4F4RA

Crystal structure of d-mannonate dehydratase homolog from chromohalobacter salexigens (target efi-502114), with bound na, ordered loop
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
408
structure length
408
Chain Sequence
b'YFQSMMKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAKTPGERYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
publication title Crystal structure of D-mannonate dehydratase homolog from Chromohalobacter salexigens (Target EFI-502114), with bound NA, ordered loop
rcsb
source organism Chromohalobacter salexigens
molecule tags Lyase
total genus 154
structure length 408
sequence length 408
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4f4rA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4f4rA01
1WUEA 2MNRA 4J3ZA 2ZC8A 3EEZA 5FJPA 4E4UA 4JN7A 4GMEA 1KKRA 3T4WA 1ECQA 4MKSA 3H12A 3QKEA 2GGJA 2P3ZA 4DHGA 3ES7A 3TOYA 2AL1A 3V4BA 2P88A 2PP1A 2MUCA 3Q4DA 3NXLA 3MQTA 4GGBA 3DG3A 4KT2A 2QJNA 4GISA 3TWAA 3R1ZA 4E4FA 3N6JA 1MDRA 4KEMA 3OZYA 4KWSA 3ZLGA 3GC2A 4HYRA 3ZVHA 1JDFA 3VCNA 4EWJA 3IJIA 3SBFA 2DW6A 2GGGA 1L8PA 3IJLA 1KKOA 1KD0A 4ENLA 5FJRA 4IP4A 1EBGA 3DIPA 3IK4A 1EC8A 4G8TA 4E6MA 3ZVHB 3MWCA 2QQ6A 3R0UA 3FXGA 3V5CA 3FJ4A 3OZMA 3U4FA 3DGBA 3DG7A 1ELSA 2OQYA 3DFYA 3SN1A 3ZLFA 3PWGA 3BOXA 3KUMA 3MY9A 2XH7A 4IL2A 2OZ3A 4HN8A 2HXTA 3VDGA 1NELA 4K1WA 3NFUA 3OW1A 2QJJA 3I6TA 3P0WA 2QGYA 4IZGA 2PP0A 2PTXA 3H7VA 2PSNA 4GFIA 3TCSA 2PGWA 3VC6A 2OO6A 4GYPC 3ENLA 1MUCA 2QDDA 1TE6A 3EKGA 3THUA 4H2HA 5FJUA 4X2PA 3U9IA 4GIRA 2OVLA 2HXUA 4HCHA 2OLAA 2GGEA 6ENLA 2OQHA 1SJCA 1FHUA 3UGVA 3V5FA 3RGTA 7ENLA 3RRAA 1TKKA 4HPNA 3I4KA 4IL0A 1JCTA 1EC9A 2PPGA 1OEPA 2CHRA 2DW7A 2PTWA 3UCCA 2PU0A 2FKPA 1FHVA 3CAWA 3VA8A 2AKMA 3RR1A 1F9CA 1BQGA 1P43A 3TJIA 2AL2A 3UXKA 5IDZA 3R0KA 3GO2A 4J1OA 4ZCWA 2GSHA 4HCLA 3N4EA 3T8QA 1XPYA 1XS2A 3QPEA 3BSMA 4ZA0A 2P8CA 2PP3A 3T6CA 4MGGA 4DYEA 3TTEA 3OTRA 2OFJA 2GL5A 1IYXA 2GGIA 2QDEA 2ZADA 2AL2B 3P3BA 4M0XA 1R0MA 1EBHA 2OPJA 1WUFA 5ENLA 3DEQA 2XH2A 3VFCA 2XH4A 2GDQA 2HNEA 4A3RA 1RVKA 3CB3A 3N4FA 1R6WA 4DN1A 3PK7A 3DG6A 3OP2A 1SJAA 3JZUA 3R10A 4KPLA 3VC5A 3MUCA 3T9PA 3S5SA 3SN4A 2OG9A 3JVAA 2HZGA 3GD6A 1JPMA 2ONEA 3UJ2A 3SQSA 3DESA 4MMWA 3NZGA 3PWIA 3IJQA 3P93A 2PCEA 3JW7A 2AKZA 3GY1A 3SSZA 1MNSA 2GGHA 3UJFA 4DX3A 4IT1A 3VCCA 4GYPA 2PTYA 4A35A 4F4RA 3ES8A 4K8GA 1SJBA 3QTPA 3I6EA 2OZTA 2FYMA 3CK5A 2NQLA 1YEYA 4JN8A 2P0IA 3TJ4A 3SN0A 2PODA 2PGEA 2QVHA 3CT2A 4H83A 4FI4A 3OPSA 3N6HA 4E8GA 4K2SA 5J04A 3QLDA 1MDLA 3FV9A 2O56A 3D46A 1NU5A 4YWSA 3MKCA 2PMQA 4G7FA 4HCDA 5BOFA 1W6TA 3FYYA 3S47A 3H70A 3DFHA 2P8BA 3K1GA 1P48A 3NO1A 5BOEA 1PDZA 3CXOA 4JHMA 3UCDA 1EC7A 3QN3A 3RO6A 2PS2A 3DDMA 3MSYA 4H19A 3PFRA 3CYJA 3TWBA 3FCPA 4A6GA 4GGHA 2OKTA 3UJRA 4DXKA 1MRAA 4IP5A 1PDYA 3RITA 2QJMA 3UJEA 5EU9A 2PA6A 2XGZA 5FJTA 2XH0A 3B97A 3Q45A 2XSXA 2PU1A 3DERA 3ZVIA 4Z17A 3BJSA 3V3WA 3ZLHA 3STPA 2OX4A 2RDXA 3SJNA 3D47A 1JPDX 4Z1YA 3R25A 5FJOA 3TW9A 4H1ZA 2POZA 3MZNA 4IHCA 3UJSA 3H8AA 3R11A 3HPFA 4HNCA 4HNLA 2OZ8A 1E9IA 4DWDA 3TQPA 1ONEA 4M6UA 1BKHA 2I5QA 4E5TA 1TZZA 3RCYA 3UXLA 3FVDA 1KCZA 1SJDA 2PTZA 4ROPA 4FP1A 1DTNA
chains in the Genus database with same CATH superfamily
3V1HA 3IJ6A 3BDKA 1XIBA 3GC5A 1TV8A 4TO8A 2D0HA 1FTXA 4JN7A 4KCTA 3GWQA 4LAOA 5FACA 1EDTA 4IFKA 2WOVA 1K3UA 1LLWA 2DJXA 8TIMA 4OHQA 2BVTA 1NHRA 7REQA 5C2XA 1ZTVA 2YXXA 4NAFA 4HZ8A 4LVGA 3SSJA 4UCGA 2AL1A 1DWIM 4QJ5B 2X8CA 3T0CA 5E0CA 3ZYZA 3ITTA 1GHSA 3LBMA 2EPKX 4IQDA 1Y5VA 3ZR4A 2XWDA 1M6IA 2Z29A 3FJ6A 5HUPA 3EOOA 2PDFA 1DQXA 1F2JA 4JL2A 1GV4A 4ZZ9A 1UD6A 4JIEA 1F05A 3EDKA 1V77A 3S2JA 2Y24A 4LVDA 4KWSA 1LJYA 1XI3A 4JTDA 3PWAA 1EJVC 4H4QA 2FZDA 1Q6EA 1XIMA 4PTVA 4A3HA 4HVXA 3HM7A 4J4KA 1OD0A 4FALA 2QCFA 3LZ5A 2QMJA 3VI2A 2DW6A 3IWPA 1XYBA 4C60A 2O4MA 3FS2A 1KKOA 3WLOA 3LPFA 1JF6A 4XUYA 5FS7A 4LW7A 1I1WA 4KEZA 3MA8A 1W1TA 3STFA 2WOWA 3IK4A 3W1NA 1V7AA 4LS0A 5EY5A 2VEIA 1NOWA 1OABA 1OY0A 3VNDA 2FDMA 2X2YA 3BOXA 2WZTA 3PSWA 4XX6A 2OZ3A 2ZUUA 3KVLA 1V6TA 2V68A 1NELA 2VEMA 1Q66A 3LHZA 1IEQA 2WBGA 7TAAA 1B4KA 4AX6A 1H51A 1OADA 1UMLA 4NP7A 3FEMA 4P7QA 5DXXA 3B8WA 4IIHA 3S5YA 1UD4A 2YGYA 4XD5A 3GG8A 4MKNA 1F6YA 3CHFA 8CGTA 4PRTA 2VUYA 5CBBA 2YJQA 3PTDA 2OYKA 1QWKA 4BFAA 4LBUA 1GEQA 3S6OA 1REQB 3MB9A 1QHOA 4HNTA 1RAKA 2GJXA 2WNZA 4H6KA 5JIWA 3P60A 1WYGA 3LPGA 3LGGA 4QFUA 2PRHA 2QIWA 5EGRA 1CLXA 3XIMA 1W2VA 3G24A 3I4KA 2J9YA 1Z48A 4J5NA 1H1NA 1OEPA 1RLDA 4Z1BA 3T05A 3S2CA 3VDCA 2Z25A 3IS4A 3UCCA 2DIJA 4XK2A 3WLLA 1U5VA 1V8EA 3W53A 3USBA 2E6FA 4UTIA 1P43A 3EYPA 1MXSA 1QK0A 3W2JA 3GZAA 4YJ5A 5KEZA 5D9PA 1I2PA 4MWAC 1KM5A 1K02A 1PX8A 1FCVA 3AS0A 3N4EA 1XPYA 1EJWC 3QV9A 4OJYA 1MRQA 3W6LA 1UWQA 1ONFA 2J8TA 1IWPA 1AZ1A 5C9WA 2GL5A 2WMJA 5AN7A 1UPMB 4QX4A 3W71A 3UESA 5E70A 3PZ9A 2IS7A 1R8LA 3WH8A 2OPJA 1RCOB 3ALFA 5D09A 2ZZ2A 3DUGA 4OBTA 3PZOA 1SZFA 2PLCA 1F3XA 1C91A 5CQ1A 3CUGA 3LHVA 4GH1A 1Q6CA 1OX6A 4EPKA 4ZQOA 5ECVA 4F79A 3S5SA 3FSTA 3GYCA 4IIFA 2CLKA 1R7OA 1ALDA 4PUMA 4AHQA 5JUVA 3WNNA 4LVBA 1RK6A 4LV4A 3W87A 1X7IA 4V33A 1NVMA 4UFJA 3MT1A 5T91A 1FUYA 3N4AA 