4F4RA

Crystal structure of d-mannonate dehydratase homolog from chromohalobacter salexigens (target efi-502114), with bound na, ordered loop
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
408
structure length
408
Chain Sequence
YFQSMMKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAKTPGERYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of D-mannonate dehydratase homolog from Chromohalobacter salexigens (Target EFI-502114), with bound NA, ordered loop
rcsb
source organism Chromohalobacter salexigens
molecule tags Lyase
molecule keywords D-mannonate dehydratase
total genus 154
structure length 408
sequence length 408
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4f4rA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4f4rA01
3QKEA 4DX3A 3I4KA 2PTZA 3I6TA 4HCDA 1KKOA 4J3ZA 4EWJA 1R6WA 1MNSA 2PTWA 2ZC8A 4Z17A 1KKRA 2PP3A 4G7FA 4IZGA 1OEPA 3N4FA 3CB3A 3FJ4A 2XH4A 4GYPC 1R0MA 2P88A 4KPLA 1JDFA 3MKCA 3MZNA 2GGJA 4H83A 5FJUA 3TJIA 1ELSA 1BQGA 1WUEA 2GSHA 1ONEA 4GFIA 4X2PA 2PPGA 3RGTA 3UCDA 2OPJA 2OVLA 2P3ZA 6ENLA 2MNRA 3OZMA 4HPNA 2PTYA 1EC8A 2AL1A 3IK4A 1F9CA 3K1GA 3S5SA 2PP1A 3VA8A 2QJMA 4DN1A 3SN4A 3NFUA 3UJSA 3FCPA 4GISA 2MUCA 3DDMA 2OZ8A 3CK5A 2OZ3A 3N4EA 2OFJA 3SQSA 2GGHA 1NELA 3NO1A 3V3WA 4FP1A 1KD0A 1KCZA 3IJQA 3ZVIA 5ENLA 5BOEA 3IJLA 3RRAA 1SJBA 3JZUA 3UJEA 3TWBA 2AL2A 2OX4A 2QDDA 3PFRA 3VC6A 3QLDA 2CHRA 1EBHA 4K1WA 3H12A 7ENLA 3CYJA 4A6GA 3T9PA 3SN0A 2OG9A 3CXOA 4IHCA 3DGBA 1XS2A 3GY1A 3HPFA 1SJCA 4H1ZA 2I5QA 2GGGA 2P0IA 2PGEA 3D47A 2GGIA 4IL2A 3OPSA 3ENLA 4J1OA 3TOYA 3VDGA 4HCHA 3ES7A 2HZGA 2QGYA 3VFCA 1TKKA 3BOXA 1JCTA 3OP2A 4JN7A 1JPDX 1EBGA 3UJ2A 4HN8A 1SJDA 3THUA 4DXKA 3GO2A 3R11A 2XH0A 4KT2A 2OQYA 3D46A 3N6JA 2HXTA 4GIRA 3DFYA 1SJAA 2OKTA 4E4FA 2QDEA 4ROPA 5FJPA 3MSYA 3OZYA 2PU0A 3U4FA 2OQHA 3EKGA 2PP0A 3TQPA 2ZADA 2AKZA 4MMWA 4ZA0A 3P0WA 3TJ4A 3ZVHA 4E6MA 3T6CA 2HXUA 3R1ZA 4E5TA 2QVHA 3TWAA 1MDRA 1YEYA 3ZLGA 3MWCA 3PK7A 3VCCA 3QPEA 3QN3A 3BSMA 2DW7A 1MUCA 3TTEA 2PMQA 3ZVHB 1FHVA 3FV9A 3FVDA 4HYRA 2XSXA 2HNEA 3R25A 3GD6A 4GGBA 3V5FA 2GDQA 5IDZA 1E9IA 4ZCWA 3RR1A 3SJNA 3UXLA 3RITA 4DYEA 3TCSA 2FKPA 3MQTA 4IT1A 3CAWA 3SN1A 4JN8A 3BJSA 3ZLFA 2PODA 3CT2A 3S47A 3UXKA 2QQ6A 4MGGA 3FXGA 2GL5A 1EC7A 2DW6A 3SBFA 4GMEA 4HNLA 2AL2B 3DG6A 1FHUA 2PS2A 1P43A 3H70A 3FYYA 2OLAA 4A35A 4DWDA 4DHGA 2O56A 2AKMA 2PSNA 1PDYA 1NU5A 4HCLA 3QTPA 3Q4DA 4HNCA 3H8AA 3N6HA 1XPYA 3Q45A 4JHMA 4K8GA 2XGZA 4ENLA 1EC9A 2PCEA 3UJRA 2GGEA 4GGHA 4KWSA 3GC2A 4K2SA 1JPMA 4IL0A 3I6EA 3DEQA 2FYMA 4IP5A 3MUCA 3R10A 3RCYA 2P8CA 1TE6A 1L8PA 1IYXA 2QJJA 1BKHA 3PWIA 1TZZA 5EU9A 3DESA 3PWGA 4IP4A 2PTXA 3U9IA 4E4UA 3DG3A 4FI4A 4YWSA 3R0UA 3IJIA 4M6UA 2RDXA 2OO6A 1DTNA 4H19A 3UJFA 2POZA 3VCNA 3NZGA 3DG7A 1PDZA 3P3BA 3P93A 2NQLA 3UGVA 3SSZA 3JVAA 3V4BA 3EEZA 2PU1A 1ECQA 3V5CA 2ONEA 1MDLA 2P8BA 5J04A 5FJOA 1P48A 1MRAA 4E8GA 4M0XA 3NXLA 3R0KA 4KEMA 3UCCA 3RO6A 3T8QA 3ZLHA 2OZTA 2PGWA 3JW7A 2PA6A 5FJRA 3ES8A 3H7VA 4MKSA 4G8TA 3OW1A 3STPA 3KUMA 3TW9A 3OTRA 1RVKA 4GYPA 3DIPA 4A3RA 2XH2A 3B97A 3DFHA 3VC5A 1W6TA 3DERA 3T4WA 1WUFA 4F4RA 2QJNA 3MY9A 5FJTA 4Z1YA 5BOFA 2XH7A 4H2HA
chains in the Genus database with same CATH superfamily
6TAAA 2VGIA 2W92A 2X8HA 3R4IA 3IRDA 1KKOA 3TYCA 4IOTA 4QLJA 1AW2A 3CC1A 2Z27A 4GKTA 2W5FA 1ADDA 3MHGA 4GYPC 5CBBA 2IKHA 4DQWA 3AIVA 5D8WA 3A7UA 3WLTA 2VGGA 1FWBC 2E1DA 3CEPA 4M29A 4YTSA 2PGFA 1JIBA 3CGDA 5HNRA 1UQZA 2YXGA 4R7JA 1RCQA 3N2MA 2UZ9A 3T1GA 1VB9A 4HZ8A 3VFLA 3S5OA 1XKYA 2BNJA 3TOPA 4P61A 3QC0A 5CPSA 4ZFMA 1V0LA 4MZ8A 1LM1A 5LHFA 5CPOA 1O5QA 2UBPC 4IGNA 2PP1A 3LGEA 2CZ5A 1TX2A 2A5HA 1H60A 5HWNA 2PEVA 5C7VA 1GPFA 1E4MM 1NJJA 3AMLA 3GD3A 1Z69A 3II4A 1HL9A 4GQRA 2W79A 4MKNA 1K7XA 3PG6A 3PWAA 2QEZA 1G4EA 4FNUA 1HN1A 3MKVA 3CIWA 1NELA 1JAEA 1MEWA 1XPGA 3H4XA 4GXWA 5CJ5A 4I5UA 3V35A 2PDUA 4NI3A 1XR2A 1ZB5A 2OMAA 4IMCA 1V5XA 5BOEA 3IJLA 1RBOB 3HG4A 3UJEA 1F8MA 1ME9A 1HG3A 4CD5A 2Y89A 1EBHA 1N8WA 4K1WA 4LU0A 2BC1A 1TPVA 1ZMDA 2VCBA 4NJIA 2IXUA 3S2NA 2VYOA 4PTMA 3LPOA 2E6AA 3DGBA 4HU3A 1YRRA 3LA4A 5LA2A 2BVYA 2DGAA 1Q1RA 3TNOA 3HPFA 2WBKA 2DZUA 2BWGA 3IIXA 5GPRA 4IMFA 3U7BA 2XVNA 4RE0A 1PX8A 2P50A 4HJFA 4F66A 3SY8A 1Z6KA 4NZ1A 5C7HA 4S3AA 3VDGA 3CZ8A 2J77A 4NAFB 3TYDA 5GNXA 2Z4GA 1RAKA 1UR0A 1HJUA 3KZPA 3VD4A 3GYCA 2X7WA 4PMOA 3M07A 3OG2A 2VD9A 3PJXA 4UTTA 4GZEA 1EQCA 2BZNA 3G6MA 4DELA 2WPEA 1CI1A 3F7JA 4KT2A 4PR4A 3N6JA 3UGRA 2PDFA 3VU2A 3G8EA 2Y63A 3NZQA 3W3OA 1XL9A 4NYUA 1QHPA 1OJTA 1Q8AA 2R24A 3NVVB 1TB3A 4HHMA 3UXIA 4V27A 4LVBA 3QV7A 1E71M 3O15A 2YGYA 3I68A 1R3WA 4GE8A 4PE8A 5CPTA 3TQPA 3OEXA 3W6YA 3I7RA 3PSVA 1TWWA 2VFDA 4FF7A 1A3WA 2J62A 5A8NA 4O4VA 2GQ3A 4AUBA 3N29A 3MV01 5CCZA 3R1ZA 4JQ2A 4MB4A 1A0EA 3P81A 1O4UA 1Q13A 5I78A 1NWTA 5T91A 3T55A 3ZVHB 4XKYA 1C9WA 4JYEA 4H7ZA 3LPGA 1X8FA 3GW0A 2TPSA 5G1TA 1FFVC 3VI2A 1H2IA 2XSXA 4FK9A 3S42A 4JXCA 4I90A 5I3DA 2CLMA 5BZAA 3D9XA 2PE4A 3H2OA 1JL8A 2EKGA 1C8QA 3VE9A 3MQTA 4PB5A 1Q7ZA 4KCWA 1SM9A 4KGJA 3W7NA 4RK8A 2VOMA 2D0HA 1B3VA 1KTNA 1EEXA 1CPUA 2ZIDA 3RUBL 2AMGA 1ZLPA 1W91A 4UXDA 5AYIA 4J3UA 