4F4RA

Crystal structure of d-mannonate dehydratase homolog from chromohalobacter salexigens (target efi-502114), with bound na, ordered loop
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
408
structure length
408
Chain Sequence
YFQSMMKIRDAYTIVTCPGRNFVTLKIVTESGTHGIGDATLNGREMAVAAYLDEHVVPALIGRDAGRIEDTWQYLYRGAYWRRGPVTMTAIAAVDMALWDIKAKAAGMPLYQLLGGKSRERVMTYAHCTGQTIEDCLGEVARHVELGYRAVRVQSGVPGIETTYGVAKTPGERYEPADSSLPAEHVWSTEKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAARLGKAVEPYHLFWLEDCVPAENQESLRLIREHTTTPLAIGEVFNSIHDCRELIQNQWIDYIRMPLTHGGGITAMRRVADLASLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQEHMPHTDETDAVFPHDYRFEDGHFLAGESPGHGVDIDEELAAKYPYERASLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
publication title Crystal structure of D-mannonate dehydratase homolog from Chromohalobacter salexigens (Target EFI-502114), with bound NA, ordered loop
rcsb
source organism Chromohalobacter salexigens
molecule tags Lyase
total genus 154
structure length 408
sequence length 408
ec nomenclature ec 4.2.1.39: Gluconate dehydratase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 4f4rA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 4f4rA01
2PP3A 4ENLA 2PS2A 2OQYA 3DGBA 2GGHA 2PODA 2P88A 3ES7A 4DN1A 1MRAA 3H7VA 1KKOA 3QKEA 1JCTA 3DIPA 4MGGA 3IJQA 3V5FA 1KD0A 3RGTA 3SN4A 3N6JA 4X2PA 4KT2A 4E5TA 3H70A 3I4KA 1ONEA 4J3ZA 2OLAA 1JPDX 2HXTA 2GSHA 2PTZA 2DW7A 4ROPA 3U9IA 5FJTA 4Z17A 2PTXA 4H1ZA 1MDRA 5EU9A 3DEQA 3D47A 3DESA 3FCPA 4HCHA 1PDZA 4DXKA 3DERA 2PGWA 2CHRA 3ZVHB 2FKPA 2OX4A 3NFUA 2OZ8A 1BQGA 2AKZA 4DX3A 4IL0A 3NO1A 2O56A 2P8BA 2QDDA 3H12A 3DG3A 1WUEA 1IYXA 2QGYA 2GL5A 1EC9A 3PWGA 1DTNA 3MKCA 3S47A 4IP4A 3BJSA 3SQSA 2PSNA 2OPJA 4KPLA 3ES8A 3VCCA 2PP1A 3ZVIA 2ZADA 3THUA 2XH7A 3DFYA 4EWJA 2OZTA 2XH4A 3JZUA 3UXKA 3UXLA 4DWDA 2NQLA 2GGJA 3RCYA 5FJOA 4HN8A 1XS2A 3DFHA 1SJCA 1EC8A 1XPYA 3VC5A 3FV9A 3R25A 3V5CA 4ZCWA 3UJSA 2AL2A 1MDLA 3IK4A 2ONEA 3CAWA 2XGZA 3N4FA 3QN3A 4GMEA 4Z1YA 3R0UA 3RRAA 2I5QA 2PA6A 2PTYA 5BOFA 1TZZA 7ENLA 3UCCA 3D46A 2PP0A 3TJIA 6ENLA 4A3RA 2QJNA 3N4EA 4GFIA 2OKTA 4E4UA 3FYYA 1ECQA 2MUCA 4IZGA 3EEZA 2POZA 3VA8A 3I6TA 1YEYA 3R11A 3QTPA 3OP2A 3VFCA 4JHMA 3MZNA 3ZVHA 5FJRA 1SJDA 3TW9A 3Q4DA 4G8TA 1SJBA 3TCSA 1OEPA 3S5SA 1TKKA 4FI4A 4E4FA 4A35A 1MNSA 3UGVA 4JN8A 3CYJA 3QLDA 4HCDA 4JN7A 2OZ3A 3U4FA 3SSZA 2PCEA 4HNLA 3STPA 3BOXA 1WUFA 3P93A 4IP5A 1NELA 3TWBA 4K8GA 2PU1A 3NXLA 2AKMA 3V3WA 1P43A 3GC2A 2P3ZA 4DYEA 4GYPA 3R1ZA 3DG7A 2RDXA 3RR1A 3MSYA 2XSXA 4GISA 1R0MA 3MY9A 1R6WA 3SN1A 3IJLA 3T9PA 3FVDA 1EBHA 2AL1A 1W6TA 4MKSA 3TJ4A 2QDEA 4HNCA 4KWSA 2GGGA 1PDYA 2PPGA 3IJIA 4IT1A 3H8AA 4DHGA 1ELSA 4J1OA 2ZC8A 3I6EA 4G7FA 5J04A 1JDFA 3RITA 2HXUA 2GGIA 3T6CA 3VDGA 1MUCA 3KUMA 3OZYA 2AL2B 1EBGA 4HCLA 3VCNA 3GY1A 4IHCA 1KKRA 3EKGA 2OQHA 3MQTA 2PGEA 3OTRA 3TTEA 3P0WA 3PWIA 3ZLGA 3R10A 3B97A 3PFRA 3T8QA 4M0XA 2GDQA 3UJRA 4GIRA 5FJUA 3JW7A 4H83A 3DG6A 3T4WA 2OVLA 3K1GA 3RO6A 2QVHA 1EC7A 3CB3A 1SJAA 4YWSA 2XH0A 2GGEA 2P8CA 4M6UA 3BSMA 4E8GA 3MUCA 2PTWA 1RVKA 4F4RA 3ZLHA 3V4BA 4FP1A 2PMQA 2XH2A 3GD6A 5IDZA 2FYMA 2QQ6A 3UJEA 1BKHA 4KEMA 4HPNA 4K1WA 5FJPA 3GO2A 3CT2A 4GYPC 3MWCA 2DW6A 5ENLA 3OW1A 3NZGA 3ENLA 3VC6A 1KCZA 3P3BA 1TE6A 3QPEA 2QJJA 1JPMA 3DDMA 4ZA0A 1FHVA 3ZLFA 3TWAA 3JVAA 3CK5A 4IL2A 5BOEA 3OPSA 2OFJA 2PU0A 3CXOA 3OZMA 3N6HA 3FJ4A 4E6MA 1FHUA 3HPFA 3TOYA 1NU5A 4H2HA 4A6GA 2MNRA 4K2SA 3TQPA 4GGBA 1L8PA 3UJFA 1F9CA 3SBFA 4HYRA 4MMWA 3R0KA 3UCDA 3UJ2A 3Q45A 2P0IA 2OG9A 2OO6A 3SN0A 2QJMA 1E9IA 2HZGA 3FXGA 2HNEA 4GGHA 1P48A 3SJNA 4H19A 3PK7A
chains in the Genus database with same CATH superfamily
3A22A 2FJUB 1RHCA 3THDA 1US0A 3W7GA 1DQWA 2WMIB 3N3TA 4A8LA 3MUAA 2PFHA 1W2PA 4GUFA 4D6EA 2O92A 1JQVA 3WMBA 1QHPA 3P81A 4EWND 4C5ZA 5JBEA 3H2CA 3GFXA 1NHRA 3M5YA 4L9XA 4PMRA 4AWEA 1YDYA 1LOQA 4ZO8A 3U2CA 4HZ6A 3B8IA 2VUYA 1T40A 3WO8A 4RE2A 4A4AA 5I3KA 1AG1O 3WQ8A 1Z8AA 4L61A 3NGFA 2V3BA 2VCAA 2YOCA 4R7OA 2WQDA 2JKAA 2BXZA 4BF5A 3FXYA 2WZMA 3L0KA 3ZWSA 3HBLA 2CLPA 2ZX9A 4EQXA 2CIPA 3E2VA 5A94A 4DXKA 2TPRA 3GUWA 3WQ6A 2PRHA 4IMEA 2XM1A 5BXTA 1UKSA 3FEQA 1HQTA 3FFSA 2VQUA 1BQGA 1YXDA 4IMFA 3ELFA 3VILA 3GRSA 1H51A 1SFTA 2P8BA 3O63A 3VD9A 3G0UA 1Q2RA 3FOKA 3S5NA 3CEPA 4UTUA 5CPMA 3CH0A 3DJJA 3T40A 1FWRA 1KBLA 1OFDA 2XIMA 4GNKB 2HROA 4NZCA 4HPHA 2PWEA 3QQWA 1I1XA 4UQBA 5KVIA 3RJXA 1RBAA 1M6JA 4GE8A 3MDWA 1ZAJA 3GXFA 4L4PA 3NQAA 4WDTA 4CQDA 2W67A 4IMAA 1RJPA 4GO8A 4EPBC 2OSYA 4WD0A 4FLSA 1E0VA 1J2WA 3SFWA 2H9AB 1S38A 1FCQA 3GXTA 2B7NA 2WNZA 3O0FA 3GS6A 1TPB1 2C7FA 2P0OA 1QR7A 3QPYA 3MZ2A 1R7OA 2WK2A 2AQOA 2W79A 4HN8A 2J7BA 2RABA 3PTQA 4MYAA 4X2RA 2H6RA 2ZZ5A 3M64A 1A47A 4QBXA 3QN3A 2OU4A 3R0UA 3RRAA 4TV5A 3S6OA 2JFEX 3QGKC 4NX5A 4REQA 1C8YA 3C0LA 1EHNA 1GOMA 2J7EA 3IIPA 4Y7EA 4DRSA 1YADA 3SR6B 3PJUA 4A8NA 3C0QA 2E25A 1A5CA 1KM6A 1WKDA 3BAIA 3QFWA 3EEGA 4DYKA 2WVVA 3DENA 2GJXB 1B3XA 4AD0A 4M6QA 3DI1A 2C71A 2C1GA 1XQLA 4QJ1A 1B4KA 3G1VA 4YWIA 3I6RA 5AZ0A 5I07A 4RV8A 4NI3A 5CC6A 2O9OA 1NP2A 3NSMA 3VFCA 3RM8A 1WAWA 1TYPA 3LPPA 4MB1A 4DAIA 5M3WA 1J8VA 3N2TA 4PMDA 4AY7A 2BVYA 2OR2A 3KWXA 4M81A 4MUPA 1SW7A 