3URBA 2OZTA 3BGAA 3M5VA 2BCPA 4H4XA 2W66A 2WZIA 1K03A 3AXKA 1OG0A 2WPEA 4LVAA 4Y9OA 5F2LA 3LG3A 1U30A 4U4MA 1EUAA 5CC5A 3PPCA 2VX4A 1H0GA 1XV8A 1G67A 3N25A 4Y9AA 3B9OA 4TX6A 4XSMA 2BOEX 1KLZA 3TJXA 4K7VA 3VUPA 1NU5A 4AXKA 3I10A 1TWWA 4YWSA 3M0HA 1HVXA 2PMQA 3E5BA 5C5YA 3WDRA 3V1PA 4CN1A 5I24A 2FZMA 1CB2A 4DPQA 8RUCA 3BAJA 3F4DA 4GUGA 3MWAA 3KOWA 1SFTA 3W38A 3BLPX 4FDCB 1O95A 2E9LA 1DJXA 4J9JA 4LBSA 1V0NA 3RUBL 4JEJA 2DUZA 4YCOA 1C93A 4ZQNA 3RR4A 2ISVA 4U2YA 5E5CA 1KGXA 1U83A 3S42A 1A47A 2XIBA 2TPSA 3BGGA 2VFEA 1OZQA 4UUIA 5U4NA 4WXZA 2BP1A 2ZUWA 2GDVA 1UQYA 3ZLHA 3H2MA 3AYVA 4R9XA 3SI9A 3CAQA 2DQXA 2VFGA 5F2GA 5ER0A 3VD4A 5KZMA 3DFSA 1XXXA 2IKIA 1EJTC 3MI3A 3G8EA 4LUTA 1MWOA 1OHLA 1VH7A 2GQ3A 2OZ8A 1CXIA 3WK0A 1KQZA 1WZMA 3K1DA 3DGZA 1E0WA 3WFLA 3SM0A 1DQUA 3CQKA 4EAMA 5FCZA 4CD6A 2YCLA 3U0HA 1JJKA 2E77A 2BWGA 3LI1A 4EPEC 4S3KA 3S6DA 2VENA 4DI8A 1JUEA 2VZSA 2Y7EA 4GQBA 2X7VA 3TW6A 3G6LA 1OX4B 1JUKA 1QR7A 2I57A 2CIPA 2D3LA 2OQLA 5CBIA 1IXQA 3WF1A 2DVXA 3E5PA 3F7JA 1W1VA 2WHKA 1Z41A 1K7XA 1W0MA 4KBXA 1XL9A 1TX2A 3N2OA 2BMBA 4PRRA 1N5WC 2Z0IA 3ABZA 3M5ZA 5REQB 3CGBA 4TVWA 3TYAA 2GR1A 2P0OA 2JIWA 1F4AA 1TWIA 4GGBA 4MB3A 3WD2A 4KFNA 3VKJA 3BSGA 3GBDA 1TQXA 2BZNA 4Q4SA 4G7EA 1UWRA 5M5DA 5IFTA 3GNRA 2VYOA 2E8YA 3SCQA 1RPKA 2XYLA 3WBEA 2X1SA 3WLNA 5LKYA 3VNJA 5HAOA 1GEHA 5FOOA 2HVOA 4JHOA 1U5HA 4GX9A 2CDUA 3SY1A 4LF2A 3JU2A 2GGGA 5KMYA 4ZOBA 1SW3A 2VC6A 4QLJA 4FO4A 3NQAA 2DGAA 1MW2A 4PC8A 3POHA 2CPUA 1ONXA 2JEQA 3NXFA 3MWCA 2FZ8A 3FXGA 1CXEA 1GXFA 3HQPA 1XYLA 2ZDSA 4YPJA 5FEWA 4O10A 3EOSA 3CMJA 3EMCA 5I3IA 2Q02A 2V30A 4DJDA 3K46A 4UC5A 1AL8A 2XH7A 3S5OA 1G69A 2FHFA 2VGGA 3PJTA 2FMNA 1OFAA 4H4PA 2DT2A 1YW1A 1B5TA 1EJSC 2OSXA 2ZVIA 3WL0A 3WNMA 3UPBA 1TVNA 1E0UA 3BXWA 2OO6A 3GVVA 5HPCA 3ARRA 3MYPA 6TAAA 5IBXC 1QBBA 2G37A 2Y63A 3NOYA 4PBFA 1EP3A 3VX1A 3TOPA 2OLAA 1BQCA 1BGGA 3BLOA 1K4HA 2X8HA 4B9ZA 4PUNA 1FDZA 2PDMA 1UB3A 4I3GA 2I9EA 4R7JA 5GJNA 3I3BA 4EXAA 4XVDA 2PU0A 4YHGA 2B31A 4ZBCA 3UY7A 3WK3A 4Q8MA 3URHA 4Q8TA 3VCRA 3QR0A 1UWSA 4B5XA 2VOMA 1UKSA 2Z27A 3EOEA 5EFDA 3CWHA 1VBRA 2EPMX 5FS6A 1A5AA 1GWJA 2E9BA 3UZZA 3H7UA 3H21A 3VE7A 3MDUA 2P8CA 4TVYA 4UTJA 3CO8A 1SMDA 5D32A 4DLFA 3IC9A 4LBRA 4BEQA 3EKZA 3O0KA 3W7RA 1IYXA 1ZP4A 1D7KA 1WOBA 3TYEA 2ABAA 3E38A 4AUBA 4JKMA 1M7JA 3DHPA 4YLWA 2GDQA 3W76A 2BVDA 2V2HA 4QITA 2C3ZA 4KPLA 3BLFA 3SN4A 2CZDA 2E6YA 1M7OA 3K13A 3NO3A 4A8RA 3W37A 3CMGA 2C79A 9XIMA 1TPFA 3FYOA 3RO8A 5DCDA 4M81A 3EUB3 1DKWA 1HJUA 3AZSA 4GQQA 3LN3A 4PR4A 3RM4A 2PD5A 2PDLA 3RILA 2DSUA 3LGEA 4LSBA 4ERGA 4IT1A 4P7RA 3YPIA 4BV6A 2E3ZA 4NEWA 2WQPA 2NQLA 4P7OA 2PWFA 2G8ZA 3NPUA 4S3GA 1OFDA 2EQ9A 1SW7A 1ZJBA 3O0HA 4RW3A 3NS1B 3FGCA 1QPOA 4H9YA 1Q63A 1PYFA 2R1KA 5AYZA 2J7DA 1FEBA 3K4DA 4H83A 1K7EA 5BOOA 3U57A 3WD3A 4ERIA 1KN0A 3GKAA 1FWJC 3C2RA 4KKXA 7ODCA 4HOZA 2UBPC 1W6TA 1OCNA 3WH9A 2X30A 3KEHA 4Q4MA 5MKGB 2YDQA 4FNSA 1P5BA 1OCJA 1Z44A 1KC7A 3L4TA 2BVYA 3DOPA 1OX5A 4QSHA 2F8QA 2VXNA 1I1XA 4IXHA 5KVHA 3TMLA 2E67A 1J79A 1JD9A 4JIRA 3W7PA 3H4KA 3WJWA 4WGHA 3N19B 3W1QA 5A8PA 2V69A 4HQVA 5E6YA 1RVGA 2W5FA 2QW5A 1XISA 2PA6A 2G3NA 4KQNA 2W3ZA 3NQDA 1CGYA 3WJSA 1EJ7L 1UUMA 1Z9AA 3WQDA 5HXMA 5DMLA 2NX1A 2XSXA 4XIAA 2QEZA 1NH6A 1A3XA 1ZLPA 5BROA 1AQ0A 3D3AA 2WMIB 5E0KA 4ZB2A 3VOFA 2VCAA 3N12A 1E6XM 3APYA 3AFBA 4CKQA 1YBQB 3R25A 2RDWA 2Z1VA 1JDEA 2VVNA 4PYSA 4DBSA 3SURA 3K5XA 4JICA 3MZNA 3KRZA 1HP5A 3KRBA 3C2EA 1BWCA 4W89A 2CHOA 3SCUA 1HFBA 1F07A 1K70A 4LUSA 3NTYA 3WJXA 2G95A 3RCYA 2QXWA 4ZQMA 2PTZA 3SCSA 2EPOA 4AX7A 3H2AA 1VENA 3WN6A 3MCMA 1PZ0A 5HJXA 1H49A 2WHMA 1H09A 3C61A 1ML1A 3PPHA 3WQFA 5C6MA 3GRTA 2CBIA 3GUWA 4LWWA 4A8NA 2HE5A 1BGAA 1UIPA 4MYXA 2QUMA 3W70A 4I6KA 1RP8A 1GKPA 5BXTA 1HKWA 3E2RA 5CJMA 5BRQA 2BHZA 1KFEA 1PZ1A 2P88A 2QAEA 3CUHA 4MLJA 1QI2A 5JU6A 4UNIA 3DG3A 1P0KA 5HR6A 1EA9C 2ZRUA 3WUEA 1H0IA 2A85A 4I5XA 5FF7A 2C1HA 1KFCA 1VF8A 1LG1A 1JVNA 4QG9A 2V63A 3SUTA 1N55A 5DMMA 4URIA 3BWWA 1VFMA 1P6WA 4AEEA 3AXIA 4HPXA 3CQ0A 3RXZA 5CGQA 2AOSA 3QR3A 5CZJA 4Y9MA 1KM4A 4W7UA 5A6MA 3AUOA 1PTDA 1TA3A 1N63C 3DAQA 4IUGA 1XH0A 3DH7A 3E0IA 5A8MA 1Q8JA 4RKAA 3RX4A 3ABQA 4KEVA 1QWGA 3A64A 4WJ8A 4DUOA 4UTHA 2QAPA 2VT0A 3FN9A 3DIPA 1KRCC 1BSLA 1E6NA 3W29A 4Q6JA 1M5WA 3LHTA 2VCBA 3G18A 4XD6A 1W1B1 1OGGA 5H8MA 1H1ZA 4C6OA 1RLCL 2VFFA 2HXTA 2NV2A 1BWVA 5HANA 1Q85A 2X7WA 3DU0A 5JXQA 4D6IA 4XAGA 2O0TA 4RZBA 1E4IA 2XTKA 3KLKA 1JZ5A 3BAKA 5HQEA 2ACQA 2ZE0A 2B7NA 3GDBA 3R43A 4JKLA 3ANYA 1HO1A 2D0FA 4X9SA 4PTNA 3M4HA 4AEFA 1TV4A 3CGEA 1WE5A 1KWKA 3FAWA 3GC4A 3THUA 3O15A 4E2BA 3U9IA 1H1YA 1EP2A 2Y8VA 3W2UA 3ETRB 4ZE4A 1S5VA 1EYEA 3MKKA 3FIGA 1R9ZA 4JKKA 3LB0A 3TSBA 3VINA 4HHPA 4BI6A 3WDHA 3RGTA 1U2YA 4BWLC 4NHVA 3GS6A 2Z1SA 1OINA 3GAKA 4ZE5A 3REQB 4FNTA 3S2LA 4A3UA 2PPGA 3CTTA 1GYMA 3CZLA 3PB0A 1L6YA 4LYPA 1RD6A 5RUBA 1JROA 5I6SA 3EF6A 5LGXA 1HJQA 1R87A 3EBVA 4AAJA 1O1ZA 3GIYA 1XH2A 2PWDA 1IR1A 3V16A 2BNJA 1SU5A 1RBLA 1X1NA 4WCJA 4XIMA 3ID7A 3VKBA 4WY0F 1YNPA 4JCMA 1XIIA 3W7KA 3VKCA 2R1LA 1ZFJA 2C19A 1P0DA 1PO9A 3ME3A 3VNYA 3CUJA 4BI5A 4ZOEA 1SSDA 5CGMA 1HL9A 2KZHA 4INFA 3WLTA 