2ZDSA 1GGOA 2WZTA 2JALA 2HVNA 3WQWA 4QHRA 1UQYA 1UBPC 1DV7A 3CH9A 2ABBA 1TYPA 1WBHA 1O5RA 1XLLA 1W2VA 4O1AA 2X1RA 3P6LA 1H1NA 3NQGA 1SR0A 2OEMA 2A6LA 1NU5A 4JKMA 4DJFC 4NT0A 4JTGA 5E9XA 2WJFA 2XWDA 4EMWA 4YTUA 1MZHA 1GOKA 2VURA 3PVFA 4JNZA 1P7TA 2GK1A 2PCEA 3UJRA 2J78A 2VZOA 1B9BA 4JDBA 1L6FA 3W02A 4K2SA 3MMWA 4DUOA 4LQ1A 1L6WA 4H4VA 1K03A 4Q4MA 5DELA 1I6NA 4OU1A 2QF7A 4AX7A 5MHBA 4AVFA 4MM1A 3QZ6A 4TTGA 1L8PA 1IYXA 3EWZA 3AHYA 1VS1A 1H7RA 4KF1A 4B4FA 4JTEA 3WD3A 5AYBA 4WXZA 3R0UA 3OLGA 2KZHA 3OVGA 4BWLC 4Z2LA 2C1HA 2OGJA 1MOKA 1RXOB 4C6FA 1G4PA 1OZMA 2G5WA 3IUHA 2JBMA 4CKQA 4K8HA 2VDHA 3W84A 1J11A 4ADTA 4F48A 3H22A 3MA8A 1I2OA 3IUDA 3EZ4A 1Q6GA 1LLZA 1CXHA 1OVDA 2OOGA 4Z2IA 2VO5A 4PN2A 4UMAA 3HPXA 3STEA 2OSWA 4IGSA 3RLUA 3VKCA 4BI5A 4EQSA 3M5YA 3P0XA 1E51A 4GCAA 4MSSA 2SFPA 4EP8C 3GU2A 2PAJA 1MYRA 2D1ZA 3WN6A 4MWAE 2D22A 3LOTA 2ZX8A 1J6PA 1XDLA 4D6GA 3PG8A 1IEVA 1R46A 3IC9A 4XBSA 3W83A 2VOTA 3BANA 5D4YA 4AWTA 4ZQMA 1A5AA 1MW1A 4FNQA 4OZOA 4NJHA 3PZ9A 2QVNA 1OG6A 3BW3A 5F4WA 2G0WA 1DQXA 3L68A 2A3HA 4ORIA 4A3QA 4Y9MA 1S39A 1N55A 1M6JA 1GV4A 3WUFA 4S3GA 4PTWA 2P88A 1P5BA 1KXQA 3MKCA 3MZNA 3OGSA 1QRQA 3PZTA 4WY0B 3VOCA 3GRSA 1DJWA 4QX4A 4N42A 3GH4A 2A0NA 4H4ZA 2JK2A 2X1SA 3N15A 3AYVA 1W9XA 2OPJA 2H3DA 2TSYA 1K77A 2VZVA 4R9OA 2Z1KA 4OV9A 2YDRA 3WL1A 5FKYA 5M03A 5JBDA 5A1AA 1XIMA 4GX8A 4PBFA 1KM6A 5M3WA 3QBUA 1JZ3A 3A21A 2D0GA 4MWAB 2PD9A 5E9AA 4CU8A 4UZSA 6CGTA 2PDWA 1XJBA 2Y7EA 4EANA 2HE5A 1Q5MA 5I79A 5BXPA 3QKZA 2QPXA 2X2GA 1XIBA 4WEVX 3V7PA 2QXWA 1NY1A 4IQLA 5DX7A 4GBDA 4MLRA 3A4JA 3RHGA 4KCTA 3W7DA 4FNTA 1BYAA 1E15A 1BWKA 2VELA 2ANUA 2IXVA 1QCWA 1GZGA 1V3JA 2YA0A 3ITXA 3GZ3A 3OBAA 2OGYA 1S46A 2VC9A 1SJBA 2E09A 4NNCA 3TWBA 3F2DA 3RIKA 4RJEA 1F3PA 4A3YA 3C8NA 1ZJIA 3DYOA 1KQYA 4O17A 2C14A 1GQIA 4D6CA 1Y5XA 5AZ1A 2ASHA 4XUYA 3PBWA 4IHCA 4UNKA 3BC9A 1O1ZA 3EDDA 1TZ7A 2BODX 3NA8A 3SUVA 1F3XA 4B90A 5F4SA 4AMCA 5U25A 4WGXA 1DJGA 2QR6A 2OLHA 3SGZA 2GGIA 1WDRA 3TN3A 5I7GA 4LVAA 3L2LA 1UB3A 1D7YA 1FWDC 1UKSA 3R0DA 5F2LA 5T9BG 2R8WA 1TZ9A 1Y5WA 4EM3A 1BQCA 2Y62A 2FJUB 3BOXA 1EXBA 2YKKA 4DYJA 3KL5A 4HN8A 1EKOA 2OB3A 2RABA 1AK5A 2DZVA 3GD4A 4D1IA 2QULA 4GVHA 1F6PA 4MUPA 4W84A 3V18A 3QSTA 3CHEA 2ZE3A 2OKTA 3FXYA 3WLOA 1E0XA 1W3HA 4OOZA 5G1MA 2NT0A 1XINA 2OQHA 2JIEA 2PP0A 3FEQA 1C7SA 2J7HA 2NQJA 4ZB0A 4GY1A 3L4VA 4WOQA 5IHSA 1KM3A 2D20A 4ECLA 1H0GA 3QY6A 1TQJA 2QVHA 1X2HA 5EL1A 1O95A 3FHQA 3EB4A 3VMOA 5FJJA 4DZHA 1PTDA 3G22A 1WAUA 5C54A 3MDWA 4IMGA 1XYZA 4L56A 3WJYA 3TYAA 3WDPP 3R6IA 1C8VA 3OVRA 3PBVA 3S3GA 2WW5A 5HJXA 2ZZ5A 2VCAA 5AYXA 3BJTA 1MO9A 3G0SA 2BGNE 4M24A 3RR1A 2HTMA 4V1YA 1E6RA 3CPUA 1J12A 2VX7A 3UXLA 5BROA 4DYEA 3MYOA 2YQUA 2G3IA 1A5MC 4AQLA 1TMHA 4E4PA 1ZK7A 3GDKA 5D2TA 3MJMA 2YIHA 1OF6A 3ZWSA 5F7UA 4LAMA 1NDZA 2PCQA 1BTMA 1EA9C 2X8RA 3SIZA 2PODA 1FWJC 4P7NA 1S5WA 2GUBA 5T9CE 3WQPA 1GQLA 3UZ5A 1ALDA 2DT3A 3APYA 1KN0A 5XIMA 1TMQA 2X40A 2VGFA 2CZEA 2AAQA 2TPRA 1QASA 2PWDA 4H6EA 1N7KA 1WDPA 3D3FA 2JIWA 4EMIA 1UH2A 4OECA 2YBUA 5IFPA 3AZSA 2YBVA 3TQKA 5ABFB 3PAOA 2CZDA 3AROA 1NDYA 3LK6A 4APNA 4AZBA 4WKHA 2I17A 3A4XA 1ESWA 3SQMA 2WVTA 3H8AA 4NX0A 3UG8A 4Q7IA 3MWAA 1Q7MA 2UY4A 3DXIA 1QNRA 3LHYA 1SZGA 1IHIA 3OIHA 3RN6A 3NDOA 3DEQA 2OLSA 4BEUA 1AOGA 4G5DA 4J3TA 1N5WC 3BAYA 4FMVA 3P14A 1LTDA 3H7RA 4K7VA 3QV9A 3B3DA 3LD5A 4Q4SA 4JHZA 4CD4A 4U5IA 5AHFA 3WMCA 3TCEA 5C9WA 4UOQA 2DJLA 1BYCA 2V0TA 2X7VA 2V9DA 1JNDA 4MLJA 1TIMA 2WO5A 2RDXA 3SCNA 1E1FA 3JUGA 1BG9A 2EQ8A 3MO4A 2PBGA 4EIVA 4H4QA 5BMWA 3KBJA 1OGSA 3S2MA 4YVXA 4Y9OA 4DUWA 3ZR4A 4AD1A 5DMNA 4JTRA 3M6DA 4QJ5B 4R27A 1BTCA 4S3KA 3RO6A 1BRLA 4MYAA 3ZLHA 4Z1CA 2PGWA 2DZPA 4RW3A 3LV5A 3G77A 5A6BD 4I7WA 1T7LA 5A94A 1WV2A 4JR5A 1SMDA 1QHOA 3T7VA 1JZ4A 1OJXA 2QUTA 4ZO7A 4Q6XA 1XICA 3OTRA 4G2DA 4GYPA 2GVYA 5EMLA 3N9KA 4BQ4A 3S9ZA 1VYSX 1CECA 2XVKA 3VOFA 3VOHA 4B15A 4F4RA 1V6VA 3NIYA 3GXNA 2BASA 3EXSA 2QAPA 5D05A 3QKEA 4KERA 1UP3A 4ZMGA 2ISDA 4Z17A 1OYBA 2YR1A 1XYAA 4H4RA 4UCGA 2FHFA 3BK0A 2CXGA 1C93A 1DVJA 3J7HA 3PZMA 4PBGA 4BKNA 3PG9A 4QISA 3WLMA 3E5PA 1S5NA 3RO8A 4H6KA 3F5LA 2CLLA 4H4UA 4MFEA 1XIJA 3WLKX 1UR2A 1UBSA 2VWTA 4PODA 4X9SA 3MZ2A 5IM51 4JIIX 2MNRA 3NTYA 3WQVA 3U7VA 2AL1A 3IK4A 3VA8A 1NP2A 1VBJA 1SR9A 4DN1A 3BAXA 1DJZA 1SFTA 4D6FA 3U57A 5GJPA 3V5OA 4RPPA 4H3DA 2WC4A 1FWRA 2HE8A 2NXGA 3LI1A 5CAKA 1WO2A 4LAOA 1GOQA 4LSBA 2XVLA 3WLRA 2ZZ2A 5TIMA 1DL3A 2HV5A 4QG8A 3DFNA 5JH2A 3UCQA 1L0PA 4Y2WA 1LORA 5C8BB 4K68A 1BXNA 5XINA 1RLDA 4GHRA 1XD0A 4DLMA 2VRQA 4RUBA 3BL3A 5CXPA 5EMYA 2Z1VA 4UFLA 4YNGA 1SO5A 2FLIA 1ZDLA 4MZYA 1E6PA 3VGEA 4C6BA 2ZUTA 1V6UA 3CM4A 1VBUA 1B54A 3M43A 3EXRA 2ZUUA 3SCQA 1FFQA 2Y1HA 4UMBA 3B9DA 2DIKA 2REQB 4JQ4A 5HQLA 3LB8A 1YE4A 4AXNA 3LCFA 5E0KA 3W01A 1REQB 4J35A 1OFDA 3CWOX 1BZLA 1XLDA 1E1EA 2VX5A 4IH3A 3HBLA 3HRDC 5A2CA 3N2CA 4MFDA 5C9XA 4JFSA 3OOQA 5CSUA 2HZGA 5DXYA 3RDKA 3GKFA 2CU0A 4TVYA 5HULA 1CDGA 1LRTA 3N3TA 2O9OA 5MKGB 3TEVA 2NQ5A 5KZ6A 3R11A 2YSWA 5EPDA 1FWNA 3D46A 5FAJA 4WDWA 3GBDA 2G3FA 2QUNA 2F38A 3W86A 5ECVA 2JEQA 3M0HA 1NIUA 2VCCA 1BRLB 3U4FA 3ZFHA 3GH7A 1NARA 3W2JA 1YKWA 3TYZA 