4F4WA

Y-family dna polymerase chimera dbh-dpo4-dpo4 #1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase IV
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
total genus 113
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4wA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f4wA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4wA01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f4wA04
3H59A 5KFXA 5C42B 7ICHA 1ZQKA 4O4GA 5KG2A 2R8GA 3V6JA 2IAJA 5I3UB 2ZD1A 3KJVB 4DL5A 3NBPB 1RTJB 5HP1A 5DB7A 2VA2A 3LK9A 2IM2A 1JIHA 3T19A 3LAMA 2FJWA 3QIDA 3TVKA 1Z00A 5J0PA 2ASJA 1TV6A 4Q8EA 7ICJA 2B43A 3K4GA 4QWCA 4ED1A 3H2LA 3IGNA 2AGOA 1U47A 4ID5A 4URSA 4UB1A 3MTKA 4RQ4A 1RA7A 4DQRA 4O44A 4R5PB 2MUTB 1FK9A 2UVUA 4K4SA 2YNIB 4PHDA 9ICMA 1ZTTA 3OGUA 3THVA 4F5QA 2YNHB 7ICPA 1IKYA 1A76A 3PMNA 4MEYA 4QWEA 4GLXA 1ZQZA 3HVWA 4RQ3A 4ZP9A 4MIBA 2ZJ8A 3MFHA 1C0TA 3C2MA 1HQEA 2UVVA 3RH6A 5DDMA 2AU0A 1IKXA 4O5KA 4R63A 4IDKB 3PV8A 1ZQYA 4DL2A 3C5GA 3DYAB 4F2RA 1X9SA 4ECQA 4IH5A 8ICXA 5J2QB 2FPMA 1ZQBA 4I2HA 1FKOA 4H4OA 4K4VA 5DB8A 1NJXA 4LQ9A 4KLJA 2AX1A 4ZHRB 3HWTA 1ZQWA 4M6WA 4MIAA 5DG9A 2A1JA 1NK6A 4EO6A 4F5NA 1IM4A 1TL3B 1LWCB 3BQ2A 3KK1A 3DLEB 2OPRA 3CDEA 5KFMA 1QTMA 7ICVA 4YVZA 2JEIA 5EWGA 5IINA 1ZQUA 5D49A 2BCUA 1IXRA 1QUVA 1QAJA 4K4XA 2VG6B 1S48A 5EDWA 4ED3A 2PFPA 5KFPA 4ICLA 4TY8B 2VG5B 2HHSA 3LP0A 5HHIA 8ICLA 1NKCA 3UQSA 1S6PA 4JWNA 2I1QA 4C8NA 4PQUB 1HPZA 7ICUA 2HNZB 3DLGA 4I2PA 8ICTA 1BPZA 3OJSA 4MF2A 4TYBA 5K14A 4O3RA 8ICBA 2Q0ZX 3H5YA 4KTQA 5J0UA 1XR6A 5DLGA 3FDSA 1EP4B 4KLDA 2IBKA 5HROB 2AGPA 1RTDA 3GQCA 5DBCA 1JLBA 4O9MA 8ICNA 4P4OA 5J29A 5HLFB 7ICEA 2FMPA 1VRTA 4DWIA 3LP2B 1N56A 4DG1A 3QIPA 2FJVA 1ZQAA 5DQIA 1ZQOA 2ASDA 4NLVA 3PX0A 4IH7A 1L3VA 1ZQTA 1RT5B 1DTTA 4MFBA 4UAZA 2JEFA 1IKVB 5KG6A 4I7FA 1RT2B 5IILA 4NM2A 4KLQA 1MSWD 1TKZB 2W7PA 5DG7A 4RQ2A 4G1QB 1TVRA 8ICRA 1XSLA 1XSNA 4BXOA 4O3PA 2R2SA 4ECSA 2F1IA 4I2QB 3FFIB 1T8EA 1JLQA 1RT4A 1LW0B 1C1CA 1SKRA 1C0UB 4RQ6A 3Q8PB 2KFNA 1RA6A 4FS2A 4M2YA 3SFUA 8ICOA 9ICNA 5J2MB 3OLBA 3RJEA 2C22A 3DDKA 1UA1A 1XR7A 1JLFA 4F50A 1JLCB 4LZGA 2XI2A 4JV2A 5KFJA 5DGBA 4QZAA 5BOLA 3MFIA 2B21A 4NCGA 2OWOA 1U48A 3BREA 7ICGA 1KTQA 3KLFA 4MK9A 1MMLA 3UPFA 3VQSA 1WCNA 5DQGA 4FBTA 1HNIA 5KFLA 4QW9A 2O5DA 4LVSA 3KOAA 2ZUCA 3ZDBA 4FBUA 2HNYA 5FDLB 4WYWA 1NK7A 1EXNA 1S0OA 1RT1A 2OPQA 4EYIB 4YMMA 1XSPA 2GWSA 3V81A 1N5YA 4O3NA 1RTIB 9ICQA 3C6TB 2BCQA 2HNDB 1BQMA 1NK8A 4M04A 4I2AA 3JSMB 2JEGA 3C1ZA 1NKBA 3CJ5A 1D8YA 4XPCA 3QGIA 2BHNA 4DOCA 2PFNA 3V6DA 5HP4A 1SH3A 3KLGB 2BDPA 3DMJA 3MR3A 5F8LA 2VG7B 4TLRA 1JKHA 4LSLA 3DRSA 4RW8A 4IG0B 5DB9A 3I0RB 9ICAA 4PWDA 1S0VA 4WFZA 5F8HA 4Q0BB 1UWBB 4KKOA 3KLHB 5KFNA 2ASLA 2J6TA 4QW8A 5IIJA 4IG3A 2UUTA 4JV1A 1XWLA 5J2PA 3RJHA 4ED8A 1ZJMA 4IR9A 3DM2B 2EC0A 4ZP8A 8ICJA 5D3GA 1S9EA 2OPPB 4RW4B 5KT6A 5CR0A 3H8JA 2XO7A 3GIJA 3JPPA 3CO9A 4ED6A 3RJJA 3T5JA 3QZ8A 4IFVB 4C8LA 1UNNC 1NJWA 4O4GB 1KHWA 4J9PA 2HHQA 2J6SA 2IAJB 2ZD1B 3MDCA 3JPRA 4YMNA 1HJPA 2BPFA 3MF5A 5HP1B 3I5BA 1B43A 3RJGA 5KT3A 3PJWA 5KT5A 1SL2A 2W9AA 2ZUDA 3T5KA 4UB2A 1TKXA 1Z00B 1TV6B 4QZCA 1NJZA 1T05A 2BPGA 4QZIA 4ID5B 2WCXA 2IJNA 3MGIA 3I0SA 4O44B 4UBCA 1TK5A 1S49A 4O5CA 1FK9B 4J9QA 4NZ0A 4DQSA 4MFAA 4NLPA 5CYMA 1FKPA 4QWAA 2H5XA 2XY5A 4NLWA 1U45A 1IKYB 9ICKA 3QEAZ 3ICLA 3KK3A 1KFSA 4B9LA 4F4KA 8ICWA 