4GBDA 1P6CA 2CZFA 1F6PA 5MHBA 3R5EA 4PCNA 1ZENA 4HIBA 2EEXA 2PDQA 2XIJA 4QM1A 4O52A 2EF9A 4X63A 1EO7A 1NWUA 3IIZA 4V2XA 3ZZ1A 1UR0A 2ACSA 1H3GA 3W1AA 8A3HA 3AISA 1UP2A 1D8WA 2HEJA 1FH7A 4UFIA 1PX3A 1SR9A 3RK8A 4P2VA 2D2GA 4BCEA 1A49A 3HIJA 4GYFA 1IGSA 4X9YA 3R2GA 4EM3A 3P93A 4PSRA 4LANA 2QCEA 2GVGA 1MNSA 2R91A 1MVYA 3PZNA 3APGA 4XBKA 3CB8A 4JTKA 1D3GA 4PL2A 4NASA 4A35A 3MO4A 3IAPA 3SGUA 2WJEA 3WLMA 1Q4NX 3L8KA 1ADDA 4ZXOA 3JZEA 1FCBA 4PA8A 1E6QM 1BZLA 2P0IA 1UWUA 1N82A 5MF5A 1ISWA 2A79A 1V3KA 3UR5A 4ML9A 4PMRA 4S2BA 3BAYA 4NUWA 1E1CA 5GQBA 2VR5A 2GJLA 3GDMA 1UW9A 5CSUA 3GRSA 3PPGA 1DWFM 3K1GA 3NO1A 7XIMA 2QDGA 2ZQ0A 5EBAA 1W1IE 4XTDA 3IJ7A 1BYBA 4DB7A 1TYTA 1L6WA 1X6LA 2J6VA 1E73M 4QLKA 5F4SA 4GY7A 3W7MA 3H54A 1QK2A 1VCFA 1VRDA 2DDXA 2YL9A 3W6YA 2C71A 1EPXA 5I09A 1CT5A 4ZVJA 3VNZA 2R1PA 3UXIA 3UJRA 4NZ3A 3UR7A 1MRAA 5U1OA 4AZ6A 4MJMA 4B2DD 1HJSA 3KWXA 2BV9A 2E1WA 4CCCA 2Z6IA 1R38A 1UKPA 2W3RA 3HURA 2DZBA 1Q6FA 3BGJA 5KZ6A 4HZ6A 2X1TA 3AZTA 3ZVIA 3RN6A 3WQCA 4GACA 1ITUA 2H8ZA 1GQNA 4Y90A 2FPVA 4KEUA 5FKYA 3C2YA 3VIPA 3M0YA 1QI0A 3G0XA 2NQ5A 3QY6A 2IPGA 3TW9A 2AAAA 3BCFA 1LQ2A 3RJYA 1W5PA 1MEHA 1EO5A 4JDYA 4M1RA 2PGRA 2X0SA 2X99A 4KRZA 1JGMA 3PNZA 4FX8A 3BVJA 4XZHA 5G4WA 1TMLA 4HP5A 1ZAIA 1F4HA 1UG6A 5A6JA 1SJDA 1QCWA 3VNLA 2ZZCA 1QDSA 4AH7A 4DJFD 3N11A 1G4EA 3GKFA 3D6NA 1LORA 5LNRA 2CZEA 4AISA 4M5PA 2QCLA 4GUFA 4WDTA 4YNGA 5FAGA 3N29A 4N6EA 3QFEA 1TQJA 1XUUA 1Z32X 3S83A 1ADSA 1XLIA 3H2CA 3G5EA 4PTWA 3HQNA 2WKGA 3PJWA 4BJHA 1M6JA 3QYSA 1TIWA 4R9OA 5JQ9A 1US0A 3WFAA 1K9DA 3SDOA 2X40A 3E2SA 5IHSA 1Q5MA 2A3LA 4GO9A 3NURA 3E96A 3T40A 4JQ9A 1WO2A 1ZJAA 3DC0A 1QT1A 3OGSA 1DWHM 4GK8A 3VCNA 4NJGA 1UCWA 1QPQA 1J9YA 1F8MA 5JCLA 2VFIA 1XC6A 3MKVA 3FY1A 3UA3A 4JFVA 4U33A 1AMYA 2GQ9A 4G8TA 4QG8A 4JTJA 1IGWA 1VKFA 5HWNA 2RHGA 3MUXA 1VIWA 4LU0A 3NOEA 1W5NA 1R3QA 3NO5A 3G77A 3NAVA 2WWCA 3SQMA 2E5DA 1KM3A 3OA3A 3HJZA 2XVGA 1RJRA 3TONA 2X8GA 1J93A 4HN8A 1PCWA 5CEWA 5I78A 3P0WA 1XSIA 2W62A 3EWYA 1XLCA 3WSUA 4GVGA 4C5ZA 3R13A 1MXDA 1L9WA 3LDVA 3AXXA 3WK2A 3TCSA 3P80A 2VOTA 1S2AA 4YYCA 1A5CA 3IGSA 5HJYA 2BY1A 4FLSA 1AUSL 1FWAC 4LVFA 2GJNA 1DXFA 4TR9A 1GPFA 2OVLA 4OQVA 2BHYA 4LY4A 4WGXA 4IPPA 2NXHA 1HG3A 1LL7A 2B0MA 1IR2A 4F0RA 4DAIA 4K8EA 2OU4A 4DBUA 1QOPA 1W5QA 3G1RA 4GX8A 2J9XA 1WYIA 2INZA 1EF3A 3LQGA 4X0NA 4PCTA 2BOGX 1EC9A 2Y4SA 5G5HB 5CZSA 4R33A 2ZUTA 3VA8A 2OYMA 3R0DA 5AHEA 2WBAA 4NRSA 2YL6A 4JL1A 3GTIA 1QOQA 1CZ1A 4QSFA 1K4QA 3UG5A 4EQRA 1TUXA 3CV6A 4ATDA 3SCTA 3TTSA 4JR5A 2CKSA 1JIBA 1M03A 1UASA 3VDAA 2FH6A 1V02E 4HCLA 3IIXA 4F0MA 4Z2KA 2B81A 2DZXA 5C9UA 2QS8A 1ECEA 4IWWA 2J66A 3UZWA 3MUIA 2VGFA 1XUZA 3TJLA 4AIBA 1TJ2A 1BAGA 1W9UA 3VOGA 3TV8A 3F4NA 1VFTA 2OT1A 1ZK7A 3BTNA 2C91A 3RLGA 3MANA 2OTDA 1F76A 1DV7A 4I9MA 3BK0A 3WQPA 4D6EA 4JBRA 3QY8A 4RE4A 3R10A 5FL0A 1DHKA 4Q7NA 4NU7A 1J2WA 4NJKA 4O16A 2X09A 3OBEA 4O17A 3DESA 3IJQA 4X61A 5H8UA 3NA8A 2PCEA 5G1TA 4QEHA 1GRGA 2CLPA 3G3DA 4C6JA 3SSZA 3MMWA 3HFTA 1A5UA 1J18A 1GQKA 3G1VA 5TR3A 1OJXA 5AC4A 3DENA 3HZ3A 3T2PA 2ISWA 1I6NA 1Q7ZA 5DY3A 1Q7QA 4XD4A 2UY5A 4YWOA 3B0VC 3CC1A 3THDA 2XN1A 2CZVA 5EBUA 3D5HA 5A6BD 3TSMA 1C8QA 2ZXQA 1XYZA 2RGMA 2XISA 2NLYA 3UW6A 4H2CA 1LLOA 2E25A 1ITCA 4N9BA 1W91A 3AHYA 1TWSA 1XRVA 4KWWA 1P1XA 1K9EA 1TJPA 4DO5A 1EP1A 2ZTJA 4J28A 5CPQA 4GC3A 2VD8A 1I2RA 1WPCA 1E43A 1BLIA 3BICA 1EQCA 4OBRA 4PMYA 4L64A 4GCXA 2HVMA 2DH3A 3CYVA 3P74A 1YPIA 5D2TA 1P48A 2BY3A 3DHUA 3JUGA 3NYZA 1J0JA 4UTTC 3CXOA 3QN3A 2PS2A 3K8LA 1K8CA 1V4YA 1XX1A 4GVFA 3HF3A 4UTWA 2V0TA 4EVZA 3EOUA 5I02A 3LPPA 2RABA 2J8GA 4HU4A 4UWMA 4G56A 3AN1A 4BF9A 4PCPA 1F3TA 3QLLA 4UTFA 2PC4A 1S5TA 3AOFA 4JFWA 4B5WA 4JYFA 4O14A 3EDEA 2NLIA 1QUMA 1OF8A 3AJ7A 1TPVA 3EWZA 3MPGA 4XZIA 2YVGA 3OC4A 3N14A 4S3BA 3K2GA 1X97A 1V08A 3H24A 3MJMA 3EPNA 5A8GA 4EPDC 1HKIA 2I5GA 3FYPA 1ODUA 1EJXC 4AZCB 3HPFA 1PTGA 1KM1A 3KS5A 1Q2SA 4AZBA 1E9IA 3GDTA 3M16A 1RUSA 2VZUA 1T3QC 2I5QA 1M01A 3VNMA 3A9BA 4XG1A 2XGIA 1ZQ5A 3NVZB 1LTDA 1S2UA 3F1QA 4JHZA 4L80A 1YQ2A 3NEVA 2D73A 1DTNA 4HPHA 3TSDA 2GRTA 1E6SM 4E4UA 4H4VA 1GQIA 1H7XA 3F4CA 3C2VA 1FFQA 2H3BA 2A3AA 3O05A 3TQVA 1A5BA 1RZMA 3H4WA 2WVVA 2NX9A 1UP3A 5ECUA 2GQWA 1V79A 3H6OA 4LH8A 3TYZA 1P7TA 4B5UA 1TZ9A 5CPLA 4EP8C 5CPNA 4HNOA 1VYRA 1XHCA 2CKRA 3CJPA 4F2TA 1JGIA 3GG1A 4XTIA 2Z1BA 4L4OA 4CQ9A 1VB9A 3GLCA 4JQ1A 1CIUA 5D05A 4AD1A 3N34A 3OBKA 4O11A 1SZEA 3QTGA 1NP0A 3GHUA 3SIZA 2VRJA 1FWFC 1DJZA 4W85A 2NVKX 3NPXA 1V3HA 3SBFA 4C6LA 4YYFA 1H7NA 2A5HA 2OKOA 4O1FA 3CTLA 4N9EA 5CG0A 3MU7A 3VOHA 1RD5A 4FOUA 4DO7A 2BFGA 3SCVA 3NG3A 2CW6A 3P8JA 3GUGA 3R4IA 2ALRA 5KITA 2FMOA 2I7GA 5FJRA 4C6IA 3GD4A 1B3ZA 4DIAA 3NVWB 3PG8A 4E6MA 1G4TA 1CI1A 3WBYA 2VL4A 2A3BA 3N3TA 5C2CA 3UEQA 1RA5A 3FJ4A 3CPGA 3VD5A 4O15A 3VABA 2CBJA 3A3XA 4ADSA 1KB3A 4L61A 4PMDA 4WOZA 3DK9A 1XYCA 1ENUA 4K7ZA 1JUBA 3H53A 2W0HA 5HBFA 3EAUA 3N2MA 1OBAA 3N04A 3ZS4A 1I75A 1P0EA 3QXBA 2ZUNA 1GEUA 4HD5A 3FNDA 2PSNA 1JRBA 2YKKA 4JX5A 1PE1A 2AMXA 4UIOA 3LZ3A 3TX9A 2DU2A 1GKQA 4O4VA 1RJQA 4K39A 1EH9A 3QHNA 3PZUA 2PWVA 5FJUA 4X0VA 4X2PA 3TZNA 4H4ZA 5EFFA 3FA3A 3OVPA 3BV4A 