3HGOA 3O07A 3QW4B 1ZPTA 2HVOA 4HK5A 3NR0A 4YTRA 3W81A 4F0LA 2DIJA 4E5TA 4F2TA 4M51A 3TN4A 5KVIA 3MWCA 5GNZA 1QOXA 3ONCA 3QEZA 3AYRA 1I2NA 4XZ9A 1FHVA 1Q6QA 3FVDA 1BVWA 7REQB 1IGWA 1IXPA 3IACA 1B2YA 2HNEA 3LTPA 3R25A 2B7PA 3N11A 5AYZA 3KWXA 3S1UA 2GJRA 1YADA 1V6WA 2CHOA 3MP5A 2YBTA 1JJKA 1PHWA 3WIJA 4JYFA 4ZZ9A 1N60C 3K1DA 4ERGA 2PUZA 3TFCA 4XZMX 3WD4A 3VD9A 3EAUA 1VR6A 2QQ6A 3CYVA 2PDQA 4KGLA 3WH5A 1X1OA 4B5SA 3MBFA 4DF2A 3MI3A 1QHZA 2RUSA 3WUBA 4F9JA 3BLOA 1ZKQA 4GQQA 1W1IE 4AEFA 3PPCA 3UQNA 5DCEA 1EWEA 2F2KA 1L2UA 5J5DA 1GVQA 3LI0A 1GW1A 3U2ZA 2OLAA 3UG4A 5FS8A 3KDNA 4CD8A 4UTKA 4DHGA 1JCLA 3OU8A 3R8HA 5AC8A 3WEOA 2EPOA 1JYXA 4RPQA 4E3TA 3QQ0A 1VJZA 2W54A 1XBXA 8XIAA 1J2WA 3GC2A 3ABSA 4GK8A 1TCMA 2ZICA 4GZ7A 1Y8BA 1HZYA 5CLTA 2DT2A 1T6MA 4GD0A 1BKSA 1HVQA 5K9XA 5HK4A 1XIIA 4JDYA 3I4EA 3HV8A 3LS9A 1BKHA 3VIHA 4MNKA 1EHNA 2WP5A 3OZPA 3DFQA 4DF0A 5CC3A 4Y6GA 3M0MA 4B3ZA 3G1DA 4F8XA 1VRXA 4JFVA 5CZTA 3DG3A 1SFSA 3PUEA 1E4NA 5KZEA 2CNCA 2YL5A 4ZODA 3WUEA 2GJNA 1PVNA 3L4XA 3W26A 5C9UA 3VXGA 1TJ2A 1A3XA 4ZQRA 3DG7A 1UROA 5AHIA 4IPLA 3LMYA 5BU9A 1TV5A 1OD8A 3EEZA 4F0HA 2XZ7A 3B8IA 4TQTA 1B0IA 4ZR8A 2QMJA 3KRUA 3TSBA 1GRHA 4J2PA 3ETRB 1U22A 1VRDA 4TX8A 2HBXA 3FA3A 1V7AA 3G1HA 4F3HA 3T8QA 5DBUA 1A5SA 2VWSA 4XD5A 2JFEX 3ZMRA 1JCYA 3S0CA 3LZ3A 4ASTA 3EMZA 1EYEA 2NVCA 1TV7A 2C7FA 2XN1A 3ES8A 4YYCA 5BRPA 4PSRA 4H6QA 5HWJA 3ISIX 4B3LA 3CAQA 3DI0A 2WSRA 1AQFA 1DP0A 3LXCA 5CJNA 4LYKA 3ABXA 3DFHA 2ZUVA 3CO8A 1FWHC 3DERA 3LM3A 3IIZA 1WUFA 2XZ9A 4L65A 2J75A 3L0GA 5FA5A 3EXTA 4RZBA 2W27A 1B31A 2CHNA 8XIMA 5HBFA 5CG7A 1AUSL 3C3UA 3B4YA 3NPUA 2ZC8A 3UR8A 4OHQA 2VFGA 1UKTA 3QFWA 3AIEA 3EDEA 5BMXA 1TPB1 3LV6A 1EUNA 3CS2A 4DO6A 4F2BA 2YW4A 1D3HA 4DF1A 4LC8A 2ZTKA 1OCQA 2E4TA 1XHGA 3EWYA 2PRLA 1ELSA 2PBOA 3QOMA 3FJ6A 3AI0A 1GEUA 1DWJM 5KVHA 3NQ8A 3WJZA 2NPXA 2FZNA 1KRMA 4PEKA 1KA9F 2Y7FA 9RUBA 1DE6A 3FNDA 4MPKA 3UZXA 4QJ1A 4MNJA 1TRIA 2E6DA 1ODUA 1U1JA 4GI9A 5E70A 2W91A 3FCPA 3TP4A 2NZLA 3N13A 1G5AA 4QDMA 1U5HA 4XKMA 1DKWA 1JDDA 3W28A 3SZ8A 1H51A 5JCIA 5D2XA 2XFWA 1QWKA 2VKZG 3N34A 4O8RA 1CB2A 4WSKA 1SMAA 4FP1A 1HKIA 1KD0A 1TV8A 4C6OA 5HMSA 1E6SM 2VZSA 5AC7A 1OT1A 4NQ1A 3HFYA 1JQVA 1UOZA 3JZUA 3KTXA 2Z1WA 3IIOA 2HISA 1DPMA 2AL2A 2XVGA 4DJDA 2E8YA 3VC6A 2Z6IA 2CHRA 3GNXA 1LZOA 5FS6A 4E8CA 5TD4A 2ZZBA 3ZR6A 3W1RA 4EK7A 4EVZA 1DWHM 4HKPA 2DSKA 1FECA 4C5YA 2X2YA 1KTBA 2DSWA 1SO6A 2OSXA 3NQCA 1ME7A 1IR2A 1P6WA 5LNWA 4IPJA 1E72M 2CC0A 1VC4A 3URBA 2ABAA 3FVMA 3UXAA 4B9ZA 1AODA 1RBLA 3GDLA 1XYCA 3RM8A 1R9YA 3P7YA 1FWFC 3URHA 4D9PA 1B3XA 2D3NA 4J40A 1B3OA 1OK6A 4H41A 5BXSA 3KXQA 3W7OA 3U2EA 3EKZA 1M7PA 4JHOA 4W7UA 3AHXA 4ADWA 1AL7A 4F0KA 3GO2A 1US0A 1NVMA 5AVHA 1EDTA 3FFSA 3MBDA 3BUVA 1OBAA 1SSDA 1F4HA 3Q65A 4UB9A 3QTGA 5CBIA 1GKRA 2XN0A 3NL3A 4RZ5A 2QDEA 3M47A 4LBSA 1AH4A 2C6QA 1OX4A 3BW2A 3EWBX 4XZHA 1ZAJA 2AKZA 4O1BA 1EUAA 1QUMA 2NV2A 2HJPA 3DFOA 3GIPA 4HZMA 2ZRYA 1DHKA 5JVLA 1V97A 1RCXB 4IISA 3W2UA 4GVIA 4S3CA 4IIBA 2EO7A 3IS4A 4OFCA 1M68A 3PBYA 1ZQ5A 3S1XA 2AGTA 1ZJHA 2FZ9A 4HU0A 3EB3A 1ONWA 3KP1A 2X0SA 3W24A 3W2NA 2DUZA 2J79A 3N14A 3VIKA 1UR1A 4KMQA 3LGDA 3W1LA 3VIGA 3MMTA 3N25A 6REQB 1OFRA 5ECUA 4S39A 1OHLA 4Q8MA 3GNRA 3TZFA 1JD7A 1GTEA 1C91A 1JCNA 1H7PA 4NRSA 1KQZA 1D8WA 2Y5JA 2BHYA 2G37A 4GOAA 4HHPA 2YXOA 4DBWA 3A64A 3N2BA 2XIIA 3BPWA 5ABGA 4MGGA 3UY7A 1P0KA 1X1ZA 5I09A 1XCWA 2DVXA 3AXXA 3OQEA 1E40A 3AALA 4C6JA 4HNLA 3PBUA 2B31A 3VILA 1UWUA 2YLAA 1V93A 3TR9A 3CASA 4JIPA 4JS3A 3II1A 4DWDA 1S2UA 4UQDA 3UEQA 2FDMA 3MTWA 2XGBA 4AZCB 1H1YA 2PSNA 1PDYA 2GUUA 1AL8A 4U33A 3Q45A 4JZ5A 4NZJA 2I56A 4K8DA 3E5BA 2HNHA 1GUVA 1UD4A 2CEQA 2Z00A 2QHAA 2WLYA 5CZKA 1FCVA 4H8NA 3WQFA 2V6AA 1TPDA 5CZSA 4B3KA 4GX9A 5FEZA 3GTIA 2XTKA 1RALA 4KW2A 2EKCA 3A4AA 5FOOA 3SY5A 4W88A 3WLJA 3KS6A 3PR2A 3QY8A 1PSCA 4L80A 4P7RA 1R3SA 2VD8A 4AH7A 4ACZB 3DESA 3TH6A 3PZOA 1OCBA 5REQB 3SGUA 5I03A 3D5HA 4BQ5A 3GR4A 4YWSA 4LS1A 3DKJA 3QSRA 5CJMA 1EP2A 1XF0A 4JY8A 1OYCA 3VIMA 5ABFA 4G9PA 3HM7A 5LXEA 3TW6A 4G56A 3W00A 1Z89A 3NZRA 2Z7KA 4GVFA 3VIIA 4XAYA 3U2OA 3FAXA 3L5MA 3LCGA 3V4BA 5B7ZA 4H4IA 2VMFA 2F61A 3WH8A 1JROA 2F6XA 2C79A 1GRBA 3MCMA 2V30A 3LNPA 4FIQA 3ORWA 3GDBA 1RQEA 3O2LA 1SW3A 4LUSB 1LQ0A 3W7JA 4XO7A 3S5NA 2CKRA 3STPA 1XDIA 1TVNA 3SCOA 2ZRZA 4HYWA 3MI2A 4JBRA 3GWQA 1PIGA 3L23A 5BWFA 3AO0A 3B97A 3N1AA 3RM4A 3HMCA 1QI5A 4D6HA 1FTXA 3P67A 4A05A 1Q66A 2EJAA 4Y90A 3Q37A 4DRSA 1KRBC 1Q6DA 1E6QM 4B5UA 4N4QA 3CV1A 1QXLA 3UBPC 2QZRA 4UQEA 3GZAA 4EOUA 5IHRA 2VVNA 3S1VA 4CVWA 4S2BA 1OC5A 1OC6A 3DOPA 4ACZA 2E9LA 2NLYA 1UH3A 1JCMP 3CQ0A 3ARSA 4MY8A 1PTGA 3TA9A 4H83A 1YDYA 1AQMA 3TJIA 4HT3A 2BBFA 3GUGA 3UWYA 2GSHA 2Y24A 3TXVA 1FWTA 1MXGA 4RW5A 4TV6A 6XIAA 1EWDA 3RGTA 2KX9A 3UZYA 1KBJA 3PP7A 1WZKA 3OZMA 3GXIA 2PTYA 1A4LA 1BEUA 2OT1A 4TTUA 1WYGA 4LOCA 2POTA 3FY1A 5E1QA 4TX6A 3MB9A 4YMZA 2PZNA 5EFFA 2V69A 1IXNA 3CGTA 4ACYA 3EPOA 2WBAA 5EBUA 4B5XA 1QPRA 4ICNA 4JX5A 3BAWA 3I3EA 3GS6A 1VKFA 4EWND 2QV4A 4QEHA 5C2XA 2XDFA 3S6OA 3IJQA 3GVGA 1G6CA 3GNOA 4JTAA 3M41A 2XPKA 1A4MA 3K8LA 4X60A 4F79A 1BWVA 4I5RA 1XANA 3UR5A 4WD0A 3LU2A 