 1OK1A 3KNXA 1C5UA 1N8OB 3BSQA 3BG8A 1EZUC 4MVNA 4A1VA 5HM2A 2BD7A 3RMMH 1TLDA 3RXGA 1NFXA 2QYIA 2VB0A 2XWBI 1DUEA 2G51A 5T6GA 3ERBA 5C67A 1GJDB 1QHRB 2GDDA 4MTBA 1MCTA 1A1RA 3L33A 1ZTLA 1NU7B 2ZGJA 1WCZA 2TGPZ 1IQKA 1A0LA 1IHSH 4ABAA 2QF3A 3SNAA 1UTOA 1P03A 2Z3EA 1O5BB 2FLBH 3EDXB 1QY6A 2QY0A 3SO3A 3ZYEA 3BF6H 2ZHQH 2ZI2H 2TGDA 2BOHB 4JMYA 4KKDA 2XC4A 1G30B 2UUJB 2JH0D 4NG9H 2CF9H 3P8OA 2BB4A 3U1IB 1A61H 2ZC9H 1GJ7B 3NUMA 4E7RG 3OY6U 3RUOA 4ZH1D 4CSYA 1O5EH 3BEIB 1O3MA 2AIQA 3PYHA 1YF4A 3O8CA 1P57B 4CREA 8GCHF 1TOMH 1NFYA 1HCGA 4K60A 1GBLA 1EATA 1Z71A 3MH6A 3Q3KA 4JK6A 4YTAA 2CG6A 3FP7E 4A1TA 2Y5GA 3R62A 3GY5A 2QV1A 2DE8A 1V6DA 2XWAA 4AYDA 1K1OA 1YPJH 3ZVAA 4HTCH 2JKHA 1H2QP 1O2PA 2O39C 3MNSA 2CMYA 2OINA 3GY4A 1RD3B 1TNGA 4E06H 2ZECA 4Z0KA 4BAKB 5C5NA 3MU8A 2Q6GA 3LU9B 6CHAB 3MNCA 1BBRK 1L4ZA 4CRDA 2G00A 1SGFA 7KMEH 5AHGH 1G2MA 1EP5A 1MTNB 2G52A 1SMFE 2JGWA 1NRRH 8GCHG 3EJHA 2FPZA 5A8XA 1K1JA 1WQVH 1QRXA 4CBOA 1EQ9A 2WPLS 3K6YA 2OXSA 1WBGB 4NSVA 3VB6A 4ZUHA 2BD5A 1A5HA 1MTUA 1SGQE 4KELA 3T2NA 1PPCE 4J2YB 4BAMB 1G4GA 4NZLA 5E0HA 4BXWA 1P09A 4YNXA 3DUXH 1DUAA 3U69H 2BD4A 3VEQB 3LGUA 3RXRA 3K2UA 2PUXB 2FIRH 4Q2KA 2Y82A 2CHAB 1TPNA 1BTHH 3SHCH 2RLPA 1MTVA 5HGGA 1D4PB 4AYIA 1P05A 2VIQA 3U98H 1TX8A 2VIVA 2F9NA 1MCVA 8LPRA 4O03A 5CHAC 3LIWA 5E2OA 1L0ZA 2BY5X 1Y5AT 1C5NH 1T4UH 2IPHA 1DFPA 3TH3H 3A8BA 1AVXA 1ZMLA 2BD3A 1AKSB 1K22H 1D6RA 2P8OC 3QN7A 1J8AA 1YC0A 1GKGA 1ABJH 2EI7A 3FAOA 3ZZ3A 3FZDA 1O3AA 1VITG 1J17T 2ODYB 1ZYOA 4NFFA 1C1MA 3EYDA 1GMHG 4LXBH 1HAVB 3MU5A 3BTGE 1TFXA 2NU0E 1O3IA 1GBDA 4IN2A 4K3JA 3B23B 1P11E 1P3CA 1SLVB 4FUDA 4D7FA 3G01A 2HPPH 3SU4A 4DG4A 2FMJA 3FZZA 1ARCA 1XXFA 2PHBA 3SGQE 5JBAS 3S7KB 3HGNA 4HFPB 1DY9A 2NU4E 2J95A 3SJ9A 2WPHS 2GZ7A 1PFXC 1SC8U 4YOIA 1A3EH 2AERH 2SGDE 2V3HH 1UK2A 4UD9H 1FXYA 3QWCH 4INKA 4K5ZA 3KXVA 2P94A 2GMTC 2VINA 2ANMH 2FI4E 1CVWH 4CH8B 2ZFQH 1Z92B 2FX4A 1E8BA 2C8WB 2BD2A 3IX0A 1V2NT 4ABHA 1WTHD 3K65B 2V0BA 2KRIA 3HPTB 1SPJA 3IITA 2BY8X 2THFB 2HGTH 1GBTA 1AWHB 1ZJDA 1JBUH 2HNTC 4VGCC 3L3TA 1O2MA 3HK6B 2BY7X 1FBRA 3UUZA 5C20A 2TIOA 3A7XA 1KXAA 4JYUH 5HMAA 3RLWH 2SNWA 5C2ZA 4NIVA 3MU4A 4OGXA 2C90B 4DY7B 3SJOA 1FY3A 2ZTYA 1LKBA 4RSPA 2ZWLH 1PPFE 1FIWA 3GDVA 3SJIA 1AVGH 3A8AA 1C2DA 5C1UA 4B2SA 1YPHC 5FCKA 4MDSA 3SI4H 1C5LH 1VITH 5EQSA 3GCTF 3VB4A 2TGAA 1DVAH 2BLOA 4UONA 5DPAA 2H9EH 2ODQA 4MQAA 3BTEE 4MNXA 1SBWA 1G37A 4AG1A 1MTWA 1EAUA 1EP6A 2ALPA 5J4QA 1OWDA 2BDCA 4PZ5A 2EI8A 4BOHA 3R0FA 3SZNA 2P3UB 3ELAH 1EPTC 1Z8JB 4CHAC 2PKAB 3TK5A 4A7IB 1CA0C 1NRSH 1SQAA 3IU3I 2GVFA 2F9BH 1C5YB 3E3TA 1C1ZA 3GDUA 4TY7A 2C93B 1HAIH 3SQHE 4D8NA 2NU3E 1KDQB 1Z8IB 1GI3A 1UTKA 2XRBA 2ZCHP 1C2KA 1VGCC 5DGJA 3ATMA 1GG6B 2BTCE 3EA7A 3GCTG 1BRUP 2G4UA 3EA8A 3QZRA 1XVMA 1FY5A 2IZ4A 1J14A 1AKSA 1HCCA 1Z6EA 2FOHA 1KTTB 5T6FA 3UNRA 1P0SH 2ZNKH 4ABDA 1NN6A 5G4BA 5LGOA 1BMNH 1SGEE 1HAVA 3A7VA 1SOZA 3EGKH 1KXEA 1IQFA 5FX6A 3H7TA 1G2LA 4NZQA 2VU8E 4WMEA 2FLRH 3RC6A 5L6NH 5EW2H 1O2IA 3GY6A 1DLEA 1MH0A 4DIHH 1NRNH 1BT7A 1PYTD 1A4WH 1K21H 1RXPA 1WAYB 1OP8A 1O3BA 2VH6A 3LGTA 1CHOG 1H4WA 3T5OA 1OK2A 2XNIA 4OS5A 3MU0A 1ZTKA 1C2IA 2O8MA 3TJOA 4BXSA 2R2WU 4X1QU 1CA0B 1O2XA 2F9UA 3H5CB 3V7TA 4XOJA 2W3KA 1F0UA 4BTTB 1BMLA 1WUNH 1C5VA 1SSXA 3FFGA 1BRAA 3P6ZB 3UR6A 2V6NA 1OSSA 2PLXA 1O2KA 4OS7A 3JZ2B 3EA9A 3A85A 1ZOMA 1CGIE 4B76A 3D49H 1TRNA 1VR1H 2XBYA 5FPTA 1G32B 2A32A 3HATH 1TABE 4H6TA 2H2ZA 1CBWB 1SLWB 3S9BA 2M5TA 1W0YH 2MCZA 2FYQA 3TJNA 1ZR0A 5H4IB 1RFNA 4X6MA 5GIBA 4DOQA 1O2GH 2FOFA 1ZRBA 4GSOA 1JRTA 1A46H 1QB9A 3T26A 5DP8A 1BMAA 1RIWB 3RU4T 2P59A 1GHAF 2G8TA 3ZV8A 1NY22 4HZHA 1JRSA 1SLXB 1U6QA 1C4Y2 2JH5D 1ZMJA 4X8TH 2AH4X 1TQ0B 2OC7A 4ISNA 1UVPA 1FV9A 3MO9A 1GJ9B 2AGGX 1GMDF 3RXBA 1QURH 3KEEA 3M5LA 5JB9S 1AMHA 3Q77A 4O3UA 4NA7A 3CP7A 3STIA 2OQ5A 1C4U2 1QA7A 4H6SB 2DUCA 4Y8ZA 2ZFRH 1HV7A 3KZJA 4X8UH 4GLYA 3FANA 1WTGH 5JBTA 2BLQA 3TJVA 2UWOA 1LHEH 1ZGIA 2PKAA 2EI6A 1F2SE 3ATLA 4WWYA 2FEQH 1PJPA 1V2OT 2CV3A 3A8CA 1LMWB 4WMFA 4Y10E 2HOBA 1GJ5H 4Y7AA 2SGQE 1V2MT 2A45B 4IN1A 4A5WB 4B73A 3HKIB 1KDQA 1AZZA 1GGDB 1SGNE 1GMDG 2O8TA 1D6WA 3JZ1B 2VWOA 4DJZB 1QCPA 3QO6A 1GHWH 4MNVA 3BTWE 1SQOA 3PB1E 2I6SA 4K1SA 4B2BA 1XUJA 4K1EA 1SFQB 1T8LA 1HJAC 2A4RA 2D2DA 3B9FH 4B2AA 3A7WA 3AVZA 2XC0A 1UOTP 4K69A 1NRPH 3PWBA 2HALA 3P17H 4DVAU 2BXTH 1LHFH 1OYTH 1IQGA 2Z6BD 4Y7BA 1LKAA 3GISB 3TIUA 2FOMB 2ZF0H 3LOXA 3LPRA 1C5PA 5JDUB 1O2LA 1T8MA 1HYLA 3M35A 3QZQA 5EG4A 1NU9A 1RJXB 1V2QT 2VWNA 1QJ1B 1NWVA 1WV7H 2BDAA 2UUKB 3S9CA 3PV4A 2A4OA 3ZVDA 3SN8A 3UOPA 1GBKA 1WOFA 1ESTA 5GXPA 1OK3A 1FONA 2SGPE 3RXHA 1KXCA 1OXGA 2HLCA 2LPRA 2OBQA 1H8DH 4IGDA 1E38B 2ZHDA 3RMOH 3LJJA 2GZ9A 4GVUA 1NT1A 1EZQA 5DP5A 2UUFB 3T5FH 3TLOA 3D23A 2FI3E 