3MBDA 3U48A 4DJFA 3DBPA 4QJ4B 3PR2A 3GXNA 3GR4A 3MV11 1H5YA 4IPNB 3GSMA 4W7WA 3NQGA 1UD5A 4NJIA 4O0KA 2DW7A 1BXCA 2Y5EA 1FHVA 1JULA 2ZBTA 4XKMA 1VBUA 2O9PA 4MKVA 4LTSA 3HPZA 4PCFA 2BBFA 1OYCA 5FI8A 4NAEB 3LMYA 1JXJA 4NJJA 2AL2A 4MPKA 3BLLA 5FESA 1SB3B 3R0KA 3QV7A 3IGUA 4LCQA 1U22A 2W27A 2VZTA 2PDJA 4NYUA 1CX9A 2XSAA 3AU6A 1T5AA 1QMLA 1XS2A 1KR0A 2V5JA 3VIIA 2EQ6A 3RNDA 1ZUAX 1AJ0A 1J10A 1EIBA 1ITQA 1J96A 3K30A 3LQLA 3C2OA 1LWHA 1K9FA 1ISXA 4ASTA 5I0DA 3SCNA 5LNVA 1EPVA 1CGVA 1R0MA 4O1CA 1GVRA 5FAJA 3VGFA 1EBHA 4J2MA 3W74A 1GETA 3KBJA 3KBWA 1ADOA 3FLUA 3NQ2A 4C6QA 1L8NA 4BI7A 1ZMDA 3NPVA 3R8RA 2PZNA 4NYYA 3VC5A 3EWXA 1TTPA 4GI8A 4MUPA 1G94A 5ABHA 1R2RA 3MP3A 3G1FA 2YLLA 3ERPA 3OOQA 1MNZA 3SW6A 2EKGA 3T81A 3KDNA 3CIVA 3BAXA 3V0UA 3EXRA 4Q6XA 4MMWA 4MY8A 4UMCA 4R5EA 3RX3A 2VP8A 2BSLA 2X1RA 4WY0B 1QBAA 3NCOA 1TSIA 5E6ZA 5D38A 2VWTA 3WH6A 1H61A 2IPFA 3DK4A 3N1AA 4MSSA 3KX6A 1JNDA 3VCCA 3FKKA 5KZEA 2PTYA 2ZZ1A 2R6OA 1PB0A 2QCHA 3CAKA 1QNVA 3GM8A 3S1VA 3VOIA 2NSXA 3BJTA 3A3WA 4D2JA 3UQNA 4O1AA 1HX0A 4JN8A 3LTYA 3STCA 1HVQA 1JZ3A 2WAGA 4CVWA 2F2KA 1PBGA 2BB0A 4XB3A 5F7UA 2GK1B 3ZFHA 1GPWA 3B06A 4PMUA 3SFKA 4H9TA 4XKYB 2J62A 4PUJA 5D8WA 1H50A 3W7OA 3D46A 1XRFA 5AYIA 3ABSA 5LYRA 1RQHA 2HK1A 2DZTA 2ZRWA 3WDPP 4W4QA 4MUZA 1ZJIA 3EDDA 1XLKA 1FY6A 3MP4A 1ZAJA 1J0KA 3T0DA 3E9AA 1XIHA 1XLFA 4U3AA 2ZRVA 3ARZA 1XHGA 3BE7A 1YNYA 2NVDA 2F7FA 3UR8A 3WCZA 2ZYFA 1OT1A 1YKWA 1VRXA 2TAAA 4MZ8A 2WPFA 3CAVA 2G4JA 4C6KA 5JBFA 5HQLA 5JH2A 3WY1A 4NX5A 5CZTA 3OVRA 1HNYA 4P8XA 4F2BA 4S3DA 3INPA 5DRCA 1WZLA 2Y62A 1GTEA 2ZZ4A 4JIPA 4Z17A 2XDFA 3UXDA 2QR6A 5DCEA 4B15A 3KVJA 4J57A 2A2IA 1GG1A 3W7LA 3H23A 3TE9A 3PZIA 4FSAA 3WNKA 1FIQB 2D2HA 3EX6A 1KNWA 1FWTA 3SCOA 2QUTA 4CNTA 1C7TA 4I90A 4K6AA 2W3SA 3DK8A 3H8AA 1GZ1A 3IK2A 4JD4A 3S5ZA 2CXEA 5AC7A 1RM6B 2VNCA 2QF7A 3QFAA 1R2TA 4GQRA 2WXDM 4Q4OA 1BEUA 4S38A 1HXJA 4NJHA 1BFNA 1NM9A 2FTYA 1W3LA 1KCLA 3HBLA 2REQB 4PMXA 3W1RA 1OGBA 2PDWA 2VO5A 1VIZA 4KESA 3U2OA 2ZC8A 2DT0A 2ZUVA 4IG2B 2FZ9A 3B0XA 1B9ZA 3UA4A 3VZXA 4H4YA 2ZIDA 4XZNX 4DELA 2A3HA 4A8IA 2XGBA 4HYWA 5AHFA 1YNQA 3A7RA 1ZX9A 3RLUA 5FD0A 3V0TA 3MS8A 4LJ3A 3PS7A 2WPBA 3P62A 4HT3A 2PLJA 1W1ZA 1PKYA 4MYAA 2ODOA 4FXSA 3CHCA 2PP1A 4AWTA 5JCIA 3CV7A 4GVHA 1H60A 3QSTA 4NXKA 3PBVA 4O13A 2EGZA 2IMRA 4Z1DA 4TMCA 1B31A 5BNKA 1WKFA 2A8XA 3VXGA 5HOSA 1MI3A 4YU1A 4RCXA 1F73A 4UR8A 3B05A 2WSKA 1Q6DA 4BKNA 4DLMA 4E3VA 1S5WA 3W26A 2YXOA 4H7CA 2WM0A 1FA2A 4HHLA 1VLWA 2UZ9A 2VGIA 3HN3A 4MHBA 3OU8A 3BH4A 4XO6A 2V5CA 2DPEA 3LTSA 1E3ZA 2O4QA 1KD0A 3M0JA 3APTA 3U6WA 1FCUA 4MZ1A 1TRDA 3ZMRA 3PUEA 3U4FA 3DGBA 1UROA 4AF0A 2BODX 3P2VA 3W22A 1T41A 3WUFA 3IJDA 3LS9A 4L1WA 3P14A 5F4XA 5CH9A 4GZ7A 3VDGA 2Y8UA 1VJSA 1QHZA 1KFBA 3EEGA 1F5ZA 3P82A 2DEPA 4KIEA 3WD1A 1V59A 4IZGA 1TMHA 4X60A 3BUVA 3A4WA 4M80A 1N2VA 2C3CA 1GZGA 2YX0A 1EQPA 3SAZA 3VX0A 1PKMA 4IMEA 1DIOA 4JCLA 4R53A 2VC7A 1C90A 2SFPA 3M64A 5HNTA 4U5KA 3SUWA 1UPPA 1EJRC 5D04C 4D6JA 1EXBA 2ANUA 1FHUA 2ZXBA 3VIFA 3W2NA 2DFAA 4DVOA 1OYBA 1T40A 4UFMA 1QNPA 1G6CA 3ECQA 3UWVA 4FF7A 3AXHA 1HP4A 4O50A 1JDDA 2PDBA 4C1NB 3ITGA 4DNAA 1JYNA 4RNHA 2E9MA 3PBMA 1EOMA 1JQXA 2Z7GA 5A6KA 2QCGA 3THCA 3L7RA 5I2UA 2AKMA 1VHNA 3GB6A 1JYWA 3DHFA 3DJGX 2WLZA 3AC0A 3IV8A 4YTRA 2Q8XA 3WUGA 3GNPA 1V0KA 2PWUA 1FOBA 2NQJA 1ZP3A 2EHHA 2GVEA 4WXYA 5ABEA 1TPH1 2GSHA 4US5D 3S46A 2QGHA 1Z8AA 1FWGC 4W7VA 4PGLA 2R9ZA 4R85A 2A3CA 2GPTA 2TSYA 1NWTA 4KWVA 3UWWA 5EKYA 4D6FA 3DKLA 3UVIA 1S2WA 2W61A 3TC3A 1BRLA 1ZCOA 3KP0A 3DEQA 3S1WA 4O1EA 3N13A 2OOGA 5A94A 1BWLA 3VNKA 4DUVA 1YXDA 4WF7A 1ZJHA 3OP2A 1R9YA 2FVKA 4PTDA 3B4YA 4P8UA 3V18A 3LENA 5K9CA 4KRTA 4RL3A 2DSVA 3SQSA 2X0YA 1PL9A 5C54A 3T09A 4QXIA 3HMJG 2VEPA 2DUAA 5TAOA 4CQBA 3ZJ6A 4AZ5A 1R3WA 4YIWA 1X2HA 1KFKA 3IAQA 5C9XA 3AMDA 3Q94A 1STZA 2G97A 4EANA 3PG9A 3M44A 4YVXA 4GFSA 4K1GA 4I5RA 2C13A 2X8RA 2QJIA 2Z1WA 1FHDA 1UH2A 2YDRA 3UCQA 2XG9A 3I7RA 4PULA 2J75A 4JTEA 2PBGA 5HA7A 1SO3A 2PODA 1RXOB 1TWDA 4ZO7A 4J3VA 4G2DA 4MAZA 1EFZA 3T2QA 3NNTA 2VHLA 2PLMA 1VJIA 2RKXA 3J7HA 3NQBA 1I8JA 3OLEA 1L6GA 4DZIA 4GVIA 1WDSA 3LGDA 2VM8A 4M6QA 4XWUA 1H6VA 1AH4A 4JHMA 2QPUA 3TDFA 1W3TA 1FFUC 4I8DA 4U3CA 3O6DA 4RX0A 3G0UA 1LF1A 5GNZA 2VKZG 4NX0A 1SYTA 3GG0A 1X38A 1DYSA 2GFTA 4GHRA 1CDGA 3N2TA 3B8TA 3MUY1 2QV4A 2XGZA 1AW5A 2JIEA 2V3BA 3RX2A 4F66A 1EX1A 3DERA 4G6CA 5AVNA 1KLYA 1NDAA 1PEZA 1FWNA 4JIIX 4S3FA 1JPDX 2WMGA 2WV8A 5TIMA 2DZAA 4OT7A 2QAFA 4REQB 4APNA 1U1HA 4HU0A 4HSOA 3F5KA 3O07A 4IHCA 4N9CA 3WQEA 4HNLA 5XINA 3UNTA 1CNVA 1DOSA 1ZBVA 3LCHA 4R7OA 3M7SA 1G7VA 1HKMA 4TV6A 4RDZA 5F4WA 3FDGA 5G5GB 1CGWA 3L4UA 3LLXA 3FA4A 5CSSA 3UETA 5D2VA 1BKSA 1CYGA 2MNRA 1TR1A 2R14A 5I07A 4N9DA 1NP2A 3C0LA 5E93A 5G4EA 1KKRA 4JTUA 4MDOA 2IQDA 3PSVA 1VR6A 1UJQA 3OLIA 1ECQA 1XD1A 4AG0A 1MW1A 1X1OA 2JF6A 3CWNA 1R9XA 3GAYA 1A5KC 3S2MA 4DHGA 2O9OA 2ZOXA 4GYKA 1JEZA 9XIAA 2MUCA 1S3HA 1ZBCA 4MDPA 4IFKB 1DE5A 5IRPA 3CXBA 1GVEA 3BANA 3ZR6A 1ZS2A 4Y2WA 7REQB 4NAFB 3URAA 5KETA 4KPRA 3M46A 3TUUA 3N6JA 3BG3A 3NDZA 4M51A 3QSRA 1FFRA 2VR2A 3HQ1A 1TTIA 3ZVHA 4PEKA 4CUCA 4IXXA 2VJXA 3GU2A 1IHIA 