4CVUA 2PTDA 4KFNA 4LW7A 1M5WA 5DMYA 2ZC1A 4HOXA 4HMNA 5CPNA 4H9ZA 1POKA 2NXIA 2HS6A 2ZXAA 3T9PA 1VEOA 3AJ7A 1P6CA 2CFFA 1PIFA 3A9IA 1X6NA 3EWXA 1UG6A 2FGBA 3W7MA 3AS3A 5L6UA 2H6RA 1YXCA 4M7TA 2QPSA 1GOOA 2BS9A 5D9MA 1JZ6A 2A3BA 2R14A 3KVJA 3D6NA 3W7KA 4IL2A 4HU4A 2ZUSA 4JIRA 2J4GA 1H61A 4XBJA 1JFHA 3PBGA 4XO6A 5B80A 2ZWYA 2G3MA 3V0SA 2ZRXA 3A9BA 4G1KA 3KOWA 1AW1A 4DWSA 3V0TA 3V75A 5LIUX 2ZA3A 3VNZA 4LA1A 4RXFA 4AVNA 1Q85A 5CSYA 4WJXA 2QGYA 2OEJA 4YVPA 5AOUA 4O0KA 4V15A 7ODCA 1V6TA 3VNKA 4PCPA 4GC3A 4O1CA 3K8MA 3QPYA 1A5OC 3Q94A 2HS8A 1FO4A 3WLIA 1MEHA 1Q6CA 2YAUA 2Y5EA 3BMVA 3CAKA 3NOYA 4O57A 3TTQA 1E9LA 4XZIA 3NEVA 5AHLA 3VMPA 4D2JA 5HXMA 4UTFA 4W89A 2X1IA 4ROPA 5FJPA 2J24A 3OZYA 1CXEA 2CERA 3E12A 4V1XA 1TPC1 2ACQA 4XAPA 1ZU8A 5G2HA 4HK7A 3CUXA 3W7EA 4Q8NA 1ZTVA 4UTMA 2NUXA 1W9VA 1TR1A 2A7NA 1FWEC 1X8CA 1K9DA 1FOBA 3FGCA 3VZZA 3E96A 2H9AA 3MYPA 4BR1A 2GSJA 1TIWA 4EMJA 3B03A 4DXVA 4DBEA 4J9JA 4HPHA 3PTDA 2RDWA 2RHGA 3U2CA 2YCEA 4C7DA 1CZ1A 1NHSA 5CSRA 1OG0A 3JZEA 4GGBA 4GUGA 1VD6A 4UFJA 5K2ZA 4CUCA 3DGHA 4B2DD 1H6VA 2EAWA 5DT7A 2X8GA 1Z9AA 2ZCGA 3WZ0E 2E8ZA 1EH9A 4ZO8A 4AIEA 5HJLA 3ELFA 3C2YA 3EX4A 5GNYA 4ZVJA 3WH7A 1NH6A 2Y6ZA 2BMBA 3HTWA 2L5HA 4YLWA 2PD5A 4AHPA 3VGDA 4FX9A 4YS1A 1RA5A 4H7VA 4JTSA 4DM1A 1A50A 4AF0A 2QAFA 3VMNA 1K4QA 4LTSA 2J25A 3TSDA 3K4DA 3WNLA 3SW6A 3H26A 1I1XA 4JHMA 3SQPA 4ENLA 3AM9A 1DJYA 1KCKA 2V5BA 8TIMA 5FCZA 3ALFA 1GHRA 4IPPA 3OGVA 4ZEPA 3DCPA 3ZIZA 4EQWA 1TPEA 3BLLA 1FIQB 1OFAA 1I60A 3SR6B 1T8QA 4Q4KA 2PF8A 2PTXA 3KVLA 2IQ0A 1KW1A 2CYGA 3EEGA 4FI4A 5A6BA 4PMXA 1LP6A 4NUWA 2A7PA 1LUCB 3IJIA 1GERA 2YFNA 1F8WA 5D9NA 4AAJA 3OC4A 1POJA 5AHEA 3UW6A 5TR3A 1VJSA 2YW3A 4H19A 4H4YA 1KFWA 4LRTA 1GETA 3AUOA 3ZWTA 3U4AA 3GHSA 1RD5A 2X41A 2BC0A 3AHTA 3PNZA 3AZTA 1BXBA 4O4WA 2PDCA 4E8DA 4KEMA 3E38A 4BJHA 2G8ZA 3WF4A 1XSJA 4QG9A 1ISYA 3CJPA 3KLLA 1GQJA 3KRSA 4K36A 1XBVA 3TC7A 1FEAA 2VTFA 1CBGA 4LAZA 3L0KA 3VNMA 4C6QA 4REQB 4PUJA 1UPMB 1WB0A 3HJEA 3TW9A 3MI6A 4A3RA 5CG0A 3O6CA 2JF6A 2NX3A 1VFSA 2Y4SA 1JDCA 1J0JA 1W32A 2WNZA 5KEZA 2WPFA 1E0VA 2QUUA 2UY5A 2H8ZA 4Z1YA 1GXFA 2PI6A 1GVFA 2A7RA 3RPDA 2XH7A 3LCHA 4D72A 1UUOA 3NEHA 4U2ZA 3NL2A 3KS5A 2OOFA 1X98A 3USBA 1YW1A 1KM5A 1KKRA 2PP3A 1J0YA 4CQAA 2R1NA 4PUUA 4IZGA 1WOBA 3C0QA 4H4SA 1S2CA 3CTTA 2VEKA 5T26A 2WHLA 2OWWA 4AX6A 3CTLA 2HSAA 4KPLA 1NAL1 3HW2A 4C1NA 1HP5A 1UHVA 3WBEA 2QCMA 2GWGA 3RU8X 4UNIA 2V2CA 3MHFA 3DK8A 2BV9A 4W93A 3GHTA 2D2JA 1CYGA 4X2PA 2XYLA 1F3WA 3AYTA 1O12A 3FOKA 5LGXA 3GFXA 1J0KA 4H04A 1RD6A 4FX6M 3TLQA 3HF3A 3M5VA 1KWGA 1TYTA 2QAEA 2EG8A 3H2FA 4AZ7A 1A0DA 2D24A 4L4OA 1NQKA 1E56A 4BI6A 3BWWA 1F3TA 2OZ8A 5AHNA 4O0QA 2PDKA 4Q8VA 4W85A 3CO4A 3N4EA 3R8RA 3M0ZA 2V5DA 3B8SA 4AIBA 1CX9A 1KCZA 3EPMA 4Y9NA 5CC7A 3LHVA 5DY2A 4CNPA 1KO0A 1M7XA 1TJPA 2C91A 5IBXC 1VIZA 4LVGA 4O15A 4CU6A 2DZSA 3ITTA 1QPNA 4GUHA 4GKLA 1LJYA 1AQHA 4HMDA 3RYSA 1XLJA 2ATSA 4LRSA 1QPQA 1E70M 3CXOA 4AEOA 4LPCA 4XSMA 5H8PA 5C55A 2P3EA 4J2MA 1QDSA 4JEQA 5GVJA 5FF3A 3KTSA 1GRFA 2RJGA 2CBJA 3G0XA 4XAGA 2WKLA 4IFKA 2DVTA 1ECEA 1ZAHA 4K1GA 1VIWA 5G2IA 1YXYA 3WF0A 4Z2HA 5D8ZA 4ILSA 1B90A 4Q6JA 5GJNA 3TQ0A 1JPDX 4I9TA 4JIQA 3H55A 4XUGA 3VNJA 3WQCA 3NURA 1QNSA 5DCBA 3USZA 4HNNA 1PV8A 5JH1A 1GT8A 3GLCA 4IIDA 5TNVA 5FF0A 3LY0A 3H2MA 3CL8A 4R53A 1EJWC 1R3TA 4YPJA 4IGMA 4PUWA 3G0UA 3BLKA 1W54A 1H49A 1OIFA 1A0CA 2H3BA 2J27A 1UOKA 1LWJA 1E5NA 1GG0A 3BQ6A 1WE5A 1QW8A 1GOIA 1R30A 2NT1A 2OT0A 4LS0A 4KRTA 1XLHA 3W6MA 4QNEA 2HXUA 1JZ5A 1MUWA 4C6PA 1GG1A 5DO8A 5EBAA 1RK6A 1FA2A 4H9MA 3PN8A 1X96A 3GFZA 3VIOA 3W22A 5FS7A 3H2CA 3SSJA 4IPNB 5IBXA 4HYRA 1KM2A 4CCDA 1EGZA 3DJGX 1GRGA 4LB4A 3K13A 4IMEA 3MUZ1 1PS9A 2Z2UA 3LBCA 3GFYA 2ZUWA 4ZQOA 4QS5A 1F74A 1UKQA 3SN1A 5LKYA 3GIQA 4JFTA 3ZJ6A 3V16A 4KQNA 4QQ3A 1UPPA 4P8WA 3VOJA 5DN1A 1TTJA 3GG7A 4GNKB 3ZO9A 4F40A 4NAEA 1J8VA 2DJXA 2YDQA 4LV9A 1W5QA 1M3UA 2DZAA 4OV4A 1OM0A 1EJRC 1ZNNA 2E25A 4E2DA 5I06A 4MJ2A 2ZZ6A 2VXNA 5RUBA 1QNVA 3WEZA 3ITVA 1DBTA 3VIJA 2XISA 4CU7A 4FR6A 1RHCA 4CN6A 4M5PA 2NQHA 4GA8A 2FTPA 4HCLA 3NJ3A 3AXIA 4C1KA 1NF0A 3W76A 1EC9A 1J18A 3STGA 1H63A 4LUTB 4C6KA 1VYRA 4WKAA 1FP8A 1VFMA 5HA7A 2YL8A 4BQ3A 3RCYA 1NFGA 1RJPA 5U1OA 1VBHA 2FHBA 3ECQA 2G4FA 3VNLA 1AMYA 3M0YA 2V81A 4JQAA 3M5ZA 4DJFD 1AD4A 4OUEA 2ON3A 3M16A 4FALA 2BGQA 4CNUA 3VKKA 1R3VA 1UD2A 4IUOA 3JS3A 2HWGA 1E1CA 4HOZA 4RR4A 4YXGA 3QMSA 1JF5A 4HQVA 4Q22A 1ICQA 2IKGA 3ZOAA 2QIWA 1B30A 4M56A 1PEZA 1YXDA 3P2VA 4GRTA 1KLYA 5FESA 5J04A 4XQ6A 5I77A 2WOWA 3NNTA 3R79A 4N6FA 4PZVA 5F1VA 4FS9A 3S6TA 1RY0A 4S3JA 4I6KA 5HQMA 5L9FA 3EOLA 4PH6A 3NSNA 4GY7A 4B2DA 5FJRA 1BSIA 2EPKX 3SFWA 2QYGA 2NVDA 3RX4A 1Z3NA 1IT7A 3RG6A 1UIPA 4I6VA 4M8UA 3PPHA 3GIYA 1V02A 3XINA 3KVKA 3AIUA 3CUHA 1HO4A 2AGKA 4XZLX 1OFEA 4KFPA 1VBGA 4S2CA 4K39A 4Z0JA 1C9DA 4IWWA 1UR4A 4PYSA 1ZALA 4Q3MA 2XFFA 1JZ7A 3IUIA 4HK6A 5EMUA 1P0BA 2DP3A 4KWVA 1LUCA 1QBAA 4I8YA 4D8AA 3HQOA 4HGXA 1ZBCA 1K3UA 5K9CA 2XU2A 3WY1A 5FS9A 2QPUA 1Q6OA 3LN3A 3KL0A 3QGVA 2WMFA 4Y8EA 4WDUA 2WHJA 1UZ4A 1BQGA 1GEHA 4O1EA 4S3FA 1JZ8A 1BYBA 3MP3A 4O50A 2VP8A 4B5TA 4UFHA 5JCLA 5HWMA 4PMVA 