4M82A 1GREA 4QJ4B 2NXIA 4BQ3A 2CZVA 2CLHA 2OZ0A 2P1FA 4HNLA 2W55A 3R2GA 4UMBA 4DXVA 5FA5A 2CFYA 3A7AA 3TROA 1ME7A 3SGUA 3AI0A 1WDPA 1EHAA 4TR9A 1ZENA 4E4PA 5A6AA 2RDXA 1YPIA 1DJWA 2Y61A 3W85A 5JU6A 4L5ZA 5DLCA 2NUYA 2A1YA 3WJXA 4XZWA 4ZBCA 2Z25A 3KX6A 4C90A 3I7QA 3THCA 2EQDA 4FF5A 4ZE4A 4N9BA 1V6WA 3TYBA 2FTYA 2PWVA 4UCFA 8XIMA 3N2BA 3LSCA 4GR1A 1OIMA 5BMWA 1QNOA 2AAMA 3PUOA 4XKYB 3UR7A 5KZMA 4UTKA 5A2CA 4Q8MA 1CB7B 3W00A 4DBWA 1OADA 1LP6A 4AZCB 4LAMA 3U8GA 1XLLA 5KITA 2YLLA 2VYOA 4GIYA 2CLEA 3OZYA 3E2QA 1OG0A 3E0IA 4ZMGA 1FBAA 5CPSA 1LRQA 1XISA 1Y5VA 4JTUA 4WOZA 5IBXC 3PF3A 2D3NA 1IZCA 2WO5A 2R1KA 1GVIA 1J0HA 3OG2A 4OOUA 3WUFA 1XV8A 4AWTA 3MDUA 1ZPTA 3CWHA 4NASA 2ZX5A 2QVHA 1XJBA 4RZ6A 2A3EA 1GOKA 1EIBA 2G37A 4GABA 1XSKA 5LNSA 1UR3M 4UR7A 5H91A 3ANUA 4EM4A 4GZEA 3H54A 1J0YA 4J3TA 4O1FA 2WSYA 3IV8A 2R82A 1FCBA 5HR7A 1W9BM 3SIMA 4HSHA 3W07A 2PBGA 5CZTA 4MJ2A 5BU9A 4UTTA 5KMYA 5IDIA 1Q63A 1KRCC 1XGZA 3MMWA 3BCFA 4MUZA 3A9BA 3DGZA 3MP3A 3OW1A 5FF7A 2JEQA 3BAXA 4DZHA 5K7JA 2XVPA 2Z4GA 2V0TA 3SADA 3QPEA 4H6EA 2YZ5A 4W4QA 2P76A 4A3HA 4WKFA 2E9BA 3PZOA 1FHVA 3GM8A 3MYPA 3JVAA 1GTHA 4HB7A 2OFJA 3ECQA 3VK5A 1W1IE 5E6YA 5EMKA 2QT3A 3HM7A 3N6HA 1OGBA 4U2ZA 3EBVA 5IM51 3M46A 1TJ0A 3BGJA 3KZSA 1JZ8A 3CUGA 4ADSA 3PNUA 2JF6A 3W22A 6TAAA 4XBKA 4S3DA 4H4QA 3QV7A 4U5IA 3MT1A 3V1PA 1DIEA 3CUXA 4GGHA 5EB8A 4MJ4A 1SO3A 4TU1A 1SO5A 2WKGA 4DO7A 2YAUA 6XIMA 1T0OA 3W37A 1TQXA 2QYGA 2O4QA 1WDQA 2GOKA 2NQZA 4DUWA 1W1ZA 1PPIA 1M53A 3AMKA 3F2CA 3AU6A 3BURA 5BNKA 1BZLA 4A21A 2HWGA 2CBJA 1TTIA 3EMZA 4PMXA 3WBEA 1NTHA 3CPRA 1HTIA 3LXAA 1GOIA 2QCFA 2XVGA 3DUGA 1X6UA 4QEEA 1ONEA 5H8PA 3B9EA 1H61A 5EMMA 2J8FA 3VABA 2E9LA 2D69A 2YDSA 1HXJA 5FJTA 1S3HA 3KBSA 4GHRA 3P74A 1TWIA 2GJLA 1XGDA 2VTFA 1AQFA 4ADUA 1A5AA 2H3BA 3KHJA 4GY1A 3VIGA 2VFEA 2J7HA 3S2LA 3DKLA 4L6DA 4D8AA 3AHXA 5FJIA 3ME3A 3S9IA 3CNYA 3GYEA 3VD4A 4Q22A 1WX0A 3E38A 3TR2A 3URNA 1M3UA 2I5GA 2NQJA 4IQDA 2WMFA 3NL5A 1X1NA 1MO9A 3UWUA 1J6OA 5CZ0A 1WUEA 3B4YA 1E55A 2D2JA 3L4ZA 4YCOA 4OBRA 4UFKA 2I7GA 2A7PA 2OTDA 2PSNA 1AW1A 3G0XA 4NG3A 5LIUX 4RPQA 1KRMA 4D9PA 4CCCA 1K7EA 3CMJA 2R1LA 5F2IA 4CD6A 4EWJA 4EXQA 4X9YA 1XYFA 2GPTA 1W54A 5B80A 2JGYA 5EYWA 1I8JA 3UXKA 1V6YA 4YU1A 3H2OA 1UPMB 5FL1A 4GLEA 4IPJA 3NOEA 4JNZA 5MHBA 1X2HA 3DFQA 1H7NA 3F4NA 1GGOA 2WHKA 3AICA 4IFRA 5HJXA 3K30A 4C65A 3CIWA 1RD5A 1G69A 4YVVA 4RE0A 2HE8A 1EA0A 4AXNA 2G97A 4IFKA 3WFAA 4JHZA 1ADSA 1W9VA 1Y0EA 1A5NC 2G96A 1V0LA 3C6CA 3GBDA 5AC4A 5FESA 5LHFA 2AOSA 2DQXA 4IM4A 2R94A 3LM3A 3N4EA 2NX9A 4B5VA 3L4TA 4Q7BA 5J8LA 5A8GA 4DYJA 4KWVA 2R1MA 3UESA 3EWCA 4LFYA 4AEOA 2XVKA 4CVWA 1F8MA 2Y5JA 2CEQA 3K4DA 1OK6A 1XGEA 2XWEA 4BWLC 3WLMA 5A8MA 4JX6A 4F2TA 3HURA 4MZYA 2PC4A 3IJDA 2ZX6A 5F7UA 3Q4DA 3T09A 1H3GA 1EPXA 3LDVA 1BXBA 1EXPA 4IXHA 4OBSA 2Z0IA 4PGLA 1P4CA 2GZXA 5I00A 1H7XA 4Y9AA 2E5DA 2V5LA 2W92A 1UR9A 1YTEA 3LCFA 4HOWA 2X1RA 2VEKA 3WQCA 4FOUA 3LG3A 1LQ2A 3V3WA 4X0NA 4NY2A 2J78A 4ML9A 4A3QA 2NLYA 1W5NA 3PR2A 1K8YA 4ZEPA 3MS8A 4KESA 4QIUA 1BF6A 2Y63A 3EB2A 1XD0A 4IQEA 1EBHA 2BB0A 3DOPA 4WVXA 4UTWC 3TW7A 1DKWA 4ADTA 1B1YA 2VEPA 4A29A 5BMXA 3VD5A 4DEFA 3ZQ9A 4ORMA 5CBJA 3SZ8A 1REQA 3HGRA 4JQAA 3S9ZA 2Y0FA 3DH7A 1ZMCA 3WF2A 2GGIA 1E72M 1KTNA 5E0FA 2DZPA 3CGCA 5AC8A 3ZM8A 3E74A 3LCHA 3K8LA 3KP0A 1K4GA 1WBHA 4TTGA 3FJLA 3ZO9A 1LWJA 3E5PA 4BK9A 3HGOA 4AZGA 1EB3A 1LWHA 3BSGA 4L56A 3RU6A 4W8LA 1PWMA 5HULA 1UMLA 1ISYA 4I7UA 3W6YA 3LQGA 4O8AA 2GDQA 5FJUA 1R3RA 3G6MA 3T4WA 2BVDA 2HTMA 4POCA 4YWSA 4U5KA 1H0IA 5D09A 2P5NA 3N12A 1MMFA 1VBJA 3CJPA 2YCEA 2ANUA 1B54A 1B9ZA 3QVQA 2GWNA 2VEIA 4JQ9A 4QAIA 1OCJA 2OXNA 3GD6A 2EPLX 2QQ6A 4GJJA 3BL3A 3AIEA 4H3DA 4M8UA 1S2VA 5HMSA 1ZLPA 2VGBA 1XLAA 4KGLA 4PEEA 3L5OA 7PTDA 3VIOA 1G6CA 3PB2A 1PZ3A 3QGVA 2D22A 4H01A 3AS3A 2VCCA 1JAEA 4DBEA 1IGWA 1SGJA 1FUYA 1H7WA 4H9MA 1VJZA 4C7GA 3T78A 3NL3A 5D8WA 2DPEA 1EYEA 1F9CA 2VOTA 4IICA 4XBJA 3PJWA 2QCDA 1FOBA 4OJYA 4XV0A 1O66A 3F4VA 3P5ZA 2WMJA 3LGGA 1P0BA 3UJ2A 1SQ7A 1DL3A 4LUTB 3VPLA 2ZXBA 3PZ9A 1E9IA 3N2CA 3FXGA 4B3ZA 1JD7A 4DUOA 3PK7A 3V0UA 1DBTA 3MMDA 2PODA 1W91A 3ES7A 4ZQCA 5FS7A 5HA7A 1U22A 4ZOBA 4H8NA 1KCKA 3NM3A 3UG8A 3E02A 2J6VA 4PUWA 3BWWA 2PC8A 1V3LA 4FXJA 5LIYX 3CGEA 3AALA 5LSMA 3K8KA 3I65A 3NIYA 1IR1A 1R2RA 5HQEA 2WZEA 4IOTA 3SSJA 2YPIA 5D9NA 3WEOA 3DECA 4JQ2A 3VNIA 3SEPA 2VCBA 1GYNA 1V3KA 1W3NA 3OBEA 1AJZA 2RDUA 2GSHA 4URIA 4W88A 1TIMA 3LTSA 1OC5A 3I7SA 4BI6A 3VDCA 1V77A 4UTFA 5EU9A 3POHA 4Q8NA 1E6SM 4DQWA 2DVUA 4UBPC 3LHVA 3V16A 2FHFA 1Q8JA 3CAKA 2Z1XA 3M43A 3VCRA 3TYAA 1AMKA 4MHBA 3QR3A 4BS0A 3HZ3A 1GRFA 3K8MA 1PSCA 5LA1A 2VZOA 1LVLA 4MFEA 8XIAA 3LXDA 3QLLA 4NNBA 3WH5A 2B4GA 4GACA 3E12A 3IVTA 3P14A 3L2IA 4N4PA 4RCXA 1QO2A 4DWSC 1DWHM 1W31A 1E56A 4PTWA 3EX1A 4CU6A 1PS9A 3S4TA 3KBVA 2WAGA 4NZ1A 2Q71A 3AMGA 3H4KA 1JEZA 3LYEA 3W01A 3NPWA 3W88A 5JCMA 1NEYA 2R24A 3D6NA 2WBKA 4UFMA 3WBAA 5IHRA 3FAXA 2B7QA 4FXSA 1PCKA 3L4VA 1E9ZB 2F2KA 3F2BA 3N19B 3BG9A 3CUZA 5U25A 3BMXA 3DFYA 1F3XA 4HMEA 2PCQA 1FEBA 1RUSA 1QI5A 4LB4A 3KE0A 2AQVA 2QR6A 5CCZA 3QFBA 2Z00A 1QW7A 3STGA 3GD4A 1HKMA 3TN5A 1ONFA 3B0YA 4GXPA 2YX0A 2REQA 3GHSA 5FJOA 1FFQA 1UWQA 3H2EA 