3N6LA 3ZDAA 1C0TB 2HAIA 2AJQA 1S77D 5KFTA 1L3SA 1HQEB 3N4MB 2YNFA 3PO4A 1MU2A 5KFVA 3RTVA 1IKXB 1DLOA 4IRDA 1SZPA 2ILZA 1CEZA 1SKSA 5KG3A 4F5PA 4Z6FA 4PGQA 3H8SA 3PW4A 3T3FA 1SV5A 1TP7A 3JYTA 4NLDA 4F93B 4XPEA 4NLYA 1FKOB 1V9PA 5L1KA 2WONB 4H4OB 2XCAA 4LQ3A 4YXJA 3OL8A 1I6JA 2KTQA 1JLAA 3ORYA 3D28A 5JXSA 4M6WB 2A1JB 4K50A 5DGAA 1NHVA 2ISPA 3KK1B 9ICWA 2OPRB 5J2DA 4K4WA 3BQ0A 2C28A 5CJ7A 2ILYA 1NKEA 4DFMA 1TVAA 4BWMA 1HYSA 4JV0A 2IHNA 2KFZA 1Y88A 2OPSA 4ICLB 1S1XA 8ICPA 4DLEA 5DQHA 1BPXA 1JLEA 1S6PB 1NK5A 4ED7A 5J0OA 1H38A 4DFKA 4DFPA 4R65A 1HPZB 4RW7A 3GILA 3DLGB 1TKTA 4I2PB 2HVIA 4RW9A 4LSNA 1D9FA 3LALA 4ED2A 4G3IA 4WFXA 2M9NA 3RH4A 3MR6A 4QZ9A 5K14B 5DG8A 4JWMA 1KRPA 9ICOA 2KN7A 4E0DA 1GX6A 4DLGA 4QZEA 4EZ9A 1LWEA 1RTDB 4GXIA 9ICHA 4R66A 1KFDA 1JLBB 2FVSA 3IN5A 4GXJA 1HMVA 4M9HA 3QO9A 5HBMA 3MABA 4M94A 1VRTB 3ETLA 4C8OA 3KHHA 3TFSA 4EYHB 4DG1B 3QIPB 1ZQPA 3CVKA 3TAPA 1NHUA 4NLOA 1HQUA 4ZH4A 1MQ3A 1DTTB 4F2SA 4MFBB 2NRWA 2PI5A 2KZ3A 2GIQA 4ED0A 3ZD8A 3TANA 3E01A 2ZJAA 4I7FB 3G6YA 5KFEA 4YR2A 1KFTA 3GDXA 4DO9A 4KLHA 5J2CA 1TVRB 2ZJ5A 4BXOB 4J9OA 3SI8A 5CP2A 1VRUA 8ICZA 3CJ3A 4B9VA 5DLFA 1JLQB 1RT4B 2B5JA 4DQIA 1C1CB 1LB2B 4O3QA 3PR5B 4M0AA 4H4MA 4R8UA 3ZDDA 4EBEA 1T4GA 3DOLA 3TARA 4IFYA 1D9DA 3KMSA 1JLFB 4RUCA 4IRKA 2JC0A 3TI0A 3M8QA 1SL0A 4NCGB 3UQ0A 2OH2A 2VA8A 1S76D 4ECTA 1RT6A 8ICEA 4I2GA 5C25A 2WONA 3KLFB 1RYRA 2BCRA 8ICAA 7ICKA 3PJXA 1HNIB 5L1LA 2F8EX 4NXZA 8ICQA 3IG1A 2HNYB 1BPYA 4J9KA 1RT1B 2OPQB 1XC9A 3RBEA 3NGDA 3V81B 3LANA 1N5YB 3Q8SB 1BQMB 1ZQLA 4KLGA 1TL1A 4KAIA 2UVRA 3G86A 4DEZA 1U09A 4QZBA 3AU6A 3PX4A 3I5AA 2FLNA 3KK2B 3V6DB 3ZDEA 4DL7A 3JPTA 4K4HA 4PHEA 2IM3A 4TUQA 2RF2A 4I2JA 5F8MA 5KFCA 4NRUA 3DMJB 8ICYA 2C2RA 3PVXA 1JKHB 4TQRA 4LSLB 5KT2A 2LYHA 3RJFA 5DBAA 2YKNA 1DGSA 3DRSB 4RW8B 2NRZA 1XU4A 3EZUA 3C2KA 2ZE2A 3QLHA 5J2HA 4EO8A 4B9UA 3QGHA 5I42A 4PWDB 3H4DA 4KKOB 3GV8B 1S9GA 3RR7A 4KLFA 8ICHA 1HARA 4IG3B 4KLOA 5J2PB 1REVA 3KHGA 4QPXA 2W9BA 5D3GB 4DOAA 4HKQA 2D3ZA 2XCPA 3UPQA 1S9EB 3D5MA 4PGXA 2R2TA 1R0AA 2WB4A 4KFBA 3BQTA 4M9NA 9ICXA 3TQ1A 1T03A 8ICCA 3UQ2A 4WXOA 9ICTA 2JZBB 3V6HA 4WYLA 3SFGA 5J0SA 4WFYA 4K4UA 1KLMA 2R8IA 1KSPA 3CDUA 3EYZA 3DRRB 5J2NA 2BPCA 3MECA 4EBDA 5KG4A 5KFSA 4U7CA 2R8HA 3N97B 1RT3A 4ZVFA 1TKXB 1T05B 2ATLA 3E2EA 2V9WA 1UT5A 4RNFA 5EWEA 4M9GA 4TYAA 3I0SB 4XUSA 2XY7A 4DSKA 5KG1A 1TK8A 4DSLA 1LWFA 1S1WA 3GIMA 1ZJNA 5CYMB 3GV5B 1FKPB 4IRCA 5L1JA 3QZ7A 4DL4A 4I2FA 3ZDCA 2HMIA 1EETA 4KN4A 3TAQA 1U4BA 3KK3B 7ICOA 3M9NB 1ZQMA 3ISCA 3E51A 4ECWA 4KO0A 3SV3A 4DSFA 4KLIA 1BQNA 3SZ2A 2YNFB 5J0QA 2WHOA 1MU2B 2PI4A 1SL1A 1DLOB 5KG5A 2D7SA 4KMUA 1WNEA 3H7IA 1QSSA 4UB4A 9ICRA 3ITHA 3FRZA 1QLNA 1CSJA 4NLTA 1N6QA 1SV5B 3JYTB 1DTQA 3DLKA 3FYHA 4MEXA 7ICIA 4KV8A 3QYYA 4X5VA 4TQSA 3RAQA 1JLAB 4DF4A 4YMOA 1ZQQA 1QSYA 4KLUA 5KFHA 3CIZA 3V6KA 3C5FA 4WXWA 3RH5A 3MBYA 4WE1A 4B9TA 4F8RA 8ICIA 3KK2A 3OSNA 3RB4A 5DKWA 4CCHA 4I29A 4F4ZA 2IM0A 3KLVA 2R2RA 3KLEA 5BPCA 4IOBA 3MGHA 3RJIA 3C6UA 1ZTWA 4KLLA 3HVAA 4RPYA 1HYSB 2XI3A 9ICFA 4R64A 4U6PA 4RNNA 3PMLA 2WOMA 2OPSB 1S1XB 1S0NA 4J9RA 4B3OA 3N6NA 1JLEB 3SYZA 4YN4A 4XQ8A 3ISND 4TY9A 3NAHA 5J2FA 2HHWA 3G6XA 5KFAA 8ICKA 4RW7B 4J9LA 2BE2A 4I2CA 1TKTB 1ZQVA 3GIIA 4YP3A 4RW9B 5KFIA 1TKDA 4LSNB 2XWYA 5J0WA 1S97A 1JMSA 1KHVA 3DRPA 2GC8A 3QE9Y 3MR5A 3HVTA 1XR5A 4EEYA 3BSOA 3G6VA 4F4WA 1BPBA 