5U7SA 1O66A 3WDQA 3W02A 2HVNA 2J7EA 1GQLA 3BLIA 4AD2A 1XDLA 4CQDA 4GA8A 4IP4A 3TAOA 1VFLA 3ANUA 5D9OA 4DZHA 4O12A 1YDOA 1NFPA 1OFEA 1VBHA 3UERA 3PNUA 2BXVA 3PAOA 1GVSA 4E38A 3DI1A 1TPEA 1OIMA 2E4TA 2ZWZA 1BG4A 4IL2A 2OX1A 5FF4A 3O2LA 2YCJA 3Q65A 3P67A 4LFYA 4JQ4A 2VD9A 3TTOA 4HMNA 5AC6A 2Y8KA 1YMYA 4IF2A 3CL7A 3H7VA 2GVYA 5SWUA 2E6AA 2PRLA 4FB7A 4WSJA 4ECLA 4MZYA 1W32A 1XRTA 5LIYX 1HL2A 1SM9A 2QDDA 1WZKA 3R79A 1DIEA 3M47A 3M0XA 3TLQA 4CLMA 1EWDA 4U31A 3GG7A 2PFHA 2DP3A 4CQAA 3WQ4A 3L0NA 4CN6A 4ZQCA 7ENLA 4XAYA 4EOUA 5C2GA 3LMZA 3VIKA 3QC3A 4TVCA 3A5FA 3CUZA 1QW9A 2QVNA 1K6WA 2NT0A 2GJXB 3LRLA 5XIAA 3QPZA 1OCQA 1M41A 1E9YB 4EXQA 3ITCA 1BQGA 1W1YA 1W3KA 3WENA 1KXVA 1XICA 3EKLA 2XVPA 3BV7A 5D9MA 2C1GA 1O12A 4M8UA 2JE8A 1E51A 1UP0A 3AWNA 1ZY8A 4KMQA 3LNPA 2XJ7A 1LUCA 3V35A 3HQOA 5AECA 4UOZA 3QPEA 4H8NA 3UR2A 2PP3A 4JTGA 1XJBA 2V3GA 4CNNA 3N9RA 3WKZA 2WZMA 4JTQA 4KETA 3PANA 2X16A 1XGZA 3CIXA 2ZZ0A 2Y85A 4QEEA 4IPLA 4Q4PA 1Q6LA 5H1WA 1RVKA 1GJUA 1PHQA 3N4FA 2NPXA 2YIHA 1XLJA 1SFSA 1TR9A 2PEVA 1POKA 4LAZA 1UIOA 4WZHA 4K37A 3MUCA 4O0ZA 3TMQA 2XIMA 1KTBA 3TAKA 3WQVA 2HZGA 2A21A 1F7BA 3UJ2A 2ABBA 1SO4A 3LXDA 1ME8A 1V02A 1V03A 2PWHA 3AMLA 1W31A 3B8SA 5E1QA 1O5KA 1LRTA 4DX3A 1VD6A 2RGLA 3F03K 1JZ2A 1KW1A 4JY9A 3TH6A 2VFHA 2ZZ6A 3VKAA 4F4RA 1GYNA 3R7MA 3QTPA 2XSBA 5DBUA 1G1YA 4EIVA 5DQPA 2FVLA 2INFA 1HT6A 2DZWA 4QGCA 4ICCX 3RCMA 4Y9NA 4B5SA 1N5XA 1NFGA 2X05A 4JTHA 4C6CA 2WVTA 1CLVA 4MPQA 4DAFA 1XDIA 1WBJA 3T0TA 1JI1A 3A7AA 1XBZA 1JZ6A 3LHUA 4H4TA 4OKDA 3WEZA 3V0SA 4CN4A 4R27A 1IEVA 3CMFA 4G7FA 5A8OA 4N0RA 1T8QA 4UNKA 3S47A 3NQEA 4QCEA 4HU8A 3PPFA 3M6YA 4ACZA 4K8DA 2IKJA 3UYCA 2W67A 5HDRA 3HPXA 1NQ6A 5G1MA 3TP4A 4RXFA 5I5RA 3PJXA 4H4WA 2QUNA 3KVMA 3L12A 1UD8A 2Y88A 2OYLA 1YADA 2BXZA 1WAUA 1OWQA 3Q37A 1I45A 1UBSA 1E3XA 4BK9A 4MOZA 2BHUA 3T44A 4RNFA 1JYXA 1JCYA 1H2JA 3CQJA 4ZENA 3STPA 2NW0A 3A7UA 4GIEA 4OWGA 3NSNA 3BMVA 3OHIA 4J7RA 2EJAA 2RDXA 3SJNA 2HTMA 4DWSA 2QIIA 3HO8A 1L6SA 3DYPA 2NQZA 1E72M 4JAWA 2J88A 3C8NA 4WOQA 4DWDA 4MY1A 1E40A 1J11A 1TZZA 1K7FA 4LUTB 3THQA 1WP6A 4NZ5A 2KAUC 1KBKA 2AAQA 4TX9A 3A4AA 3QMRA 3S2NA 3RHGA 1AQMA 2BOFX 1T7LA 4LALA 5FJPA 5FSEC 1OYAA 4DRSA 1OCBA 2EKCA 3RCNA 2WP6A 1P0NA 3F5LA 1SO6A 1ZCCA 3QPYA 2YCLB 1W5MA 1WKDA 3H12A 5LHEA 3WK1A 3GX9A 1A5SA 3EPOA 1LBMA 4FNQA 5JCNA 3LPOA 3V4BA 1TYGA 2BGSA 1H2IA 1JDCA 1VFSA 2V6AA 3RFAA 1WV2A 3GHRA 1F3EA 1DIDA 1UA3A 3M5YA 4KT2A 3UZ5A 1QPNA 2PAJA 4GISA 1I2OA 2D3NA 2A6NA 1R3TA 2ZE3A 4KS0A 4E4FA 1P4CA 4H8UA 5A6TC 1DHPA 1KBJA 3LXBA 3AS2A 8XIMA 1RQEA 1ICQA 1RY0A 2UWFA 3GNOA 3HA1A 4O1BA 3LUTA 4W5UA 3G1AA 5C7VA 1XWYA 3PBUA 2DSKA 2PB1A 3NGFA 4L6OA 3OYZA 1UD2A 5A2CA 4JTIA 1IEIA 3OVGA 4G7EB 3VNIA 3AZRA 5AYBA 3ZWTA 1O5RA 2POTA 2BC0A 4CU8A 2W9MA 2ZUMA 3GW3A 4FR1A 2YPIA 3GRIA 3QGKC 3BJFA 1EBGA 1RSCA 2OMAA 3B8VA 1D9EA 1JR1A 3AMCA 1GYLA 1LYXA 2VELA 3CGTA 4HK7A 3AI0A 1JOAA 3OZMA 4MJZA 1VFFA 1ELSA 3M7WA 3CZGA 4AWEA 3SCPA 5I03A 4GKTA 4LAKA 5DY2A 3PTMA 1ZZMA 1QPKA 3GR7A 4UCFA 1VQTA 3AIBA 2OWWA 2UY2A 5GPRA 3RYSA 4CQ8A 4DJEC 1IXNA 3KOYA 1GJPA 2HMCA 2VC5A 3BCJA 5FF0A 4JZ5A 3VC6A 3B03A 2DSWA 3AIWA 1XCFA 2F38A 2QHAA 4D6GA 1IQ8A 1ZKQA 4ACYA 4UZSA 4GIRA 3WO8A 3VM7A 3RU8X 2E1DA 5GNYA 4FAMA 4YHEA 1TMQA 6ENLA 1SJCA 2V8ZA 4X22A 1TPDA 4EQWA 1TUFA 2D20A 2ZRYA 3WUBA 2P3EA 1ZY9A 3NDOA 2CHNA 3CH9A 4HSNA 4IUOA 2XM1A 1S39A 3CAWA 1BVZA 3OZPA 1XW8A 3VUSA 3AQUA 5IM51 4KRUA 1IXOA 4FX7A 2PWGA 3BW2A 3A23A 5CPTA 4HU3A 2W79A 4Y8FA 5ABFA 2FFCA 3VDHA 1W9XA 1TB3A 3T0BA 4O0QA 4MIMA 1MEIA 5E9XA 4D6DA 1W9VA 2V5KA 3ARSA 5DO8A 2CZ5A 3C52A 1VFHA 3M1ZA 4DNMA 2C0AA 3PC0A 3KS6A 4NF7A 1UZ4A 3SO7A 3FXYA 2YFNA 1JEHA 4L9YA 4S3CA 1Z6KA 3WD0A 3ATZA 3RM9A 1O6IA 3RLVA 1JPHA 1B2YA 2HNEA 1PJ9A 2DVUA 2EG6A 3JZUA 1R30A 1J4EA 1WA3A 3LD5A 4S1FA 1AD4A 1V6WA 4F8XA 3KL0A 4MNJA 1W1A1 2OG9A 2NQ9A 3JVAA 4CD8A 4AMAA 1JPMA 3W1UA 3VO0A 3OYXA 1Z89A 2WVSA 3W27A 1A5MC 4K36A 2YB1A 4FIQA 3UYIA 3WLKX 3U8GA 1XF0A 3II4A 2OT0A 3ARYA 2AQOA 2CESA 1U5JA 1X2GA 1CECA 4JQ3A 1WXYA 3F4WA 1J12A 5TNVA 3O6AA 1LRQA 2ACUA 3VPLA 3TKFA 4ZOHB 4FXJA 1Q13A 4EF9A 1XKJA 2VRKA 1EEXA 3ANVA 1NF0A 1NOFA 2CERA 2V81A 1UZDA 5J04A 3QLDA 5GJPA 3FV9A 5C9RA 2FQIA 3OA5A 4D1IA 4JY8A 4MWAD 3JR2A 5L9FA 3MUZ1 6XIMA 3FGCB 4LC8A 3DHDA 4D6HA 5E09A 3R12A 3DFHA 1X7FA 2P8BA 3UXAA 2F84A 1JZ8A 1I2NA 4JTSA 4LQ1A 9CGTA 1PDZA 1PKNA 3RPDA 4LEQA 3GXIA 4C6PA 4QDMA 2L5HA 4O57A 2XVLA 1JPIA 2J27A 2G3JA 3GH7A 3QQ0A 4M29A 4GZEA 3EA1A 4BS0A 1A3WA 3T0AA 1US2A 4V1YA 4OZOA 3OQ8A 2VDHA 4AD4A 1YDYA 3B97A 3CHDA 1JDAA 2A0NA 4P5UA 4CEXC 2XHYA 4L6HA 2D24A 4GABA 2GUBA 3NQCA 4DJED 3GXDA 5D30A 4LS2A 4HHMA 4ZO6A 3BPWA 2HE8A 3D47A 1XG4A 4WDWA 4KFPA 2BC1A 4IQJA 4NZJA 2VEGA 3BLEA 4HNNA 4M7SA 3THAA 4WQ6A 3ZM8A 2HPIA 2PGFA 4QR6A 3UWUA 1DEDA 1KFLA 3N6QA 3ARVA 3PTQA 4M6UA 1R47A 1E5NA 2BS9A 2VUNA 3F2BA 4QG6A 3TZFA 3TA9A 3VOCA 4IQLA 4O54A 5DT7A 5TD4A 3W6MA 3LADA 2WZHA 5GVJA 4JOMA 3OJGA 1EF2A 3WEMA 1VPXA 2YSWA 1UR4A 1O4UA 1UKOA 1W9PA 3TTYA 3DYMA 3G1XA 3R6IA 1Y5WA 4LUSB 1PYMA 5M3WA 1S2TA 1A4LA 3DH9A 2NVAA 4MKSA 3C2FA 4H7VA 2X41A 1LL4A 2QUVA 1POJA 2YXGA 3BOLA 2ZXDA 1NEYA 