5A6JA 2PWVA 1FKXA 2QJMA 3APTA 4DJDC 3SN4A 5LIXX 5FJIA 4N0RA 3ZR5A 1RUSA 2G95A 1MNZA 2RGLA 1X39A 1GZJA 4JTUA 8RUCA 5U4NA 3TC6A 3FN9A 2BY1A 4WY0F 4J56A 2VZTA 2EG6A 1HQTA 2ISFA 3FDGA 1RR2A 4GPNA 2CFYA 4QNWA 1XI3A 3O6AA 1X6UA 4GI8A 5KZDA 4MB1A 5I3KA 2B0MA 2C3ZA 1DIDA 5HAOA 3HGJA 3LEPA 4ATWA 3ZZ1A 3TMQA 5EBKA 1GJUA 1XH2A 4HPJA 1UC4A 1J4EA 3DN5A 1K02A 1H4PA 1FY6A 2J8TA 2BY0A 3WSUA 3GU1A 4C60A 1V51A 4C1LA 1LT7A 1XBZA 1OQFA 3M4HA 1YBQB 3EDJA 1XWYA 3O06A 1W9PA 3M0KA 4ATDA 2Y88A 4X0VA 4JNMA 1YQZA 1O6IA 5DF0A 5G4HC 1EPVA 4RLIA 5CKSA 4QAIA 4PCSA 2YDSA 4UTLA 1FWWA 1U1UA 4AD3A 4GJIA 4HTBA 1I2RA 3F5JA 1ZXIC 3LGGA 4C6DA 4PRTA 2VR2A 1UUQA 2ACRA 1ZENA 4UQCA 4E2VA 4JDRA 3VUPA 1OCNA 4M6PA 3U0HA 3W1XA 2DV0A 1DIKA 1FDJA 1MZRA 4NY2A 1KXVA 1SGJA 3UESA 2YPIA 4NI8A 2ZUNA 3TYEA 2X30A 1BFNA 2F84A 1R47A 2XFRA 4MMWA 2UWFA 3ABQA 1XP3A 1LWIA 2ADAA 3QR0A 3WQGA 2J7DA 3STCA 1P4CA 4UBPC 4XD4A 1W3JA 3R89A 4AD4A 1KFEA 4GR1A 4EPDC 4XX6A 3PK7A 4IMDA 3RMJA 2GH5A 3CHVA 4X22A 2Z24A 4IJBA 4AVOA 1W1A1 1ZAIA 3SUUA 4FHAA 1R7AA 4OGZA 2CDUA 1FWGC 3HGSA 3WQ6A 4DI9A 4GQGA 3PJUA 5A8MA 3AS2A 2GDQA 5IDZA 4YJ5A 4RE2A 3WBYA 3GHUA 4HIBA 5DLCA 1W2PA 1C8XA 3I7QA 3LTYA 4XD3A 4X0NA 5DBTA 1UMLA 1V7YA 3FX4A 4AEEA 2CLHA 3M7SA 3BJSA 5JMUA 4JCMA 4LEFA 1JPKA 3P8IA 4O28A 1XLBA 5XIAA 3EBVA 2WXDM 1EQPA 5DFAA 4EQXA 2WMGA 1WQ5A 4WUIA 1DWIM 1VF8A 3MSDA 4H01A 2CXEA 2DW6A 3QQWA 1Z44A 3O63A 4GMEA 2E6FA 3L4YA 2WANA 3D3AA 4ZOHB 1RJQA 4J4KA 2VDIA 1BSLA 3OODA 4JOMA 1CEOA 1JOAA 4RNFA 2YL6A 3DK4A 3A47A 3BG9A 4O0ZA 2HEJA 3A24A 4S23A 5JRBA 4MWAA 3ITGA 2VC5A 3PUDA 3AICA 2YCLA 2XGZA 4AZHA 1JPMA 3T07A 4CQ8A 2DSUA 3M6YA 3LM7A 4RXGA 3A5VA 1PPIA 1TFVA 2P8CA 2WLZA 4GIEA 4IFOA 4WK9A 5K7JA 1ZCOA 2YX0A 3A3HA 2QJJA 4C6EA 1RK5A 3PWIA 9CGTA 3MKKA 1KCXA 3K46A 4IG2B 4L1WA 4TO8A 3XISA 3UA4A 4LYRA 4R34A 1XLCA 2WJDA 3M1ZA 4BS0A 1YHTA 2WCGA 4M6UA 1JXJA 4FO4A 1DTNA 3CUJA 3O8AA 4A8IA 1JAKA 3VCNA 1UIOA 4NHVA 3VGBA 3N12A 3W1MA 3VNDA 3JVAA 3THDA 3AIQA 2BY3A 3GC5A 3V5CA 4LY8A 4WOZA 5FJOA 4QM1A 3AIBA 1E9YB 2F6KA 4LAUA 3UWZA 3PUGA 1H0IA 4MZ1A 4FF5A 2O4QA 2TAAA 4C1NB 1U5JA 1PE1A 4L4LA 4CQCA 4MKSA 3DENA 4FAMA 1J5SA 3EOEA 3EWDA 1VFOA 1SFLA 4FXSA 1IXQA 1AZ1A 4P8UA 1TQXA 1IXOA 2XH2A 1MI3A 1F3EA 3TQVA 4ML4A 5ABHA 3N6QA 1XGDA 3QY7A 3MO7A 4H2HA 5D9OA 1T40A 4H50A 4GINA 4OVXA 4XISA 4LUTA 1SZRA 5K4XA 1TCDA 3P61A 4E38A 1Z32X 5A6KA 2YZRA 1EX5A 2CLEA 5A8OA 3LLXA 4CEUC 2PWGA 4IXXA 3GTNA 5I00A 3S4TA 2NWRA 4UQ9A 4ERIA 4HMEA 4XZBA 4XAFA 2HQAA 4Y96A 1FCQA 2ZBTA 3AMZA 1TVLA 4PSPA 4GYKA 3ABRA 3UCDA 4BI7A 5D2VA 6ENLA 1W37A 4J5NA 4W7WA 3H6OA 1GVIA 4HPNA 2DT1A 4IFKB 2V3BA 2I16A 2JGYA 3TW7A 3CQIA 4CNSA 2FGLA 1QOQA 1TTQA 3P80A 1RLCL 3T09A 3SCTA 3BZGA 4JTDA 1EP3A 2WJEA 4MDOA 3IK2A 1TPUA 9XIMA 1R3YA 3W7QA 1N61C 2V82A 3UNTA 1V4YA 4DXXA 3G5EA 2OZ3A 4GACA 2BOFX 1JCJA 3E2SA 3GNNA 1WBJA 5JBFA 3MDUA 4UC5A 1QOPA 3WJWA 3W82A 5LIYX 3T78A 3SO7A 3E9AA 3SDOA 1PO9A 4F0SA 1RP9A 2C3CA 2R94A 1ADSA 2V5JA 3EDKA 3PFRA 3BG3A 4HZ7A 1V59A 4CNNA 4A6GA 1DNCA 2OG9A 2Q02A 5CLWA 4LYPA 5BWAA 4QDWA 4DO4A 4QROA 4GXPA 3AQUA 3L65A 5E6YA 3RRXA 3W7CA 1A5NC 4Q8TA 1HGYA 1QPOA 2V8ZA 3WNPA 3BG5A 1BLIA 4H1ZA 1M53A 1RJRA 3LENA 3L5OA 4NP7A 3OYXA 3FS2A 1SFJA 4CQ9A 4PUKA 3A3XA 3G1YA 5LYRA 2DY3A 3B0YA 1Q45A 1EX1A 3P62A 3MT1A 1RVGA 3N9SA 1Z42A 3TDFA 5FIPA 3LMZA 3EX6A 2A2IA 2WK2A 3VDBA 1GVEA 3L8KA 3M0VA 1JCTA 4WJ8A 4LJ3A 1SJDA 1ZBKA 4C7FA 1UC5A 1KWKA 4AC7C 3OJGA 2XH0A 1FCUA 2XN2A 4UR7A 5JCKA 1PHQA 1CCWB 3ICJA 3MV11 1ZP3A 1E43A 1YMYA 2H90A 4H2CA 4M81A 4H4WA 1TPH1 3TYBA 3MSRA 1LQAA 4RDWA 2BXZA 1JRBA 1R7OA 2GJPA 3W9ZA 5E0FA 2EJ1A 3WQ5A 4UFMA 1WOAA 1KCLA 2G41A 2ZADA 3GG8A 3TJ4A 1TWZA 4Q8OA 4HNVA 4XIMA 4MIMA 3I3DA 1TSIA 2QNEA 2ODOA 3S5YA 1MDRA 2ZUMA 5LIKX 4HNTA 4H6RA 4O12A 3QPEA 3QN3A 4OUIA 3ARPA 4JAWA 4S3EA 3TN6A 1YTDA 1GJPA 1TV4A 3I3BA 1XD1A 1KB3A 2WHKA 2JGQA 3G1FA 1T8XA 1P6BA 2Y7DA 5LIWX 4O11A 4GJ1A 4HU8A 5A8QA 3KLJA 1VPYA 5HNTA 2NW0A 1PX4A 7CGTA 2I9UA 1DJQA 1B4EA 5A8PA 1DJHA 4DWSD 5EFDA 4IT1A 1JF6A 2AQWA 2CWXA 1ZGDA 4KWOA 2QIIA 1CLXA 1PIIA 3T40A 1IZJA 4OQVA 3S47A 2CBIA 1E4LA 1D7KA 4UMCA 4JIHA 3FXGA 3QRHA 1Q1WA 4JTIA 1F05A 3HQ1A 2VEMA 4O13A 2V63A 2ZZ0A 4O52A 2ZX7A 3RJYA 1N82A 3W1PA 2E5CA 3IAPA 1M1BA 1QFEA 3GKAA 3BOLA 2GWNA 4DZAA 3HG2A 3HG3A 3GNPA 4RDZA 3VGFA 1XUZA 4QSFA 2EPMX 5I23A 2CCRA 3QTPA 5BRQA 1PBGA 3Q4DA 4HNCA 2HCVA 2BVWA 4N9EA 4AXKA 3N73A 1DJXA 4EAYA 5D30A 2A3CA 3DK9A 4R7OA 1XDJA 3DC8A 1O68A 1RCOB 2O0TA 3TN5A 1H7XA 1WKYA 3A12A 3A6OA 4L64A 4AF0B 3LRMA 3NG3A 3MCOA 3U5YA 4KWUA 1KBIA 4C6CA 3ARUA 5DMMA 3W74A 5TF0A 1EF2A 4H4PA 1J0HA 3PANA 5C2GA 1B3YA 4AWSA 1JDAA 1E3XA 2XINA 4CD6A 4K37A 8A3HA 4GQ0A 4HHHA 1L6SA 1MW2A 3KX6A 4EPKA 6PTDA 3G1SA 4QFUA 1H7NA 4US6A 4W87A 2C15A 4TR9A 3B0UX 4IP7A 1M01A 3NSMA 3PTQA 3WQEA 1J0IA 3NPWA 2BHZA 3VM7A 1E3ZA 2CKSA 3LSBA 2IQTA 5F2MA 4M82A 4DBSA 4EX4A 2UV8G 4Q33A 5AYYA 1XLEA 1YYAA 3TTOA 3G2GA 4PRRA 3TYUA 4LUJA 5K9DA 1W1ZA 5IDIA 3MS8A 1HKJA 4A8NA 1RVKA 1WDWA 2C16A 1DOSA 1W8SA 1KGWA 3PF3A 3VZXA 2YFOA 3KOYA 4AZIA 3CZLA 1CGUA 2ZRVA 3VC5A 3T4WA 1T96A 1GOMA 4OTKA 5D38A 3CV7A 1LG2A 4PTDA 5JIWA 4HMCA 5HINA 1XKJA 