1Y5UT 2JETB 1HJAB 1ESAA 1Q31A 2BZ6H 2P95A 3GXEA 3F1SB 1HAXB 3RXLA 2AMDA 1TGCA 2ALVA 1DY8A 2BDIA 1JIRA 3ZD1A 1SOTA 1MUEB 1RTLA 1EUFA 1N8OC 1NS3A 5F8ZA 1SHYA 3MO3A 3SNEA 3T62A 3RM2H 5EQRA 4BAOB 2VVVA 4IC5A 1WU1A 1C1OA 1NM6A 3A86A 3M7TA 5HYPA 1V2WT 3GYMA 3P92A 2ZPQA 5L30H 1A5IA 1DICA 3GYLB 5GWZA 7GCHG 1QL8A 4IMZA 1FAKH 2BZAA 1XMNB 2ERJA 2R9PA 4OGYA 2SNVA 3A88A 3RXDA 4U2WA 2VH0A 2J38A 2ZDNA 4D7GA 4CH2B 2OTVA 1BB0B 3M7UA 4DGJA 2FS8A 1TRMA 3LH1A 1P2OA 4WH8A 2B0FA 1Y5BT 1QL9A 3RP2A 1IAUA 1J9CH 1W14U 1QTFA 1MQ6A 1Y3YA 3SU0A 1C2MA 1DM4B 4Y71A 1OWHA 1TA6A 3E91A 3F9GA 5EPYA 3MH7A 3T29A 2AMQA 4XE4A 1VJ9U 1TNLA 1ANBA 3Q3YA 1O2QA 2XBVA 5HYOA 2ZGBH 2BLVA 2I6QA 2Q6DA 4DJZA 1K1NA 2XRDA 1C2HA 4Q7YA 3RMLH 1NFUA 3V3MA 2W81A 1FMGA 2Q1JA 2R3YA 2ZDMA 4TWWA 5DKMA 4ZXYH 3SV2H 4GCHF 3TNSA 4TYDA 1KLTA 1P12E 4RN6A 5PTPA 2EC9H 3NXPA 4FU8A 2Z7FE 2RG3A 5FBIA 1W11U 1A0HB 1MKXH 2JH6D 3E90B 2FP7B 5C3NA 6CHAC 2ODPA 3OY5U 1MU8B 2A7CA 1QQ4A 1FIZA 3UR9A 3O8DA 1MTNC 3VB7A 3KN2A 2H6MA 5FXLA 4FVBA 3N7OA 2WPJS 4KGAA 1GHXH 1V3XA 1EJAA 1HFDA 1TX6A 1DSTA 2P3TB 3DFLA 3CALA 3RXOA 1UCYE 1FQ3A 3SU6A 1FY4A 3GICB 2PGBB 2XRCA 4Q7XA 1UJ1A 4GCHG 4YO9A 1C9TA 1O2RA 1W10U 2FOAA 3MI4A 3ATWA 1S0RA 2VWLA 1BHXF 1OWEA 2O9QA 2W7SA 2WUCA 1DE7H 1WSSH 1C5RA 2G5VA 2R0KA 2JRAA 1GI2A 5ESBA 1TMTH 2CHAC 3MO6A 2R2MB 2FYRA 2BY6X 1RS0A 1KXBA 2MCYA 1MKWH 1PQ7A 2LNCA 5JPMG 1Q2WA 3MHWU 3RXUA 1CHGA 2WIIC 2BVSH 1XUGA 2H9TH 1C1SA 2BVXH 2ZTXA 2J34A 4Y76A 1YYY1 1CKLA 4E7NA 1AFQB 2FM2A 4NGAH 3VFEA 6ESTA 4C16A 1TPOA 3RXKA 1LHDH 1O2ZA 1ZHMA 3U9AH 1G3DA 1TOCB 2BX3A 1KLJH 2DE9A 1BCUH 1SFIA 1UHBB 1OJYA 1LY2A 2ANWA 1C5ZB 3UREA 1D3DB 3BTKE 3QTVH 1C1WH 4JYTA 5JBCS 3M7PA 4WVPE 2J2UA 1F7ZA 1CT4E 1HGTH 2P93A 2RCEA 4QT8C 3EQ0H 1EASA 3ZZBA 1O2NA 3OX7U 5IYTA 4SGAE 3ZVBA 1H04P 3TH4H 1XKAC 3MQLA 1H03P 3KQDA 1SB1H 1CGJE 1P3EA 3GCHB 1AD8H 1BHXB 4O9VA 3A83A 1E37B 1BTUA 1ZTJA 1ZPZA 4OS1A 3TGIE 3M5MA 3L89M 2ANKH 1ZMNA 2VIDA 1SVPA 2IOTA 2ZFTA 3CS7A 1QBNA 1BJVA 2UUYA 1ELGA 1QRZA 1W8BH 2O8UA 2ZU4A 2AGIX 2QIQA 1D3PB 2TBSA 3ZZ5A 4INLA 1ZSKA 2OD3B 2D8WA 3A89A 3MU1A 2D26C 1FJSA 3RXIA 1XX9A 1BBRE 3STJA 1K1LA 3ZZ6A 4LOTA 2W80A 4YT6H 2FI5E 4UFGH 1TPSA 1FLEE 1ZHPA 5C1YA 4ZHLU 3VGCB 1H1BA 5CMXH 3QGJA 3S0NA 4K2YA 2O8WA 4AFUA 1UCYH 4ABIA 5JPMH 4UFEH 1MAYA 2ZPRA 4AFZA 1O3CA 3A7TA 1SGPE 4XBDA 8KME2 3M3VA 1PPBH 1HLTH 3MTYA 3ATIA 1GDQA 4MPXA 1N6XA 5HYUB 4GHQA 3SW2B 4NCYA 4B75A 1DWCH 1PPZA 3URDA 1IQNA 2QN5T 1B7XB 3L6PA 5DK1A 1UK3A 1W7GH 3LKWA 2O8LA 2Y7ZA 3AW1A 1LVBA 5I25A 3U8RH 1FPHH 4Q80A 3BEFB 1GI9B 1K1MA 2PWXA 2FESH 4AYMA 2CG7A 2WPKS 3U8OH 4BAHB 1GI6A 4AGKA 2AFQB 2ZG0H 1EZSC 3Q3XA 3O8EB 1C2JA 3M3TA 1FN6A 1LPKB 1V2KT 1TGSZ 4FXGG 3R3GB 1P9SA 4MUCA 3VPKA 3CS0A 1E36B 1T8OA 1TAWA 1BUIA 3SNBA 9ESTA 1L1GA 3E8LA 2GV6A 4KTUA 1TE0A 1ZSLA 4WH6A 4Y8XA 4FUBA 1GG6C 3RXSA 1JMOH 3RJ3D 3ESTA 2XTTB 2GZ8A 4CBNA 1O39A 4LOYH 1C5XB 1CU1A 3ZZ4A 1HJ8A 1O2WA 4FUIA 1XKBC 5GDSH 1PPQA 2BZMA 2J9NA 1EOLA 1UHBA 4GHTA 1S83A 5T3HA 2SGEE 1TBQH 2WPMS 3A84A 1AUJA 4MPUA 1DANH 4B2CA 1TNJA 2FWWA 1HFHA 1GKNA 1GBEA 1RGQA 1O2UA 4LOSA 2ZTZA 3BV9B 1HRTH 2VJ1A 1OWIA 1QRWA 3P8FA 3C27B 1T32A 3UNSA 5FX5A 1E0FD 2F83A 1DXWA 2BXUH 4FUEA 3ZV9A 4IMQA 4ABJA 1CQQA 1QB1A 1O38A 1DXPA 3GY2A 1GJ6A 2P3FH 1GJ4H 2XQWC 1LCYA 3TVJB 5J4SA 4AYYB 4X8SH 1F0TA 2NU2E 3F68H 2B7DH 1O2YA 4E05H 2BOKA 1B0FA 1VZQH 1GMCF 4JCNA 1DT2A 1CE5A 2RL0A 2AGEX 3P95A 1TB6H 4WY3A 5EPNA 3BN9A 2IJOB 4NIWA 1VCQA 3HKJB 4FXGH 1TRYA 2GKVE 2Z9JA 3IG6B 2VIPA 1ANCA 4NA8A 1CBWC 1PQ5A 2B5ID 1YGCH 2GT7A 5AFYH 1RRKA 1S84A 4ZROA 2OLGA 4YLUA 2PGQB 3T27A 2FDAA 3ODFA 5EXNA 1ID5H 5TJXA 1RIWC 3ZZDA 1DS2E 1IQJA 3SJKA 5E8EH 2PUQH 1AVWA 1E35B 1O9AA 1GHVH 4JZ1A 3ZVGA 1YPKH 5LPFA 3SU2A 3NKKA 1H9IE 3OXUD 2ZCLP 4NFEA 1TA2A 5FCRA 1YLCA 3V13A 4I8GA 1C5TA 2YNBA 2WYJA 3O8RA 4ESTE 2XWJI 3F6UH 1W7XH 1TGNA 2PFEA 4AORA 3P8GA 2YNAA 4IS5A 3DD2H 2EEKA 4X8VH 2QA9E 5DP3A 1HIAB 1HXFH 2STAE 3MH5A 3NCLA 1TBZH 1UO6A 1MZDA 1GI0A 2ZKSA 4U01A 1OOKB 1RTFB 2QXIA 4YOJA 1CA8B 1O3OA 5K0HA 1V2ST 1ZGVA 2RKYA 2G81E 1AZ8A 1E88A 4DURA 1AFEH 4RKOB 4DT7B 1GGDC 1Z8RA 1HDTH 2XBWA 1N1LA 1G4FA 3GY8A 3GY3A 5HYTB 1PYTC 1TGBA 1TONA 5HXFA 2RA3A 1THSH 2R3UA 1XUKA 1LVOA 4B74A 1G3CA 3AAUA 3GY7A 1BRBE 4B71A 4I8LA 1AE8H 1IQHA 1Z1JA 1BOQA 3PMJA 2Y5FA 1NZQH 1ANDA 3RU4D 1OYQA 3UY9A 1ELEE 5JYIA 2HWLB 5AVDA 3E6PH 4AG2A 4K8YA 2ZU5A 1NROH 2SFAA 3VB3A 1ELBA 1CT2E 2VIWA 1O31A 2ZDKA 1TQ7B 3SGAE 1BIOA 1W0ZU 1GHYH 2WUBA 3LC5A 4U32A 1AUTC 2RA0A 5DP7A 3AW0A 3AAVA 1GI1A 4K1TA 3OSYA 2PTNA 3ZVCA 1X7AC 3M36A 2Y81A 1GHAG 3RXFA 1QNJA 4M7GA 2A5IA 3PM3A 3ZVEA 2BMGB 3GCOA 1UVTH 3BIVH 1W2KH 3QX5H 1FZZA 1O36A 3KF2A 3I29A 2ASUB 4BANB 1S85A 1V2RT 3TVJA 1YKTA 2C3SA 1G9IE 4ONTD 3A7ZA 1F0RA 3SJ8A 5A0BA 1HAPH 