4I2IA 4F91B 2UVWA 1LWEB 4KE5A 9ICEA 2JZBA 1S1VA 4MKBA 4F5OA 1HMVB 3QO9B 4PHPA 5HBMB 4NLRA 7ICMA 1U9LA 4KLTA 4RPZA 2Y1IA 1L5UA 3CJ2A 3DRRA 2WTFA 4I28A 1D0EA 2IM1A 3MEEA 5F9LA 4ELTA 3ISNC 3EZ5A 3KMQA 1ZQHA 4RT3A 1C1BA 1HQUB 7ICLA 4TUSA 1COOA 2ZUBA 1T3NA 4ZP6A 1X2IA 3E01B 4Y34A 2HHTA 4QWDA 3PW0A 3GFKB 1ZQJA 5J2JA 1S1UA 2BGWA 3HPOA 4QZFA 5BOMA 5KFBA 3BSNA 4XRHA 3GV7B 4C8MA 3C21A 4ZPCA 4P4MA 1VRUB 4GC7A 3LWLA 2ISOA 3IHQB 4XO0A 1LW2A 1S1TA 2B5JB 1NK0A 3DI6A 4IFVA 2P6UA 1Z4UA 1QSLA 5J0RA 4DSEA 4ZPDA 1UA0A 4H4MB 4R8UB 3V7LA 4TUPA 2I5JB 5J2BA 2BQUA 3BR9A 3H4BA 4I2BA 1J5OA 1HNVA 4FO6A 3DOLB 4IFYB 5F9NA 2I1RA 5J0XA 4ECUA 4BDPA 2FLLA 2PFQA 3M8QB 3KLIA 4O5EA 7ICNA 1RT6B 4NLZA 5C25B 2FPLA 1U49A 1S6QA 2BRLA 1JX4A 1RDRA 1TQLA 4QZGA 3Q8RB 1NOMA 4LZDA 7ICTA 2V4RA 3H5UA 3TAMB 3IG1B 3H98A 2ZTCA 3T5HA 4DQQA 4GC6A 3Q8KA 3Q8LA 4NLNA 1UT8A 4RQ7A 1L3UA 3MR2A 1TL1B 1SH2A 3BGRA 4ELUA 1RTHA 1BGXT 4YMEA 2E9ZA 4RZRA 1NK4A 5D4BA 4URGA 9ICJA 1K1SA 4KN7A 3EPIA 2P6RA 1ZETA 1HUZA 3IGVA 2RF2B 4PUOA 4DL3A 3MEDA 5J1EA 1RYSA 2D41A 2YKNB 4UAWA 1RXVA 3KHRA 4RQ5A 1AROP 2ZE2B 3QLHB 7ICRA 5I42B 4M9LA 4C8KA 4O4RA 1WCLA 2BR0A 3RR8A 1CUKA 1S9GB 2HVHA 3QEBZ 5KFKA 1REVB 5KFQA 4YFKA 1SUQA 2W9BB 1ZQRA 4PPXA 4HYKA 1TV9A 4IR1A 3PY8A 4NY8A 4ZPBA 3OHBA 2FVQA 1R0AB 1QE1A 4KFBB 4IQVA 1XS9D 2QE5A 1T03B 1A77A 3NAIA 3NKYA 4RW6A 3V72A 2B6AA 3DOKA 5KFFA 4MH8A 5J2EA 5KG0A 2W8LA 1MQ2A 5F8GA 3BQ1A 3UXPA 3RB3A 2RDJA 1KLMB 3H8WA 3GYNA 5EWFA 4NLXA 5J2NB 1RT7A 4NLSA 3MECB 2XY6A 3AU2A 4YG2A 3KHLA 4P2HA 1RT3B 3UR0A 5J2IA 2Y1JA 2R8KA 2BRKA 2FPKA 4B9SA 2AGQA 4NLUA 5D46A 2V0NA 1KLNA 1LWFB 1S1WB 4KHRA 2DFLA 3KNAA 3CJ0A 3TFRA 4RNMA 5CYQA 4O0IA 1D8LA 2I5JA 3MEGA 1IKWA 4J9NA 1S9FA 2HMIB 1EETB 4ECVA 1JLGA 2IA6A 5IIKA 2BQ3A 4P4PA 4Y2AA 4ECZA 2E9TA 3OLAA 4RNHA 3N6MA 4KO0B 2FJXA 2IJFA 5KFWA 1JXEA 1BQNB 2F1HA 9ICUA 2YNGA 3NTUA 2YKMA 1TAUA 3H40A 2JLEA 3Q8QB 4NLKA 2AWZA 4J9SA 7ICSA 2W8KA 2BANA 4M47A 4EZ6A 1N48A 1BPDA 3ITHB 3PW7A 3PZPA 3TAMA 4B9NA 3UDLA 2RKIA 2JEJA 1N6QB 5IIOA 3BDPA 3BJYA 1DTQB 3DLKB 3UXOA 4YCXA 4UAYA 4KB7A 4KV8B 4YXMA 3M8PA 4ZPAA 2IMWP 5KT4A 3C1YA 3HW8A 3LP1A 2XC9A 1OS5A 3CWJA 3SV4A 4ZVEA 4QZHA 1ZYQA 4I27A 2W9CA 5C24A 3V4IA 2QV6A 4X2BA 3V7JA 4IKAA 2KZZA 4WE1B 3M8RA 1ZQEA 2HWHA 2CJQA 4IH6A 2GIRA 4Q43A 4BWJA 4RNOA 1DOQA 4RQ8A 5CWRA 3KLEB 3HKWA 4MKAA 3PR4A 1K1QA 2BCVA 4PH5A 3C6UB 3AUOA 3RRHA 3OHAA 1ZQDA 1ZQCA 2WOMB 2HWIA 3PX6A 4B3OB 3RRGA 2AQ4A 2NRXA 3M9MB 8ICVA 4NLGA 3IS9A 3JPNA 3IM1A 5HMMA 4BGDA 4URQU 3H5SA 4PHAA 4JUZA 2BE2B 1RXWA 3M8SA 4K4ZA 2NRTA 2IC3A 4TURA 9ICSA 4YQWA 3QGGA 1ZQXA 3DRPB 3IRXA 1NK9A 3HVTB 4K4YA 4RQ0A 3OL7A 5DDYA 5C42A 3OL9A 4B9MA 3B0XA 3PO5A 1RPLA 3EWAA 1XO1A 3CJ4A 4KHMA 1S1VB 5I3UA 3KJVA 3NBPA 1RTJA 5KFYA 1TK0A 5C5JA 3LAKA 1T94A 4NM1A 4M9JA 5EOZA 4DF8A 1TFRA 2P66A 5J2GA 9ICIA 5KFRA 3MEEB 2DPJA 4K4TA 3LWMA 1C1BB 2XGQA 2ZTEA 3EW9A 5J2KA 4R5PA 2CKWA 2MUTA 5IIIA 5J2AA 5KFGA 1LV5A 3K75D 2YNIA 4O3OA 3RB0A 1S1UB 4UB3A 4KLEA 4ZVHA 2YNHA 4ELVA 3RBDA 1Z3EB 3MDAA 4IQXA 1BVSA 2ALZA 3Q8MA 7ICFA 1LW2B 1S1TB 4NYZA 4ZMMA 3ISBA 3DI6B 2WRMA 2NRVA 3OSPA 4IDKA 4MFCA 1S0MA 4JK1A 4J9MA 3DYAA 1J5OB 1HNVB 4Y2CA 3FQLA 2VA3A 5DBBA 4DSJA 4ZVGA 4NLQA 5J2QA 4KSEB 3KLIB 4OL8A 4Z6CA 2XGPA 4Q45A 5JUMA 1RAJA 3M9OB 1S6QB 3NMAA 4ZHRA 4YD1A 1SH0A 4QZDA 4DQPA 3FSIA 3HX0A 3OJUA 1TL3A 1LWCA 5TZVA 2BQRA 3DLEA 2BKEA 1X9MA 4UB5A 