3AQUA 2KX9A 7REQA 3OOQA 1E6NA 1QWGA 4D6HA 2G4FA 2CBUA 5HJLA 2WOQA 4ZFCA 2VP8A 5GNYA 2E09A 4IF2A 4W5UA 1XDIA 1WO2A 3MSDA 4H04A 4XG1A 2CZFA 3TZFA 1CBGA 4FXFA 3AWOA 2I5QA 1FWJC 3QW3A 2Q09A 4D6JA 3P80A 4MWAD 3MVIA 1PV8A 1CGTA 2Y7EA 4WSJA 3S6DA 1P1MA 3BV7A 3B04A 4R9XA 1ITUA 3KZPA 4RE4A 2EG8A 4W8AA 4CQAA 1KXVA 5CGTA 1XHCA 1YNYA 1N8IA 4NKCA 3N17A 3AZTA 1W2VA 1FHDA 1B5TA 6XIAA 4N6FA 3E0FA 5CGQA 4JHMA 2OELA 1KW1A 1U2YA 1BYAA 2WQPA 2H8XA 2DU2A 5CGMA 3W7OA 2UY3A 1VPXA 2E3ZA 4WJ8A 3E9AA 1Q65A 1WDWA 1NVMA 2PDIA 4MAZA 4CQBA 1JDCA 2PCEA 3M16A 3NL6A 5FKYA 3KTXA 2VELA 3O3RA 3FG2P 2WC3A 1WUFA 4PUMA 3UR5A 1M7XA 2PU1A 3NXLA 2SFPA 3GU9A 2P3ZA 1LRTA 1N5WC 1UD6A 4B5SA 2HK1A 2XTKA 3WEZA 1K9EA 5EMLA 3PSVA 2OGYA 3VX1A 5ABFB 3OIHA 1OX5A 5FF0A 5G1TA 4EQWA 1R9XA 4HK6A 4H6QA 2JQXA 2VENA 1EFZA 4P8WA 3MI2A 1IGSA 5A2AA 1DWAM 1KWKA 4WR3A 5LGXA 3GXNA 3DK8A 2VC7A 4ZB2A 3QHOA 3MUZ1 1PIFA 4K8EA 3EOLA 5C2XA 2PURA 3NYDA 4AC1X 1N5XA 3T6CA 1AL7A 3TMLA 3ZR5A 3N9RA 4C6KA 1MUCA 1OCQA 4MAVA 1XINA 1OYAA 1P6CA 3BARA 3BJTA 1XYZA 4HK5A 3R4IA 1TYTA 4AWUA 4JY8A 5A2BA 4HU8A 2BFGA 2YFNA 3LB8A 5DY3A 1GQNA 3MO7A 4IGHA 3IIXA 2ATMA 1W3KA 2CBIA 4XD6A 3N11A 4K38A 2J8TA 1RY8A 4ZQNA 1JJKA 4ZO6A 2YDQA 3W38A 3LUTA 2WHLA 3CQJA 4LEQA 1AZ2A 4C1KA 4PEKA 2OWWA 3NNTA 1VFMA 4LAOA 3LHYA 2BHZA 1XYLA 2J75A 2QAFA 4UCGA 2GGEA 5CZSA 5CXPA 2XN0A 1AVAA 3USBA 3XINA 3C5QA 3CGDA 5CSSA 4EQSA 1MQQA 2A79A 3MP5A 1VFFA 3VNYA 1W1PA 3NL2A 1GT8A 3C56A 4JIEA 2YL9A 4K1WA 2WZTA 3OQ8A 5FJPA 1F5ZA 4H6KA 2BC0A 1OIFA 5EL1A 5AC7A 4NNCA 3ENLA 1BD0A 2GH5A 4XK2A 1QPOA 1UWIA 1Q4WA 1JPMA 3PZGA 1W1YA 3VUSA 3MP4A 3GYCA 4PCNA 1RCQA 4OUEA 3CXOA 2NXHA 2FVMA 1FHUA 3W2MA 3D3FA 3WJZA 4AC7C 3FVMA 2VXNA 3LK6A 2CLOA 2MNRA 2W63A 1XRVA 4ORIA 4H7ZA 3WF1A 4YLWA 1TPEA 1Z69A 3Q94A 3KOXA 2WC4A 1CGVA 2OO6A 1TV8A 4V1XA 3DGRA 2HVNA 1JDEA 4ZXLA 1EEPA 2XFYA 4I8DA 2NV1A 2DZAA 1N82A 4PBEA 2HRWA 3PPFA 2YFOA 1V51A 2HMCA 2A3CA 1JVNA 3R12A 1PE1A 2A21A 3CV6A 2WC7A 4I9AA 3S3GA 1KN0A 4S23A 3O0KA 1VCFA 3M0KA 4B4HA 3WYZA 2QHAA 3H4WA 4IX0A 3HPSA 1LCOA 4U4MA 3MBDA 5E0CA 3NPUA 2CHOA 2E6AA 4Q7IA 5LXXA 3LRLA 1J0KA 3ARXA 3DHFA 3W1LA 3Q37A 1GCYA 1TX0A 1ONRA 4O0ZA 2VKZG 3QOKA 3VX0A 3PHAA 3SM0A 2QEZA 1RP8A 1TPUA 3VGFA 1TX2A 3ONCA 2WM1A 3CPGA 4YJ5A 3A13A 3ITCA 5B7YA 3R07C 4DPQA 1LYXA 3O6CA 2W62A 4M7SA 2AKZA 2OT1A 3RLVA 4DX3A 3L4XA 1A5SA 8CGTA 4UFJA 2BGNE 3WNOA 3P82A 3TSMA 3NQVA 5LA0A 2VVNA 2CLKA 3B9AA 4GUJA 3HW2A 1V4YA 1X98A 3ARSA 1JUEA 1JXKA 3ARPA 4EF9A 3NQ6A 3GDKA 3LNPA 4E2VA 3UWQA 4LJ3A 1AQHA 1VF8A 1DHKA 3EYPA 1H50A 1NWRA 3VGEA 1X8CA 2C19A 1QW9A 3MV01 3ZVIA 4ACZB 3VGBA 4Q3MA 4GA8A 4ZB0A 3IJ8A 1OM0A 5AECA 3THUA 4MB5A 4PR4A 2ZCGA 1GZJA 2VFHA 3APYA 2HK0A 3IJ6A 5SWUA 3N2OA 4CNSA 4CD8A 4H9TA 2ZUTA 3CQ0A 1E3XA 1TWZA 1GKRA 1OBAA 2XGIA 3KL3A 2NQHA 3CTLA 1GYLA 1TJPA 4O10A 4NYUA 2I17A 1R3SA 2XHYA 3KLLA 4ZOEA 1BVWA 1CXHA 3PTDA 3NOYA 1CPUA 2AL2A 4D2JA 1UCWA 4I8YA 2OODA 1X6LA 1W8SA 4UNKA 4FLQA 2OX1A 4GI8A 2XGZA 1NM9A 3N4FA 1KBJA 5H1WA 1RCXB 1YBQA 4DI8A 1OCNA 1ZGDA 1AJ0A 4JTGA 1FXQA 1JF5A 1Z7AA 4YMZA 1TPFA 1QNVA 1O60A 1ZP4A 3W1QA 4JQ3A 1MZHA 1DOSA 2J25A 5M1TA 3MI3A 4K7VA 4JIRA 2ACRA 4QLLA 3AZSA 3M5ZA 3WLRA 1FY6A 5D38A 2O55A 5AYYA 3KBWA 4JTCA 1GPWA 3R11A 4C1NA 2J74A 3ZS4A 5H6HA 3ZVHA 3NO5A 2A6LA 3TDFA 3HJZA 4HJWA 3TA9A 5CPQA 2HPMA 4H2CA 4LUSB 3ATYA 1J0ZA 2XJ7A 3OYXA 3UY7A 3QLDA 1RV8A 3SDOA 1KXTA 3DXIA 2BY0A 4EPKA 1DWFM 4ZVJA 1H0GA 3IK2A 3ARVA 4C6EA 1X7IA 3RIKA 1KM5A 3U4FA 4GYKA 4XKMA 2ZYFA 1SSGA 2C8NA 3DZ1A 2PTDA 2WOIA 3RR1A 3TQKA 3C4UA 4F0SA 3FGCB 2WVSA 3WLLA 1TVLA 4BURA 4BCEA 1YDNA 3N04A 3C86A 2TSYA 3PPGA 2ACQA 4LS0A 1TWSA 1PTDA 3VMNA 3WJWA 1EA9C 1MUWA 5CLTA 4GUHA 5BXSA 3G8RA 5DX7A 1DJNA 1XKYA 3S5YA 2WLZA 4M29A 3U5YA 2FPYA 4O1EA 3UZ5A 2PD5A 4XWUA 3RLGA 4GVHA 3PVFA 1ME8A 3B0XA 5A69A 2OKOA 1Q6OA 3L68A 5CSYA 5L9FA 3IIVA 1ICSA 4GG9A 3IIOA 1EXBA 4JR5A 4DF2A 2R8WA 1Q6FA 2W3RA 4PZVA 3SJ3A 3W9ZA 3CQHA 1M41A 5M5DA 1F8WA 5LHEA 4JGDA 1V02A 2H8ZA 3ZXWA 4Y9OA 2NX3A 2PDMA 1IT0A 3U2OA 1XLEA 3AYRA 3W7NA 3WD2A 4MY1A 2VZUA 4M6UA 1Q7ZA 5FF2A 3OVPA 2ZWZA 3MUIA 4HMDA 1S5WA 5FSDC 4AZ5A 1R5YA 3VNJA 3LZ5A 3G1SA 1KRBC 3PP7A 3H21A 4R88A 4L80A 3AIBA 1GYMA 3LA4A 3JS3A 4EPDC 1TE6A 3W23A 5ECUA 4FNTA 1XC6A 3AWNA 2WMKA 4W8BA 3TAOA 1EJXC 1GRHA 3G1HA 4RV3A 3TWAA 1ENUA 5BOEA 4MKVA 3OHIA 3W2LA 2Z2AA 2PWGA 3B4UA 1TPH1 1B0IA 5D37A 4RDZA 3V0TA 3DHDA 3A9IA 3FJ4A 4UQAA 3S2MA 4IPLA 2FJKA 3G1XA 3M7SA 3NVVB 2YVJA 4H2HA 3BW3A 4F40A 1NFBA 2IPJA 2PDHA 4IIHA 1R46A 3KBJA 1I75A 3M0VA 6REQB 1G1YA 5AZ1A 3IVUA 3V75A 3PUDA 4AY8A 1BXCA 3RUBL 4H9UA 1DWJM 3NWRA 4MADA 1F8IA 2WOVA 3SCQA 3CGBA 1WBJA 1PCWA 5HUPA 1PIIA 4D72A 3VAVA 1XD1A 5E1QA 3IGUA 3NJ3A 3EOOA 4NRSA 2Y4SA 2FHBA 3F4CA 2Y2WA 3UA4A 1OX4B 2P53A 3IJ7A 4A8RA 3W7KA 2J4GA 3CEUA 4NJKA 4XQ6A 1A0DA 3W87A 2PAJA 4E2DA 4JY9A 4ZQPA 2DIJA 2HXTA 2PTZA 1OC6A 4LCSA 5F1VA 1TMLA 1SR9A 1DJIA 2ABAA 1KCLA 3AXIA 3L23A 3BXWA 4Q32A 5AOUA 4F0HA 2R1NA 2X7VA 1CDGA 2F6KA 4RL3A 4V2XA 2AMGA 1XRFA 4LBSA 3UCQA 4HTBA 2JIWA 1KFLA 5T26A 1UZDA 4UFHA 3O16A 2DZVA 1WKEA 2RGMA 2OZ8A 2WNWA 4O14A 2UZ9A 3LHZA 1CGXA 1JIBA 1GSNA 1NF7A 3OYZA 2EF9A 3TMQA 3FYOA 1IXQA 3W1MA 5A6LA 3WQOA 1OFEA 1R3WA 3IACA 