3BQ5A 3QOMA 1QTWA 3IVSA 3SUSA 4EMWA 3PULA 3GTFA 1H7OA 2F9RA 5HULA 1YRRA 3AS3A 1W3IA 4DY1A 4LT9A 5D2YA 3W7EA 4IIBA 2JKPA 4R7WA 3IVTA 4RDYA 1CXKA 1UWAA 4H4IA 2E3TA 2PDYA 1GZJA 1HGWA 4LYRA 4LC6A 1E0XA 3ZWSA 2GZXA 3Q6JA 3NQMA 3ZJ8A 1E4MM 3GVWA 2D1ZA 2YB4A 1R86A 4JTLA 3CUIA 6CGTA 1IIHA 2ZUSA 1XQKA 4ATWA 2Q09A 2XU2A 3F4VA 4ENLA 3IANA 1IV8A 3CGCA 1H4PA 1B1YA 1TA3B 4ZO9A 5LNUA 3AALA 3TCEA 3R94A 2XINA 5I79A 1JZ4A 3EWDA 3KUMA 2Y5JA 4AZ7A 4IMFA 3WMLA 5FSDC 1Y65A 3QF0A 3N9KA 4GH3A 3RM8A 3ZT6A 3NFUA 2G41A 1TV7A 3CEPA 4ZSTA 5IXEA 4GQGA 1AODA 4PE8A 2PP0A 4QE4A 1BSIA 2PTXA 3P81A 4JYEA 3WQ6A 1CW2A 4D8AA 5EB8A 4DBEA 3FSUA 3P7YA 2ZA3A 1GONA 1BYAA 3A4JA 5A2AA 4L9XA 4PMVA 1ZDLA 4KW2A 4A8LA 2V5DA 5G5IA 5BXPA 5A2BA 4P61A 2HROA 1NY1A 5HUOA 1YPFA 3VGEA 2YBTA 1W8SA 2EQDA 4GCAA 2E8ZA 1ZU8A 1XLGA 2F6XA 5D2XA 4E2VA 1NSJA 4WKFA 3B9AA 4UTMA 4GY0A 2V3DA 3M07A 4RDVA 2PTWA 3L4YA 3N2XA 3KBNA 3AIVA 4Z08A 3RR1A 1AA1B 1O60A 2CBVA 1SMAA 1NIUA 3CZKA 3TJIA 1WQ5A 3MO7A 4H9VA 3FHQA 4WX2A 1XP3A 4YXGA 4J1OA 3EXSA 3C8FA 3MHFA 1HJXA 1GOIA 1DPMA 4JTAA 4ZA0A 2J47A 4NNBA 2ZCGA 4H50A 4DO4A 3HW2A 1W8GA 5LIWX 3TTEA 3OTRA 2V3AA 2OGYA 4N2YA 4XVEA 4ORIA 1CWYA 1UKQA 4LY8A 3NM1A 3ZIZA 2OELA 3W28A 4QE5A 3KCOA 1E1FA 1XBVA 5LXXA 1LOLA 2UY4A 3VIJA 4RE3A 3TEVA 2R94A 4GC4A 3PK7A 5DELA 4C1LA 3NDYA 4LB3A 3VILA 2D23A 4UQBA 4Y8EA 2VCCA 1ZALA 2I56A 3QC0A 1A3HA 2WW5A 4NNAA 3W7IA 3DX5A 4H7ZA 4Z2GA 3T42A 4DJDC 1J5TA 3EB2A 4F9DA 5D03A 4JYDA 3GXPA 1NTHA 2Q8ZA 4FPSA 1ITXA 2VI0A 1WDRA 3W00A 4U2ZA 3C0JA 4K8GA 2WHLA 4UMBA 3EX4A 4Z1CA 4MF4A 3GFZA 1GOKA 1WXJA 1XLMA 1YEYA 2J79A 2W55A 1MO0A 3IGHX 1C8XA 3AIUA 3MVIA 4JPGA 3E0VA 2GWNA 1GVFA 5KZDA 3S1UA 2RH9A 1EB3A 3I3DA 4DYJA 3CT2A 1JZ7A 2YLAA 4FI4A 1X39A 4M52A 4HA0A 2O56A 6REQA 3S9ZA 3E1F1 2VZOA 3B8UA 1R3SA 4ALDA 1TCDA 3AHTA 4TTGA 2WCSA 2YVFA 3GFYA 5DANA 1VGAA 1XSKA 3H7RA 4F0KA 1S2VA 4Q3MA 1E1CB 3ARPA 1TZ7A 3BMWA 2OSWA 1HW6A 3CNYA 4EF8A 2BASA 5DMYA 4GOAA 1G7UA 1UH3A 3VMPA 1YTEA 2XVNA 3EWBX 4ONVA 3VD3A 3W75A 2NVCA 3PB2A 3L5OA 4L4LA 2OKTA 3H2OA 5LA0A 4A3QA 5BXSA 3RITA 1EHAA 4RPPA 3UJEA 3RDKA 3DC8A 1QATA 3LERA 3ITOA 2NT1A 4IMDA 2PI6A 5JCKA 2YCKX 5CJ5A 3R58A 3CGDA 2QCDA 5IOBA 4UQDA 3G1HA 5FF3A 1XANA 3B0YA 1B54A 1OD8A 1YX1A 3TIMA 1N60C 4Z1YA 2H9AA 5LSMA 5FMHA 3EWWA 3KM8A 3L0KA 3VMOA 2POZA 2A7PA 2E6DA 4IGMA 1ESWA 1CXLA 3MV01 5C8BB 3R11A 2BDQA 2OWXA 1SPQA 3OG3A 1YDNA 4JNMA 2ZX8A 2GLKA 1XFBA 3A6OA 1IEWA 3EMZA 1CB7B 1TV2A 1S5NA 4ICNA 5AC5A 4HPGA 1KCZA 4B4HA 4XBJA 3KW3A 2CNCA 2C3DA 1GORA 2ZRXA 2YDSA 2YA1A 1VEOA 1VCGA 3L4VA 5CC7A 5A8QA 3L5MA 3M0KA 4JIHA 4BY3A 3WF2A 3HFYA 5H6HA 1MO9A 3FG2P 3W7QA 1EUNA 3ES7A 5FS8A 2G3FA 4IOTA 2EPNA 3FDKA 5CBJA 3Q4DA 1KM2A 4L5ZA 4XAFA 3IUHA 1A50A 2XIIA 3QQWA 1BG9A 3UZXA 2VC9A 2EO7A 2EAWA 4MWAA 1FWRA 1XIGA 4ZQPA 2XFFA 5AB3A 5BMWA 3VIHA 2GDUA 1OT2A 3TWAA 2WCAA 5I3FA 3WX7A 5AHMA 1DJQA 3V75A 3IPWA 1X1ZA 4OE7A 1TRIA 1JDFA 4EKJA 3UF9A 4RUBA 3IJIA 4U5IA 4UR9A 1QAPA 5AZ0A 4I6VA 2PDIA 2AGKA 3EX2A 1S7MA 3OGVA 1UHVA 1SR0A 3MSDA 4DJDD 4YVPA 4A21A 4GQ0A 5GNXA 1Z69A 4S39A 3KAOA 5LIKX 3ABXA 1BTCA 4QLLA 4BR1A 4OIFA 3W7JA 3ZQ9A 2QCMA 5EMKA 5CZ0A 4IJCA 2JEPA 1WDDA 1SZRA 3STEA 3SY5A 3KBVA 5I06A 4ROQA 4HNVA 3OW1A 1B3VA 4HOXA 2ICSA 2WC3A 3T4CA 1AJZA 2XIQA 2IPJA 5D37A 3EX3A 2J25A 2CLFA 4GRSA 5EMYA 4ADUA 3NVVB 1E55A 2ESCA 4NL1A 5DLCA 1RY8A 3SGGA 1UWIA 4LUJA 1TE6A 4P8WA 3FVMA 4AD0A 1GHRA 3I4EA 4AW7A 4MVAA 3EA2A 1XC4A 3L68A 4HCHA 4IISA 4NSBA 2YYUA 4ES4A 4HBKA 4HTYA 4DM2A 1WAWA 1MOKA 3Q58A 2JKAA 4PTXA 1IF2A 2E5CA 1QASA 4X2RA 2XUCA 4TVDA 1G01A 1K8XA 2QCNA 3U2EA 3USZA 4HTBA 5H8PA 3HPSA 1UZHA 3LV6A 4DBDA 3LCLA 2O9RA 4I9JA 4TXEA 1FH8A 1FP8A 1FWCC 1GG0A 1GKRA 4IICA 3L9CA 2J3NA 1RR2A 2JALA 2X1UA 3TU9A 1B90A 4CCDA 3C5QA 5I3JA 3QBUA 3QW3A 4Q7BA 3BSMA 5H2ZA 5FA5A 4JNZA 1JCXA 2WOQA 1QXLA 4QAIA 1X98A 4B5TA 4D71A 5K2ZA 4FX9A 4YCPA 3TFXA 5H91A 5FF2A 1N8FA 2J7CA 3WLPA 5ENLA 1KA9F 1EX5A 4C65A 3E0LA 3CU2A 4KGLA 4HSHA 4A3RA 1MQPA 3A4XA 4FF5A 2PD9A 2WHJA 1UZ1A 2NSOA 3T9PA 3GK0A 3MCNA 2A3EA 4XD3A 1NOUA 3TN6A 2DZPA 3FX4A 1EOKA 2H6RA 3WELA 3GY1A 5A6AA 2X42A 1U1UA 1QRQA 3GVQA 2CXGA 1VLIA 4AVNA 4XZBA 3KZSA 1KM0A 2IW0A 4A29A 5CLTA 2OLSA 1CENA 1QO2A 3ES8A 4FNPA 5HATA 3G1SA 1DWGM 3A24A 1BVNP 3LCWA 4QQ3A 3BL3A 1D8CA 4OU1A 4FLRA 4YWIA 1FDJA 3URQA 4H9XA 2J4GA 4GJJA 1HF6A 1XYAA 5E9AA 4OOZA 2OLHA 4DEFA 4E0CA 3VU2A 3MSGA 1B3OA 2CC0A 2VX5A 4HOWA 4PBEA 1HO4A 5EMUA 1FBAA 2HS6A 1IWBA 3A5VA 3KP1A 5A69A 3IVUA 1S38A 3CH0A 2WLYA 3NZQA 1J01A 3WFZA 4Q8NA 1V51A 5EYWA 4JNYA 4DNHA 3TNBA 1DL3A 1X8CA 3P6LA 2OODA 1E4LA 1TG7A 3U5YA 3UCDA 4IJBA 2P1FA 3RO6A 4GUIA 2QF8A 3VAVA 3H2EA 4J3WA 1E5JA 1TFVA 4AYGA 3PFRA 3H2FA 1EKOA 2FB2A 3FCPA 4EAYA 4J3UA 5CAHA 4L4MA 3DZ1A 1GT8A 5AY7A 4DZ5A 4AD5A 1JCLA 5FJTA 4DF2A 4PUWA 4PMNA 1XBYA 1GUVA 2JKEA 2X50A 3Q45A 5I3GA 5CZKA 3TA6A 4F9JA 2C1IA 4NZ1A 5JIPA 1Q6OA 3MUAA 7PTDA 1IEXA 4D6CA 5CKSA 2QULA 1UWTA 4H9ZA 3EPMA 3SR6B 4H3DA 5FJOA 4LCRA 4UBPC 3R8GA 4HZMA 2J8FA 3L2IA 3M0LA 5A8NA 1XFCA 5AVHA 1DIKA 4J2PA 4JTRA 2R24A 4A05A 2CLMA 1JI2A 2WKJA 3WQGA 4LAMA 3O3RA 5IBXA 1GVIA 1I2QA 1V0MA 3KE0A 1MZHA 3UXLA 2CEQA 4P8VA 