2RDIA 2VANA 2VG6A 4RT2A 4MF8A 1PZNA 4K4IA 2W7OA 3LDAA 2PXIA 4TY8A 1ZQFA 2VG5A 4KLMA 3ZD9A 3BGRB 4DS5A 1RTHB 2FMQA 4ECXA 1X9WA 2J6UA 1JXLA 4PQUA 5CA7A 2C2DA 2HNZA 4ZP7A 3NL0A 2IHMA 3KTQA 1NNDA 9ICGA 4PUOB 2AQ0A 3MEDB 5J1EB 5KG7A 2W9MA 1SKWA 2FVPA 2WK4A 2FVRA 1ZQNA 4K4GA 4TN2A 4QWBA 4F4YA 1GX5A 2R8JA 3EPGA 4MK7A 3H5XA 1EP4A 4WZMA 5HROA 2MAXA 2HHVA 1ZQSA 4DSIA 1KDHA 5HLFA 1SUQB 2D3UA 4I2DA 3RAXA 3LP2A 5L9XA 1D1UA 1QAIA 3PW2A 4DOBA 2V4QA 9ICCA 3T5LA 4RU9A 1BPEA 4EBCA 5J0YA 1QE1B 1W25A 1RT5A 4YR0A 4RW6B 4O3SA 3CDWA 2B6AB 3RJKA 4PGYA 4Y3CA 3DOKB 4MK8A 8ICGA 1IKVA 8ICUA 1RT2A 2FVCA 3ISDA 2HHUA 5EUHA 1S4FA 3UXNA 4MFFA 2FMSA 4NRTA 3BSCA 5F8NA 4DS4A 1TKZA 4G1QA 1RT7B 3B0YA 4KBIA 9ICLA 3GIKA 4IQUA 3I5CA 5KFZA 1MC8A 1YVFA 4I2QA 3FFIA 1JN3A 1LW0A 4H54A 3HHKA 3PNCA 4F4XA 1C0UA 5KFUA 3C23A 4R0EA 1C7YA 2HHXA 3HT3A 2BCSA 4IQTA 5CYQB 5J2MA 4DFJA 1IKWB 3MEGB 4WZQA 1ZQIA 3BSAA 1JLGB 4IQWA 5DB6A 3HP6A 1JLCA 2ZTDA 1TAQA 9ICVA 2KZMA 2E9RX 4XA5A 4KLSA 2C2EA 5L1IA 2YNGB 1ZQGA 2PFOA 5F8IA 2HW3A 2YKMB 4RUAA 2ZKUA 4F3OA 2AX0A 3FQKA 4F5RA 2BANB 2UUWA 5FDLA 2RKIB 5HNKA 5T14A 4DL6A 1RZTA 5HHHA 1N4LA 4ECYA 1RTIA 4RQ1A 3C6TA 2HNDA 3M8PB 1B22A 3LP1B 8ICMA 3JSMA 4F92B 2FLPA 2JC1A 8ICSA 3PHEA 4Z6EA 2W9CB 5C24B 3V4IB 5J0TA 7ICQA 4I2EA 1NJYA 4GXKA 3KLGA 3V7KA 4YR3A 3RB6A 1C2PA 3T1AA 4YD2A 2VG7A 4Q44A 5F8JA 3PW5A 5HMLA 5KFOA 4IG0A 4TXSA 2I9GA 3I0RA 5IIMA 4UBBA 3LP0B 4KITB 4M95A 5KTQA 4Q0BA 4Z6DA 8ICFA 5CHGA 9ICPA 1UWBA 1HUOA 3OL6A 3IS9B 1KEJA 2R2UA 3KLHA 5KFDA 3C2LA 4FS1A 4UQGA 1S10A 2DPIA 2IC3B 1L3TA 3DM2A 4RPXA 4ECRA 2F1JA 3JPSA 2OPPA 5CB1A 4RW4A 3IRXB 9ICBA 5KT7A 3JPOA 1T7PA 4QZ8A 4Q8FA 3JPQA
chains in the Genus database with same CATH superfamily
3JRWA 1EX8A 1FJEB 1X5OA 1JMTA 1T9XA 5KG2A 2R8GA 1N0UA 1RKJA 1OY8A 5I3UB 2ZD1A 4J90A 1ULZA 4DL5A 5DB7A 3DOMA 2VA2A 1UL3A 2M0NA 2J9DE 2U2FA 3CSKA 4NZ7A 1UVNA 2XYGB 2AJ4A 1VC6A 1WOOA 4ERDA 3H2LA 4CLYA 3ZTRA 3IGNA 1O6XA 1U47A 4ID5A 2C3UA 4O44A 2YPZA 2WHEA 5K20B 3WKBA 1P9QC 5IYZF 2RU3A 1IBKJ 5AT1B 2IJRA 1O08A 2R86A 7ICPA 2ROEA 4PXCA 4MEYA 4GLXA 2Z8QA 5CCLA 1ZQZA 3R0DA 1BNCA 2HGMA 4DV6H 1VS3A 2UUBJ 3C2MA 5F41A 5IQ6A 4BKNA 1GMUA 4CO5A 2QK4A 2B9EA 2NXCA 2UVVA 5LM7E 3RH6A 5DDMA 4QIEA 1E9ZB 1IKXA 2KYXA 4R63A 3PV8A 2MKIA 2CNLB 4MMOA 4DL2A 3C5GA 2YY3A 4ID8A 2R7SA 2E5LH 1FDBA 3WDOA 5AICA 5J2QB 3HO1A 1WCMA 4H4OA 5DB8A 2R7QA 4ZHRB 3HWTA 4N8NA 1B6RA 3H0PA 1FRJA 1NK6A 4DR4F 1IM4A 3DC2A 3TX8A 4DX7A 3KK1A 2Y3YA 3DLEB 2JEIA 5IINA 1TE2A 1ZQUA 3AQPA 1T3QA 2BCUA 1IXRA 1R8HA 3R3TA 5EDWA 2Y0SC 5KFPA 4WGXA 3EVWA 3NRBA 1NHKL 4JP8A 2PEBA 4PAAA 4X66F 2YN4A 4KX3A 4C8NA 4PQUB 2FHJA 1Q0NA 3HM9A 3EGWB 4I2PA 1RJQA 1J5EF 1FNOA 5EE9A 3T8LA 4IOCQ 1HR0F 1N0VC 4NXMF 1YMYA 4TYBA 1R0CB 3R2DJ 1O75A 2W43A 2WF5A 2G0JA 5C3EG 3MAHA 3H5YA 4KTQA 1KOOA 1YJ9S 5HBRB 3FDSA 2GJ2A 4Q7AA 4KLDA 1FRLA 5HROB 3G4SS 2AGPA 1RTDA 1DK2A 2F77X 2G08A 1F44A 4O9MA 3J7YU 4P4OA 3HB9A 3DN9A 5HLFB 1VDHA 4N47A 2Y0BB 5HO4A 4DWIA 1EQMA 1N36J 2GLTA 2OFGX 3A13A 5KOWA 2UUCF 3KWMA 4ACOA 1M6YA 2EKYA 4ZCKA 3VAMA 5KG6A 2DO4A 1RT2B 3EGNA 1MSWD 4WKRA 1XQIA 2CVIA 3CIMA 2W7PA 2FZKB 1D3WA 5DG7A 4WK1A 1TVRA 8ICRA 1XSLA 1FVQA 4OZ2A 1MMNA 2ZC4A 4I2QB 1R0BG 1JLQA 1RT4A 1C1CA 2UXDH 3EUB2 4UT4A 4CC5A 3Q8PB 3WK7A 1CE8A 4F71A 5ALNA 4QYRA 3RJEA 2YQ1A 3AXKA 4LVNP 2H54B 1RG6A 3UR3C 2ZJTA 5KFJA 5DGBA 5L46A 5H2FU 4QZAA 5BOLA 