3R5EA 3LHZA 4FOUA 1T0OA 1NHPA 4HCDA 2PTWA 3UWWA 2OCZA 1B1YA 2P53A 4EXAA 1V3LA 1F7BA 4JGDA 4MKVA 3DBNA 1C92A 3EB2A 2AAAA 3QF0A 4PB3A 3SJ3A 1I1WA 4IX0A 1QBBA 3LHWA 2EBNA 3W2LA 2WPBA 1GREA 3CZEA 3IVUA 2ISVA 1OFQA 3ARTA 4B5VA 5FJUA 5CGMA 3NQ7A 4L5ZA 1IV8A 1LOLA 3EPNA 1IEQA 4U5KA 4A4AA 3R7MA 2AQOA 2E67A 2W61A 4IGHA 2A1YA 1E0WA 2QW5A 3GC4A 3UXDA 1QWGA 4POCA 3TMLA 1HW6A 1TPFA 1ZRQA 2NVKX 2QMKA 5IRPA 1UZDA 4DYKA 3KAOA 3B0PA 2YVJA 1WXYA 3QV8A 3L67A 5DT5A 3ITLA 1DXFA 3QXBA 3TAOA 3DDMA 1TELA 1UA3A 1K4GA 1A80A 4NASA 3QR1A 3CQJA 3ZT6A 1Q6LA 3O16A 2WKGA 2WV8A 1BPLB 4QE1A 1JFXA 1EYWA 4N02A 1Q7QA 3YPIA 4M7SA 4H4XA 1H41A 4H9TA 1XIFA 3BSGA 4RNJA 1MVYA 4LCSA 3AAMA 1KFJA 3SQLA 2WNNA 1I9CB 2C1IA 4FNSA 3TX9A 1UH4A 3LBMA 1FRBA 1FX6A 3SURA 2WHMA 2G3NA 3KOFA 3P5ZA 2H9AB 4P8VA 4NAEB 2X42A 3HJZA 4ZOBA 3WLNA 1C7TA 3CMJA 4KCVA 4GG9A 1JI1A 2E5DA 3Q67A 4HSOA 4HPGA 4PMZA 5EMJA 4IQDA 5C6MA 4IMAA 3T81A 1ZY9A 4WSJA 3PJTA 4DLFA 2WM0A 1OFBA 3GRTA 1W3TA 4LV4A 1I4NA 3WMLA 3AMDA 1KXHA 1BYDA 2VHLA 3WFAA 3HG5A 3A4WA 4D8LA 3OPSA 1JULA 3F5KA 1DE5A 1FXQA 4XTIA 3N04A 2E40A 4Z1AA 1HO1A 3AXKA 4FSAA 3F4CA 3RXZA 4I7UA 3ES7A 4QCFA 2ZZ1A 1Q2RA 3IV8A 1G4TA 1A5UA 1YPXA 2QS8A 3UJ2A 3UYCA 3UWEA 1KR1A 3THUA 1EJTC 4EAMA 1KRAC 1JCXA 3QHMA 1KBLA 1Y65A 5GJMA 3S6DA 1V3MA 3K30A 1GQNA 2WMHA 3PPGA 5LSMA 4LF1A 4HP5A 3WFZA 4GABA 3MSYA 3W1QA 1TV2A 5I3FA 4M3PA 3L5LA 3S5ZA 2R6OA 4PRWA 1WKDA 2YDAA 1V3IA 2RDUA 3ZVHA 3G1AA 2QCHA 1PKNA 1K8CA 4GI6A 3L12A 2J9YA 1MUCA 3K5XA 3LLDA 3E49A 3W72A 1FDYA 4DNMA 2F2HA 4I7VA 3TONA 2WOIA 1SW0A 2AMXA 3VO0A 4PUNA 3KFTA 2TYSA 3FA5A 1K4HA 5BU6A 2VUNA 1OFPA 1E6NA 4FA3A 1UMYA 2ICSA 5ABEA 1ICSA 3C2EA 4QG6A 2ATMA 2DH2A 4FR1A 1ISVA 3BE7A 3AWNA 4GXMA 1YNYA 5J5RA 1GYMA 1R85A 5HUPA 4IFRA 4PA8A 1JYWA 3BCDA 3QZEA 4RDYA 4JL1A 3CT2A 3B4UA 3ZXWA 2GR0A 5JUVA 3GR8A 3IPWA 4QSHA 3W7GA 1C90A 1EC7A 2Z1BA 1MRQA 3BTNA 3L0NA 1V6XA 2GQ8A 5HATA 4FEZA 2VEFA 3LXAA 3LPFA 3H21A 1EOKA 4O16A 2JE8A 3SRKA 2DZWA 1LWHA 3WELA 3W7LA 4US5D 4IIFA 2OWCA 4URIA 1MW3A 1QO5A 1OX6A 3QFEA 3EMCA 5KETA 3N6HA 3IGUA 4QS6A 1VQTA 3NVZB 3LUTA 4OBSA 1GVRA 1ISWA 3VNYA 5M1TA 2VM8A 1G69A 3HPZA 2IUZA 2V5LA 1SQ7A 2NVAA 3CWNA 1LRNA 4O19A 4LEQA 5A6TC 4R7WA 5CC5A 2R9RA 2CW6A 1EJXC 1B9ZA 4AIUA 4CCCA 1F8IA 5DMLA 4BF9A 2QGHA 3T44A 2I14A 1HIZA 2B7NA 3L21A 2AQVA 3SY1A 2WQPA 2WPGA 3W53A 2CIPA 5AECA 2C8NA 1U33A 1P1MA 2OODA 4M6VA 3KBNA 2J6XA 1JEHA 4PMRA 1NFBA 2OELA 3RCMA 1NEYA 5A6MA 4AHQA 4YCOA 5I24A 3EWCA 2PDPA 3W07A 2E9MA 1HKWA 3BW4A 3GNDA 2XVPA 1WXJA 2CETA 4ROQA 4M1RA 3NS1B 1X1NA 1HTIA 3W1TA 3FYPA 3TJLA 7XIMA 3R07C 4DBDA 4E8GA 1RPKA 3UG3A 3FIGA 2XHYA 1BG4A 4I9AA 2C13A 1S1RA 1WDDA 3JW7A 4WVXA 4AZ6A 1P0EA 1A5BA 1XSIA 2PA6A 1DYSA 4U28A 4L6OA 1TA3B 1QJWA 5CZ0A 1PUDA 1WZAA 1TV3A 4JTFA 3OW1A 3QW3A 4U10A 3O7UA 2A85A 3LXBA 5H8MA 2OKOA 1STZA 3QZAA 1YDVA 4UTTC 1OCJA 5C70A 1W6TA 2WB5A 3SM0A 1ZZMA 3MY9A 3WK2A 2EQDA 4W9TA 1TWIA 3ZJ7A 3O6YX 3OQ8A 1LBMA 3MUAA 1ME8A 4KETA 5JQ9A 4ICCX 1R6WA 1MNSA 3W25A 3OLDA 4LXFA 2YCLB 4K7YA 3PAJA 3N4FA 3B9AA 3CB3A 4OIFA 4Q7NA 4FPSA 4IM4A 1R0MA 2ACSA 1FP9A 2ZZ4A 4BK9A 1CGWA 1F73A 1T5AA 3WCZA 5JCMA 1CENA 2YL9A 4UFIA 2PDMA 3MVTA 4LNYA 1JNEA 4W8BA 1V02E 2EPNA 1PWMA 4YU1A 1UZHA 1QW7A 2YCJA 3G1XA 1TX0A 1SB3B 3RX2A 1H5VA 1IGSA 2J74A 1ENUA 2DH3A 2FJKA 3KOXA 1LLOA 1I8JA 1Q4WA 1XISA 3S5SA 3OBEA 2E1WA 5BXTA 4PFHA 2BLEA 2BP1A 2MUCA 2BGSA 1AW5A 4C91A 1MUMA 4HYVA 4WX2A 1NPXA 5HOSA 1N2VA 4ZO6A 3NYZA 5JU6A 3AN1A 4DJEC 2OEKA 2WVVA 2GDVA 2FH6A 3AOFA 4PMUA 3POHA 5CZJA 3RJXA 3O0FA 1RZMA 2DZTA 4WXYA 3L9CA 1K6AA 1TVPA 3EA1A 3GDMA 2W0UA 2YLLA 7TAAA 1H2JA 2FVMA 3CEUA 1EEPA 1KV5A 3A5FA 4DI8A 3P84A 2XFYA 4FDCB 2GJLA 4LGXA 4RX0A 1VEMA 3LQLA 2FTWA 3NPVA 4GI4A 2WSKA 1EJUC 4UCFA 2E77A 2B7QA 1F6YA 4Q8UA 1R2RA 2GGGA 4R33A 3GSMA 3L2MA 3D47A 1L2QA 3W6LA 4R85A 1KBKA 4IPIA 1S2AA 3QFBA 2Z7GA 1QI4A 4G6CA 5I02A 1DHPA 3KLKA 4GCXA 3WDJA 3OGRA 2DIEA 3NQAA 4MUZA 5I6SA 2BVTA 3SUTA 3FJNA 2Y85A 5AZ0A 4IJCA 1VLIA 4OT7A 2Z1SA 2ZWZA 3URNA 3EDFA 2Y70A 5HMFA 5HMDA 2ZA2A 1EP1A 2QT3A 3IJ9A 1EA0A 4GVGA 3TU9A 3VKDA 2PURA 4LS2A 1N5XA 5D2YA 4A2RA 2OU4A 5DANA 2ZXQA 1HGWA 1IIGA 1WXZA 2BXYA 1IR1A 3L7RA 3LB0A 4JTCA 3E0LA 4PMJA 1BWCA 1EZWA 2CLPA 4YHGA 3C2VA 4NXSA 1Y0EA 2YJQA 3ARYA 3WDIA 2NWSA 1AH3A 3UA3A 1JRCA 3P0WA 4GZIA 4GFSA 3XIMA 2YYUA 3EWUA 1NHRA 1TUFA 3VD7A 3T6CA 3UFYA 3VX1A 4IX2A 4PC8A 3NRZB 1ISXA 1QI0A 3VKAA 5PTDA 3HB9A 3QPZA 3W1AA 5KTLA 3WKZA 1KNWA 3MMUA 5H6HA 4P7OA 1LG1A 1QATA 1OABA 3CNYA 1FFUC 4UUIA 3WQOA 1X6LA 4EXQA 5IOBA 1Q2SA 4NIRA 1R9XA 1O7AA 1U2YA 2TMDA 4WRHA 4H9YA 1GYLA 3V5FA 4GC4A 4DWSB 1XM3A 1IEXA 3RNDA 1NWRA 3M0LA 4L1XA 2OYLA 3KE0A 4V28A 4GQBA 1Z48A 2E7FA 2ZVRA 2QV5A 3C0SA 3C8FA 1JI2A 2JQXA 3R12A 3ZLFA 4YWOA 1MW0A 1MFUA 2IS7A 4EKJA 1VZWA 3BLIA 1A5KC 3DX5A 2B7OA 1A49A 1TWDA 1KV8A 5A3HA 4FLSA 3WX7A 4H7CA 1UA7A 3SBFA 2C0HA 3S2CA 1XC4A 3NZ1A 1P43A 3U8GA 3QMTA 1CLKA 1PAMA 4AYGA 2Y8VA 2PDXA 1E6XM 2NQZA 4EM4A 3H54A 1TWSA 4HSNA 4RL3A 2F7FA 3WF3A 2NSXA 1XGEA 1J79A 3WNOA 4EXBA 3CUFA 3CQHA 1M04A 3ITOA 2R9ZA 1J9YA 3VKBA 1THFD 4HA1A 1GCYA 1R86A 2E68A 3B8VA 5FD0A 1J5TA 2FYMA 3GX9A 3AU2A 3DECA 