1RQBA 4HNNA 3BLLA 3R13A 1DTNA 1RVGA 5EMJA 1TMHA 1MVYA 4WRHA 5BXRA 1LTDA 2OPJA 2EXOA 4KPLA 1RAKA 2ZVIA 5ECVA 4U33A 4XIAA 2X2GA 1AA1B 1F61A 4NZ4A 4LUYA 4NEWA 3T55A 3DFTA 3TN3A 5KSWA 1CXKA 3DHUA 3EWDA 2IW0A 2BNJA 4PTXA 4FOKA 4NJIA 2FZNA 1NP0A 1HG3A 1XPYA 4PSPA 1HJVA 3R25A 3V5CA 2J8GA 1O5RA 3NEHA 3L65A 3W3OA 2PB1A 2ZZ2A 2RUSA 1YNPA 4HPJA 4ZOCA 4KS0A 2WANA 4A3YA 4JTAA 1B3OA 4RDYA 2Q6ZA 2Q8XA 1DEDA 2PTYA 4PBFA 3D46A 3WNMA 4PTNA 2PLCA 3W2KA 3AJXA 3AO0A 3O07A 2QJNA 3WY1A 1QFEA 2JIEA 1FA2A 4MDOA 2OKTA 3NQ8A 1SZGA 4HQVA 4CCZA 3V35A 1JQXA 2C14A 1EYWA 3FYYA 4CEUC 4QEHA 3T08A 1XWYA 3QM3A 2VEGA 2Z26A 3RR4A 5LNVA 1NDZA 2W3SA 2I56A 1ME9A 2E0PA 5IRPA 4AZ7A 3T0TA 1KBBA 5M17A 3RM9A 4BEUA 1ICPA 4QS5A 4KGJA 4G7EA 2NX1A 3MMUA 1UR2A 5DMYA 5E6ZA 1ZBCA 1UWRA 3BUVA 3SFKA 1RLCL 4AHQA 4UZUA 1RA0A 1TRIA 4CU7A 3RPMA 1UQYA 1JRPA 1W3TA 4FHAA 3T0CA 3TP4A 2YXGA 3NZQA 4QQ3A 4C6DA 2YVFA 3AS1A 2CLLA 4NQ1A 3PBGA 3HG2A 1QWKA 2A85A 4MF4A 1F4HA 2J3NA 4GX9A 4DWSB 3MCMA 4PA8A 1DXLA 2V5DA 2DZTA 2GR2A 4E8CA 1UC4A 3W82A 1S2TA 3VIIA 1IWAA 1GNXA 2OO0A 1GZ1A 5GRTA 5DN1A 1PO9A 2YW3A 3OHMB 3GR8A 4C6CA 1Z48A 1N55A 5DQPA 5TF0A 1UOZA 2OEMA 1T96A 2W3ZA 3QBUA 4ML4A 2IXVA 2YVGA 3AS0A 1UIPA 2E7FA 1K9FA 3KTCA 2GVGA 1QDSA 4EACA 5D30A 5CSUA 3AN1A 1JZ2A 1MO0A 1PYMA 1L2QA 1ZJAA 3H2FA 3ALFA 4GVGA 3SB0A 3WN6A 2XWDA 4RPPA 3AHYA 1JL8A 4HHMA 4DNMA 1UIOA 1GQJA 4GIEA 2I16A 1FRBA 1JNEA 1M7PA 3B0UX 3AU2A 4BKNA 5T9CE 3NUKA 3M7WA 4HNUA 5GNXA 4A05A 4UB9A 1E1EA 1QHZA 4LY8A 4HYVA 3SCWA 1KFJA 3CWNA 4QDMA 2VC5A 7ODCA 3HOJA 3W7EA 4C6IA 4WQ6A 4EF8A 2DUZA 4Y8EA 3MUCA 2DZBA 3WKZA 2BWGA 3NGJA 4YHEA 4DO4A 5KETA 3VOHA 3B0VC 1KBIA 5BRBA 5AYIA 3QFEA 3W2JA 1VB9A 2PWHA 3R94A 3NZGA 1TYGA 2EJAA 3QV9A 3WLQA 4Z2HA 3DDMA 3OVQA 1BYDA 3N73A 1STZA 4S3JA 5BU6A 3EX4A 2QF8A 3GRTA 2H9AA 5FEPA 3S46A 4RNHA 3SGZA 2WBGA 1DXFA 1XBZA 1C3FA 3VFLA 2IUZA 2R14A 1H7OA 4HSOA 4C6JA 3ANVA 1BGGA 1US3A 4P7OA 2NSXA 1UP2A 2V9DA 2A3HA 5I3FA 3SRDA 3GBEA 1S39A 1X96A 2DVXA 1UH3A 5FJJA 4EAYA 2GVYA 3RN6A 3V5OA 4O57A 3TK7A 4IJRA 1E6PA 3EMQA 4FR1A 1JYWA 5A6MA 2PDWA 1TB3A 4ZTYA 4OVXA 4DN1A 3BLPX 4Q4RA 5MKGA 5EBKA 4QG8A 1EUAA 5BZAA 1TJ2A 1CTNA 2PDBA 1GESA 4PSRA 4DO5A 1X7FA 3LPGA 4AD4A 1Y5XA 3V5FA 3W72A 1JYVA 4REQB 1TZ9A 3OLEA 4NAFB 2PDJA 1VCGA 4KT2A 4MNJA 4Q6XA 2WZIA 3MBFA 1IEQA 2Y8VA 4H7VA 3EF6A 2QCEA 3KBMA 1BTCA 4AZ6A 2WVVB 1HJWA 1MYRA 4CNOA 1F2JA 2V5BA 1MDRA 1Q6RA 3WQ5A 1DJGA 1RA5A 1Z9AA 2EGZA 2PZ0A 1U5VA 2CKSA 1DWIM 4OZOA 4WOQA 3T81A 2E1WA 2DH3A 3R0DA 3WDJA 3A47A 1TVPA 3C2VA 2LLEA 1IZKA 2FH6A 3PZNA 2NUWA 1P7TA 3W26A 4XVEA 1UP3A 2D2GA 2ZKMX 1M1BA 1FWEC 3PZQA 3GH5A 2HS6A 4Z1AA 3HGJA 2BC1A 1XLFA 1WOBA 1XCFA 1SR0A 2J66A 4GBUA 3HF3A 4ZQMA 5CPTA 2VFDA 3UG5A 4MLJA 1RSCA 3MKCA 5REQA 3MSGA 3WQDA 2DJLA 4I9JA 3PG9A 3AHTA 2I9EA 3W83A 5K9CA 5I7GA 4F3HA 3WJSA 1JRBA 3GHRA 3VIPA 2VC9A 1Q45A 1V3MA 1X8FA 5JBDA 3RILA 2DZWA 2OZTA 5K4XA 3CL7A 2G3FA 2TPSA 3PUEA 1J6PA 4L1XA 2CXGA 4XKYA 3V36A 1L6SA 5LGZA 1JG9A 3QF0A 5I3JA 4BY3A 4PTMA 3E2SA 5G4WA 4IMCA 3ARTA 4LQ1A 5DEZA 2HBXA 1F74A 3QW4B 4M6VA 5FS6A 4LH8A 3UQNA 4FEZA 3VO0A 3DBNA 2YB4A 3U2ZA 3WMLA 3GG1A 3QJAA 1UR0A 1MZRA 4GINA 1CLXA 4AF0A 3FKKA 1MQRA 4XAPA 3ABRA 4E4UA 1XICA 4Y96A 2XIJA 1OGGA 4NXKA 1LORA 1XIHA 3AC0A 1GJUA 1Y8BA 4NNAA 4HN4A 4DO6A 1K02A 3BZGA 2POZA 3TYUA 2HDJA 4Q8OA 3LHUA 4F66A 1RBOB 3SRHA 2ICSA 4AH7A 2V3EA 1BG4A 4XTIA 1HJUA 2QCNA 1IIHA 1E43A 3PPCA 2BHYA 4I9MA 4R33A 4W86A 3HPZA 3NDYA 4F79A 2DEPA 2V6AA 4KRUA 5FS8A 3II4A 3C2OA 5DRCA 4JN8A 4AIEA 2D23A 2Y5EA 4CD5A 4HCDA 4YVPA 2XSAA 3O6AA 4NZ3A 3FDGA 3PZUA 2CHNA 2D20A 4JTLA 3WDPP 1G4SA 2C13A 4IP5A 5DCEA 3TCEA 1D7KA 1GTEA 4TVCA 1YRRA 1P43A 1MFUA 3HPAA 1NQ6A 5CC7A 2OLHA 4YHGA 3R1ZA 2HS8A 1G94A 4RZ5A 3AIUA 4E0CA 1SFLA 2EPMX 2YJQA 1L6YA 2Q01A 2Y89A 3PC0A 1OFOA 3G6LA 3UA3A 1U30A 2Z24A 3SY5A 2X0YA 2EKCA 2YKKA 3IPWA 4FSAA 1LG1A 1KM1A 2HPIA 5CPLA 1IEXA 2BOGX 3VKDA 4DHGA 4ONVA 3LPFA 4S2CA 2IS7A 3KRZA 5J04A 3AIVA 1DJYA 4KCVA 3PBVA 3E0LA 4MB4A 1S2AA 1Z32X 2OSWA 2QIWA 5B7ZA 3MHGA 1JFHA 1ONWA 4O18A 1I2PA 1VEMA 1ITXA 2XZ9A 1OB0A 4E2BA 1XDLA 4HPXA 2IKGA 1JPIA 1VBUA 4RNIA 3DYMA 5A8PA 2D2OA 3BW2A 3PFRA 1JI1A 1XFCA 2B81A 2QJIA 4LBRA 2ZRZA 2EQ9A 5AHEA 3ISIX 2ACUA 4KCUA 1GHRA 2OVLA 1VGAA 3CWOX 2ZTKA 3DI0A 5FEXA 1E6ZA 2D3LA 3CASA 1OFPA 4F48A 5AC6A 1V6VA 4ZENA 5F4XA 3LLFA 3BSMA 5HMEA 1BVNP 3LGDA 1GHSA 4GNVA 4NX0A 5AY7A 2XVLA 4HA1A 2HE5A 3C2YA 3UF9A 3EWYA 1L6WA 2V2DA 4I6VA 4LBUA 2X05A 1TV3A 3TKFA 4C6NA 5FEWA 1JUBA 4QDWA 2X42A 3DAQA 2ZUUA 4H8HA 3UWEA 1V08A 4LYPA 3UWWA 4DBUA 3B8WA 1XLMA 3EXSA 4OIFA 4L4LA 3B03A 4MPKA 4AG0A 4KWOA 3NDZA 3DHPA 5F2GA 1UKTA 3GW0A 2WSQA 3JR2A 4WK9A 3SIZA 3POCA 4XZBA 2HISA 5HWJA 3CMGA 5FSEC 4D1JA 2XDFA 3UJFA 1RCOB 3ARRA 4MMWA 3CGTA 1MSSA 3LTPA 4LF1A 1XBXA 4BQ4A 3H2NA 4TX8A 2QZRA 1V0NA 4IMDA 3ORWA 3F4DA 2X41A 1UMYA 4O1DA 4IL0A 3A4AA 4LU0A 2YGYA 1A5MC 2HV5A 1MRAA 4Q8QA 1KLZA 2XN1A 4H7CA 3R8HA 4B92A 3KOYA 4G6CA 4JTHA 3QKEA 4IFKB 4O28A 3DIPA 4EPEC 1V7AA 2VR5A 3B8UA 1H09A 1IHIA 1X1OA 4ZL1A 2VVSA 4QSFA 1TMQA 1QI4A 1PWLA 4P8VA 3GXIA 2EHHA 4MM1A 3WQGA 4WDWA 4N9EA 1LT7A 1D9EA 3QPZA 5C9UA 5HBFA 3CAVA 1QPKA 5AKQA 2CC0A 2JE8A 4IMGA 2FZBA 1K8CA 3AIQA 