5C8YF 4NCGA 1U48A 3BREA 1AB8A 1FJGF 1KTQA 3KG4A 5HMZA 5KAFU 4JMUA 3KLFA 1WKLA 1MMLA 2CNNB 3BO4A 1AZSB 1Q5YA 3VQSA 3FBEA 2RUSA 4DV5J 1HHTP 4NA1A 1GNKA 5C4XG 5CCMA 3POTB 3QWUA 3OXGA 1RT1A 4YMMA 4LR9A 2GAHC 2KN4A 2GWSA 1PYTA 3DUGA 2AYMA 1N5YA 2HLTA 2QA1A 5IT4A 3R5CA 2ZH9A 2JEGA 4JI6J 3JQKA 1VBXA 4ENOA 4XPCA 3T6JA 3T81A 5BR8J 4A3BG 4DOCA 2PFNA 2VFRA 3H0RB 2YB1A 2KK0A 3DMJA 2QA2A 4LSLA 2GO9A 1QVFR 4IG0B 8RUCA 3P45B 4PWQA 4X65H 3KD3A 2Q1LA 4CNTA 4OZ1A 2Y0SF 3RW6A 2E1MC 4WFZA 5DDPC 4KKOA 1KC8T 2MKKA 3NQBA 3GIPA 3Q86A 5KFNA 1WEXA 2ASLA 3J7Z5 4JI8F 1H7XA 1YBAA 2R7RA 1WWHA 3OQ2A 1HNZJ 4OZLA 2LU2A 4KR0B 4RW4B 5KT6A 2KJVA 3CO9A 2B56A 4ED6A 3QU7A 2DQNB 1CI4A 3BKTA 3G82B 2OTJS 2LFVA 2QO3A 4AT1B 1QQ6A 2L9WA 5HP1B 2IBOA 1Y3KA 3OXLA 1PX2A 3U1NA 1RWOB 2W9AA 1TAEA 3T5KA 1TKXA 1T05A 2RRNA 3K8WA 2RJZA 4GMKA 2CPDA 2QIFA 2ATCB 2W04A 4CH1A 4OYWA 1S49A 1VHFA 4O5CA 2Y0SE 5E5NA 2FHOB 2N7YA 5DDRC 2CJ9A 4WTOB 3C46A 2GVZB 3GIDA 3SBMA 2XY5A 1LXJA 1Z2LA 1KNZA 1U45A 1U8SA 1IKYB 2DCUB 5JU5A 3KK3A 3RG6A 3ZNUA 2JHDA 4F4KA 1T9VA 3I87A 3GJTB 3QRPA 1WUDA 1C0TB 2HAIA 3W2WA 3W2VA 3KOOA 2VH7A 4C4RA 4DR4J 2YRWA 2K8CB 1MU2A 2W2PP 2Y9UA 4X4QA 1SZPA 1CEZA 2OEJA 3D6MB 1KP6A 1VIXA 3SDEA 2LEAA 4P6QA 4Z6FA 4LF6J 3H8SA 2P5VA 5AKHA 1Q8IA 3T3FA 4CT9A 5IYCG 3GPAA 2LMRA 1TP7A 1IBCB 4OI4A 4F0LA 4XPEA 1V9PA 2XCAA 4YXJA 2LMIA 1ZOLA 3F53A 4X66J 1NMEB 2VR1A 4ETZA 3ORYA 2J7WA 4M6WB 2IVFB 2A1JB 1N88A 3I96A 3TUPA 2QSFA 1J5EJ 4K50A 2GMHA 1NHVA 3ILOA 3LGNA 4WF9Q 2OPRB 5J2DA 3IG0A 3BQ0A 1Y9OA 1KL9A 5CJ7A 3F56A 2CUYA 1QD1A 1Y3JA 1FWDC 4HLBA 1XMBA 4BWMA 4RWWA 3BV8A 1IBLH 4ICLB 2OPSA 2ZNYA 4NI2B 3GONA 4USTA 4MA5A 8ICPA 4DLEA 4KGVB 1BPXA 1M5SA 1T9TA 2H3FA 4P2FA 1CJVA 5IM0B 4F04B 4XTTA 5A76A 4R65A 4YS2A 2PFFB 4HI1A 3GILA 3DLGB 1CJKB 5C1OA 1OSDA 3KFWX 1FERA 1ZM3A 2F9JA 3NS7B 1KKHA 4YHHH 2PD1A 3MR6A 5K14B 4R88A 4JWMA 2PA3A 4KHPJ 9ICOA 2KN7A 4E0DA 3U7JA 4ZJLA 4C8ZA 3CCZA 2C3OA 5IC6B 2CPIA 3K5NA 4EZ9A 4PRFA 4M5DA 5M2RA 1UKUA 4P52A 4GXIA 2ZJQQ 1KFDA 1JLBB 3FCHA 4UQTA 1FJ7A 4GXJA 1RISA 4M9HA 2AXTU 1VRTB 4IQMA 3KHHA 4ICAA 2B7BB 2RAQA 3SXLA 4ETSA 2FKLA 5EE3A 3OFFA 4MFBB 1V51A 1VQNS 1YITS 2KZ3A 2GVDB 4ME6A 5KFEA 3W60A 2IYIA 3K5PA 3MPYA 4KLHA 1XMOF 3JSBA 2XMKA 4NLCA 4Y2JA 4BXOB 3SI8A 4P71A 3DXBA 5LOQA 2DZDA 2WSCC 5E79U 1X9NA 2B5JA 2OUGA 1LB2B 2HWTA 2B3TB 1DV2A 4N77A 4O3QA 1RZMA 5AK5A 3A0HU 2IDEA 1T4GA 3DOLA 3US5A 4LH8A 5AKEA 1D9DA 1JLFB 2FB9A 1YJ7A 2EFNA 2R7OA 4OJPA 1SL0A 2HS3A 2QN6B 2Q6CA 1S76D 2BABA 4JI7J 3UO0A 2OMLA 2WONA 3DNCA 7ICKA 4JI0F 3PJXA 1HNIB 5L1LA 2CQ4A 2LXIA 4UAUA 1FO1A 1UQVA 1V38A 2HNYB 5LT5A 4M5JA 4MV7A 1BPYA 1D9AA 2O01C 4J9KA 1XC9A 3B4DA 3NGDA 2DK2A 4WK3A 2CQYA 3K0JA 1ZQLA 5E7OB 1U26A 1VC0A 3ZTPA 4KAIA 2B8QA 1U09A 4LFBF 4JI8J 3PX4A 3CULA 1FD2A 2OAUA 4EGJA 1L8OA 1IQTA 3P5TL 3EGJA 4DL7A 2IM3A 3FC9A 5AI0A 4TUQA 2ZUAA 2RF2A 2KXFA 5F8MA 3AAWB 2UUAH 3QX7A 3L7OA 2LYHA 3RJFA 3DRSB 2YKNA 4RW8B 3C2KA 1DAXA 3TA0A 2ZE2A 3WK9A 5J2HA 3MC1A 5I42A 4QNLA 4PWDB 5EE0A 2Z2YB 4B02A 3IG5A 3L2PA 2C2OB 1WDTA 3CXCR 2GPWA 8ICHA 2VDIA 3QFWA 4K0KH 2VPSA 4DV4F 4FVMA 3HJVA 2QX0A 3ISZA 2FVKA 1NDLA 2WZ1A 4DOAA 5K8NA 4OJ6A 1S9EB 2WB4A 2IRXA 2QGFB 4IZOA 4A8FA 4PCQA 1UHUA 3K5HA 2GA7A 4AXJA 4WXOA 2HFZA 7AT1B 1OJ4A 4Y2MA 1M5PC 1FWCC 4YDDB 3SFGA 4RB0A 2OHFA 3LWBA 1Y11A 5C0YA 2MTLA 2QB0A 2BPCA 6FDRA 2IFXA 4JI1H 4DU7A 3FBBA 5HSPA 5EWEA 