1J16A 5C1XA 2C8ZB 1BTYA 1THPB 1OS8A 3SU3A 2NU1E 1RTKA 1GBCA 2OC8A 1LHCH 2BHGA 1EOJA 3S7HB 5F6MA 2JETC 2C4FH 1GJAB 1MKXK 1C5QA 1GCDA 2W5EA 3PLBA 4KP0A 2A4QA 3RXAA 4MLFB 5ABWA 3A81A 4ISIH 4X2XA 2ZHEH 2BDHA 1YPGH 1HAZB 2GCTB 1ABIH 3RU4E 5F03A 4Y8YA 1MU6B 2QXGA 2AIPA 4H42U 4MPVA 1BTPA 1UTNA 1UVSH 4WXVA 1BMMH 1GL1A 1O3HA 1HAYB 1YP9A 1Z6JH 1VVDA 3SV6A 2OC0A 1C1NA 1QB6A 3P8NA 1MD7A 3ZVFA 1C2EA 4BNRA 2UWNA 3NFPI 4FUCA 1FPCH 1LHGH 3BTME 1MBQA 1TNHA 1IQLA 2FODA 1J15A 4IW4E 1Z1IA 1SL3A 1GI4A 2PV9B 2VVCA 3NPSA 3SNCA 2B9LA 4OS2A 2F9OA 1HIAA 1MKWK 1TNIA 2QCYA 5GJ4B 5LH8A 3U1JB 3QLPH 1JOUB 4X2YA 1SHHB 1NC6A 1C1VH 4NIYA 1ELAA 2IZ3A 3S9AA 5B6OA 4X6OA 1O2OA 1P02A 1M9UA 1QBVH 3ZZAA 3A8DA 1JWTA 1YPMH 2W7UA 3TK9A 3MYWA 3T25A 1GBAA 4HI3A 4YOGA 1Z7KA 1KSNA 4FUFA 4AB8A 3TU7H 3UTUH 3M7QA 1ORFA 2VGCB 2BQWB 4FUJA 2CN0H 2A7JA 2CJIA 2FOBA 2ZU1A 1G3BA 5L2YH 3E16B 1F0SA 1UVUH 4FUGA 1OK9A 1C1UH 3PO1B 4JZDH 1W3CA 3RXJA 2WV4A 1EJNA 4IBLH 4J1YA 4X0WU 3M3SA 1DX5M 4WF8A 3HK3B 5BRRE 1O5GH 4NSYA 3UPEA 2SGAA 2G5NA 1ZHRA 3KIDU 2OQUA 2VNTA 2LOJA 4WMDA 3A80A 1EB2A 1VCPA 4B1TA 4CRFA 1WYKA 2OUAA 1S82A 2ZO3H 1Y3UA 2ZDAH 1GCTB 4UEHH 1SGTA 4I8JA 1QGBA 1LPZB 4UE7H 1MZAA 3A7YA 4MG3A 1G36A 5EOKA 2FS9A 1O3KA 2OC1A 3SV7A 1GWAA 1GDNA 5DO4H 1YBWA 2ANYA 3V0XA 1HAHH 3OTJE 4DW2U 4LZ1H 2TGTA 1K1PA 2AEIH 1K2I1 2CXVA 4ZAEA 3NWUA 2OBOA 1Y3VA 4Y0YE 5K7RA 3MWIU 2CGAA 1TWXB 1UCYK 5A0CA 4ABGA 1XM1A 4YT7H 4FVDA 4AFQA 1K9OE 2PW8H 4MPWA 4GPGA 4F4OC 2A5KA 3KQBA 1NPMA 2ZFSA 3KGPA 3RC5A 1AFQC 1A7SA 2VIOA 1INCA 3GCNA 3A87A 4ZKRU 4CR9A 1AB9C 1D3TB 2ZA5A 2V3OH 1HB0B 2Q6FA 1GBIA 2ZCKP 1GI7B 1QIXB 2BD9A 4OS4A 4AYVB 4GUXA 2GGVB 4X6NA 5IDKA 4MNYA 1SS2A 2C8YB 1VJAU 1EAWA 3UQOA 1QA0A 1AE5A 1SRZA 1BITA 3SOSA 2A55A 3MNXA 1HAOH 1LQDB 2A7HA 4DCDA 4INHA 4AX9H 3TNTA 5DP9A 1GJCB 1P01A 3SI3H 1GBMA 4I32A 3GCHC 1ETTH 4I8HA 3VXEH 1O5CB 3RLYH 1HFIA 1O30A 1C1QA 2ZFFH 2BDBA 2GDEH 3ITIA 3LONA 1V2TT 1GJ8B 4A5TS 1ELFA 2BY9X 2A0QB 4AOQA 2WYGA 3K9XB 2OP9A 4Y6DA 2BM2A 1HUTH 1GJBB 3KHVA 5A09A 2ULLA 3RXQA 2PKSC 3TJUA 1P8VC 1THRH 2ZQ1A 1EAXA 4ABBA 2Z3CA 1W13U 4R8TB 1TYNA 1GHQB 1GBJA 1H9LB 1FUJA 1BJUA 4XDEA 5HM9A 1AB9B 1A3BH 5FAHA 1SQTA 1XVOA 4DIIH 3LGIA 3LDXH 1CT0E 3SORA 1QR3E 1EB1H 2BYAX 5T6DA 3VGCC 1SGIB 1O33A 4I33A 1QO6A 2PSYA 2QF0A 1SI5H 1FY8E 4ZKNU 1L1NA 1OWKA 2P16A 3GOVB 1N6YA 4X2WA 1V2UT 4A1XA 3P70B 4RKJB 1GBBA 1G3EA 3EAJA 1GHBF 4ZKSU 1PQ8A 4MNWA 1OPHB 3SUGA 4FUHA 4LK4A 4ZH8A 4XBBA 3WY8A 1XUFA 1NESE 1QL7A 3DA9B 5FO8C 2KMSA 4I31A 1IOEA 1EXFA 1UTLM 3BTTE 1SR5C 3FP6E 1PPEE 1Z8GA 2GD4B 3KCGH 3QGNB 2VWMA 4PROA 1F5LA 4I8KA 1SGDE 2F3CE 2NWNA 3SNDA 4JHSA 2BLWA 3IWMA 4NWKA 1YCPH 1P2QA 2PKSB 5A8YA 1ELTA 1JIMA 5TCAA 3UOUA 1P2IA 1H9HE 4BTIB 1VITF 1FY1A 1GBFA 5FHTA 3LH3A 1BTWA 3ATKA 2UWPA 1GMHF 3SHAH 1C5SA 1GHBG 1HAGE 3DT0H 1VVCA 2B5TB 1LDTT 1O5FH 4D9QA 1TGTA 1GVZA 1DSUA 4JZEH 1A5GH 3MFJA 3VB5A 4WJG2 2A1DB 4D76A 2GP9B 1O2SA 5L2ZH 1S6FA 2XXLA 2K1QA 1DWDH 1WQSA 2XCFA 2GX4A 2TPIZ 1O3NA 1P2KA 3BTDE 1MD8A 1UVOA 3LGVA 5SGAE 3LGYA 3SW0X 1QBOA 3TGKE 3D65E 4ASHA 1O3LA 1AQ7A 3B8JA 5JBBS 1FI8A 3DHKH 1Y3WA 3RXCA 4K8BA 1Y3XA 2FTLE 4Q7ZA 1IHTH 1TPAE 3FVFB 1T4VH 1BRCE 1BA8B 3KQCA 1LO6A 3BTHE 3UWIA 1UK4A 3ZRZA 3A82A 3E0PB 1YPEH 2EHFA 6LPRA 4XFQA 2Z3DA 2Z94A 3I78A 5JB8S 1QQUA 1K28D 2ESTE 3LC3A 6GCHF 5LPEA 2ZU3A 1P06A 1KY9A 1GVKB 3U8TH 3TITA 4Y11E 1AU8A 1S6HA 3AASA 3PMHB 1H2PP 2FO9A 3FP8E 5TCCA 1KYNA 4OS6A 1O3FA 1Y8TA 1VCWA 1O3GA 3ZZ8A 1ANEA 5CHAB 1ZZZA 2STBE 1E5GA 3PLKA 4ZHMU 1O0DH 1KTSB 2A4GA 2Z9LA 2ZHWH 2KAIB 2ZP0H 3INBC 4NA9H 2HVXA 3W95A 1T8NA 3RXVA 3PMBB 5EU8A 1T7CA 2HNTF 2P8OB 1LVMA 3M37A 1F5RA 2XC5A 5ESTE 1ETSH 4J38B 1LPGB 4ZMAH 2QAAA 4R0IA 2D1JA 1BTXA 4AYEA 1OP2A 1KXFA 6GCHG 2HNTE 1UTQA 5CE1A 4JZIA 1L4DA 4NWLA 1O37A 3GOVA 2ZPSA 4YM9A 4AGJA 2PSXA 1CGHA 4AN7A 4AB9A 3Q76A 5EW1H 1AHTH 1S5SA 2HPQH 4X1PU 2BX4A 1C9PA 5EQQA 5FPSA 2BQ7B 1GPZA 1BBRH 2ZDVH 4NIXA 2XYAA 5DP4A 1YCPM 1DLKB 1O2JA 1CSOE 1C5MD 3QTOH 4BAQB 2QGRA 1YPHE 1V2LT 3BTQE 3EE0B 1L1JA 2F91A 2V8EA 4O3TA 1P10A 2YRAA 1IQEA 2H5DA 2GMTB 5E0JA 2FOGA 4I7YH 1TALA 2H5CA 1O2HA 3OP8A 1FAXA 3ZD2A 2BDGA 3ZZ9A 3RMNH 1MTSA 4A6LA 3SGBE 1TMBH 3BEUA 1P04A 4B2RA 2R0LA 3ENSB 3RXEA 1V2VT 3F9FA 3RXMA 5A0AE 1HJ9A 1LTOA 5FBEA 1C5OH 4VGCB 1SGCA 1MBMA 3LGWA 1XXDA 5C5OA 4H4FA 2ZGCA 2ZIQH 4TY6A 1GL0E 3SQEE 2RDLA 1D9IA 4O97A 3TK6A 1C5WB 1CHOF 3MMGA 2RKZA 1XUIA 4X1SU 2A2XH 2GCHF 3TGJE 5HZPB 2Y6TA 1SGRE 3CENA 4JZFH 2GTBA 1ETRH 4UDWH 3UNQA 5GCHF 3UQVA 1QJ6B 1BDAA 2FX6A 3NK8A 1MQ5A 4YESB 1GMCG 1YLDA 4ISLA 3S69A 1EKBB 4X1NU 1PPHE 4A92A 1MMJN 4UFFH 2OCVB 3BIUH 1Q3XA 1LVYA 7LPRA 3QK1A
chains in the Genus database with same CATH superfamily