3BOLA 2RHGA 1UW9A 2B0MA 1J4EA 1SMAA 2CLIA 3DEQA 1TG7A 3UGRA 1NWUA 3R43A 3FCPA 1QO5A 3RCMA 1AODA 3QRHA 1ZALA 4KMQA 2VNCA 3G24A 4V27A 4JCMA 3OLDA 2OX4A 3CZEA 4L1GA 3OZOA 4I9TA 4J27A 1C8XA 5ER0A 1QOXA 1JZ6A 2O56A 2Y24A 3VE7A 3M1ZA 4GUGA 4PUDA 1V79A 4P8UA 1L6FA 4NZ5A 4CN6A 1GWJA 1XCXA 3WDHA 2C0AA 3EA2A 2WP6A 1TREA 1UUOA 5D2VA 4JKLA 3QYSA 1ISWA 3NVDA 5C8BB 2P50A 1AFSA 3N25A 4AFYA 4HA0A 1XSJA 2ZADA 3LB0A 3H4GA 4WLCA 2XPKA 4RK8A 2Z2BA 3MMTA 3CBWA 4FLOA 1J5SA 4GKLA 2W27A 3T0AA 3TN6A 3W02A 3UXLA 3M9YA 1XLKA 1UR8A 2D2HA 2YL5A 1CCWB 3ZJ8A 3QGAC 1SJCA 4RLIA 3WH8A 3SQMA 3FV9A 4JFTA 1WDRA 1S5VA 4K7YA 3UG3A 1X97A 2O9PA 3O7UA 3TNBA 4JQ1A 4G56A 3T44A 4LVGA 3LHTA 4KFPA 1YNQA 2WYSA 3GNOA 4N9DA 3DX5A 7ENLA 3S8HA 3TJIA 4LSBA 1AD1A 4AW7A 3Q2DA 1CI1A 4F9DA 1Q2SA 2J24A 2PGFA 2A0NA 4PUUA 1QNRA 4RZ4A 3NQ2A 2VD9A 4O17A 3L0GA 2YXXA 2OJPA 4H4SA 5I77A 2DP3A 4HSNA 3C3UA 2ZWYA 5AB3A 3A4XA 1GRGA 1CXEA 2VI0A 3RX3A 5LXEA 2AAQA 1ZFJA 4PFHA 1KFKA 3AM9A 4OV4A 4IFOA 1LRNA 2PDXA 4LAKA 2GUBA 1MEIA 3T2QA 1XG3A 2GLKA 1BYBA 5EPDA 3CYJA 4S38A 2VHLA 2XM2A 4Q8TA 4FXRA 3OA3A 4I6KA 2OOFA 5GVJA 1VHCA 2G8ZA 2QCHA 3VNKA 3W84A 4EMIA 2ZE0A 2OYLA 4AWSA 3R8GA 1V0MA 4TIMA 2Y85A 1RQEA 4LYRA 4IP7A 5T91A 1DTUA 4O12A 5BRQA 2R91A 4IXXA 3QZAA 3B9OA 1KR1A 4FS9A 3ABXA 2A3BA 1K77A 3K13A 1KXHA 3WLIA 4Z2IA 5ABGA 3KTSA 1UASA 1SVDA 3GTIA 1ZDLA 1GKQA 3GDMA 2D0FA 2ZICA 3O15A 4ICNA 4WY0A 1HX0A 3SY8A 4N6EA 2Q3RA 3TV8A 4LUTA 3WX7A 1UG6A 4CEXC 1ZCCA 2FFCA 1MFVA 3UYCA 3AXKA 3UWZA 5ABEA 3WL0A 4FA3A 4JYDA 4NZFA 4UUIA 3DFNA 3R7MA 4C6PA 2ATSA 4BZYA 3NQGA 4LAZA 3WNPA 4PN2A 1FWHC 1FP8A 2V8ZA 3A23A 3RITA 1YW1A 4JTRA 1W32A 2NWSA 1I60A 1HUVA 1MXSA 1ITQA 2YCKX 2WNQA 1XLDA 1N61C 3BTNA 4GCAA 3K4AA 1KKRA 3UZJA 1UUQA 3GG8A 3SUUA 3VUPA 3W1AA 3CO4A 4HBKA 1VFUA 2DFAA 3C8NA 5G2IA 2XFWA 4M0XA 1KR0A 2GVLA 1XP3A 2FVLA 3JW7A 4TTUA 5K2ZA 4YCPA 4FX8A 3N2MA 5C2CA 4CUCA 4PB3A 2WKLA 1GW9A 1RBLA 1BXNA 1BFNA 3CAQA 4QP0A 1GG1A 1WDSA 4Y9MA 3NVTA 3EX2A 3WLPA 4C7FA 3NVYB 1J93A 2PTWA 1H62A 1ZQ5A 3PZTA 4K37A 5KZEA 2PMQA 4B2DD 2XH2A 4AQLA 3C52A 4J2PA 4IUGA 3EDJA 3SGGA 1KQYA 5HUOA 3TW6A 1SFSA 4KEMA 1O94A 2WJEA 3LBMA 1E6XM 4TQTA 3ZR6A 4E3VA 3P67A 5ENLA 4JTFA 4WCJA 1TIWA 5A1AA 1KCZA 2FFIA 1BWKA 4YYCA 4R7JA 3QXBA 1GXFA 2QPUA 2GFTA 3MANA 4J3UA 3GC4A 1CGWA 1W5PA 3WSUA 3CL8A 4JL2A 2XIBA 3UNDA 5C70A 3AXHA 5CZKA 3G0SA 5GPRA 3CV1A 2WJDA 2C3CA 1Q6GA 1NU5A 1CYGA 1PIGA 4EX4A 4A6GA 3A4JA 3ARWA 4YTTA 1AJ2A 2DT3A 1AW5A 5BWAA 1J9YA 4NIRA 1QVBA 3UCDA 1E6RA 1UJQA 2P0IA 2OG9A 4Z0JA 3O9NA 4W89A 1CGYA 2ZIDA 5DCDA 1QBAA 1PAMA 2REQB 1XRTA 1PYFA 3O0HA 2IPGA 1TE1A 1K9DA 1H7PA 3TN4A 4NSBA 4LX4A 4Z08A 3VYLA 3SRKA 1H60A 4B15A 1C92A 1BSLA 4JCLA 1ESWA 3S1UA 1VQZA 3MA8A 3DC0A 3Q6JA 4Z2JA 4NT0A 3FAWA 3WIJA 4GVIA 3T1GA 1XIJA 3T0BA 2IPWA 2OWCA 3N6JA 2QCLA 4AMCA 3I4KA 4US6A 4QE1A 1ISZA 1PX4A 4DLFA 1EH9A 1A50A 1BEUA 4FO4A 2DW7A 4H8VA 2DT1A 4NL1A 1JCLA 3H23A 1E1CA 2PTXA 2WNNA 4HZMA 4YTQA 3P5YA 3A5VA 3P8JA 4Q6JA 4B9YA 3D47A 2VEFA 3R79A 1OINA 3M6DA 3DK9A 4LPCA 1XL9A 4HCHA 1PDZA 1JF6A 2TRSA 2VX7A 4XSMA 3D9XA 1E4LA 5XINA 4FNPA 4PMQA 3KRSA 3W1TA 2VR4A 4KW2A 5CC3A 4PMOA 4GQBA 1D7FA 3SQLA 4PCTA 2QGYA 3GC5A 1EC9A 2VZSA 3VKJA 3A3XA 3S2JA 1F73A 4KETA 1EJRC 3HRDC 1IXNA 4KEZA 5HQMA 1LM1A 1FCVA 4GXMA 5ABFA 1KM2A 2RDWA 1TWWA 1XH1A 1CXIA 2WPFA 4K8DA 1JPKA 3LM7A 4G9PA 3H7UA 1A5OC 3VNMA 4TVDA 3NZ1A 4XZMX 4S3EA 1JCMP 2D24A 1XUZA 3P61A 2BDQA 3ITGA 1GERA 2YA2A 3B8TA 3ABZA 3ZOAA 4GKTA 3VU2A 5GJMA 2VGIA 1QNQA 2XGBA 2PWUA 4HA4A 3JU2A 4QTGA 4Q4OA 4ADWA 5AHLA 2YBVA 3OVRA 6CGTA 2WW5A 1XC4A 2AGTA 5L6UA 1LLWA 3H53A 3UZXA 1EO7A 2FDSA 1XIMA 1Y7VA 4ZTXA 4GMEA 1OWQA 3HMJG 4TMCA 2Z1SA 2J27A 3KVJA 5HNTA 5JQ9A 1ZY8A 4WEVX 2QJHA 9CGTA 4LRSA 4UTMA 5CAKA 1HKKA 1GVOA 4QROA 4B5XA 5FD0A 5I6SA 2Y1HA 2YXOA 1V6UA 1I2NA 4R53A 4AMAA 4F9JA 4V1YA 1X2GA 4GRTA 1ECQA 3TONA 2AGKA 1FIQB 3WD1A 1HL9A 3HQOA 3MCOA 4L9ZA 3UNTA 5K4ZA 1XF0A 3BZJA 3RYSA 1L2UA 3WJYA 5EY5A 2WCAA 1VCVA 3UPBA 3P6LA 3NRZB 2QCCA 1I2OA 3GU2A 3TTOA 1DPMA 4O0KA 4YYFA 1EGMA 1AQ0A 1GVRA 5DBUA 1XG4A 3EB3A 3EA3A 1U33A 1VPQA 4LNYA 2IKIA 3I3BA 5A6BA 3SCSA 4FOJA 4D1IA 3TOPA 2VD8A 3L9CA 4QISA 4JX4A 1J11A 3VMOA 3TWBA 3I7RA 1V6XA 1EF2A 4GXWA 3BO9A 2QUMA 1LBMA 3VDHA 4DYEA 2ZZ0A 1RK6A 4NUWA 4PCSA 3CHEA 1LJYA 1XQKA 2VFFA 4ASTA 3JRKA 2GJPA 3SN1A 3IJLA 5DF0A 5EMYA 4US5D 3H55A 2RFGA 3GDBA 5EBAA 3QMRA 4KWSA 4Z2LA 3EWUA 2J9YA 2GGGA 5CJMA 4UXDA 4TMBA 4A22A 5GJPA 4FALA 3DJGX 2A4AA 3C3NA 1D3HA 5U4NA 5U7SA 2F8QA 5C9WA 4G7FA 1E5JA 1E9YB 4B9ZA 2X8HA 3UD6A 1E1FA 3GFZA 5JRBA 3HFTA 1ZNNA 4NILA 3XIMA 2OEKA 3KUMA 4GC4A 3NEVA 4HKPA 1J79A 3VCNA 3UETA 4D6GA 3L2LA 4H4XA 4Y90A 1FWNA 4HU3A 2ZE3A 4FIRA 2PI6A 3WQPA 5IHSA 1H63A 4OKDA 5EMUA 5BXPA 1XBVA 2NUXA 2FVKA 1V0KA 3UJRA 3KOWA 2XYLA 4GCXA 5BCAA 1G4TA 5IOBA 1FECA 1E70M 4ZSTA 4YXGA 3H2AA 1J5TA 1YHTA 1SJAA 4QRNA 2GVJA 4JTTA 1M7OA 2G4JA 1EUNA 3OA5A 5CEWA 3JZEA 1FDZA 1RVKA 4F4RA 1O1ZA 4B5WA 1HO4A 2WMGA 1M03A 1T8XA 1A5KC 3AHZA 4JOMA 1VKFA 3WLTA 2V30A 1XM3A 4MZ8A 5BWFA 2UY5A 2Z27A 3GO2A 4IPPA 1VYSX 4B2DA 3NDOA 3RNMA 2F5ZA 1HP4A 3IUHA 1A0EA 1PKMA 4YVXA 3BAJA 1Z89A 2GR3A 3QEZA 3QKZA 5AHNA 4EOUA 1JZ5A 4IL2A 3W71A 4U3AA 2W54A 3OZMA 