1L8NA 3MHUA 3RAOA 1K9TA 4DZIA 1FWSA 1QNQA 3WO8A 3W37A 3DFTA 3AXMA 5EGRA 5A5WA 3BH4A 4K3ZA 2O7QA 1QI2A 1G67A 1EXPA 1QK0A 5HJYA 1EJSC 4J57A 1W5PA 3MP4A 2ZYFA 4S3BA 4MPQA 3S2JA 1DWFM 4HPXA 2WP6A 1ITCA 1PDZA 3L66A 3GK0A 3HPAA 4LVDA 3K2GA 4X61A 1LOSA 3IJDA 3O6DA 1W5NA 3BAKA 2F6UA 2P8BA 1KBBA 3H53A 4UOZA 1BF6A 3WF2A 4TMCA 3C3NA 4I5XA 2VEGA 2R1MA 1TPWA 6XIMA 2VR4A 1OGGA 3WUGA 4AZCA 3DKLA 3V0UA 4GO9A 2FVLA 2OZTA 4QXIA 2QCDB 1OFOA 1H5YA 5FEWA 3SCVA 4O18A 3FKRA 1Q6RA 3VE7A 4WZHA 3E0IA 4WJEA 4UTWC 1EDGA 4JYDA 3KUMA 3WBWA 4EPEC 4XZNX 4QE4A 3DIPA 4NILA 2ZRUA 2P1FA 4UOJA 5IFTA 5G1YA 5HQEA 3S1GA 3VK5A 5EY5A 1B5TA 3PBMA 1D9EA 2FFIA 5C9RA 4J3XA 3NL5A 2RH9A 1K6WA 4NJJA 3VIFA 3E0WA 4TIMA 3PJWA 4EWJA 2V6OA 2VFEA 3TC3A 1J0ZA 1DEDA 2QUMA 2C3DA 4ALDA 4WHBA 2Q6ZA 1OIMA 1W8GA 4B5WA 3EA2A 1R5YA 4H9UA 2QJHA 6REQA 3C86A 4LX4A 4GNVA 3TXZA 2A79A 3M46A 4V2XA 1HVXA 5HR6A 3NDZA 1IWBA 1IT0A 4BEQA 2EF9A 1S2TA 1D8CA 1PJ9A 1U1HA 1Q6FA 5CGQA 3KBMA 1UWIA 4IG2A 4B16A 1EIBA 3VX0A 3VVGA 1F9CA 3AUJA 3ZJ8A 4UFKA 3HMJG 3NFUA 3EYPA 3AS0A 4UR9A 3WJSA 3POCA 1KTCA 3MPGA 2XM1A 1GHSA 1ZHAA 3U5UA 2D3LA 2AOSA 3OVPA 3NSXA 2NUWA 3LCXA 3VUSA 2ACUA 4UQBA 3ANYA 3NO1A 3ZVIA 1UUMA 1AFSA 4X63A 3BDKA 2IPJA 1UJPA 3FDKA 4H00A 3PHAA 1OC7A 4PB4A 5FF2A 4KEUA 3OYZA 2V67A 1VFHA 3C2FA 3ZM8A 4XG1A 3H12A 4EF8A 4QJ4B 7ENLA 3MC5A 1Y7VA 1XFCA 2RGMA 2V5KA 4CQBA 2XIBA 5A6SA 4GUFA 3UERA 4ZTXA 5EB8A 1NDWA 3KHDA 2HBVA 1EIXA 1SJCA 4UTUA 1VYPX 2I57A 1QW9A 1XLKA 4TVDA 3AISA 2PDBA 3PC0A 2GDUA 2J8GA 3PZUA 4L7ZA 3D0CA 1F5ZA 4I9MA 3V1PA 1GVOA 5MKGA 3DHDA 2VDGA 2RKXA 5CGTA 2PZ0A 3W1NA 2PC4A 3W2KA 5LNUA 2FFCA 1K9EA 4JIEA 4JN7A 3UY8A 1W17A 3M7WA 3IVTA 2WJZA 1HJWA 2J6VA 2GRTA 1SZEA 1M7OA 4BWLA 1G0CA 4ZO9A 2VX6A 2HXTA 3NQBA 1REQA 3B0XA 3DFYA 1CXFA 1R2SA 4NG3A 3F2CA 1C3FA 3GB6A 1W1PA 3R94A 1E0TA 4RE3A 4ZA0A 1UP2A 2X16A 3W75A 2G50A 2FZDA 1O94A 4YTQA 3B8DA 2F5ZA 4W5ZA 3TJXA 2GOKA 2ZXDA 4L9YA 1UD3A 4KH2A 1CGVA 3FKKA 2O9RA 2X1TA 3AIWA 2QKFA 4MNMA 3TTEA 4NJGA 1NHQA 2WC3A 5G5IA 4GIYA 1ZP4A 2V2DA 4YTTA 7A3HA 1VAHA 5LNVA 1J93A 4DPQA 4DNAA 3FV9A 2EQ7A 5SWUA 4NEVA 3BZJA 4P5UA 1Y5VA 1WDSA 3AZRA 2GQWA 1EGMA 4LYQA 3NUKA 3VD5A 3T0BA 1DXIA 4ZCWA 2E3ZA 1KM0A 3FYOA 3LDVA 3GG0A 1GWJA 4KEZA 3A7AA 3TCSA 2Q3RA 2QCLA 2FKPA 5CC6A 1KFLA 4B4HA 1FXPA 3KCOA 1SO4A 1I75A 3QYSA 4AB4A 2W4XA 3IGSA 1TREA 4C65A 1UWSA 2BY2A 3LCWA 3OG3A 4PCNA 3ZJKA 3UXKA 4ZB5A 1AQ0A 4JNYA 3AC0A 1W9DM 2GL5A 3DUGA 4V33A 4DJFA 4OKDA 2ZDRA 1LYXA 4JD4A 1SZNA 1FHLA 5FF7A 5K3VA 2VR5A 2WNQA 2HVMA 5HNNA 1H11A 3WFLA 3AYSA 2OYMA 2Y5SA 5IXEA 5EKYA 4ZE5A 2BB0A 2OWXA 1A3HA 3DYPA 4HZ6A 3CLWA 1H7WA 1K1DA 3EOUA 1BHGA 3TA6A 4MOZA 3UR2A 3NQFA 3INPA 3SFKA 1XDMA 5HDRA 3G18A 1BAGA 3C6CA 1RY8A 1LL6A 4L9XA 5BNKA 1XYFA 2D69A 4MB3A 4JQ9A 4PMQA 2GGEA 3W4RA 4GGHA 2HDJA 3P82A 4MAZA 3G1RA 1VHNA 2V3EA 3R8GA 2CLFA 4Q4PA 4MYXA 2YCKX 4WDXA 3AU6A 3L5AA 1A5CA 1JEZA 3AMKA 3HPSA 3PULA 5KZMA 4NZ3A 1J01A 1HKKA 1KFBA 1ZS2A 1WZLA 3NVTA 4PCTA 3NQDA 1SYTA 3M5XA 1K9FA 1ZJAA 2QLYA 1FQ0A 3L4WA 1ML1A 3BLDA 3HOJA 4NNAA 1TRDA 1WX0A 1DWGM 2OQLA 3IEBA 1WAWA 3IGXA 4ZB2A 2AAMA 3PZIA 3BGAA 1CXKA 1UD5A 2NX9A 1VBRA 3NXLA 2BOEX 5BOOA 1H09A 1W3LA 4AY8A 4DEFA 3BARA 4BZYA 2W66A 3UD6A 2IMRA 3GVVA 1ZJBA 2UY2A 4J27A 1VPQA 3OLEA 3KRZA 1PZ0A 1VHCA 4F2UA 1JYNA 1XRSA 3TNBA 5FEXA 1DXLA 2XG9A 2A6NA 5U7SA 2GJXA 1EHAA 3C0LA 2O7SA 1FBAA 4KIEA 2J7GA 3KM8A 4XSLA 1YTKA 3I4KA 1DQUA 3CXBA 1VP5A 4Q4QA 3DYMA 1OT2A 3VABA 3MANA 4BF5A 1UWTA 2VRKA 3U48A 3HN3A 3U3HA 2PDGA 1V77A 2VEIA 1Z41A 4QITA 3G6LA 4GH1A 4MTVA 4WDTA 1LROA 3V36A 1WPCA 1IIHA 2XSBA 5LNRA 1I0BA 3ARRA 1VPXA 4I3GA 1PYFA 4C6IA 1M6IA 2V3AA 2G97A 3NXFA 3ZT7A 1AH0A 4OWGA 5CH9A 3ANVA 2FQIA 1MQQA 2FIQA 2NX1A 4B91A 3BCFA 2OSYA 3UYIA 3UJSA 3W7PA 1YNPA 4AW7A 2BX7A 3IJ8A 1XBYA 1V8EA 4N9BA 4LF2A 4GYJA 3TVAA 3TTSA 3DU0A 4HA0A 4B9YA 1NDAA 3WMBA 4DBUA 4LY4A 1FHDA 2WWDA 1OK4A 2E0PA 2IW0A 3HO8A 2OFJA 4AYSA 3NCOA 1GTHA 1EO5A 3C56A 4QE5A 3ZT5A 2FPYA 1ZCCA 3C2OA 3QHOA 1XQLA 3OLIA 1VCGA 1C8YA 4GUJA 2WSYA 1F76A 2OR2A 2ZA1A 1L6GA 3WDHA 1RA0A 2OX4A 3KZSA 1HF6A 3NVWB 5A8GA 3EUB3 2DQWA 1H50A 2VENA 1LVLA 1VFFA 4XK2A 3IARA 1R9ZA 1FFRA 1P7TB 2GK1B 1UR3M 3WBAA 4CNOA 3OB8A 1GPWA 4MAVA 2BCPA 1SSGA 3F4WA 4DJEA 4RZ4A 5F1UA 3GY1A 4CN4A 2Z1XA 1A5LC 1JUKA 2I5QA 1R2TA 4A8RA 4LWWA 5E6ZA 4XWUA 2V3DA 3PSWA 3U6WA 2ZVIA 4HHLA 3ZSSA 3LPPA 1VENA 3MSGA 4DO5A 1SVDA 2HROA 3STFA 4E2OA 1YQ2A 2IKIA 2XIMA 9XIAA 4FNRA 4OJYA 5A6AA 4PGLA 3PB0A 3VD3A 2O9TA 2YA1A 3TSMA 1MWOA 3EA3A 3E6EA 3PNUA 1LL4A 4O1DA 2Z26A 4FOJA 1WYIA 5AY7A 4W7VA 1DIOA 3PS7A 2DQXA 1SUXA 3UWVA 2PU0A 1YNQA 2OO0A 2ESCA 1HL8A 2E9BA 3KHJA 2P5NA 3VINA 3GUWA 2Z0IA 4AG0A 1FCBA 2NV1A 3S2LA 2FH8A 3T05A 1EL3A 3M0XA 3N9RA 3DGZA 2CZVA 4MY9A 3VCCA 3C61A 1M7JA 3LXDA 2Q01A 2QJGA 3DH7A 3APGA 1RH9A 1Q3NA 1E9ZB 4IIEA 3A7RA 1CLVA 1GNXA 3OIXA 3B40A 2X0YA 3R13A 4ICMA 5HANA 1W31A 2WZIA 3BMXA 1PXGA 4U3CA 3KBVA 3CUZA 2WM1A 2QJIA 1P0NA 3C52A 1T41A 2RAGA 2P10A 4M1BA 1V0KA 3NOEA 1KC7A 2G3JA 2GR3A 1U83A 2Z25A 3F03K 1BF2A 1PX3A 2QCDA 2Y7GA 1UCWA 4F0RA 4LCRA 3BICA 3BOFA 2R82A 3AIRA 5G2WA 1F2JA 5AFDA 4S1FA 4XTDA 3LSCA 4NAFA 2C0AA 