2SGFE 3SBKA 1P9UA 2ZGXH 4ABEA 1O34A 4ISHH 1HNEE 4AFSA 4GAWA 2RLQA 2YOLA 1GHZA 1HXEH 3MQKC 3KYFA 4ZXXH 2GCHG 4XSKU 2G7IA 1FDPA 1FN8A 1SGYE 4APLA 3ODDA 4JYVH 1EPTB 2AMPA 4CHAB 3OEDC 2FTMA 3SUFA 1U5MA 3TH2H 5GCHG 1AY6H 1E34B 2J4IA 2K8IA 2QXHA 2I2LA 3RDZA 1K1IA 4ZHAA 1O35A 4TPIZ 3KL6A 3QUMP 3OYPA 4FU9A 3T28A 1C2FA 1O5AB 1UTJA 3DFJA 2BQ6B 5EXMA 3QDZB 1VGCB 1TBRH 5EXLA 3LJOA 5A2MH 2KX4A 3F2FA 3I77A 2JJ1D 2Z9GA 4JK5A 1QFKH 2KAIA 1OX1A 3NZIA 5AFZH 1V2PT 2AYWA 1P2NA 1TX7A 2ZFPH 2ZHFH 1XUHA 2AS9A 4KTSA 4YZUA 3K6ZA 3FGRA 3ZZCA 3SUDA 2B8OH 7ESTE 2TRMA 1IQIA 2F9PA 2XNDD 9LPRA 2GCTC 2XOKD 2ZZUH 1KIGH 4YXWD 3RM0H 2KR7A 4KTCA 4X6PA 1O3PB 1DPOA 1BTZA 3LT3A 2WHXA 4XBCA 4BTUB 4AZ2B 1ZPCA 4THNH 2EY4C 1NO9H 3W1EA 2VVUA 3V12A 1H8IH 5LPRA 1ESBA 4U30A 1NTPA 5DG6A 2IN2A 4LZ4B 4TWYA 4CRCA 2HRVA 5E2PA 4D9RA 1WXRA 3SUEA 1B0EA 1DOJA 3BG4C 3URCA 1DWEH 5E0GA 3OU0A 2XCNA 2Y7XA 4CRBA 3ZLEA 1O3EA 2YMSD 4CR5A 1O2VA 4F55A 2A5AA 2J94A 3HGPA 2BVRH 1TMUH 3FGTA 4CRAA 1P2JA 4Y0ZE 5A8ZA 1SLUB 2QXJA 5EGMA 1HBTH 1A0JA 3C1KA 2H9HA 2CF8H 2VGCC 2W26A 1QUBA 3UFAA 2WINI 1GI5A 3UIRA 2BDYA 5DP6A 3KQEA 1O3DA 1CO7E 1QJ7B 1ZSJA 3PO1C 3PTNA 3PWCA 1T31A 2A2QH 1F92A 1PPGE 3RC4A 3MH4A 1V2JT 2J92A 1ELCA 1TIOA 3PLPA 1QGFA 3M61U 1Y59T 1HPGA 1D3QB 1C1TA 1EAIA 5ETXA 2Z9IA 5FPYA 2WSSD 1TNKA 1W12U 1OJWA 2FXRA 2JGXA 1DDJA 3D62A 2QY0B 1AWFH 2EA3A 5GNDA 3SV9A 1GCTC 1UMAH 8ESTE 1GVLA 2WV5A 3BG4B 1TPPA 3MNBA 1AGJA 1C1PA 1C2GA 1O32A 2PTCE 3MOCA 1BQYA 1ZJKA 1KLIH 1EPTA 3PTBA 2XWBF 4F49A 2F9VA 2G55A 5I0QB 1ELDE 4CRGA 1AO5A 2ILNA 1C1RA 1AI8H 1O3JA 1UTMA 2XBXA 5F8TA 1DWBH 4UFDH 2KFWA 4HGCA 1YM0A 1DITH 1SG8B 2ZYCA 1FNIA 3WW7A 1ACBE 3SV8A 1SGFG 3RXTA 1L2EA 3F9EA 5I46H 1MAXA 2A31A 2ZU2A 2ZEBA 4Z6AH 2WPDD 1BZXE 2QC2A 3F9HA 3SU1A 1F5KU 7GCHF 3TPIZ 2GV7A 1AIXH 3M5NA 2FOCA 4SGBE 5GPIB 3E1XB 1LQEA 1KXDA 2Y5HA 2EC3A 1SKYE 1C4V2 2C8XB 1ZLRA 1P2MA 2Y80A 1EZXC 1O5DH 2ZQ2A 1EJMA 3PROA 2GT8A 3UWJH 3BTFE 1TPGA 2WPIS 2YMSB 1O2TA 2XW9A 1YCPK 4Y79A 4ABFA 1IQMA 3M5OA 1OWJA 2G4TA 2PR3A 1B5GH 1GI8B 1JXPA 1NFWA 4WXIA 3FKSD 3GDSA 1ELVA 1A2CH 2BD8A 1ARBA 2YBYA 1S81A 4XRNA 1UTPA 4YLQH 2W3IA 3H7OA 5F8XA 1EX3A 1OJVA 3O8BA 3AK5A 1GDUA 2UWLA 1OP0A 4FU7A 4X2VA 3RXPA 1FX0B 1OKXA 3ZYDA 3W94A 1C2LA 5DJ7A 2FZZA 1GBHA 1YPLH 5DN5A 5AF9H 5EODA 2H1UA 3ZZ7A 3Q00A 1TPMA 1AN1E 2FOEA 3SU5A 4ZKOU 1NRQH 4TPYA 1PQAA 2CKUA 2ZGHA 1ZPBA 2Z9KA 4IC6A 3PMAB 4ISOA 3VXFH 1ZRKA 1E79D 5BPEA 4K12A 3E0NB 2V35A 1S0QA 2ZDLA 4X1RU 1OK1A 3KNXA 1C5UA 1N8OB 3BSQA 3BG8A 4ACBA 1W0KD 1EZUC 4N7EA 4MVNA 4A1VA 5HM2A 2BD7A 3RMMH 1TLDA 3RXGA 1NFXA 2QYIA 2VB0A 2XWBI 1DUEA 2G51A 5T6GA 3ERBA 5C67A 1GJDB 1QHRB 2GDDA 2M2AA 4MTBA 1MCTA 1A1RA 3L33A 1ZTLA 1NU7B 2ZGJA 5C94A 1WCZA 2TGPZ 1IQKA 1A0LA 1IHSH 4ABAA 2QF3A 3SNAA 1UTOA 1P03A 2Z3EA 1O5BB 2FLBH 3EDXB 1QY6A 2QY0A 3SO3A 3ZYEA 3BF6H 2ZHQH 2ZI2H 2TGDA 2BOHB 2JIZD 4JMYA 4KKDA 2XC4A 1G30B 2UUJB 2JH0D 4NG9H 2CF9H 2W6JD 3P8OA 2BB4A 3U1IB 1A61H 2ZC9H 1GJ7B 3NUMA 4E7RG 3OY6U 3RUOA 4ZH1D 4CSYA 1O5EH 3BEIB 1O3MA 2AIQA 3PYHA 1YF4A 3O8CA 1P57B 4CREA 8GCHF 1TOMH 1NFYA 1HCGA 4K60A 1GBLA 1EATA 1Z71A 3MH6A 3Q3KA 4F48B 4JK6A 2AHME 4YTAA 2CG6A 3FP7E 4A1TA 2Y5GA 3R62A 3GY5A 2QV1A 2DE8A 1V6DA 2XWAA 4AYDA 1K1OA 1YPJH 3ZVAA 4HTCH 2JKHA 1H2QP 1O2PA 2O39C 2KZ4A 3MNSA 2CMYA 2OINA 3GY4A 1RD3B 1TNGA 4E06H 2ZECA 4Z0KA 4BAKB 5C5NA 3MU8A 2Q6GA 3LU9B 6CHAB 3MNCA 1BBRK 1L4ZA 4CRDA 2G00A 1SGFA 7KMEH 5AHGH 1G2MA 1EP5A 1MTNB 2G52A 1SMFE 2JGWA 1NRRH 8GCHG 3EJHA 2FPZA 5A8XA 1K1JA 1WQVH 1QRXA 4CBOA 1EQ9A 2WPLS 3K6YA 2OXSA 1WBGB 4NSVA 3VB6A 4ZUHA 2BD5A 1A5HA 1MTUA 1SGQE 4KELA 3T2NA 3ZIAD 1PPCE 4J2YB 4BAMB 1G4GA 4NZLA 5E0HA 4BXWA 1P09A 4YNXA 3DUXH 1DUAA 3U69H 2BD4A 3VEQB 3LGUA 4AC9A 3RXRA 3K2UA 2PUXB 2FIRH 4Q2KA 2Y82A 2CHAB 1TPNA 1BTHH 3SHCH 2QE7D 2RLPA 2L74A 1MTVA 5HGGA 1D4PB 5C0TA 4AYIA 1P05A 2VIQA 3U98H 1TX8A 2VIVA 1BMFD 2F9NA 1MCVA 8LPRA 4O03A 2JDID 5CHAC 3LIWA 5E2OA 5B6LA 5HIZA 1L0ZA 2BY5X 1Y5AT 1C5NH 1T4UH 2IPHA 1DFPA 3TH3H 3A8BA 1AVXA 3SZEA 1ZMLA 2BD3A 1AKSB 1K22H 1D6RA 2P8OC 3QN7A 4Z1MD 1J8AA 1YC0A 1GKGA 1ABJH 2EI7A 3FAOA 3ZZ3A 3FZDA 1O3AA 1VITG 1J17T 2ODYB 1ZYOA 4NFFA 1C1MA 3EYDA 1GMHG 4LXBH 5EIYA 1HAVB 3MU5A 3BTGE 1TFXA 2NU0E 1O3IA 2IJD1 1GBDA 4IN2A 4K3JA 3B23B 1P11E 1P3CA 1SLVB 4FUDA 4D7FA 3G01A 2HPPH 3SU4A 4DG4A 2FMJA 3FZZA 1ARCA 1XXFA 2PHBA 3SGQE 5JBAS 3S7KB 3HGNA 4HFPB 1DY9A 2NU4E 2J95A 3SJ9A 2WPHS 2GZ7A 1PFXC 1SC8U 3OEHD 4YOIA 1A3EH 2AERH 2SGDE 2V3HH 1UK2A 4UD9H 1FXYA 3QWCH 4INKA 4K5ZA 3KXVA 2P94A 2GMTC 2V3MA 2VINA 2ANMH 4HG6A 2FI4E 1CVWH 4CH8B 2ZFQH 1Z92B 2FX4A 1E8BA 2C8WB 2BD2A 3IX0A 1V2NT 4ABHA 1WTHD 3K65B 2V0BA 2KRIA 3HPTB 1SPJA 3IITA 2BY8X 2THFB 2HGTH 1GBTA 1AWHB 1ZJDA 1JBUH 2HNTC 4VGCC 3L3TA 1O2MA 3HK6B 2BY7X 1FBRA 3UUZA 5C20A 2TIOA 3A7XA 4RI0A 1KXAA 4JYUH 5HMAA 3RLWH 2SNWA 5C2ZA 