4ACZA 1E0WA 3FA3A 3NO3A 3P7YA 3MPGA 4E6MA 2EPOA 3HPFA 4FF7A 4G2DA 2DSZA 2IQ0A 3WQFA 3UG4A 1L8PA 1KNWA 2E6YA 3SBFA 3EANA 2Z28A 5LA2A 3U7VA 3R0KA 1QPNA 3VE9A 1D2KA 3A12A 5FI8A 4OHQA 1GKPA 3UPMA 3BAYA 3PAJA 4NAEA 4QE5A 2C15A 4H19A 1WPCA 1TR1A 3OGSA 5TIMA 1UD8A 3B8SA 1EJUC 3OLIA 3B8VA 5HJYA 1TJRA 3ZZ1A 2ZBTA 2QUNA 2WPCA 2Y7DA 2ZZBA 1YIXA 3WK0A 5I03A 3H7VA 4S3BA 4I5RA 2AQWA 4XBSA 1V7YA 3QY6A 3VVGA 3LPOA 1QI3A 3IJQA 3J7HA 3FA5A 4UOZA 6TIMA 1UKOA 3UU0A 3V7PA 4LV4A 3PBYA 5I3DA 4PB4A 3W7QA 3KL0A 3C61A 2V5JA 5D2XA 1RK5A 4J3ZA 1A5BA 4N42A 1U83A 2VJXA 3WL1A 4Z17A 2INEA 1R38A 1EKOA 2YA1A 1MEWA 3B9DA 2YDRA 4K68A 4QFUA 4Q33A 3KEHA 2F6XA 2RGLA 1WE5A 1QT1A 3AHVA 3DERA 1JNDA 3ZVHB 3BLIA 3OEXA 5I79A 4LUSA 4KIRA 3AXMA 3EWXA 3DFOA 2NVDA 2Q8LA 2OCZA 2WWDA 1PTAA 4BQ2A 3L7RA 2GR0A 1DVJA 3BG3A 2QDDA 4DWSD 1XIFA 1SZEA 2QUTA 1IYXA 4TO8A 1ZUAX 3N4AA 2X1UA 2ZZ1A 4R3UA 4OFCA 3GNNA 1RXOB 3IARA 1DQUA 1PHWA 1AZ1A 1V5XA 3YPIA 1UBPC 1TPWA 1VAHA 4WDXA 1IEVA 3FGCA 3OBAA 3TTQA 2J7CA 2PP1A 2WPEA 2Y7GA 2WHMA 2D0HA 3VNZA 1XDJA 3HG5A 9RUBA 2EQ8A 1PJ9A 2E77A 4K7ZA 3VZZA 4O16A 3WH9A 1V8EA 3QMTA 2HVOA 2VGGA 1S2WA 2DUAA 7TAAA 4ICMA 2EPKX 1HO1A 3LCWA 3E0WA 2NQLA 1ML1A 4WF7A 4Z1CA 2OYMA 3REQB 5LZLA 1GVYA 4UZSA 1VS1A 3VIMA 3G2GA 2EEXA 3OLGA 2WP5A 3W7HA 4EM3A 1L9WA 3GIPA 5KZDA 1IT8A 1VH7A 4C91A 4Y9NA 2X0HA 3S6TA 3GD3A 5FMHA 4QQUA 2BOEX 5BOFA 1TZZA 3UCCA 4ALDA 3WDIA 5C54A 4GX8A 5DMMA 4PCFA 2FGBA 3UZYA 1LUCB 3RXZA 4UTHA 1M01A 4GH1A 4IISA 3RAOA 3PUGA 4QXIA 1GQIA 1EIXA 1GUVA 4J3WA 3AISA 4IGSA 2ISFA 3ZT5A 4IIEA 5I02A 2W61A 3HG3A 3MWAA 3EGJA 1BVZA 1UWSA 1G7VA 1U1UA 4OQVA 1SZFA 1BG9A 4DUVA 1CB2A 3LRKA 1S46A 1E73M 1R8LA 4F0LA 5HINA 1V93A 5FJRA 4KEUA 4PB5A 1RP9A 3S5SA 3VKBA 1QNPA 3SUSA 4E4FA 2X30A 4KRZA 3GNDA 3MHUA 3QY8A 4CQ9A 4F0RA 2OEJA 1OHLA 3UZWA 4DJDC 1YQZA 5TR3A 1XH0A 1EOMA 3T07A 2OGJA 3STPA 1HFBA 3BOXA 1OFQA 2CESA 1I6NA 3F5JA 1K03A 1O4UA 5DMNA 1GK8A 4ERGA 4GYPA 4X9SA 3EOUA 1R7AA 1SZRA 3H4XA 4RXGA 3MSYA 4GISA 4XD5A 4S3FA 2J9ZA 3B3DA 6REQA 4QCFA 2A7NA 2BCPA 2NSOA 1W6TA 3NSXA 3UR8A 2DQWA 4B91A 4KF1A 4MVAA 1Z3NA 2E1DA 1F6YA 4US5A 1H7RA 4H9ZA 3H8AA 4XD4A 3ZIZA 2ZTJA 3H26A 5ABHA 3FY1A 4BV6A 4FLRA 4H4UA 1HP5A 3LBOA 4W7WA 2WSKA 4H4PA 1QATA 3ARZA 1QK0A 1OX4A 2FDMA 4L6HA 3H7RA 4J9JA 3IV3A 2J7GA 1VLWA 2ACSA 1J12A 3EAUA 3N2XA 3MQTA 5EKYA 4DF1A 2NPXA 3IWPA 3R10A 5A6KA 1ZAHA 4GIAA 4M19A 2V3AA 3KRUA 4DJED 1H11A 1AD4A 4H83A 1UD3A 2VRQA 1R2TA 5JCIA 1WXYA 4JTKA 4Q4MA 4F0MA 4MNMA 5J5RA 4I3GA 2XH0A 3M0LA 1A49A 4ZODA 1A3XA 1GZGA 2W9MA 1EWDA 3PULA 2ZA3A 3ABSA 2PDCA 1UPPA 3AXXA 2IMRA 1KC7A 2V81A 1PVNA 5E5CA 4EMWA 1HJQA 3F1QA 1VD6A 5A8OA 2HQAA 1S5TA 2Q02A 1W0MA 5G4HC 1GRAA 1FFUC 3TFCA 3P3BA 1ZTVA 3HIJA 4A2SA 3AYTA 3ZLFA 4KRTA 1PX3A 3CUIA 1UB3A 4W93A 4CD7A 2F7FA 1W1B1 1XYMA 1ZS2A 4BEQA 1LBLA 4TVYA 3RDKA 4NYYA 1S1PA 3PTKA 1KV5A 4TXEA 3CYVA 1ZRQA 2ZUMA 3HQPA 1OFAA 4GGBA 4H9XA 4HYRA 1FXPA 1RALA 1WYGA 1TPC1 5JVLA 1K1DA 1VFOA 4HNOA 3DCPA 3SN0A 1NOUA 3GHTA 5T9BG 3GTXA 2FTPA 3T0DA 3FN9A 4GUIA 1UKPA 2VURA 1R85A 2PS2A 1LF1A 5HK4A 1OF8A 4S3AA 4J28A 1GOOA 1DJQA 3COTA 3DFPA 3CLWA 5DXXA 4AX6A 3RLHA 1CWYA 3QFAA 2A5HA 3ERPA 2YL8A 1EEXA 3IRDA 5GQBA 5TBOA 4IJBA 3LMYA 3EPOA 2ZZ7A 5LYRA 1JPHA 2J7FA 1Q6DA 1G4PA 5C5YA 4GZJA 4UTIA 4H6RA 1JPDX 4CCDA 2X8RA 3D5HA 1QW8A 1MOKA 3TEVA 1ZXIC 1T6MA 3STCA 2B31A 1P6BA 3I3EA 4AB4A 2YCLB 4H8UA 3N14A 1Q7MA 1HNYA 5G1MA 4S3CA 3ZSSA 1QBBA 3LN3A 5FAGA 4GC3A 3M5VA 3G22A 5A95A 2W66A 4CNUA 1O1HA 1WZMA 4DXXA 3VOIA 4Z1DA 2GQWA 5G2WA 3LHWA 3W86A 1UHVA 1DNCA 4M3PA 5AHIA 9XIMA 3UXDA 4Z42C 4FR6A 1E4MM 3L5LA 2BG5A 4PRTA 1YQ2A 1UWAA 2VFGA 3ZT7A 1R3VA 3EZ4A 4DWSA 1Z42A 4IP4A 4PUEA 4Y8FA 3STFA 1CZ1A 4ZB5A 3ONBA 3BANA 1FWDC 2PEVA 1HKWA 1XFBA 2PWDA 4QGCA 2E40A 2V68A 5HNRA 3C2EA 4AVNA 5U1OA 2DZSA 4AHOA 2EAWA 3THQA 2Y5SA 1XHGA 3JZUA 4GQRA 3CT7A 3EX3A 4HOXA 5FEZA 3GVWA 5CLWA 5HQLA 4BHYA 2GGJA 1Q6CA 3LI0A 4N0RA 3SUWA 2MANA 1NARA 1I1WA 2ZX8A 3VC5A 3KXQA 1FWBC 3WUBA 4J40A 2PZNA 4IWWA 3UJSA 2QPXA 2ZZ4A 4M24A 5K9DA 4GZIA 3RLUA 4FX7A 5D32A 3LBCA 2X2YA 4D6DA 1AUSL 2TYSA 1YTDA 4KPRA 3GXPA 3CLMA 1GV4A 2Y8UA 1FDYA 1XLBA 2PP0A 1EBDA 4CGTA 1UJPA 2QVNA 3NQMA 3WF3A 3G8EA 1MI3A 1DQXA 1RH9A 3IAQA 3HU7A 4JTIA 1IXPA 1DHPA 1EL3A 1H1NA 3KCLA 2QPSA 1BHGA 1SSDA 3CQIA 3I6TA 3ZT6A 3SAZA 4J4KA 4B4FA 1CXLA 4DJFD 3AZRA 5C71A 4XAZA 1SJDA 4J35A 2C3ZA 1KA9F 4OECA 1BF2A 1TKKA 3W2UA 1FWTA 4ZQRA 1BWVA 3F03K 3KCOA 5FCZA 4RW3A 3PBWA 4UIOA 3OB8A 4HP5A 2BS9A 3SSZA 3WCZA 4DNHA 1HKVA 4O4WA 2R9ZA 2E28A 1IXOA 5AVHA 3GK0A 3W1RA 5FF4A 2ISVA 3DC8A 4AY1A 4YIWA 1VFLA 4PODA 1FKWA 2PUZA 2XSXA 2G3NA 5C6MA 1W1VA 3HQ1A 3CXBA 4ZO9A 3OQEA 3CPUA 2OYKA 3DGHA 1LZOA 4AYSA 1EJ7L 1ZHAA 2X16A 3B9JB 4MKSA 1O7AA 1N8FA 2O7SA 2Y7FA 2BXVA 3II1A 2J13A 5F2MA 2V69A 3ARQA 2ZC8A 1TA3A 2D1ZA 4WZHA 4JBRA 4QITA 2GOUA 1E4NA 3A5FA 1VFTA 3GR7A 3W76A 5MKGB 2A7RA 2XZ7A 1PKYA 3K5XA 4NAFA 1RQHA 4HCLA 3VNDA 4MG4A 4ILSA 1LOLA 5A8QA 3GY1A 4UR9A 2CLFA 4IHCA 4KIEA 4X0VA 4D8LA 1X38A 5FACA 1POKA 3L8KA 4X60A 3IRSA 5D33A 3PNZA 1A4MA 3A7RA 2FIQA 2PDYA 3THAA 4ECLA 3PANA 1R3QA 1DJHA 3LCGA 5DMLA 4LAUA 3VI2A 2GSJA 2PDLA 2BHUA 4UTTC 4DJEA 4AVOA 1SYTA 3RMJA 4ROQA 1WA3A 3V0SA 1E40A 