4TYAA 2ODGA 2VDHA 4XUSA 4P2MA 3RUBL 3ILJA 4UY85 1LWXA 2H4YB 3GIMA 4B3RH 3A8KA 1A5MC 5CYMB 2K4HA 1M1KT 4OHZA 4IRCA 2W24A 2KM8C 4DL4A 1EETA 4FYVB 4DR3F 4EFBA 3MM7B 2KIWA 1FE4A 5CEHA 3HZGA 2E8NA 4CIOA 2I87A 3BKFA 1FEZA 3OFHA 3GFHA 4KO0A 4J0MA 4OZNA 3J80U 2BUNA 5DO2A 4YB8B 3SZ2A 4I64A 2WHOA 2M2BA 2HVRA 1SKUB 2PI4A 3WX4A 1KCXA 1BY9A 4MYUA 3FZ2A 1FNXH 4IYQA 2D7SA 5LYJF 2HS4A 1TWHA 3O8WA 2DWCA 4UB4A 1Z19A 1CSJA 4I55F 1N6QA 3JYTB 1DTQA 4HR2A 2F4VF 3V4MA 4BY7G 2F65A 3NVVA 3M2UA 1SV4A 1SC4B 3RAQA 1FFUA 4MAKA 1FXLA 4LRBA 1JALA 5KAIU 4CO2A 1ZHQA 1CQJB 3CIZA 4PJ0U 2E2IA 1CJTA 3FM9A 4HHUA 2J8SA 2MA1A 4I67A 2YKOA 3JTPA 2IRYA 5BPCA 4LF8H 1Y1VG 5D0HA 4RKUC 2I8CA 2WOMA 2CPFA 4J9RA 1NSAA 2R7TA 3T1HH 2G13A 4CLTA 1H3DA 3W9HA 4XQ8A 4TY9A 2BJ9A 1WYGA 2HHWA 1X5SA 5KFAA 2X1FA 4RW7B 4LBHA 2GH1A 2OD6A 2DISA 4DFDA 4J9LA 1D09B 3SSQA 2CG8A 2XZDB 2F4FA 3GIIA 4RW9B 2YWFA 5KFIA 4WP9A 1S7HA 2CKZB 5J0WA 3KNGA 4QIWF 2KAUC 1JMSA 1KHVA 2EXUA 2E8PA 4LBPA 1S5LU 4DN9A 1HBMA 2X51A 2ZDOA 4EEYA 2NYIA 1K83A 4K7QA 3I4PA 1Q4RA 1LWEB 2MQ8A 1S6UA 1R89A 4YY3H 1HMVB 2BACA 4G1IA 4OZJA 1L5UA 2AZ1A 2VF3A 4OV1A 1S6OA 1PIEA 1E6YA 1WORA 3MEEA 3M6KA 3DKDA 4DR7J 1M5OC 4RT3A 1HQUB 2KU7A 3NOCA 1T3NA 5DM7Q 3VTIA 4USWA 3BS5A 1C4AA 1ZQJA 4PDBA 2V4JB 1CG2A 3IRWP 2HBZB 5KFBA 5IS2A 2BKNA 2GV1A 3BSNA 1S99A 4JI0J 1VRUB 1UC9A 1LW2A 2BYCA 4EPBC 2EH9A 1Z1BA 4KRWA 2P6UA 3KZXA 4FDFA 5J0RA 4DSEA 4ZPDA 1RJJA 4TUPA 2BQUA 3KAKA 4I2BA 5ALMA 3FK4A 5JVLA 4IFYB 1K9MT 1WOSA 1YK9A 2FTRA 4N56A 3N28A 4ECUA 4BDPA 3M32B 4BC7A 4ZQIA 2KB2A 2O6KA 4LFBJ 4JYAF 1QQ7A 2YQEA 3GMGA 2CQ0A 2RRDA 3ZZUA 1PK3A 2LEPA 2KE7A 1X4AA 3PRBA 4JB8B 4QZGA 4AL5A 4ER8A 3RJ0A 4B3SJ 2EK6A 4G9BA 4I56A 3QU5A 2E5HA 1UVJA 2ZTCA 3CCMS 2R7WA 3O7UA 5FLXW 3Q8LA 1UT8A 1PVRA 2L08A 4U7UK 1L3UA 2N4DA 3MR2A 1TL1B 4MAMA 1SH2A 4LF9H 1FF2A 1BGXT 2V8DA 3DF7A 4BWSC 5LP6F 1TL7A 5AK6A 3GTKA 1KW4A 4KN7A 2V6AA 1JROA 4R7RA 2P6RA 3IGVA 2ZNZA 2FP4B 2XG8A 4L3KA 2D41A 2XHCA 3N43B 3OTDA 5B0DA 4OYZA 2M3DA 3P96A 2V2KA 3QLHB 1R31A 1XMQF 3WC2A 1T9YA 3QJPA 4ZA1A 1S9GB 3AQFA 4HEA9 1TUGB 3K5MA 1REVB 2VFSA 2W6NA 5D1OA 2K8BB 1HBNA 1GSAA 2W9BB 2Z2ZA 4LF7F 3UMCA 4HYKA 1GEHA 1DARA 1K5OA 1FX4A 2VQEH 3U27A 2R7UA 5A6PA 4IQVA 2HOQA 1VQ9S 2F3JA 3AQEA 3V72A 5HMDA 5KG0A 3MM5A 3OVBA 1EJTC 2HIYA 1GSHA 3BQ1A 3N6XA 5HJXA 1KVIA 2BJ8A 1FWEC 5EWFA 4NLXA 2AYGA 4YG2A 4ATNA 2QLJB 3GU3A 4WJBA 3UR0A 1PK8A 2HGNA 4CQBA 4FZNA 1XNRF 4B3TF 4ZN3A 4Y2QA 2AGQA 3WK5A 4AQYF 2V0NA 2R93G 1S1WB 3KNAA 2DH9A 3SMVA 3CJ0A 2NR0A 3QAUA 4DLKA 2R87A 1N5TA 1E9YB 2I5JA 3MEGA 4J9NA 2F4VJ 1S9FA 2KHQA 3MR7A 1JLGA 1C4CA 4EFEA 1QH9A 3AXMA 2YCHA 2WAQD 1KD1T 1X9XA 4ECZA 2XVTA 3OLAA 1KTVA 4ZVRB 2FJXA 3VPBA 2MZRA 4G1PA 2F1HA 5ALRA 4OZ3A 2JA5A 2DHAA 2QMUB 3HSZA 2QLTA 4I6YA 1TAUA 1N34H 2A2CA 1SGGA 2PN6A 2BANA 1N48A 3PW7A 4B9NA 3OV7A 2B0GA 1FE0A 1FESA 3DLKB 4DV2H 4KB7A 2P9CA 4ZKAA 2V58A 3LP1A 3QXGA 4LFAH 3I9ZA 4DX6A 1JKJB 4QZHA 2DEIA 4I27A 1POJA 3V4IA 1RKIA 4IKAA 4DV7J 2J8AA 4UCUA 2DRAA 1WG1A 3VC8A 2GNKA 4BC9A 5AE2A 3CP8A 1WG5A 1CS4B 4MKAA 2YMMA 2BX6A 2BCVA 3B6BA 3C6UB 2XIGA 4P0PA 4EX7A 3OHAA 3PFOA 1ZQCA 3Q1KA 4ZCMA 3U9SA 1I94H 1AXQA 5FD6A 4WU2A 3IAM9 2VUMA 4KGMA 3JPNA 4AYBA 4EMDA 5HMMA 3GYXB 2W6QA 1RXWA 4K4ZA 3TZYA 2NRTA 3HOWG 3MMBB 3QPIA 2NSCA 3L9ZA 1OYDA 4YQWA 4CE6A 1R27B 2CA9A 1ZD4A 1KEEA 2ROPA 2LQ9A 2C35B 1A6SA 4O23A 3JTOA 1UCVA 2HHHJ 2W2MP 