4NIVA 3MU4A 4OGXA 2C90B 4DY7B 3SJOA 1FY3A 2ZTYA 1LKBA 4RSPA 5EJZA 2ZWLH 1PPFE 1FIWA 3GDVA 3SJIA 1AVGH 3A8AA 1C2DA 5C1UA 4B2SA 1YPHC 5FCKA 4MDSA 3SI4H 1C5LH 1VITH 3OEED 5EQSA 3KYGA 3GCTF 3VB4A 1H8HD 2TGAA 1DVAH 2BLOA 4UONA 5DPAA 2H9EH 2ODQA 4MQAA 3BTEE 4MNXA 1SBWA 1G37A 4AG1A 1MTWA 1EAUA 1EP6A 2ALPA 5J4QA 1OWDA 2PP6A 2BDCA 4PZ5A 2EI8A 4BOHA 3R0FA 3SZNA 2P3UB 3ELAH 1EPTC 1Z8JB 4CHAC 2PKAB 3WSXA 3TK5A 4A7IB 1CA0C 1NRSH 1SQAA 3IU3I 2GVFA 2F9BH 1C5YB 4FOUC 3E3TA 1C1ZA 3GDUA 4TY7A 2C93B 1HAIH 3SQHE 4D8NA 2NU3E 1KDQB 1Z8IB 1GI3A 1UTKA 2XRBA 5IK2D 2ZCHP 1C2KA 1VGCC 5DGJA 3ATMA 1GG6B 2BTCE 3EA7A 3GCTG 1BRUP 2G4UA 3EA8A 3QZRA 2KM0A 1XVMA 1FY5A 2IZ4A 2HLDD 1J14A 1AKSA 1HCCA 1Z6EA 2FOHA 1KTTB 5T6FA 3UNRA 1P0SH 2ZNKH 4ABDA 1NN6A 5G4BA 5LGOA 1BMNH 1SGEE 1HAVA 3A7VA 1SOZA 3EGKH 1KXEA 1IQFA 5FX6A 3H7TA 1G2LA 4NZQA 2VU8E 4WMEA 2FLRH 3RC6A 5L6NH 5EW2H 1O2IA 3GY6A 1DLEA 1MH0A 4DIHH 1NRNH 1BT7A 1PYTD 1A4WH 1K21H 1RXPA 1WAYB 1OP8A 1O3BA 3F3BA 2VH6A 3LGTA 1CHOG 1H4WA 3T5OA 1OK2A 2XNIA 4OS5A 3MU0A 1ZTKA 1C2IA 4B6EA 2O8MA 3TJOA 4BXSA 2R2WU 4X1QU 1CA0B 1O2XA 2F9UA 3H5CB 3V7TA 4XOJA 2W3KA 2CK3D 1F0UA 4BTTB 1BMLA 1WUNH 2Y8RA 1C5VA 1SSXA 3FFGA 1BRAA 3P6ZB 4DT4A 3UR6A 2V6NA 1OSSA 2PLXA 5C17A 1O2KA 4OS7A 1YLNA 3JZ2B 3EA9A 3A85A 1ZOMA 1CGIE 4B76A 3D49H 1TRNA 1VR1H 2XBYA 5FPTA 1G32B 2A32A 3HATH 1TABE 4H6TA 2H2ZA 1CBWB 1SLWB 3S9BA 2M5TA 3NRLA 1W0YH 2MCZA 2FYQA 3TJNA 1ZR0A 5H4IB 1RFNA 4X6MA 5GIBA 2Y8SA 4DOQA 1O2GH 2FOFA 1ZRBA 4GSOA 1JRTA 1A46H 1QB9A 3T26A 5DP8A 1BMAA 1RIWB 3RU4T 2P59A 1GHAF 2G8TA 3ZV8A 1NY22 4HZHA 1JRSA 1SLXB 1U6QA 1C4Y2 2JH5D 1ZMJA 4X8TH 4Q4LA 2AH4X 4MSLA 1TQ0B 2OC7A 4ISNA 1UVPA 1FV9A 3MO9A 1GJ9B 2AGGX 1GMDF 3RXBA 1QURH 3KEEA 3M5LA 5JB9S 1AMHA 3Q77A 4O3UA 4NA7A 3CP7A 3STIA 2OQ5A 1C4U2 1QA7A 4H6SB 2DUCA 4Y8ZA 2ZFRH 1HV7A 3KZJA 4X8UH 4GLYA 3FANA 1WTGH 5JBTA 2BLQA 3TJVA 2UWOA 1LHEH 1ZGIA 4PO7A 2PKAA 2EI6A 1F2SE 3ATLA 4WWYA 2FEQH 1PJPA 1V2OT 2CV3A 3A8CA 1LMWB 4WMFA 4Y10E 2HOBA 1GJ5H 4Y7AA 2SGQE 1V2MT 2A45B 4IN1A 4A5WB 2GJGA 4B73A 3HKIB 1KDQA 1AZZA 1GGDB 1SGNE 1GMDG 2O8TA 1D6WA 3JZ1B 4ASUD 2VWOA 4DJZB 1QCPA 3QO6A 1GHWH 4MNVA 3BTWE 1SQOA 3PB1E 2I6SA 4K1SA 4B2BA 1XUJA 4K1EA 1SFQB 1T8LA 1HJAC 2A4RA 2D2DA 3B9FH 4B2AA 3A7WA 3AVZA 2XC0A 1UOTP 4K69A 1NRPH 3PWBA 2HALA 3P17H 4DVAU 2BXTH 1LHFH 1OYTH 3H09A 1IQGA 2Z6BD 4Y7BA 2YMSC 1LKAA 3GISB 3TIUA 2FOMB 2ZF0H 3LOXA 3LPRA 1C5PA 5JDUB 1O2LA 1T8MA 1HYLA 3M35A 3QZQA 5EG4A 1NU9A 1RJXB 1V2QT 2VWNA 1QJ1B 1NWVA 1WV7H 2BDAA 2UUKB 2F4LA 3S9CA 3PV4A 2A4OA 3ZVDA 3SN8A 3UOPA 1GBKA 1WOFA 1ESTA 5GXPA 1OK3A 3DSOA 1FONA 2SGPE 3RXHA 1KXCA 1OXGA 2HLCA 2LPRA 2OBQA 1H8DH 3DSPA 4IGDA 1E38B 2ZHDA 3RMOH 3LJJA 2GZ9A 4GVUA 1NT1A 1EZQA 5DP5A 2UUFB 3T5FH 3TLOA 3D23A 2FI3E 1Y5UT 2JETB 1HJAB 1ESAA 1Q31A 2BZ6H 2P95A 3GXEA 3F1SB 1HAXB 3RXLA 2AMDA 1TGCA 2ALVA 1DY8A 4P02A 2BDIA 1JIRA 3ZD1A 1SOTA 1MUEB 2WV9A 1RTLA 1EUFA 1N8OC 1NS3A 5F8ZA 1SHYA 3MO3A 3EE7A 3SNEA 3T62A 3RM2H 5EQRA 4BAOB 1RLHA 5FL7D 2VVVA 4IC5A 1WU1A 1C1OA 1NM6A 3A86A 2QF4A 3M7TA 5HYPA 1V2WT 3GYMA 3P92A 2ZPQA 5L30H 1A5IA 1DICA 3GYLB 5GWZA 4I86A 7GCHG 1QL8A 5KEDA 4IMZA 2KCPA 1FAKH 2BZAA 1XMNB 2ERJA 2R9PA 4OGYA 2SNVA 3A88A 3RXDA 4U2WA 2VH0A 2J38A 2ZDNA 4D7GA 4CH2B 2OTVA 1BB0B 3M7UA 4DGJA 2FS8A 1TRMA 3LH1A 1P2OA 4WH8A 2B0FA 1Y5BT 1QL9A 3RP2A 1IAUA 1J9CH 1W14U 1QTFA 1MQ6A 1Y3YA 3FN8A 3SU0A 1C2MA 1DM4B 4Y71A 1OWHA 1TA6A 3E91A 3F9GA 5EPYA 3MH7A 3T29A 2AMQA 4XE4A 3VG8A 1VJ9U 1TNLA 1ANBA 3Q3YA 1O2QA 2XBVA 5HYOA 2ZGBH 2BLVA 2I6QA 2Q6DA 4DJZA 1K1NA 2XRDA 4RT1A 1C2HA 4Q7YA 3RMLH 1NFUA 3DSGA 3V3MA 2W81A 1FMGA 2Q1JA 2R3YA 2ZDMA 4TWWA 5DKMA 4ZXYH 3SV2H 4GCHF 3TNSA 4TYDA 4YIZA 1KLTA 1P12E 4M9FA 4RN6A 5PTPA 2EC9H 3NXPA 4FU8A 2Z7FE 2RG3A 5FBIA 1W11U 1A0HB 1MKXH 2JH6D 3E90B 2FP7B 5C3NA 6CHAC 2ODPA 3OY5U 1MU8B 2A7CA 1QQ4A 1FIZA 3UR9A 3O8DA 1MTNC 3VB7A 3KN2A 2H6MA 5FXLA 4FVBA 3N7OA 2WPJS 3PV5A 4KGAA 5F53A 1GHXH 1V3XA 1YWUA 1EJAA 1HFDA 1TX6A 1DSTA 2P3TB 3DFLA 3CALA 3RXOA 3SYJA 3F6KA 1UCYE 1FQ3A 3SU6A 1FY4A 3GICB 2PGBB 2QF5A 2XRCA 4Q7XA 1UJ1A 4GCHG 4YO9A 1C9TA 1O2RA 1W10U 2FOAA 3MI4A 3ATWA 1S0RA 2VWLA 1BHXF 2WZQA 1OWEA 2O9QA 2W7SA 2WUCA 1DE7H 1WSSH 1C5RA 2G5VA 2R0KA 2JRAA 1GI2A 5ESBA 1TMTH 2CHAC 3MO6A 2R2MB 2FYRA 2BY6X 1RS0A 1KXBA 2MCYA 1MKWH 1PQ7A 2LNCA 5JPMG 2OK5A 1Q2WA 3MHWU 3PV2A 5EJLA 1CHGA 3RXUA 2WIIC 2BVSH 1XUGA 2H9TH 1C1SA 2BVXH 2ZTXA 2J34A 4Y76A 1YYY1 1CKLA 4E7NA 1AFQB 2FM2A 4NGAH 3VFEA 6ESTA 4C16A 1TPOA 3RXKA 1LHDH 1O2ZA 1ZHMA 3U9AH 1G3DA 1TOCB 2BX3A 1KLJH 2DE9A 1BCUH 1SFIA 1UHBB 1OJYA 1LY2A 2ANWA 1C5ZB 3UREA 1D3DB 3BTKE 3QTVH 1C1WH 4JYTA 5JBCS 3M7PA 4WVPE 2J2UA 1F7ZA 2KCOA 1CT4E 2J98B 1HGTH 2P93A 2RCEA 4QT8C 3EQ0H 1EASA 3ZZBA 1O2NA 3OX7U 5IYTA 4SGAE 3ZVBA 1H04P 3TH4H 