2DSKA 4JPGA 3V4BA 1E15A 3O6YX 1DXIA 1P7TB 3UJEA 3PS7A 4IIDA 2YCJA 4HPNA 3QV6A 4JTJA 1EQPA 4F2BA 1Q4NX 3MWCA 2YBTA 1S2CA 3TJLA 3HQNA 2ZOXA 3GWQA 2FPVA 1JZ4A 3L2MA 3IC9A 4MB3A 1AMYA 1F05A 3W6LA 4X3ZA 3KHDA 1EWEA 5REQB 3CIXA 1GOWA 3CK5A 3RMEA 4ES4A 4PMYA 3RM4A 3GDRA 1VPYA 4PRRA 1YE6A 1JCJA 3W53A 5D9PA 4ZE5A 5JIWA 4P7RA 4LWWA 2JKPA 4D8ZA 3OBKA 2UWFA 1Y5WA 3FSTA 3M0JA 4K8HA 1VDVA 3R58A 1ZP3A 4GWEA 4LVFA 4E2OA 1P0KA 5D9MA 4E38A 5M2FX 1PZ0A 2XG9A 3GKFA 1JFXA 4E3TA 1KFBA 1DP0A 1NH6A 3LV6A 2PRMA 3S1XA 3LTYA 2CERA 3IGSA 1TWDA 2KAUC 1S5MA 4X61A 1BRLB 3KM8A 1IIGA 4M1BA 5A6SA 2ZVRA 4QX4A 3PJTA 3BV4A 1LQ0A 1XLHA 3RGTA 5JH1A 5G4EA 2YBUA 2WCSA 3LU2A 4O1CA 4C6QA 1K6WA 2BTMA 4MNKA 1OT2A 1P5BA 3SCOA 4AF0B 3P60A 3F5KA 5FF3A 2VRKA 1RM6B 1YLVA 2NQ9A 4J5NA 4R85A 2TMDA 5EFFA 1WXZA 1ZCOA 5TD4A 3O6DA 2GK1B 4MWAA 1XIDA 1UYQA 2J47A 3WBWA 1RJQA 1ZZMA 3SR7A 1CT5A 1XIEA 3LXBA 1R3TA 2XVNA 1NIUA 3VKAA 2W5FA 1LL6A 5G5IA 2PLJA 4ZO7A 4LTSA 1OZMA 4ZQOA 1T99A 4FNSA 1POJA 2DDXA 5BOOA 3NFUA 3GHUA 1R2SA 3D0CA 3NO1A 3WZ0E 2R9RA 5CJ5A 2CU0A 1JULA 3G1DA 2GQ8A 1F3TA 5C9RA 1LLOA 1WOAA 1MQPA 4LCQA 3DG3A 1A3WA 2GL5A 4KBXA 4ERIA 5DANA 4N9CA 1SO6A 3DYOA 1V6TA 2CLMA 2IPFA 5CG7A 2E5CA 4H4IA 3S47A 2G50A 1MXDA 4JTEA 2JBMA 4GVFA 3EB4A 4O54A 2WZHA 5E70A 3CZLA 1JD9A 3GDTA 3R5EA 1H6VA 3ES8A 4O53A 5DRIA 1M6IA 3NQDA 2C3DA 2X99A 1UQZA 2HNHA 4LVBA 2GYIA 2DUXA 6ALDA 3GSMA 3EDFA 3CMFA 2JF7A 2QDHA 1ZAIA 5I06A 1NQKA 5DXYA 5CKSA 4JIQA 1BWLA 2VMFA 4IG2A 5G1YA 4PULA 4HD5A 1QHOA 5A6JA 1ZSXA 2BMBA 3WD0A 2QCGA 3N6QA 2PRLA 5CZJA 1B31A 4BQ5A 3QMSA 1TFVA 1VBRA 3MU7A 3W7CA 5I3GA 4KWUA 1K7XA 1DXEA 1U5HA 4ZSUA 3M0YA 4R27A 1HZYA 1E71M 3EAOA 2XU2A 5HMDA 4MFDA 1GONA 1JDAA 2GJRA 4GPNA 4OT7A 2A6NA 4MYXA 1VIWA 3B05A 1OABA 2I5IA 4QG6A 2X8GA 1K8ZA 1K4HA 3FJ6A 1FTXA 3TH6A 4DPPA 1V3JA 1JEHA 4AZIA 2MUCA 4IZGA 3EEZA 1H2IA 1JI2A 1QPRA 2DH2A 1HF6A 1C8QA 3HA1A 3OC4A 1VJIA 1FEAA 5D9OA 3W0KA 2Z29A 2A3AA 5BW6A 1I9CB 1FDJA 1T7LA 4V15A 3TW9A 1GW1A 3G3DA 2BX7A 1ODUA 4R9OA 1V03A 4A35A 1VJSA 8TIMA 4NJGA 4DJFA 2CCRA 3UGVA 4OV9A 1MW3A 1Q8AA 1CECA 1R9YA 5AHFA 5DT7A 4XZLX 3T7VA 4XO6A 1V97A 2UBPC 3BLKA 4O15A 4CN4A 4C6FA 3U48A 1Q85A 1EJWC 1SUXA 3SRFA 4O8RA 4CCEA 4IH3A 1ECEA 3G77A 3FSUA 3NURA 1EOKA 3EDEA 1SW0A 3NA8A 3M0ZA 3CUFA 4XZIA 1KTCA 4ZR8A 2XFRA 1XI3A 3AOFA 3M5XA 1OY0A 1PKNA 1HJXA 1WZKA 1KLYA 3BLFA 2AL1A 3LNMA 3CC1A 5C7HA 1IEWA 3QQ0A 3CTTA 2BY3A 4N2YA 4NF7A 3W29A 1F3PA 4QAWA 4NZJA 4PTDA 4QS6A 2GDVA 4IGMA 4IT1A 2PPGA 2VFIA 4WY0F 2EBNA 1H41A 2YL6A 3G1FA 1HKJA 2Z7KA 2WSRA 4I7WA 3SCVA 1CLKA 3CZKA 1YXCA 1IZJA 2CZ5A 4IJCA 2J9XA 4ATDA 4AYGA 3BGGA 1I4NA 1K6AA 3URHA 1EBGA 3T42A 5EFDA 3TYDA 5HWMA 1N7KA 3QQ1A 4M1RA 3U4AA 3OZPA 2GUYA 4U10A 4KH2A 4QLJA 2ALRA 5LIWX 4TOQA 1IWPA 4AU0A 4LCRA 5EBUA 3ZLGA 3H2MA 2ZUWA 1OSEA 1AW2A 1TJ1A 4LUJA 4LW7A 2OLSA 4GIRA 1Q6QA 2ZZ6A 4B3LA 1LPFA 1Q7QA 2Y88A 4YL2A 1P0EA 4S2BA 1W1TA 3RO6A 4Q8VA 1Z44A 4TX6A 1OF6A 3G1YA 1NY1A 3DBPA 2FGLA 1FVPA 4OUIA 3RF9A 4QHRA 1D8CA 2E5AA 3B0PA 3ZLHA 2CBVA 1T3QC 3BMVA 5IDZA 2BY2A 1V3HA 1P0DA 4O13A 3RPDA 1W17A 3EWBX 5DCBA 1PBGA 1FFVC 3CT2A 4GYPC 3BH4A 1LQAA 1NF0A 4UFIA 2YZRA 4JX5A 2YYTA 1WKFA 2VDIA 4HTYA 3UFYA 4NXSA 1I45A 2QJGA 4MJZA 3WQEA 5F4WA 1UWTA 5JMUA 1JGMA 2E6DA 2GDUA 3NQEA 1EGZA 3BICA 2V6OA 4BR1A 4WGXA 2Q3OA 1NFGA 3TQVA 3T2OA 2PU0A 1PKLA 3CS2A 3W4RA 3CQKA 4YNGA 4XZNX 3TOYA 4AZBA 4H41A 3S42A 2Z1BA 1SB3B 3BCJA 5HATA 1W1A1 4RNFA 1TO3A 3EWZA 4YPJA 1Q66A 3VOJA 5G5GB 2O7QA 3RCNA 1WQ5A 2CZDA 1BTMA 3A21A 1UP0A 2DORA 2YQUA 1ZBKA 2CYGA 2ADAA 3SCUA 3L4UA 1XXXA 3L4YA 3TUUA 2C16A 2BASA 1ZU8A 2QIIA 1C8VA 3G1AA 3U7BA 4ENLA 3WUEA 3EX6A 4JYEA 2OQYA 1Z41A 3GTNA 1KFCA 1KGWA 3TC7A 2POTA 4AISA 3ITLA 2ZZCA 3GU1A 4NJJA 4XB3A 1K3UA 4KERA 3RU8X 3UR2A 1SFJA 3E5BA 1WAUA 4XX6A 3QHNA 4E5TA 3ZJKA 3H70A 4CVUA 1UZHA 2YB1A 4JTSA 3WF4A 1YX1A 4PL1A 2GJNA 3UZZA 4DM1A 1B30A 4L4MA 2F2HA 1LBFA 2RKXA 4NI8A 4ROPA 4LY4A 3RHGA 3UVIA 4PBGA 4OOZA 1IE7C 5TNVA 3HO8A 2BODX 2CITA 2OOGA 4FMVA 2PD9A 4MTVA 4B3KA 1FWSA 3RO8A 2VO5A 4IIGA 4QR6A 3GNRA 2WCGA 3GZ3A 2INZA 1A5LC 4DELA 1GEQA 4HHHA 1YE4A 1ITCA 5DT5A 2XIIA 4JFSA 4ATWA 1M7JA 3I3DA 3MC5A 3TYCA 3H24A 3SCRA 1OCBA 1EJTC 3WQVA 4GYJA 2H90A 3URBA 3GG7A 3EA1A 4P7QA 1VLIA 1MW1A 2WM0A 1FH7A 4MKNA 5BRPA 1IT7A 4L6OA 2X09A 3W7JA 3EKLA 3NM1A 2J7DA 2CFFA 3W6MA 2WMHA 2CW6A 1O12A 1A4LA 4Q8UA 3VIKA 2J6XA 3APGA 2QKFA 5AHMA 2ZXDA 3TAKA 2OWXA 5MF5A 4WY0B 1KB3A 3TR9A 3QSRA 4AX7A 4F0KA 4LALA 2I9UA 4PRWA 1TV2A 3TYEA 2YA0A 1PX8A 1CXFA 2XH4A 3WMCA 1LG2A 3FJNA 2PWFA 5I3HA 4H4VA 1J96A 4PCPA 3PM6A 4GI9A 3WLJA 1DJZA 3UBPC 1SZNA 2ASHA 2G3JA 3LI1A 2NQ5A 2QUUA 3LD5A 1MW2A 4B16A 1GEHA 5IFTA 1LWIA 1KCXA 1XH2A 2VWSA 2GWGA 1E0TA 4D6FA 4EVZA 2WMIA 1ADOA 1OK4A 3T2PA 2XSBA 4K39A 3IK4A 3R6IA 5KEZA 1K8XA 2V3FA 2ZFAA 2TAAA 3K1DA 5CPNA 1EJVC 3CO8A 3KAOA 1KGUA 4I90A 5AYXA 3KBNA 3WQ4A 2O0TA 2WKJA 1YYAA 2XINA 1XANA 3STEA 1FH8A 4RW5A 4H4RA 3BGAA 2QV5A 4LA1A 1NDYA 2QF7A 1OFRA 1HN1A 2A8XA 2ZRVA 2BSLA 5LNRA 4O4VA 3TC6A 3VA8A 4V33A 4GQQA 4D6IA 3O8AA 3BK0A 4LVAA 3S5OA 3SCPA 2PDGA 1UZ4A 3MO4A 1WDDA 3VMPA 3E0VA 1EF3A 4QDPA 3TIMA 3HMCA 5F1UA 4AIUA 2QULA 4ZZ9A 1HVXA 2V2HA 3TTSA 4ATLA 2ZUNA 1MNSA 