1OYAA 2PDYA 4OE7A 3IIVA 3CV6A 5D04C 2J66A 4X2RA 1PB0A 2WOQA 4REQA 1W1B1 4GO8A 2BFGA 1XRVA 3VCRA 1TR9A 4WF7A 3KOZA 1FHUA 2ZX6A 5D03A 2FMNA 1N8FA 5CPQA 4QLKA 3NDYA 3SEPA 3EKLA 5CQ1A 3TTYA 3FEMA 3ABOA 2O56A 3CZJA 1HKMA 4CQDA 1SU5A 2AKMA 1CGYA 5E5CA 4AZGA 4R3UA 1B57A 1BVNP 3DH9A 2PRMA 1IQ8A 2J8FA 3AMGA 4PEEA 3B06A 1OADA 4N7QA 3S8HA 1LF1A 2ZRWA 4K8GA 4NRRA 3VKJA 3DBPA 3GG1A 2CWNA 4L4MA 4NU7A 1HUVA 3QH2A 1W3IA 4IL0A 4L9ZA 3CV2A 4HNUA 3GVQA 1QTWA 4FXFA 1GRTA 3PPFA 3T2OA 2EG7A 1VEPA 2PWEA 3TZNA 4B92A 3L2IA 5T8GA 3PZGA 3W38A 1H62A 1RM6B 1P0DA 5KSWA 4AC1X 1IF2A 1YX1A 3GHRA 5I3IA 2E5AA 3WBXA 1ONFA 4MJ4A 4R9XA 1WKEA 3N2OA 1ZBVA 1R38A 4RE4A 4DJED 4Q32A 3B8TA 3FG2P 1UJQA 3F4VA 3C2RA 5A69A 3UJFA 3P93A 4US5A 2VX4A 1OGBA 2Y0FA 3UPMA 2X05A 4LC6A 2C71A 4K7ZA 2WZEA 1QU4A 1ECQA 3SB0A 5G5HB 4DJDD 4ORMA 4UTHA 3H4GA 4LALA 1MRAA 4DIAA 2QCFA 2VGBA 1T3QC 3GM8A 3W7RA 2V3GA 3F4DA 1WNOA 2GVJA 3IRSA 5J8LA 5TBOA 1O5KA 1XC6A 5LHEA 3THAA 2PWHA 5BXRA 1A47A 2VQTA 3WQDA 4ZQPA 2O9PA 4NL1A 3W1UA 3T2QA 2V5CA 3WQ4A 1Z7AA 2I7GA 3THCA 3ATZA 4ZSTA 1XUUA 3F2BA 4W8LA 4IIGA 4XD6A 3N4AA 1ITUA 5FJTA 3GRIA 3PZVA 5BOFA 2V3FA 5M17A 4ZE4A 3ZQ9A 1F61A 1GONA 1I2QA 2PTZA 1LPFA 3KCLA 5C71A 4G7FA 2NQ9A 4I8DA 3FJ4A 1ODZA 2D73A 3ALGA 4JTJA 3E2QA 3CMFA 2QCGA 5GQBA 1EJVC 5AHMA 1O5XA 2NXHA 1J10A 2IPGA 1YLVA 1D3CA 3BO9A 4X3ZA 1T99A 4GIAA 1WA3A 3DFSA 3CQKA 4Y9AA 4GFIA 1D7FA 4L61A 3MW7A 2PPGA 4AIOA 3HQPA 3VOIA 3WL0A 2P3ZA 2WQDA 3PY2A 4H8UA 2YB1A 4MG4A 3WLHA 1XW8A 1JUBA 4QBXA 4U31A 4L6DA 3K1GA 2YZ5A 1LOQA 1XH0A 1ICPA 3CUIA 2PLMA 5AN7A 3LTSA 4AISA 4QP0A 4EACA 3WEMA 5FACA 3ERPA 3QC3A 2INEA 3TE9A 2DSVA 3VOGA 5K4ZA 4A2SA 1IZKA 1EF3A 4ZOCA 3SQSA 3GTHA 1R3RA 3LADA 4HB7A 3DHUA 1W1VA 2ZKMX 1CT5A 1YBQA 2GZXA 1V0NA 3NGFA 3B8UA 3R58A 2WMIB 3I10A 1NP0A 3Q58A 1HJXA 1UW9A 2QDDA 1FEBA 2CPUA 4L4PA 3NVDA 3QLDA 3GVRA 4ZGYA 2Y2WA 1UP0A 1XH1A 4IIHA 4FZIA 3OVQA 1JPHA 3SN0A 3W0KA 2PFHA 4OBRA 4RKAA 3VDAA 1K7EA 1S3TC 3BVJA 2X99A 1XS2A 5D32A 3B8WA 2D23A 2P0IA 2GVGA 2XGIA 4PMNA 4J28A 2WSPA 3QGKC 2Q8LA 2CESA 5HR7A 4PBEA 1JGIA 4J3SA 1KXTA 4DUVA 1UD8A 2VFIA 2E3TA 4NZ4A 1EBDA 1Q6EA 4HA3A 4JQ3A 1V79A 3TLLA 3GXTA 2XUCA 3UZJA 3IWPA 5M2FX 1E5JA 1VGAA 3A23A 4BQ2A 1F6KA 1D2KA 1OY0A 2D2GA 1AJ0A 2WAGA 4A29A 2X8CA 2INFA 1TTIA 3W7IA 2INZA 3I7SA 2XM2A 5BW6A 2PDHA 3EX3A 3QHNA 4QR6A 1X2GA 3BMWA 2DDXA 4Q8QA 3FSUA 5C9ZA 3W29A 3GR7A 1F07A 1W0MA 4GZJA 1TG7A 4Q7BA 3NVYB 2Z2AA 4P7LA 4HOWA 2J7EA 4Q4RA 4UTWA 1GEQA 3CH0A 4M19A 1YEYA 3G3DA 3KCJA 2YXXA 1VFTA 3BSMA 5BCAA 4KBXA 3COTA 2PMQA 3R43A 1MXSA 2W9MA 4HSHA 2XIQA 2FPVA 1GKQA 2JEPA 3AHZA 3O0KA 3SADA 3JU2A 1TYGA 3BAJA 3T2PA 4XB3A 5HPOA 1CWYA 4WQ6A 8CGTA 3AWOA 3H4KA 4W8AA 1TA3A 1AMKA 3CU2A 1W9UA 4H9XA 4D6DA 4ZENA 2WSQA 1KM1A 1Z8AA 3T0DA 2GQ9A 2FPTA 2BDQA 1ZL1A 2WC7A 4DAIA 1SO3A 3RR4A 3LRLA 4Q4OA 4LUIA 3ANUA 3SCSA 1X7FA 3ZSTA 3TIMA 1NDVA 3E0VA 5CSSA 3TKFA 1BWLA 3L4ZA 4YVVA 4G1NA 3GVWA 2PS2A 3O0HA 1E1CB 4LUSA 1QK2A 3LRKA 3FYYA 2LLEA 1PKMA 4A35A 4EF9A 2ZX9A 3BURA 1EGVA 2BVDA 3UG5A 4NXKA 3GBEA 1E0UA 5HPCA 2VL4A 4BHYA 1DTUA 1TMLA 4YHEA 3LG3A 3QR3A 4A22A 2P76A 4ZSUA 4DNHA 1OD0A 4O1FA 3B04A 3S83A 1XV8A 4XV0A 3RPTA 2DSZA 2KAUC 5F2IA 1N63C 5D09A 2QUVA 3SCWA 3TK7A 1IT8A 2WMIA 2XIOA 1CGXA 2DZXA 4IQJA 5DRCA 4Z08A 4JKKA 5LZLA 1VH7A 2ISSA 3ZYZA 3G1VA 4RNIA 4ZQNA 1L6YA 3TV8A 3UP8A 3KRBA 3KDOA 1LBFA 4PMDA 1H7OA 1MQRA 3E02A 2J13A 2JF7A 4ZOEA 3NZGA 3RLVA 1GYNA 3P3BA 2RDTA 3KW3A 4JFWA 2NQLA 1EFZA 5D02A 1FWAC 2RFGA 3ARZA 4GNJA 3DJJA 4RCXA 1HJQA 3NL6A 4D6JA 2Z29A 4YN5A 1P48A 1QR7A 1XYLA 5G4EA 5CEWA 2GSEA 2VUYA 1W5OA 1US2A 5I3GA 4PTVA 3CHCA 2ZOXA 4D71A 2G4JA 3CHFA 4J3WA 1ZX9A 2HPIA 1PCKA 4DPPA 3DAQA 4NSBA 3H7VA 4TV5A 3HURA 1C29A 2QCEA 3S1WA 3VDCA 4PL2A 2PWUA 1GVSA 2NV9A 4CEXC 2X0HA 2YVFA 2O55A 3UETA 3HQNA 5E93A 3PB2A 2QJNA 3FSTA 3P8JA 4JX6A 4MJMA 4XBKA 2VC6A 4DX3A 4U2YA 5AB3A 1DQWA 3PZQA 3T0AA 1DWAM 1BD0A 4XVEA 5H91A 2WYSA 3GXDA 2XH4A 5AC4A 2ALDA 4QEEA 4DB7A 1XRFA 2F8QA 5E0CA 2JKEA 3FAWA 4RV8A 2DT0A 1PWLA 1OZQA 3MUY1 5A2BA 4KPRA 2BXVA 4CLMA 2OVLA 1V08A 3WK3A 5CBJA 1DIEA 1JZ2A 3QJAA 2A3AA 5JCNA 1EC8A 4NJKA 4AU0A 2JKAA 1E55A 3E74A 4FLOA 4JPGA 4JY9A 4GBUA 3W27A 4GISA 1XG3A 4LIIA 4WLCA 1CGTA 2WOVA 3EX2A 3ITCA 2B81A 3A3WA 1RV8A 3CGBA 2GLKA 4MNLA 3O05A 4WSHA 2PDJA 2EPHA 4JTTA 3TR2A 1AG1O 4QQUA 3VAVA 3MMDA 2X50A 1AJ2A 5FI8A 1HNYA 1E4IA 2XWEA 1XFBA 2QCCA 3FW6A 4YCPA 1M9HA 2QF8A 3V3WA 4W86A 4FIRA 2ZFAA 4C7GA 3GAKA 4JICA 1GVYA 2IKJA 1GESA 2GQAA 1M03A 3QVQA 1QI3A 3GXFA 3S9YA 2W3RA 3BLEA 1VCFA 4CGTA 4PFMA 3RNMA 3ARWA 3SUSA 4M6QA 4JQ1A 4N9CA 1A53A 5H2ZA 1S5MA 3CYJA 1GOWA 1KGUA 2EQ6A 3M9YA 2C1GA 3H2EA 3REQB 4MWAC 2ZZCA 2CLOA 3PUOA 4IXHA 1KFCA 3WMSA 3BV4A 3SRDA 5I2UA 1IWPA 4UTIA 5KITA 4KEVA 2W3SA 1JR1A 4ADSA 4KWWA 3EGJA 3CL6A 2DEPA 4MJZA 1FWIC 1LDCA 4FX7A 3NPXA 4JTLA 4DO7A 3MU7A 2HRWA 3TOYA 1IZCA 3BGGA 3LBOA 5C0QA 1TJ0A 2OTDA 4H8VA 5LA0A 3C5QA 1E73M 3LQGA 3NQEA 1YPIA 3OP2A 3SAZA 2PDNA 4XKYB 1UR8A 3GW3A 1BGGA 2WZMA 4DXKA 3PTKA 1FDZA 4HNOA 1G9HA 3FJLA 5TQLA 4TXEA 4AWUA 4O54A 2PB1A 4ZTYA 1UZ1A 4LB3A 1CTNA 2FHCA 4ONVA 2ZQ0A 4E4FA 2I5GA 5A95A 3BV7A 4GH3A 3URQA