3W83A 3WJZA 4Z0JA 4FP1A 3WG6A 1B3XA 1CEOA 4GLEA 2G0WA 1WUEA 3TFCA 2XZ9A 3SGZA 2OGJA 4P7LA 3TVAA 4PUUA 1SFLA 3EEZA 4D8ZA 4KCUA 4NRRA 4FX6M 1CTNA 2WCGA 2OB3A 1KCXA 4PUDA 4CQCA 2E5AA 1XIEA 3EANA 3O0FA 2VZVA 4AD3A 1LCOA 1EZWA 1BF6A 2FGZA 2INEA 3IEBA 3LSCA 1QI3A 1DJYA 4AVOA 1HKJA 5HWMA 1IT7A 2JGQA 2OCZA 3NXLA 3CT7A 2VQTA 2ON3A 3CUXA 3WJYA 3O06A 5A6SA 2A1YA 2WVVB 5FEPA 1A5LC 3POCA 1P7TB 4GXPA 3R1ZA 4FNUA 3BCDA 1W37A 5DRIA 2D2OA 3KTSA 4QQUA 1UOKA 2WKLA 3NIYA 4S3JA 4BA0A 4HYRA 4HA1A 3FOKA 3O6CA 5HNUA 5DN1A 1H41A 2FH8A 1D2KA 2GUUA 2R1NA 3UG4A 4DUXA 3LEPA 2HNHA 3L4WA 7A3HA 3PBGA 4HA3A 3U3HA 5M17A 2ISFA 4OV9A 2VEKA 4YVVA 3AXMA 3LM7A 3LSBA 3QYQA 1FWWA 2FJKA 4FLQA 3TC6A 4C90A 2QQ6A 2J7GA 1FEAA 1EXPA 2HSAA 4L7ZA 5KSWA 1TE1A 1JAEA 1RBAA 3DFYA 4Y7EA 4QCFA 4OECA 2I14A 1V3MA 1BTMA 2XN0A 2G5WA 1PIIA 2DJLA 1REQA 4NY2A 5L6UA 4DQWA 5CPOA 1C29A 3GQYA 2DUXA 3W2KA 3EDJA 3W9ZA 3WQOA 1A53A 5HQMA 2BVWA 3T78A 2PE4A 5M2FX 5HINA 4NT0A 4UTKA 4PL1A 2XFYA 1MW0A 1GW9A 4DXXA 3VKKA 1N7KA 4FOJA 3TNOA 3GTNA 4RZ4A 2E28A 2LLEA 1N61C 3TN5A 3BQ6A 2C7FA 3WBAA 1WNOA 4YTQA 1BYCA 1LROA 1MMFA 1UR8A 2DIEA 1X8FA 4JTFA 2NXGA 3W07A 4PEEA 4XO7A 3W7GA 3BO9A 2QZRA 1V3IA 3CPRA 1WOAA 4CCZA 1DJIA 1MZRA 3QZEA 1F9CA 7TIMA 3ARWA 1VBGA 3ARQA 2YAUA 3LCGA 4N4QA 4O19A 4M19A 1VEMA 1EZ2A 2G3MA 3NZ1A 3WH5A 2BY0A 2EQ8A 1JCJA 1M65A 3BAWA 1TVLA 1K9TA 1GVOA 1KRAC 3SCRA 1T99A 5CJNA 1Y0EA 2HQAA 4DYKA 3BG9A 1UYQA 3SQLA 2AL2B 1UH4A 2VX6A 3NQ6A 4GG9A 5LA2A 1GOWA 3FFSA 4RE2A 5AZ1A 4F0HA 3CWOX 1KWGA 2Z1KA 1VBJA 3LY0A 1DVJA 3UWEA 1VDVA 4DN1A 3O9NA 4K38A 1EGZA 5FJJA 1F6KA 3BC9A 1VPQA 2WSPA 3OLGA 5I3KA 2Z2BA 3W7HA 3DFQA 1A0CA 1ZB5A 4GPNA 3L4XA 1QJWA 1E1EA 2OEMA 1M68A 2AKZA 3NL3A 1LWIA 1PIFA 2J77A 2I9UA 3UU0A 1QU4A 3UJFA 2QLYA 3KFTA 1FVPA 4UTUA 2YA2A 1FWIC 1UJPA 1LDCA 1RK5A 1U33A 3IRSA 4LCSA 4H41A 3NZRA 1W54A 4FEZA 3OLDA 3SUUA 4YN5A 1HQTA 3MZ2A 1EIXA 3BZJA 3IACA 4PMJA 2XM2A 2DSZA 3IIOA 2NWRA 1XCWA 1XYMA 2IXVA 3NSMA 4JDBA 4OGZA 1KQYA 4EM4A 4UFKA 3CS2A 4AWSA 4M82A 2QVHA 3HGJA 1S5MA 1GRTA 3DFPA 2PDGA 2ZKMX 3VIOA 1GOQA 3FEQA 4K2SA 5AYXA 4GINA 3PUGA 3MC5A 1VPYA 1VZWA 4NKCA 2NUXA 4PB5A 3H70A 1OFRA 4G9PA 3B4UA 1UC4A 4IGSA 4HPJA 1C8YA 3MSYA 1DXEA 4HKPA 2EQ7A 2GH5A 1VHCA 2QPXA 3TWBA 3VD9A 3SJ3A 2I16A 1TO3A 1HZYA 1IT0A 1QVBA 1PDYA 4ZFCA 1RJPA 3PJUA 2HWGA 1C92A 1R46A 5BMXA 3M43A 4IFOA 4PCSA 4DF0A 3LBOA 4WJEA 3TROA 2IUZA 3M6DA 1YTDA 4F40A 1OJTA 3CZJA 4PMOA 2ISDA 1FXPA 4B2DA 4BF5A 3LA4A 4M24A 2WVUA 1R85A 1KBLA 2Y1HA 2OX4A 2VFDA 3DFNA 1R3YA 3C0SA 4J3SA 1I60A 4ZQRA 4ADWA 4AC1X 3ITXA 1W1PA 4PFHA 2RUSA 4UXDA 4KERA 2NX3A 3RAOA 1XINA 2NV1A 1GOMA 3TQPA 3ITYA 1OX4A 1JCNA 5LNWA 2P10A 1ONEA 2FZBA 3VDBA 1ZPTA 4ZTXA 2QMKA 1CGXA 1PXGA 1E15A 2Z26A 3E0WA 4UB9A 5D8ZA 4AVFA 4WLCA 4ROPA 4B92A 1W56A 3EA3A 2WM1A 2CYGA 1MXGA 5BWAA 4GR1A 1Q65A 5KVIA 5REQA 3PY2A 4RK8A 3WDIA 4BWLA 4RXGA 3N2CA 3BAIA 3HRDC 4O28A 1QFEA 4GMEA 1NHPA 1NARA 3T2OA 3T4WA 3DGHA 1FX6A 4QJ1A 3AICA 1W2PA 5G2IA 1JRCA 4ZXLA 1NHQA 2GVJA 1KTNA 2P3ZA 3WNOA 1D7YA 2X1IA 2ZWYA 1OSEA 3VIGA 1EJUC 4C91A 3RU6A 3QMSA 3ABRA 4MB1A 4UOJA 3KVKA 1XBXA 3MQTA 2E09A 3VIMA 3WEOA 5DMNA 2Y70A 3IUIA 3KL5A 1JCMP 1V7YA 4L1XA 4OUEA 2NQHA 5K4XA 4AZIA 4G5DA 4LYKA 5FJIA 5TF0A 5BW6A 1EDGA 2PCQA 3H4GA 3ELFA 3GC2A 3ZSSA 3PUDA 4EACA 4GKLA 3VOJA 4Q8UA 2ISSA 2F5ZA 4K7YA 3QGAC 2GSEA 3I6RA 4UTWC 1FECA 2ZA1A 4B3LA 3PUOA 3WD4A 4OUIA 1S2CA 2PDUA 5J5RA 1IT8A 3OB8A 4FXFA 3NL2A 4JFSA 1UR9A 4WKHA 1XPGA 4Y9PA 2ZZ3A 3QVQA 4AMCA 3L23A 3M0VA 3V5CA 3CBWA 4W87A 4NVTA 3CZ8A 1VFUA 3VGBA 3SN1A 4E2DA 3QH2A 2YQUA 4W9TA 2NUWA 3MY9A 2PZ0A 1SZNA 3CO4A 4H04A 2WJZA 1J0YA 4MTVA 4D9PA 4JN6A 3CHEA 5BCAA 2YVJA 3WBWA 4JDRA 1B30A 5CAKA 3UP8A 3ZT7A 4AF0B 4H6EA 4H01A 3ISIX 4GD0A 4PUKA 4GBUA 3UVAA 3WLSA 4MJ2A 4QDWA 1MUCA 2Z2UA 2YZ5A 4PMQA 3EKGA 1EL3A 4JQ2A 1AH0A 4LNCA 3A47A 1XGDA 1DJHA 3WLRA 4CD7A 1MQRA 3GU9A 5FL1A 1G0CA 3FK4A 4LAUA 4K8HA 3EDFA 3RIKA 2GR2A 3KLLA 1HJVA 3FKRA 3HMCA 3W88A 1GESA 4R3UA 3LYEA 4WEVX 3GDLA 2GUYA 3NUKA 4DZAA 5C71A 4IMCA 3AJXA 4C5YA 2P76A 4TQTA 2ATMA 1V6YA 4AIUA 4YTSA 2D0GA 1GK8A 4WJXA 3UXKA 2XWEA 1CGUA 1IIGA 4B5NA 1JD7A 1QNQA 1US3A 3PZGA 3W7CA 1V6XA 1P6BA 3UGRA 1TPC1 3WYZA 3H26A 3M0IA 2F61A 3IJ8A 1GCYA 3RJXA 4HA4A 1UR3M 2DZVA 2ALDA 5CPMA 4TX8A 4KH2A 1SW0A 2OFJA 3WNLA 2QDEA 1YE6A 1KGWA 1KV5A 3NQFA 2OEKA 1IWAA 3SIMA 4KGJA 1VFOA 3H55A 1CXFA 3HG5A 2RAGA 1L2UA 1QNOA 4HN4A 2CWXA 1MW3A 2XH4A 2P53A 2FTWA 3EGJA 3CB3A 3ICJA 3U2CA 1G4PA 4FK9A 1TPB1 1TIMA 1SSGA 2Y6ZA 3KXQA 4H4UA 3DG6A 4ZEPA 3VFLA 3WQ8A 8XIAA 4LB4A 3VE9A 3LV5A 3I7QA 5C7HA 7CGTA 2ZX5A 1TWZA 3GDRA 1VCVA 1BRLB 3W2LA 4MLRA 3G1YA 3XINA 3KRUA 5B7YA 2VRQA 1TX0A 4K3ZA 3IJ9A 4EMJA 1FH9A 3HTWA 2FPTA 4PUEA 3UFYA 1ISVA 5B7ZA 4GUJA 1ZBKA 3UZJA 1NJJA 1WB0A 1F74A 2V38A 5CSRA 2A7NA 2CLEA 2PDNA 3DKJA 2YCIX 4GJIA 1SJBA 4Z2HA 1LM1A 3S3GA 3T55A 4HMDA 3W1XA 1JL8A 1YYAA 2FLIA 2ATSA 3MW7A 4XQ6A 2V6OA 4JQAA 1F8IA 1PKLA 3RPTA 1WKEA 5MKGA 1TV3A 4K68A 2DQWA 5BU9A 4MNLA 3L5LA 3PZQA 1ISZA 1FO4A 3PHAA 1UD3A 5A6BA 4LGXA 1Y8BA 3GHSA 4B3ZA 2YOCA 1MDLA 4DJFC 4QAWA 1C9WA 1QNSA 5HMSA 4HHHA 3PFMA 1QPRA 2JBMA 3AIRA 3M5XA 2Z6JA 