3OPXA 4QYZJ 2E1RA 3OL9A 1NU4A 3OUZA 5K4LA 1XO1A 3IAS9 1R3NA 4KHMA 3H25A 1RACB 1S1VB 5I3UA 1ROFA 4B3MJ 1PC5A 1T94A 3H0GG 1PKUA 9ICIA 4NL5A 5CRXA 1XNSA 3LWMA 2RHSB 1TTHB 3EW9A 3EE3A 2CKWA 1WG8A 2FK2A 1YQHA 2VUNA 5G5GA 5ETKA 3K75D 2AMCB 3D9BA 1S1UB 2HHPA 4USMA 1WF1A 1C3OA 1R8BA 1TELA 4DV1F 3Q8MA 7ICFA 3M4XA 1VQ6S 1P1LA 2R92G 3FKBA 3DDHA 5HVHA 4X4PA 3ISBA 3HD1A 2WRMA 3UVJB 2NRVA 1N32F 3MM8B 4MFCA 1B4SA 2W3SA 4LF4F 4HR7A 4J9MA 2CPXA 2UUAJ 3HFVA 3D6FB 4DSJA 2ACYA 5J2QA 4KSEB 5LSRA 3SQIA 2UV8A 3EICA 3WKDA 1FFSB 2YKAA 4Z6CA 4OL8A 4Q45A 5JUMA 3CTRA 1S6QB 4ZHRA 4HQ6A 2UXCH 2MZQA 1SH0A 4QZDA 3BPSP 1RJPA 2HOIA 1QTNB 3NGKA 5KL1B 3DLEA 3UD5A 1UVIA 1RHJB 3MDUA 3RFCA 4V19X 1XMQJ 1BQXA 4MF8A 2YTUA 5MAOA 3AMZA 5AE1A 3LDAA 3L4BC 1BUXA 1M90T 2CAJA 1B0PA 2JRSA 2FHJD 4OX6A 2FMQA 5HMEA 4W98A 2J6UA 3VVTA 4PQUA 1IVZA 4LF7J 2AKWB 1YJUA 5CA7A 4WIIA 2FJDB 4ZP7A 9ICGA 2ZDHA 1F2HA 2MSTA 5J2UF 4PUOB 3TR5A 3UFXB 1SIWB 5AJ3J 1HWJA 2A6MA 3BS9A 3O0FA 4K4GA 4ZI7F 4TN2A 5D77A 1IR0A 4LH7A 1RM6C 1UETA 3H5XA 2EDUA 4B3RJ 5HROA 2HHVA 3BM7A 1ZQSA 4Z37A 3D68A 5HLFA 3W5YA 4OI1A 4JI4H 4B3TJ 3B9JA 4DOBA 2LKYA 1VLYA 2BMBA 3T5LA 1QE1B 5IP9G 2KT3A 3M6XA 1TZ0A 2PVPA 3JAMU 4K59A 1WSVA 3RJKA 4PGYA 3BGFA 3VWSA 5BYRA 2DGWA 4DV6F 3OVAA 8ICUA 1RT2A 1VQSA 4USUA 1URJA 2OFHX 5ALQA 5KL8B 3ENWA 3EMTA 4NRTA 3PYGA 3L3CA 1U1KA 4WD3A 4A48A 5D4PA 3QNMA 4IQUA 3GIKA 5K8OA 3I5CA 2E5SA 4F3QA 2XICA 4I2QA 2DXDA 4H4KA 2ZG6A 2CWXA 4UCOA 2ZIUB 5J2TF 2BEFA 3PNCA 4ILMA 4USHA 1HNWJ 2HFUA 3CD5A 1G3OA 4M5IA 4R0EA 2LYVA 2HHXA 2CFXA 3HT3A 3FMWA 5CYQB 3W3SA 4DFJA 2VQDA 1SB3C 3HP6A 5FLXY 2YXLA 1RK6A 2ADCA 9ICVA 1KJ8A 2QLXA 4RDVA 2E9RX 3FJ2A 3NGSA 2NPIA 2M52A 5HV6A 1Q81T 5L1IA 4WIQA 5B7WA 4ZITA 1B6SA 1AZSA 1IN0A 3H0LB 2HW3A 3R27A 4OYMA 2DD8S 4YIWA 3PSTA 3KFUF 3QFHA 3VQTA 3POTA 4I6WA 4M5LA 1UAWA 1RZTA 4TV9F 4J03A 4OYOA 3GSDA 4L72B 1VQKS 8ICMA 2FLPA 2B0CA 3R5JB 1RCOB 5A8KB 5C24B 2YQ0A 1K47A 4YY3J 5AIBA 5J0TA 2G0AA 3AODA 3MJFA 3TWZA 2PMZF 4P9SA 1W2IA 3CVZA 1YG0A 2NO5A 1UP1A 2G1HA 4CLZA 3AJ1A 4IG0A 5HMLA 5KFOA 1VI7A 5IIMA 2C2NA 4UBBA 3ZO7A 2VIXA 5ETNA 2LPEA 5KTQA 2EBEA 1HUOA 2J0WA 3EJMA 2AYEA 2Y8WA 2FHMA 1XNQJ 2QA4G 1R6YA 5FD1A 3UN2A 1HIWA 1VBHA 4RWXA 3ZZ0A 5G4HC 2CADA 2DPIA 5C44G 4BX9C 4CYUB 1S5ZA 1H2VZ 1POKA 4RW4A 2E7VA 1ONXA 1BHNA 4WTYA 3FCWA 3JPOA 4Q8FA 2MB0B 1L7NA 5T7LB 5KFXA 5HQMA 2MHEA 1ZQKA 3CCRS 1DHMA 3G82A 5AE3A 2DNQA 1X5TA 3KJVB 3UFCX 4BBRG 5HP1A 2VOOA 2UXDF 3VZHA 2BE9B 2IM2A 4O0NA 3AYHB 3M6VA 3QIDA 3D54A 2LVWA 1PO6A 3TQTA 3TVKA 2NXEA 4UATA 7ICJA 3ICJA 3MMJA 3FMAA 4ED1A 2K2PA 1WHYA 4UB1A 4JI2H 2QT3A 3EXYA 1WHVA 4LRDA 4NEYA 1I7NA 3Q22A 4K4SA 3CD7A 9ICMA 2GVZA 4P7TA 3THVA 2NUHA 2GO7A 4NYOA 2FGCA 3CNQP 1P8GA 1IKYA 2CNOB 3MAAB 1I7LA 4QCLA 4QWEA 1SWWA 2PO4A 2OXOA 4ZJOA 4RQ3A 2MQLA 1RSCA 4E98A 3MCSA 3CCVS 3MFHA 1C0TA 2EPIA 1PBUA 3TEGA 4C7QA 2MQQA 2CJXB 4TLQA 4L75A 2EG2A 4LF9J 2KJ8A 4CDGA 3CJRA 1GO3E 4X4SA 3M30B 1XN9A 1RP5A 4IDKB 1QAXA 3L3FX 5ALIA 4F2RA 1RLCL 1LEOA 4DR1F 4C9DA 8ICXA 3KKAA 2FZGB 9RUBA 3RRKA 2NQPA 2MLZA 4C0BA 3OD2A 4JI3H 2J7KA 4K4VA 1JJCB 4C5AA 1RQNA 5G0RB 3FEXB 4KLJA 1ZQWA 1E4GT 4HVZA 1SJFA 1B0VA 4M6WA 1IWGA 2A1JA 4EUVA 4EO6A 5IT0A 3NS1A 2K8GA 1F1BB 4RX6A 2RS8A 4X65F 2VKZG 2V8PA 2OPRA 4EK2A 2LM1A 3U1LA 2VQEJ 1WUUA 3GR1A 2WFAA 1S48A 4M1KA 2XTJP 1F0MA 1WJ9A 3RW7A 2POKA 1UJ5A 2PFPA 4ICLA 2JA6A 4NI2A 2YU9A 4QQBA 