1XKAC 3MQLA 1H03P 3KQDA 1SB1H 1CGJE 1P3EA 3GCHB 1AD8H 1BHXB 4O9VA 3A83A 1E37B 1BTUA 1ZTJA 1ZPZA 4OS1A 3TGIE 3M5MA 3U28C 3L89M 2ANKH 1ZMNA 3UB0A 2VIDA 1SVPA 2IOTA 2ZFTA 3CS7A 1QBNA 1BJVA 2RDEA 2UUYA 1ELGA 1QRZA 1W8BH 2O8UA 2ZU4A 2AGIX 2QIQA 1D3PB 2TBSA 3ZZ5A 2X2ZA 4INLA 1ZSKA 2OD3B 2D8WA 3A89A 1K0HA 3MU1A 2D26C 1FJSA 3RXIA 1XX9A 2IPQX 1BBRE 3STJA 1K1LA 3ZZ6A 4LOTA 2W80A 4YT6H 2FI5E 4UFGH 1TPSA 1FLEE 1ZHPA 5C1YA 4ZHLU 3VGCB 1H1BA 5CMXH 3QGJA 3VWOA 4K2YA 3S0NA 2O8WA 4AFUA 1UCYH 4ABIA 5JPMH 4UFEH 1MAYA 2ZPRA 2J97A 4AFZA 1O3CA 3A7TA 1SGPE 4XBDA 8KME2 3M3VA 3K3TA 1PPBH 1HLTH 3MTYA 3ATIA 1GDQA 4MPXA 1N6XA 5HYUB 4GHQA 3SW2B 4NCYA 4B75A 1DWCH 1PPZA 3URDA 1IQNA 2QN5T 1B7XB 3L6PA 5DK1A 1UK3A 1W7GH 3LKWA 2O8LA 2Y7ZA 3AW1A 4Q63A 1QZ8A 1LVBA 5I25A 3U8RH 1H8ED 1E1QD 1FPHH 4Q80A 3BEFB 1GI9B 1K1MA 2PWXA 2FESH 4AYMA 3UAIC 2CG7A 2WPKS 3U8OH 4BAHB 1GI6A 4AGKA 3WWFA 2AFQB 2ZG0H 1EZSC 3Q3XA 3O8EB 1C2JA 3M3TA 1FN6A 1LPKB 1V2KT 1TGSZ 4FXGG 3R3GB 1P9SA 4MUCA 3VPKA 3CS0A 1E36B 1T8OA 1TAWA 1BUIA 3SNBA 9ESTA 1L1GA 3E8LA 2GV6A 4KTUA 1TE0A 1ZSLA 4WH6A 4Y8XA 4FUBA 1GG6C 3RXSA 1JMOH 3RJ3D 3ESTA 2XTTB 1EFRD 1MABB 2GZ8A 4CBNA 1O39A 4LOYH 1C5XB 1CU1A 3ZZ4A 1HJ8A 1O2WA 4FUIA 1XKBC 5GDSH 1PPQA 2BZMA 2J9NA 1EOLA 1UHBA 3FO8D 4GHTA 1S83A 5T3HA 2SGEE 1TBQH 2WPMS 3A84A 1AUJA 4MPUA 1DANH 4B2CA 1TNJA 2FWWA 1HFHA 1NBMD 2J98A 1GKNA 1GBEA 1RGQA 1O2UA 4LOSA 2ZTZA 3DCLA 3BV9B 1HRTH 2VJ1A 1OWIA 1QRWA 3P8FA 3C27B 1T32A 3UNSA 5FX5A 1E0FD 2F83A 1DXWA 2BXUH 4FUEA 3ZV9A 4IMQA 4ABJA 1CQQA 1QB1A 1O38A 1DXPA 3PRBA 1W0JD 3GY2A 1GJ6A 2P3FH 1GJ4H 2XQWC 1LCYA 3TVJB 5J4SA 4AYYB 4X8SH 1F0TA 2NU2E 3F68H 2B7DH 1O2YA 4E05H 2BOKA 1B0FA 1VZQH 1GMCF 4JCNA 1DT2A 1CE5A 2RL0A 2AGEX 3P95A 5EJ1A 1TB6H 4WY3A 5EPNA 3BN9A 2IJOB 4NIWA 1VCQA 3HKJB 4FXGH 1TRYA 2GKVE 2Z9JA 3IG6B 2VIPA 1ANCA 2KCAA 5DN6D 4NA8A 1CBWC 1PQ5A 2B5ID 1YGCH 2GT7A 5AFYH 1NBME 1RRKA 1S84A 3PRDA 2OLGA 4ZROA 4YLUA 1KMHB 2PGQB 3T27A 2FDAA 3ODFA 5EXNA 1ID5H 5TJXA 1RIWC 3ZZDA 1DS2E 2L6OA 1IQJA 3SJKA 5E8EH 2PUQH 1AVWA 1E35B 1O9AA 1GHVH 4JZ1A 3ZVGA 1SQRA 1YPKH 2EQNA 5LPFA 3SU2A 3NKKA 1H9IE 3OXUD 2ZCLP 4NFEA 3OE7D 1TA2A 5FCRA 1YLCA 3V13A 4I8GA 1C5TA 2YNBA 2WYJA 1YY3A 3O8RA 4ESTE 2XWJI 3F6UH 1W7XH 1TGNA 2PFEA 2LELA 4AORA 3P8GA 2YNAA 4IS5A 3DD2H 2EEKA 4X8VH 2QA9E 5DP3A 1HIAB 1HXFH 2STAE 3MH5A 3NCLA 1TBZH 1UO6A 1MZDA 1GI0A 2ZKSA 4BWCA 4U01A 2K0QA 1OOKB 1RTFB 2QXIA 4YOJA 1CA8B 1O3OA 5K0HA 1V2ST 1ZGVA 2RKYA 2G81E 1AZ8A 1E88A 4DURA 1AFEH 4RKOB 4DT7B 2HVYB 1GGDC 1Z8RA 1HDTH 2XBWA 1N1LA 1G4FA 3GY8A 3GY3A 5HYTB 1PYTC 1TGBA 1TONA 5HXFA 2RA3A 1THSH 2R3UA 1XUKA 1LVOA 4B74A 1G3CA 3AAUA 3GY7A 4FETA 1BRBE 4B71A 4I8LA 5HIYA 1AE8H 1IQHA 1Z1JA 4B6FA 1BOQA 3PMJA 2Y5FA 1NZQH 1ANDA 3OFND 3RU4D 1OYQA 3UY9A 1ELEE 5JYIA 2HWLB 5AVDA 3E6PH 4AG2A 5KECA 4K8YA 2ZU5A 1NROH 2SFAA 3VB3A 1ELBA 1CT2E 2LP6A 2VIWA 1O31A 2ZDKA 1TQ7B 3SGAE 1BIOA 1W0ZU 1GHYH 2WUBA 3LC5A 4U32A 1AUTC 2RA0A 5DP7A 3AW0A 3AAVA 1GI1A 4K1TA 3OSYA 2PTNA 3ZVCA 1X7AC 3M36A 2Y81A 1GHAG 3RXFA 1QNJA 4M7GA 2A5IA 3PM3A 3ZVEA 2BMGB 3GCOA 1UVTH 3BIVH 1W2KH 3QX5H 1FZZA 1O36A 3KF2A 3I29A 2ASUB 4BANB 1S85A 1V2RT 3TVJA 2C3SA 1YKTA 1VKYA 1G9IE 4ONTD 3A7ZA 1F0RA 3SJ8A 5A0BA 1HAPH 1J16A 5C1XA 2C8ZB 1BTYA 1THPB 1OS8A 3SU3A 2NU1E 1RTKA 1GBCA 2OC8A 1E1RD 1LHCH 2BHGA 1EOJA 3S7HB 5F6MA 2JETC 2C4FH 1GJAB 1MKXK 1C5QA 1GCDA 3F2GA 5HKKD 3WWBA 2W5EA 3PLBA 2J5UA 1S6LA 2A4QA 4KP0A 3RXAA 4MLFB 5ABWA 3A81A 4ISIH 4X2XA 3F2HA 2ZHEH 2BDHA 1YPGH 1HAZB 2GCTB 1ABIH 3RU4E 5F03A 4Y8YA 1MU6B 2QXGA 2AIPA 4H42U 4MPVA 1BTPA 1UTNA 1UVSH 4WXVA 1BMMH 1GL1A 1O3HA 1HAYB 1YP9A 1Z6JH 1VVDA 3SV6A 2OC0A 3OAAD 1C1NA 1QB6A 3P8NA 1MD7A 3ZVFA 1C2EA 4BNRA 2UWNA 3NFPI 4FUCA 1FPCH 1LHGH 3BTME 1MBQA 1TNHA 1IQLA 2FODA 1J15A 4IW4E 5CHBA 1Z1IA 1SL3A 1GI4A 2PV9B 2VVCA 3NPSA 3SNCA 2B9LA 4OS2A 2F9OA 1HIAA 1MKWK 1TNIA 2QCYA 5GJ4B 5LH8A 3U1JB 3QLPH 1JOUB 4X2YA 1SHHB 1NC6A 1C1VH 4NIYA 1ELAA 2IZ3A 3S9AA 5B6OA 4X6OA 1O2OA 1P02A 1M9UA 1QBVH 3ZZAA 3A8DA 1JWTA 1YPMH 2W7UA 3TK9A 3MYWA 3T25A 1GBAA 4HI3A 4YOGA 1Z7KA 1KSNA 4FUFA 4AB8A 3TU7H 3UTUH 3M7QA 1ORFA 2VGCB 2BQWB 4FUJA 2CN0H 2A7JA 2CJIA 2FOBA 2ZU1A 1G3BA 5L2YH 3E16B 1F0SA 4OM9A 1UVUH 3N7EA 4FUGA 1OK9A 1C1UH 3PO1B 4JZDH 2JJ2D 1W3CA 3RXJA 2WV4A 1EJNA 4IBLH 4J1YA 4X0WU 3M3SA 1DX5M 4WF8A 3HK3B 5BRRE 1O5GH 4NSYA 3UPEA 2SGAA 3CI0J 2G5NA 1ZHRA 3KIDU 2OQUA 2VNTA 2LOJA 4WMDA 3A80A 1EB2A 1VCPA 4B1TA 4CRFA 1WYKA 2OUAA 1S82A 2ZO3H 1Y3UA 2ZDAH 1GCTB 4UEHH 1SGTA 4I8JA 4XD7D 1QGBA 1LPZB 4UE7H 1MZAA 3A7YA 4MG3A 1G36A 5DN4A 5EOKA 2FS9A 1O3KA 2OC1A 3SV7A 1GWAA 1GDNA 5DO4H 1YBWA 2ANYA 3V0XA 1HAHH 3OTJE 4DW2U 4LZ1H 2TGTA 1K1PA 2AEIH 1K2I1 2CXVA 4ZAEA 3NWUA 2OBOA 1Y3VA 4Y0YE 5K7RA 3MWIU 3GS9A 2CGAA 1TWXB 1UCYK 5A0CA 