3BG5A 2VVSA 2FB3A 5BOEA 6TIMA 3OEXA 2HBVA 3F2CA 1C3FA 4IJRA 3R8HA 6ALDA 5I3DA 4P7NA 1KCKA 1IZJA 3P5ZA 1AD1A 2HISA 3U7VA 1KXTA 5D33A 2V2CA 4QTGA 3PZTA 2V2DA 1XRSA 4A6GA 2WMIA 2ZZ5A 4GGHA 4QBXA 1FWBC 1O5XA 4J3XA 5CSYA 3W1LA 4OFCA 2RDTA 5EU9A 4JFTA 3C86A 1YBQA 1R5YA 3QV8A 4X3ZA 4B5VA 4HK6A 3QY7A 1AOGA 4BF7A 3NQ7A 1XLHA 1NDZA 1WDWA 3BJSA 1I0DA 1ICPA 3V3WA 2QJGA 2V5LA 4CEUC 1PAMA 2OO0A 1I9CB 4GNKB 1A80A 1OFOA 3T8LA 3A13A 3SR7A 1TJ0A 1MFVA 1FCQA 3RPMA 1VAHA 2HS8A 3GXMA 1JFHA 3LK6A 4MM1A 3H4XA 1T6MA 3C56A 5DFAA 5D9NA 1A4MA 5K3VA 5LXEA 2WANA 3C3UA 1TCMA 2J7HA 3NVTA 1XQLA 4C6FA 3KHDA 3FVDA 4LEFA 3S8HA 2HJPA 2YZRA 1VC4A 3BMXA 3MP5A 2EG8A 3WIJA 1C9DA 4Z2IA 4J3ZA 2NWSA 4FS9A 4CU6A 2O9TA 4L56A 3QM3A 3DJJA 5LNSA 3TK7A 5HMFA 3H22A 4HMCA 4M56A 1PS9A 3SADA 4N4PA 3QKEA 3OVQA 2QNEA 4IX0A 1E9LA 2QYGA 1KRBC 1DXLA 1ZBWA 3S4TA 1E71M 2YBUA 3TOYA 5IHRA 2CETA 3P8IA 2D69A 3CASA 4IQEA 1THFD 4QDPA 1C8VA 5DT5A 4IPIA 4MG4A 2RJHA 4LX4A 4BQ3A 2CCRA 3A3HA 3G22A 4W8LA 3RRXA 3RMEA 1QW8A 1SGJA 4PBGA 5EMJA 3KLJA 1M53A 1E70M 4QNEA 3BLDA 1MDRA 2GYIA 1TPUA 2Q01A 4AFYA 4W86A 2RFGA 3VKDA 3CV1A 4Q32A 3TYUA 3ALGA 1PV8A 5LZLA 3UT0A 4GWEA 1YXYA 5LA1A 1RH9A 1X96A 4NEVA 3SRDA 3HGOA 3B9JB 3TYDA 4GRTA 4LV9A 4AU0A 1DP0A 3IJLA 1KO0A 2IPWA 2WMFA 3N73A 5JCMA 4FR6A 1A0DA 1OK4A 2DZSA 4FIRA 4CD4A 2WPCA 5GJMA 3ZVHB 2J7FA 4LYQA 3ARXA 5JH1A 1BWKA 1LG2A 5CC6A 4TOQA 5FS9A 3A21A 2WOIA 2ZDRA 1H63A 3DYOA 2E68A 4GNVA 3QFBA 1PUDA 1E56A 4EXBA 2YW4A 4B9YA 4W8BA 1BVWA 4AQLA 5JMUA 4K1WA 3FJLA 1ZSXA 2DT3A 1O5QA 1UKTA 2H3DA 2YBVA 5DX7A 3HV9A 3I6TA 1J8VA 4RE0A 2PURA 3DFTA 4XV0A 1L2QA 4QNWA 1XKYA 5AC8A 2PGWA 2V82A 1MUWA 4UR7A 1JYVA 1B4EA 2HK0A 2ZXAA 3TN3A 3KHJA 3ITLA 3REQA 4H2HA 1TREA 3SFWA 4RNIA 3EWCA 2HXUA 3EOLA 1Z7AA 2GGEA 1C7SA 3UGVA 2Q3RA 4NXSA 3M0MA 2IQ0A 3O16A 1B0IA 3U2ZA 4UNLA 1EHNA 4IL0A 3UD6A 2NV9A 2V9DA 1XSJA 4PZVA 3TYBA 3M41A 2GOUA 1CCWB 4TU1A 4LUIA 4UTTA 3HU7A 1GW1A 3KWSA 5KTLA 1J6PA 3R89A 4JTCA 3ZSTA 4EMIA 3CIWA 4AIEA 2J9ZA 3HGRA 5BRPA 3ABOA 1LRNA 1YLVA 4UQEA 5T9CE 2TODA 2WYSA 3GO2A 1GOXA 3TLLA 2CFYA 3CUFA 3ZOAA 4ZCWA 1NWSA 3VMNA 4JFUA 1R2SA 3C3NA 2P50A 3NSXA 2Q71A 3VGDA 5DCBA 2WC4A 2Y5SA 4ZOCA 2ZADA 3SZ8A 4DI9A 4M0XA 1PSCA 2R9RA 4DXVA 1UUOA 5CC3A 1LUCB 1T0OA 3SECA 4EWND 1UC5A 1R6WA 3DECA 4AZGA 1LL6A 4DM1A 2O55A 4N6FA 3F5JA 1Q8AA 3U5UA 1S1PA 4DUWA 5FEXA 4Q22A 1E4NA 4WVXA 4XAPA 4QE1A 3OIHA 4ZSUA 3T7VA 1N62C 3V5OA 1V6VA 3LLFA 2GQAA 4O53A 2YFOA 5HPOA 3TN4A 4NZCA 5BZAA 1V3LA 2XFWA 1KM6A 3AIQA 1H7RA 1EEPA 3B9EA 4MWAE 3K8MA 1IZCA 4O8RA 4S3EA 1ME7A 1PWMA 3S5NA 2FYMA 3CK5A 5D4YA 1M1BA 3G6MA 5T8GA 1DJGA 3LI0A 4WDXA 4EQSA 5E0FA 2PGEA 2DY3A 2Z24A 5HK4A 3M9YA 3PBWA 1KTCA 2J13A 4BHYA 2DV0A 3EMQA 3OPSA 4V28A 3LOTA 4O8AA 1TV5A 5HMEA 4UOQA 3PBYA 4M6PA 4Y96A 2EPLX 2RDUA 2AAMA 3GHTA 1LT7A 2W4XA 3W72A 2E0PA 4RZ6A 4AHOA 3BURA 1DJNA 4O18A 1W9BM 3N17A 3GFXA 4ICMA 2W63A 3SEPA 1QI5A 9RUBA 3A22A 3DDMA 4TUFA 4XZWA 1J0ZA 2J78A 3Q67A 3GH4A 1Q6GA 3LX9A 2QPSA 3CYJA 5A3HA 5BYWA 4Q7IA 3RNMA 3B9NA 3GIPA 1RCQA 1HUVA 3W0KA 3HGSA 4ACZB 4IP5A 3WLHA 4LA1A 1DE6A 3AHXA 4UFLA 4TV5A 1GVYA 3LCFA 3ZT5A 4H00A 3SRKA 3B0UX 1F3PA 2FGLA 2QDHA 2R1MA 1O7AA 4ZB0A 2YCEA 1EGMA 4IMAA 5AHIA 5CG7A 3SQPA 3DBNA 1DJWA 3BOFA 2NUYA 1LZOA 4CVUA 3ZJ7A 3W23A 4FXRA 3MMUA 4C6BA 4ZGYA 1Z3NA 4H6RA 4Z2LA 1WCGA 4HGXA 3PTKA 4J27A 1GSNA 3LM3A 1W3HA 3NM3A 3VZZA 6PTDA 1HKVA 2Y7DA 4GIYA 4HNCA 4C6DA 2WK2A 2VWSA 3AYRA 3L0GA 4GYJA 4J3TA 4ZODA 3IGXA 1BKHA 4H8VA 3O8AA 4DWSB 4FOKA 5JBDA 2ZC1A 1Q7MA 1YE4A 1LWJA 3MYOA 1AK5A 4QISA 4EK7A 2OWCA 1SQ7A 3G3MA 4RV3A 4Q8QA 4RLIA 4I7UA 1J6OA 1N8IA 1S3TC 1FWHC 2G50A 5A95A 2WSRA 3CM4A 1BPLB 4LXFA 4W84A 2ZICA 4IH3A 4E4PA 2GGJA 2AQWA 3BW3A 2O7QA 3MHGA 1Y7VA 2GR0A 4R34A 4CD5A 4MFDA 2FHCA 3IRDA 3KRSA 3W86A 3ONBA 3EX1A 2D2JA 4UQ9A 1O68A 3FHAA 4MY9A 3AWOA 1I0BA 2QJNA 4S2CA 2Y7FA 1LOSA 2WJDA 5AFDA 4GJ1A 4KEMA 4BEUA 4GXMA 4S3AA 3TC7A 3ZLGA 2HPMA 2EG7A 4QROA 2Z1XA 3OODA 1GREA 1J0HA 1WDQA 3S9YA 5K4ZA 1A0EA 1PTAA 4Z1AA 4EWJA 3QRHA 1GJWA 3RLHA 3G0SA 5HNNA 3LNMA 1I4NA 1L8PA 2EBNA 1XLDA 4F0SA 4TIMA 4XBSA 5CXPA 2W6RA 5AHNA 1FWEC 5G2WA 1JG9A 4ZOAA 3GVRA 1RP9A 4YS1A 3KZPA 4BQ4A 1B9BA 1HTIA 3IARA 3R0UA 1XYFA 2GJPA 4LUYA 1ZL1A 5G4HC 3CV2A 2TRSA 2FJUB 5M03A 3RF9A 3ZLFA 3UNDA 4LPCA 4O4WA 3PWGA 2XVKA 3W7DA 4WSKA 4ZFMA 3WNPA 1D7FA 3KBMA 1AQHA 3LLDA 1H62A 4LF1A 5DBTA 4XAZA 1FWDC 2QJJA 4HNUA 3RG6A 3G2GA 1AH3A 4GI4A 3CLMA 4I8YA 3GIQA 3WMCA 2KX9A 3ENLA 4RV8A 3EWUA 4M3PA 3E49A 2ZX7A 3LXAA 2WSYA 4V27A 1UMYA 3SRHA 5C70A 1W9DM 1OC6A 3W2MA 3KBSA 1WKYA 1RQBA 1KBBA 1TKKA 1N8WA 1MSSA 2IQTA 1ODZA 1EBDA 2PRMA 3AUJA 4E8DA 1XGEA 2CHRA 1W3NA 5EA9A 3V36A 1AVAA 5I3HA 1KGUA 2FKPA 3PN8A 4MADA 5A6LA 5I23A 1Z42A 3OBAA 3A12A 2W0UA 3NL6A 4RPQA 1ZXIC 3GE7A 4YTUA 1RCXB 1XIJA 5EMLA 1QI4A 4JXCA 4DO6A 3LB8A 2JK2A 4ADTA 2PDXA 5D2WA 5IDZA 1K77A 3VGHA 1WXZA 1FFVC 4W5ZA 2GVLA 2B4GA 3EZ4A 3NRZB 1OFPA 4C7FA 1W17A 2YDAA 4MGGA 3O6YX 4EX4A 1K8ZA 1NDWA 4DYEA 3BSHA 1Q1WA 4US5A 3P3BA 1K1DA 5ABFB 5HWJA 1AG1O 3ZR5A 3MMTA 4XISA 1WUFA 3UPWA 4UFHA 3NVYB 3UG3A 2XH2A 3MMDA 1LBLA 5C9ZA 3QHOA 4C6MA 2ZZ7A 5M1TA 2BXYA 3NWRA 3KOFA