1W5QA 4D71A 4DZIA 5JIPA 3NPXA 1FH9A 2EQ6A 4JN7A 2O4MA 3ATZA 5FL0A 4H4ZA 2FQIA 3AMDA 2QLYA 1ZBWA 4WSHA 1NSJA 1RY0A 2BOFX 4W84A 4DY1A 3P62A 5D2TA 3WK1A 4UMAA 4PUKA 1EDTA 3NR0A 4CNPA 3FDKA 3USZA 4JFUA 2F6UA 1Q13A 3AUOA 3W1UA 1UKQA 5HMFA 1QUMA 4UC5A 4IPNB 4PH6A 3WQWA 3PTMA 5FIPA 3FHAA 3RFAA 3VM7A 3OG3A 1ZBVA 4GJ1A 4P7NA 3K4WA 3KFTA 2RDTA 4UQEA 4MY8A 3M47A 1NOFA 2G41A 3MJYA 3TYZA 4LB3A 4UTJA 3W81A 4FIQA 1ELSA 2QMJA 4BA0A 3RX4A 2B7OA 3SURA 4Q4SA 3BCDA 2WJFA 3EMCA 3RK8A 1JOAA 4JIIX 5TAOA 1LDCA 3M0MA 3L5MA 1KXQA 3TTEA 3JUGA 3QTGA 2WVUA 4A3UA 5HDRA 1W9DM 8RUCA 1HL8A 4J7RA 2ALDA 4EAMA 2GJXA 3FK4A 1E1CB 1P6WA 3A24A 3DKJA 3I68A 1W9PA 1EC7A 1Q3NA 4C5YA 2XIQA 3L5AA 2YR1A 3KVKA 1ZL1A 4DVOA 3C2FA 3DN5A 1JGIA 4LANA 4JXCA 2Z1VA 4M80A 1NJJA 4UMCA 1UROA 5C9XA 4KCTA 1E4IA 3WD3A 1F76A 4OGZA 1VQTA 4H4YA 1A5UA 1YTKA 1R30A 2YIHA 3IS4A 1GVQA 4YTUA 3NXFA 2RJHA 1EO5A 2C91A 2V63A 3GH7A 2C18A 2CXEA 1KFWA 2D73A 3W73A 4OU1A 3BSHA 1F6PA 4XD3A 1SU5A 2F38A 3UXAA 3KCJA 2OSXA 1OQFA 1WNOA 4NJHA 4G1KA 2FB2A 2VC6A 1GOQA 4WJEA 2UV8G 3PN8A 3WNKA 1G0CA 3SI9A 1GJWA 3N18A 3GVVA 3W1PA 3UVAA 3GXDA 3BPWA 3OGRA 4EQRA 1AH3A 3DGBA 2GGHA 1FWWA 2P88A 5C7VA 4AZCA 4I5XA 1DYSA 2G95A 1XYBA 7A3HA 1BWCA 1CW2A 1WXJA 2QMKA 3PG8A 3AJ7A 1J0JA 2VL4A 1R9ZA 5AYBA 3CB8A 5DY2A 2ODOA 3GTHA 1JUKA 3AIRA 5C9ZA 1IF2A 4RDVA 4PTVA 2EPHA 1VP5A 3TQ0A 4QNEA 3AIWA 2Z6IA 4KKXA 4DJEC 2ZX7A 1WB0A 3WG6A 3LXCA 3FEMA 2GSEA 4XAYA 2OLAA 2O9RA 4HA3A 3U5UA 1KV8A 4AEFA 4Y2WA 4J3SA 3IAPA 3UY8A 4H1ZA 4AIBA 2WOWA 2ZZ3A 1Q1RA 4O50A 4HMCA 4GY7A 2PDQA 2QAEA 4TVUA 3U57A 3SY1A 3VGDA 1FQ0A 5A8NA 1TCMA 2ISWA 4G5DA 1D3CA 1C9WA 2E67A 3BG5A 1O5KA 3CUHA 4NRRA 3URQA 3WFLA 3P2VA 3XISA 4DI9A 3KLKA 4WGHA 3WLHA 4JDYA 3GDLA 1KFEA 1F3WA 3KLJA 4Z2KA 3TFXA 1HGYA 1VBGA 4B5UA 2JALA 5IXEA 4JN6A 3OVGA 2DSUA 4WJXA 4HIBA 4UR8A 1IWBA 4GD0A 2IKJA 4LNCA 3MSRA 1HKIA 2FMOA 1NWTA 3FIGA 4QM1A 3TXVA 4RX0A 3TJXA 3HGSA 3IJ9A 1OD8A 4PMJA 2EJ1A 1XIIA 1S2UA 2E8YA 3FKRA 1TSIA 3ITOA 1RPXA 3GG0A 3HFYA 2XUCA 2IQTA 4DWDA 4L65A 3NG3A 5LNWA 1PEZA 2Y6ZA 2CWXA 3NZPA 5F2LA 3DFHA 1F3EA 1EP1A 1W9XA 2V3DA 1DORA 1XR2A 1UUMA 1WYIA 2FZ9A 2X40A 2ZXAA 3PZVA 4O11A 4XVDA 3BAKA 4GI6A 1A53A 1XX1A 2FZDA 1PL9A 2ONEA 3VOCA 3KOZA 4M6PA 5I09A 1S5NA 1PXGA 3FX4A 1YXYA 2G5WA 3WNLA 4MWAC 3NQCA 2WBAA 3BOFA 1VBHA 1ZY9A 3QHMA 1EZ2A 1QI0A 1YDOA 4FK9A 4PUNA 1G01A 2RH9A 3DU0A 1U1JA 3VKKA 2FB3A 2YDAA 4HHLA 3WH6A 1KO0A 1V3IA 3N13A 5AFDA 3A7UA 3W7MA 4P5UA 1RD6A 1LROA 4B90A 2VZVA 3WF0A 3W7RA 2UY4A 3OP2A 2YLAA 3RJYA 1TPVA 4AD5A 2W0HA 1UOKA 3S2NA 2WSPA 3B8DA 3TU9A 4D6CA 1B57A 3CL6A 4FI4A 2VGFA 1E0XA 8A3HA 4A8IA 4WSKA 4J2MA 5GNZA 4C6OA 1WCGA 4JFWA 4CQ8A 3EWWA 3BJFA 1F4AA 1JCXA 1YKWA 3GTFA 1LL7A 3MYOA 1J01A 2BLEA 3ARYA 1DIDA 3P93A 3W1NA 4K8GA 3UERA 2AKMA 5K9XA 2VR2A 2PF0A 3B9NA 2VDGA 4DZAA 1A0CA 3U0HA 1B9BA 4WUIA 4M7TA 3QYQA 1YMYA 1DWGM 1VENA 3MY9A 3G1RA 5HANA 3ZJ7A 4H9YA 4BI7A 3FVDA 1UR4A 3CZ8A 3GNPA 4Q8PA 1XCWA 2ZUSA 3S5ZA 1B3YA 2E5BA 4LOCA 5FOOA 2E4TA 4DLMA 2DJXA 3VTRA 3ZFHA 4PC8A 4UQ9A 1GPFA 3VD3A 3SCTA 4J1OA 4NAEB 4UTLA 1JDFA 2DSWA 3LENA 5C0QA 1DIOA 3LSBA 3CZJA 3UT0A 3KS5A 1SM9A 3A3HA 3WBYA 1OYBA 1OZQA 2GVEA 2RAGA 2XN2A 4GQGA 3CHCA 3WLSA 3APTA 1A3HA 3BMWA 2X1IA 3F7JA 2F84A 3M0XA 7XIMA 3M07A 3URAA 1JCYA 4FPSA 3GXMA 3MW7A 3P84A 3T8QA 4AD2A 1AK5A 7CGTA 2B7PA 3U6WA 3OU8A 3ITTA 4S39A 2VRJA 2BVTA 5KTLA 2WLYA 5M03A 4DJFC 5C55A 3BLDA 2VWTA 3M41A 4GBDA 1EJSC 2WPBA 5HOSA 2ZRUA 4MLRA 1H5YA 1XIGA 4PL2A 2V38A 1O6IA 5E9XA 5I78A 2HQMA 4K1GA 1NDAA 4WXZA 3A6OA 2FLIA 4DBSA 3MUXA 3S1GA 5DO8A 1O95A 4O19A 4QNWA 1QOQA 1UH4A 3VC6A 5LNUA 4C7DA 3GVGA 1EDGA 2YYUA 2ZXQA 1QRQA 4MNLA 1JROA 4JICA 4WKAA 1X6NA 3R8RA 4WHBA 2WPGA 2EO7A 3ZWTA 2W6RA 4LS1A 2G3IA 1U5JA 1UA7A 5D04C 1Q6EA 4C60A 4AAJA 5DBTA 2JGQA 4IIFA 1QCWA 4RKAA 3PG6A 1TUXA 3CV2A 4HK7A 1OX6A 2R1PA 1X1ZA 3DYPA 3VXGA 4R5EA 3Q58A 1VFSA 4N02A 4K3ZA 5JH2A 3W27A 3FNDA 5A3HA 2IXUA 3REQA 2HZGA 3GQYA 3ZSTA 4P7LA 5D4YA 2Z1WA 1DE6A 4WX2A 2PP3A 2Y62A 3PAOA 1J18A 4O52A 1NHPA 1PUDA 1UD5A 1REQB 3E1F1 1C7TA 3QZ6A 5HR6A 1KKOA 1XLJA 4AZHA 1JAKA 4H4TA 3LS9A 3OIXA 3MKKA 2C0HA 1LUCA 3SN4A 2WV8A 4H50A 1DIKA 1W56A 4YTRA 1YDVA 3BQ5A 1KBKA 4TVWA 4C6LA 4NEVA 5K3VA 3ETRB 2FHCA 3AUJA 2WWCA 4L1WA 3QV8A 1CEOA 4HU4A 3UW6A 1EX5A 4EXBA 3DESA 3N3MA 5G5HB 1K9TA 2WHJA 3PZIA 3W7PA 4MDPA 2X50A 3VOFA 3VZYA 3LCIA 1D8WA 3IGXA 1MXGA 5D03A 4GO9A 4U28A 5HXMA 5C2GA 3CU2A 5H2ZA 1GJPA 5KVHA 2DT2A 4PMNA 5JXQA 1FWCC 3N34A 4LS2A 1FX6A 4CQCA 1HGWA 4QG9A 3HJEA 3EUB3 4S3GA 3GB6A 3MV11 3B40A 3FLUA 2J88A 3EPMA 1QASA 1TVNA 4PMZA 1JYNA 3VCCA 2DZXA 4DZ5A 2E68A 1E9LA 3LCLA 1UZ1A 4LXFA 1QPQA 3KRBA 2NVAA 3C8FA 2BBFA 3BE7A 3CHDA 1FWFC 1XW8A 1G5AA 2JKEA 2QCDB 2EKGA 4JYFA 2QNEA 1D3GA 3F4WA 2I57A 4Q4KA 4FAMA 4WDUA 5KINA 1QTWA 3KL5A 3TTYA 1EC8A 2ABBA 3ZJ6A 3PY2A 4TUFA 4ZCWA 4RNJA 3GZAA 1TUFA 5AVNA 4XIMA 3N9KA 1FO4A 2QGHA 3CAWA 3MB9A 3C2RA 1XUUA 1KRAC 2PA6A 1XDMA 5TQLA 4J3XA 1RZMA 4DUXA 3WDRA 3EKZA 1G67A 3TSDA 4YWOA 3IUDA 4GFIA 3TZNA 3ZR4A 4FX9A 4LYKA 4DNAA 3PPHA 4JKKA 1W3IA 4J3VA 4LUIA 4RJEA 5CSRA 2NT0A 2X1SA 1ONXA 2X7WA 2PGRA 3PBUA 2FPTA 3GAKA 1K70A 2VX5A 1YEYA 2PBOA 5XIAA 3QTPA 3NVZB 3N9SA 3UP8A 1UD2A 5CBIA