4ABGA 1XM1A 4YT7H 4FVDA 4AFQA 1K9OE 2PW8H 4MPWA 4GPGA 4F4OC 2A5KA 3KQBA 1NPMA 2ZFSA 3KGPA 3RC5A 1AFQC 1A7SA 2VIOA 1INCA 3GCNA 3A87A 4ZKRU 4CR9A 1AB9C 1D3TB 2ZA5A 2V3OH 1HB0B 2Q6FA 1GBIA 2ZCKP 1GI7B 1QIXB 2BD9A 4OS4A 4AYVB 4GUXA 2GGVB 4X6NA 5IDKA 3NJAA 4MNYA 1SS2A 2C8YB 1VJAU 1EAWA 3UQOA 1QA0A 1AE5A 1OHHD 1SRZA 1BITA 3SOSA 2A55A 3MNXA 1HAOH 1LQDB 2A7HA 4DCDA 4INHA 4AX9H 3TNTA 5DP9A 1GJCB 1P01A 3SI3H 1GBMA 4I32A 3GCHC 1ETTH 4I8HA 3VXEH 1O5CB 3RLYH 1HFIA 1O30A 1C1QA 2ZFFH 2BDBA 2GDEH 3ITIA 3LONA 1V2TT 1GJ8B 4A5TS 1ELFA 2BY9X 2A0QB 5T1VA 4AOQA 2WYGA 3K9XB 2OP9A 4Y6DA 2BM2A 1HUTH 1GJBB 3KHVA 5A09A 2ULLA 3RXQA 2PKSC 3TJUA 1P8VC 1THRH 2ZQ1A 1EAXA 4ABBA 2Z3CA 1W13U 4R8TB 1TYNA 1GHQB 1GBJA 1H9LB 1FUJA 1BJUA 4XDEA 5HM9A 1AB9B 1A3BH 5FAHA 1SQTA 1XVOA 4DIIH 3LGIA 3LDXH 1CT0E 3SORA 1QR3E 1EB1H 2BYAX 5T6DA 3VGCC 1SGIB 1O33A 4I33A 1QO6A 2PSYA 2QF0A 1SI5H 1FY8E 4ZKNU 1L1NA 1OWKA 2P16A 3GOVB 1N6YA 4X2WA 1V2UT 4A1XA 3P70B 4RKJB 1GBBA 4ACAA 3OTPA 1G3EA 3EAJA 1GHBF 4ZKSU 1PQ8A 4MNWA 1OPHB 3SUGA 4FUHA 4LK4A 4ZH8A 4XBBA 3WY8A 1XUFA 1NESE 1QL7A 3DA9B 5FO8C 2KMSA 4I31A 1IOEA 1EXFA 1UTLM 3BTTE 1WDIA 1SR5C 3FP6E 1PPEE 1Z8GA 2GD4B 3KCGH 3QGNB 2VWMA 4PROA 1F5LA 2RFKC 4I8KA 1SGDE 5DSFA 2F3CE 2NWNA 3SNDA 4JHSA 2BLWA 3IWMA 4NWKA 1YCPH 1P2QA 2PKSB 5A8YA 1ELTA 1JIMA 5TCAA 3UOUA 1P2IA 1H9HE 4BTIB 1VITF 1FY1A 1GBFA 5FHTA 3LH3A 1BTWA 3ATKA 2KCYA 2UWPA 1GMHF 4ZCNA 3SHAH 1C5SA 1GHBG 1HAGE 3DT0H 1VVCA 2B5TB 1LDTT 1O5FH 4D9QA 1TGTA 3ZLDA 1GVZA 1DSUA 2V7QD 4JZEH 1A5GH 3MFJA 3VB5A 4WJG2 2A1DB 4D76A 2GP9B 3WSYA 1O2SA 5L2ZH 1S6FA 2XXLA 2K1QA 1DWDH 1WQSA 2XCFA 2GX4A 2TPIZ 1O3NA 1P2KA 3BTDE 1MD8A 1UVOA 3LGVA 5SGAE 3LGYA 3SW0X 1QBOA 3TGKE 3D65E 4ASHA 1O3LA 1AQ7A 3B8JA 5JBBS 1FI8A 3DHKH 1Y3WA 3RXCA 4K8BA 1Y3XA 2FTLE 4Q7ZA 1IHTH 1TPAE 3FVFB 1T4VH 5CDFE 1BRCE 1BA8B 3KQCA 1LO6A 3BTHE 3UWIA 1UK4A 3ZRZA 3A82A 3E0PB 1YPEH 2EHFA 6LPRA 4XFQA 2Z3DA 2Z94A 3I78A 5JB8S 1QQUA 1K28D 2ESTE 3LC3A 6GCHF 5LPEA 2ZU3A 1P06A 1KY9A 1GVKB 4RT0A 4TSFD 4P00A 4Y11E 3TITA 1AU8A 1S6HA 3AASA 3U8TH 3PMHB 1H2PP 2FO9A 3FP8E 5TCCA 1KYNA 4OS6A 1O3FA 1Y8TA 1VCWA 1O3GA 3ZZ8A 1ANEA 5CHAB 3F0PA 1ZZZA 3KQ5A 1COWD 2STBE 1E5GA 3PLKA 4ZHMU 1O0DH 1KTSB 2A4GA 2Z9LA 2ZHWH 2KAIB 2ZP0H 3INBC 4NA9H 2HVXA 3W95A 1T8NA 3RXVA 3PMBB 5EU8A 1T7CA 2HNTF 2P8OB 1LVMA 3M37A 1F5RA 2XC5A 5ESTE 1ETSH 4J38B 1LPGB 4ZMAH 2QAAA 4R0IA 3FOAA 5KGOA 2D1JA 1BTXA 4AYEA 1OP2A 1KXFA 6GCHG 2HNTE 1UTQA 5CE1A 4JZIA 1L4DA 4NWLA 1O37A 3GOVA 2ZPSA 4YM9A 4AGJA 2PSXA 1CGHA 4AN7A 2VBCA 4AB9A 3Q76A 5EW1H 1AHTH 1S5SA 2HPQH 4X1PU 3CNRA 2BX4A 1C9PA 5EQQA 5FPSA 2BQ7B 1GPZA 1BBRH 2ZDVH 3N99A 2XYAA 4NIXA 5DP4A 1YCPM 1DLKB 1O2JA 1CSOE 1C5MD 3QTOH 4BAQB 2QGRA 1YPHE 1V2LT 3BTQE 3EE0B 5C0UA 1L1JA 2F91A 2V8EA 4O3TA 1P10A 2YRAA 1IQEA 2H5DA 2GMTB 5E0JA 2FOGA 4I7YH 1TALA 2H5CA 1O2HA 3OP8A 1FAXA 3ZD2A 2BDGA 3ZZ9A 3RMNH 1MTSA 4A6LA 3SGBE 1TMBH 3BEUA 3N7DA 1UW7A 1P04A 2W6ID 4B2RA 2R0LA 3ENSB 3RXEA 1V2VT 3F9FA 3RXMA 5A0AE 1HJ9A 1LTOA 5FBEA 1C5OH 4VGCB 1SGCA 1MBMA 3LGWA 1XXDA 5C5OA 4H4FA 2ZGCA 2ZIQH 4TY6A 1GL0E 3SQEE 2RDLA 1D9IA 4O97A 3TK6A 1C5WB 1CHOF 3MMGA 2RKZA 1XUIA 4X1SU 2A2XH 2GCHF 3TGJE 5HZPB 2Y6TA 1SGRE 3CENA 4JZFH 4TT3D 2GTBA 1ETRH 4UDWH 3UNQA 5GCHF 3UQVA 1QJ6B 1BDAA 2FX6A 3NK8A 1MQ5A 4YESB 1GMCG 1YLDA 4ISLA 3S69A 1EKBB 3F0OA 4X1NU 1PPHE 2Y8TA 4A92A 1MMJN 4UFFH 2OCVB 3BIUH 1Q3XA 1LVYA 2F43B 7LPRA 3QK1A
chains in the Genus database with same CATH topology
2SGFE 3SBKA 1P9UA 2ZGXH 4ABEA 1O34A 4ISHH 1HNEE 4AFSA 4GAWA 2RLQA 2YOLA 1GHZA 1HXEH 4ZXXH 2GCHG 4XSKU 2G7IA 1FDPA 1FN8A 1SGYE 3ODDA 4JYVH 1EPTB 2AMPA 4CHAB 3OEDC 2FTMA 3SUFA 1U5MA 3TH2H 5GCHG 1AY6H 1E34B 2J4IA 2QXHA 3RDZA 1K1IA 4ZHAA 1O35A 4TPIZ 3KL6A 3QUMP 3OYPA 4FU9A 3T28A 1C2FA 1O5AB 1UTJA 3DFJA 2BQ6B 5EXMA 3QDZB 1VGCB 1TBRH 5EXLA 3LJOA 5A2MH 3I77A 2Z9GA 4JK5A 1QFKH 2KAIA 1OX1A 3NZIA 5AFZH 1V2PT 2AYWA 1P2NA 1TX7A 2ZFPH 2ZHFH 1XUHA 2AS9A 4KTSA 4YZUA 3K6ZA 3ZZCA 3SUDA 2B8OH 7ESTE 2TRMA 1IQIA 2F9PA 9LPRA 2GCTC 2ZZUH 1KIGH 3RM0H 4X6PA 4KTCA 1O3PB 1DPOA 1BTZA 3LT3A 4XBCA 4BTUB 4AZ2B 1ZPCA 4THNH 1NO9H 2VVUA 3V12A 1H8IH 5LPRA 1ESBA 4U30A 1NTPA 5DG6A 2IN2A 4LZ4B 4TWYA 4CRCA 2HRVA 5E2PA 4D9RA 3SUEA 1B0EA 1DOJA 3BG4C 3URCA 1DWEH 5E0GA 3OU0A 2XCNA 2Y7XA 4CRBA 1O3EA 4CR5A 1O2VA 2A5AA 2J94A 3HGPA 2BVRH 1TMUH 4CRAA 1P2JA 4Y0ZE 5A8ZA 1SLUB 2QXJA 5EGMA 1HBTH 1A0JA 3C1KA 2H9HA 2CF8H 2VGCC 2W26A 1QUBA 3UFAA 2WINI 1GI5A 3UIRA 2BDYA 5DP6A 3KQEA 1O3DA 1CO7E 1QJ7B 1ZSJA 3PO1C 3PTNA 3PWCA 1T31A 2A2QH 1F92A 1PPGE 3RC4A 3MH4A 1V2JT 2J92A 1ELCA 1TIOA 3PLPA 1QGFA 3M61U 1Y59T 1HPGA 1D3QB 1C1TA 1EAIA 5ETXA 2Z9IA 5FPYA 1TNKA 1W12U 1OJWA 2FXRA 2JGXA 1DDJA 3D62A 2QY0B 1AWFH 2EA3A 3SV9A 1GCTC 1UMAH 8ESTE 1GVLA 2WV5A 3BG4B 1TPPA 3MNBA 1AGJA 1C1PA 1C2GA 1O32A 2PTCE 3MOCA 1BQYA 1ZJKA 1KLIH 1EPTA 3PTBA 2XWBF 4F49A 2F9VA 2G55A 5I0QB 1ELDE 4CRGA 1AO5A 2ILNA 1C1RA 1AI8H 1O3JA 1UTMA 2XBXA 5F8TA 1DWBH 4UFDH 4HGCA 1YM0A 1DITH 1SG8B 1FNIA 1ACBE 3SV8A 1SGFG 3RXTA 1L2EA 3F9EA 5I46H 1MAXA 2A31A 2ZU2A 2ZEBA 4Z6AH 1BZXE 2QC2A 3F9HA 3SU1A 1F5KU 7GCHF 3TPIZ 2GV7A 1AIXH 3M5NA 2FOCA 4SGBE 5GPIB 3E1XB 1LQEA 1KXDA 2Y5HA 2EC3A 1C4V2 2C8XB 1ZLRA 1P2MA 2Y80A 1EZXC 1O5DH 2ZQ2A 1EJMA 3PROA 2GT8A 3UWJH 3BTFE 1TPGA 2WPIS 1O2TA 2XW9A 1YCPK 4Y79A 4ABFA 1IQMA 3M5OA 1OWJA 2G4TA 2PR3A 1B5GH 1GI8B 1JXPA 1NFWA 4WXIA 3GDSA 1ELVA 1A2CH 2BD8A 1ARBA 2YBYA 1S81A 1UTPA 4YLQH 2W3IA 3H7OA 5F8XA 1EX3A 1OJVA 3O8BA 1GDUA 2UWLA 1OP0A 4FU7A 4X2VA 3RXPA 1OKXA 3ZYDA 3W94A 1C2LA 5DJ7A 2FZZA 1GBHA 1YPLH 5AF9H 5EODA 2H1UA 3ZZ7A 3Q00A 1TPMA 1AN1E 2FOEA 3SU5A 4ZKOU 1NRQH 4TPYA 1PQAA 2CKUA 2ZGHA 1ZPBA 2Z9KA 4IC6A 3PMAB 4ISOA 3VXFH 1ZRKA 5BPEA 4K12A 3E0NB 2V35A 1S0QA 2ZDLA 4X1RU 1OK1A 3KNXA 1C5UA 1N8OB 3BSQA 3BG8A 1EZUC 4MVNA 4A1VA 5HM2A 2BD7A 3RMMH 1TLDA 3RXGA 1NFXA 2QYIA 2VB0A 2XWBI 1DUEA 2G51A 5T6GA 3ERBA 5C67A 1GJDB 1QHRB 2GDDA 4MTBA 1MCTA 1A1RA 3L33A 1ZTLA 1NU7B 2ZGJA 1WCZA 2TGPZ 1IQKA 1A0LA 1IHSH 4ABAA 2QF3A 3SNAA 1UTOA 1P03A 2Z3EA 1O5BB 2FLBH 3EDXB 1QY6A 2QY0A 3SO3A 3ZYEA 3BF6H 2ZHQH 2ZI2H 2TGDA 2BOHB 4JMYA 4KKDA 2XC4A 1G30B 2UUJB 2JH0D 4NG9H 2CF9H 3P8OA 2BB4A 3U1IB 1A61H 2ZC9H 1GJ7B 3NUMA 4E7RG 3OY6U 3RUOA 4ZH1D 4CSYA 1O5EH 3BEIB 1O3MA 2AIQA 3PYHA 1YF4A 3O8CA 1P57B 4CREA 8GCHF 1TOMH 1NFYA 1HCGA 4K60A 1GBLA 1EATA 1Z71A 3MH6A 3Q3KA 4JK6A 4YTAA 2CG6A 3FP7E 4A1TA 2Y5GA 3R62A 3GY5A 2QV1A 2DE8A 1V6DA 2XWAA 4AYDA 1K1OA 1YPJH 3ZVAA 4HTCH 2JKHA 1H2QP 1O2PA 2O39C 3MNSA 2CMYA 2OINA 3GY4A 1RD3B 1TNGA 4E06H 2ZECA 4Z0KA 4BAKB 5C5NA 3MU8A 2Q6GA 3LU9B 6CHAB 3MNCA 1BBRK 1L4ZA 4CRDA 2G00A 1SGFA 7KMEH 5AHGH 1G2MA 1EP5A 1MTNB 2G52A 1SMFE 2JGWA 1NRRH 8GCHG 3EJHA 2FPZA 5A8XA 1K1JA 1WQVH 1QRXA 4CBOA 1EQ9A 2WPLS 3K6YA 2OXSA 1WBGB 4NSVA 3VB6A 4ZUHA 2BD5A 1A5HA 1MTUA 1SGQE 4KELA 3T2NA 1PPCE 4J2YB 4BAMB 1G4GA 4NZLA 5E0HA 4BXWA 1P09A 4YNXA 3DUXH 1DUAA 3U69H 2BD4A 3VEQB 3LGUA 3RXRA 3K2UA 2PUXB 2FIRH 4Q2KA 2Y82A 2CHAB 1TPNA 1BTHH 3SHCH 2RLPA 1MTVA 5HGGA 1D4PB 4AYIA 1P05A 2VIQA 3U98H 1TX8A 2VIVA 2F9NA 1MCVA 8LPRA 4O03A 5CHAC 3LIWA 5E2OA 1L0ZA 2BY5X 1Y5AT 1C5NH 1T4UH 2IPHA 1DFPA 3TH3H 3A8BA 1AVXA 1ZMLA 2BD3A 1AKSB 1K22H 1D6RA 2P8OC 3QN7A 1J8AA 1YC0A 1GKGA 1ABJH 2EI7A 3FAOA 3ZZ3A 3FZDA 1O3AA 1VITG 1J17T 2ODYB 1ZYOA 4NFFA 1C1MA 3EYDA 1GMHG 4LXBH 1HAVB 3MU5A 3BTGE 1TFXA 2NU0E 1O3IA 1GBDA 4IN2A 4K3JA 3B23B 1P11E 1P3CA 1SLVB 4FUDA 4D7FA 3G01A 2HPPH 3SU4A 4DG4A 2FMJA 3FZZA 1ARCA 1XXFA 2PHBA 3SGQE 5JBAS 3S7KB 3HGNA 4HFPB 1DY9A 2NU4E 2J95A 3SJ9A 2WPHS 2GZ7A 1PFXC 1SC8U 4YOIA 1A3EH 2AERH 2SGDE 2V3HH 1UK2A 4UD9H 1FXYA 3QWCH 4INKA 4K5ZA 3KXVA 2P94A 2GMTC 2VINA 2ANMH 2FI4E 1CVWH 4CH8B 2ZFQH 1Z92B 2FX4A 1E8BA 2C8WB 2BD2A 3IX0A 1V2NT 4ABHA 1WTHD 3K65B 2V0BA 2KRIA 3HPTB 1SPJA 3IITA 2BY8X 2THFB 2HGTH 1GBTA 1AWHB 1ZJDA 1JBUH 2HNTC 4VGCC 3L3TA 1O2MA 3HK6B 2BY7X 1FBRA 3UUZA 5C20A 2TIOA 3A7XA 1KXAA 4JYUH 5HMAA 3RLWH 2SNWA 5C2ZA 4NIVA 3MU4A 4OGXA 2C90B 4DY7B 3SJOA 1FY3A 2ZTYA 1LKBA 4RSPA 2ZWLH 1PPFE 1FIWA 3GDVA 3SJIA 1AVGH 3A8AA 1C2DA 5C1UA 4B2SA 1YPHC 5FCKA 4MDSA 3SI4H 1C5LH 1VITH 5EQSA 3GCTF 3VB4A 2TGAA 1DVAH 2BLOA 4UONA 5DPAA 2H9EH 2ODQA 4MQAA 3BTEE 4MNXA 1SBWA 1G37A 4AG1A 1MTWA 1EAUA 1EP6A 2ALPA 5J4QA 1OWDA 2BDCA 4PZ5A 2EI8A 4BOHA 3R0FA 3SZNA 2P3UB 3ELAH 1EPTC 1Z8JB 4CHAC 2PKAB 3TK5A 4A7IB 1CA0C 1NRSH 1SQAA 3IU3I 2GVFA 2F9BH 1C5YB 3E3TA 1C1ZA 3GDUA 4TY7A 2C93B 1HAIH 3SQHE 4D8NA 2NU3E 1KDQB 1Z8IB 1GI3A 1UTKA 2XRBA 2ZCHP 1C2KA 1VGCC 5DGJA 3ATMA 1GG6B 2BTCE 3EA7A 3GCTG 1BRUP 2G4UA 3EA8A 3QZRA 1XVMA 1FY5A 2IZ4A 1J14A 1AKSA 1HCCA 1Z6EA 2FOHA 1KTTB 5T6FA 3UNRA 1P0SH 2ZNKH 4ABDA 1NN6A 5G4BA 5LGOA 1BMNH 1SGEE 1HAVA 3A7VA 1SOZA 3EGKH 1KXEA 1IQFA 5FX6A 3H7TA 1G2LA 4NZQA 2VU8E 4WMEA 2FLRH 3RC6A 5L6NH 5EW2H 1O2IA 3GY6A 1DLEA 1MH0A 4DIHH 1NRNH 1BT7A 1PYTD 1A4WH 1K21H 1RXPA 1WAYB 1OP8A 1O3BA 2VH6A 3LGTA 1CHOG 1H4WA 3T5OA 1OK2A 2XNIA 4OS5A 3MU0A 1ZTKA 1C2IA 2O8MA 3TJOA 4BXSA 2R2WU 4X1QU 1CA0B 1O2XA 2F9UA 3H5CB 3V7TA 4XOJA 2W3KA 1F0UA 4BTTB 1BMLA 1WUNH 1C5VA 1SSXA 3FFGA 1BRAA 3P6ZB 3UR6A 2V6NA 1OSSA 2PLXA 1O2KA 4OS7A 3JZ2B 3EA9A 3A85A 1ZOMA 1CGIE 4B76A 3D49H 1TRNA 1VR1H 2XBYA 5FPTA 1G32B 2A32A 3HATH 1TABE 4H6TA 2H2ZA 1CBWB 1SLWB 3S9BA 2M5TA 1W0YH 2MCZA 2FYQA 3TJNA 1ZR0A 5H4IB 1RFNA 4X6MA 5GIBA 4DOQA 1O2GH 2FOFA 1ZRBA 4GSOA 1JRTA 1A46H 1QB9A 3T26A 5DP8A 1BMAA 1RIWB 3RU4T 2P59A 1GHAF 2G8TA 3ZV8A 1NY22 4HZHA 1JRSA 1SLXB 1U6QA 1C4Y2 2JH5D 1ZMJA 4X8TH 2AH4X 1TQ0B 2OC7A 4ISNA 1UVPA 1FV9A 3MO9A 1GJ9B 2AGGX 1GMDF 3RXBA 1QURH 3KEEA 3M5LA 5JB9S