1HNXF 2ZBIA 2CXEA 2EKNA 2XQCA 3UQSA 2AEJA 2QTWA 2D3DA 4RAZA 5IM0A 3H8MA 7ICUA 4DV3F 2GZOA 2HNZB 3DLGA 1CJKA 2KG1A 1AUVA 4ZOSA 4B17A 1Q8KA 1BPZA 5E3CA 3OJSA 2CJYB 4MF2A 5C1PA 5K14A 4XIUA 4HHHA 4EGLA 4N41A 2Q0ZX 1X31C 4J9UE 1XR6A 2A19A 2APOA 2FHKA 1WF2A 2VJ5A 1JLBA 3TUJC 1EZ1A 2R7XA 5J29A 3R2CJ 4Z42C 2FMPA 1VRTA 3DDIA 1N63A 1N56A 4F3MA 4WHBA 8AT1B 2YWHA 2FJVA 3TJ9A 3Q24A 3TO8A 1FKAF 4A8YA 2ASDA 1SJQA 2UZ9A 2NS1B 4MFBA 1F6TA 4UAZA 3BGUA 2JGAA 5IZHA 2GVDA 1IKVB 5CZVA 5IILA 4NM2A 2QS8A 4DJBA 4HNVA 1V3RA 1TKZB 4RQ2A 3DU5A 5LL6d 5ETTA 3CJSA 4BXOA 4O3PA 4C3LA 4AXIA 2WBRA 3PACA 3FFIB 4F0MA 3HMJG 2NREA 3R23A 1ZBTA 5HQLA 1GT8A 4HT7A 3ICXA 5SZTA 1RWVB 2FJAB 3ETRA 3K59A 4Y2XA 2KFNA 3AOCA 4QJVA 4M2YA 4MKVA 4EI2A 3J81j 2ZIWB 1OY9A 5F3ZA 4GFJA 8ICOA 4OX9H 2HQGA 3DDKA 1U2CA 1GSOA 1JLFA 4F50A 2XI2A 2LP4A 4JV2A 4HH0A 2AJ2A 1IIPA 3DV9A 2OWOA 2Y1LB 3THPA 5LMNH 1B4FA 3K89A 1N5VA 1HNIA 5KFLA 4OHXA 7FD1A 3ZZYA 3CB4A 3VAFA 1CQIB 4CLSA 1HWLA 4FBUA 2HNYA 5FDLB 4JI5J 2MU2A 4WYWA 2YH0A 4CNYA 1XTZA 4CH7A 3ADAC 2HS0A 5EN1A 2CJKA 2BCQA 2HNDB 1NK8A 4I2AA 2QT7A 3WK8A 3MTWA 4K5RA 3PFEA 5HMYA 1MN7A 2BHNA 2I6WA 2GHWA 4C4SA 5FSEC 2AJFE 5HP4A 2IOHA 4UBPC 2MLYA 1DK3A 5A8WB 2ZXHA 5EX0A 3RGXA 2BDPA 4KGKA 5F8LA 2VG7B 4TLRA 3UCGA 4JV5F 3DRSA 4RW8A 4PL1A 3HXLA 3I0RB 3MXHP 9ICAA 4KH0B 4PWDA 1Q5VA 4Q0BB 1AA1B 4QIVA 4HACB 3KLHB 3GIRA 2J6TA 4LREA 2E3TA 2UUTA 2XHWA 4NZ6A 3VPDA 4X62H 1B70B 5LMUH 3RJHA 4ED8A 1XJWB 2EC0A 2G5IB 3WC0A 4ZP8A 3UD4P 2Z58B 1S9EA 1HQ2A 2KJWA 1WDDA 3H8JA 3HPAA 1KBRA 3F73A 3JPPA 1LNQA 1UVKA 2ADBA 4FNIA 3MPWA 1PUZA 1UNNC 2K4EA 1FFWB 1NJWA 5IWAH 4O4GB 3LO3A 2AV5A 1W26A 2QLBB 2HHQA 1X7VA 1WI8A 2IAJB 2K3IA 3LSCA 2BPFA 2ZHOA 1B43A 1GTEA 4OHYA 1H74A 1ZZFA 2A3JA 1SL2A 3I82A 2C3MA 1IUJA 3NNAA 1Z00B 1TV6B 5ETOA 1VK3A 5ETMA 4QZIA 2AJ0A 2IJNA 3MGIA 5CAAA 3QFFA 4LUBA 2HDOA 2HRTA 4UBCA 1TK5A 1FK9B 4CO3A 2FI1A 4DQSA 4MFAA 3G6ES 4OYAA 5CYMA 3MCMA 3HOYG 1JJHA 4DR6F 4OZ0A 3MM7A 4C6AA 1KFSA 8ICWA 3MPVA 1GXUA 2MQOA 2OLWA 3K57A 5KFTA 5HI7A 4CP5A 1HQEB 4ZLNA 2NU9B 2ZVSA 4X4TA 4IRDA 4NCAA 4DV0H 1R8AA 2DNZA 1YJTA 5ETSA 3U1MA 2IIHA 3JYTA 1HNXJ 1HW8A 3IMQJ 4NLYA 2XMVA 1FKOB 2WONB 3WO1A 2G9OA 4QIWA 2EWHA 3D28A 1WWUA 4DV3J 2I6XA 1WACA 4AL6A 1AFIA 1K44A 1IBKH 5GAEU 3D0HE 4JB3A 5DGAA 5EHHA 1H72C 2ISPA 9ICWA 2PA8D 2JV3A 2VJUA 3R5HA 2FB0A 3IP4B 4OYBA 2ZIXB 1TVAA 4YB1P 3E5NA 1J2NA 2QARB 2UUBH 1RWNB 1Y88A 3D1OA 3C16B 3PCOB 1S6PB 4UB6U 3NS6A 1HPZB 4RW7A 2JFKA 3TACB 4ZIVA 4IO1A 2ZITA 2DWQA 1V6HA 4RW9A 1RWUA 3SAFA 1D9FA 3D67A 5CA5A 3LALA 4ED2A 4G3IA 1FXRA 4WFXA 4WBNF 2CPZA 2R7LA 4QZ9A 5DG8A 1Z2NX 4LRAA 3HOUG 4JI1F 4QZEA 3VAGA 4C97A 2CDRB 1LWEA 1PYOB 1YJVA 3DRXA 3UN3A 2X1AA 3CJTA 1HMVA 2JVRA 2DGZA 3ED5A 4M94A 1VGYA 3M8ZA 3ETLA 3TFSA 4EYHB 1LK7A 4CTAB 3GTJA 2CPYA 3QIPB 3W7BA 1W2BR 3CVKA 3VR1A 1ZA1B 2Q6BA 3KALA 1HQUA 2DGTA 4OJOA 2GIQA 5BPHA 4I7FB 4CNZA 3G6YA 4YR2A 1KFTA 3GDXA 2R4FA 1GQEA 2V4JA 2E8MA 2QFIA 4W92B 4DO9A 1ZQ1C 2KSWA 1YHQS 5J2CA 4ZVUB 2AZ3A 2ZJ5A 4DXLA 4MKYA 2FIUA 1VRUA 3VGVA 2M05A 3JSLA 2V63A 4RQNA 2QC3A 2XMMA 1A0OB 5I4MA 4ZPVR 4GO7X 2RNEA 3NMRA 1EHWA 3NEKA 3R5DA 4L6V3 3N7RC 1P1MA 3OW2R 3RF9A 3JRXA 1HLWA 3PR5B 3ZDDA 2XMTA 3LGMA 3ZZRA 4IFYA 1TUWA 5AI8A 2JC0A 3M32A 3UQ0A 2VA8A 4ECTA 5K5MA 2B8PA 3OR2B 1A9XA 1NH8A 1FHTA 4FPRA 3DHWC 2G09A 1T0TV 3C15B 4J7CA 4JV5J 3V2UC 4D3HA 4FZMA 4LJMA 3MPUB 3RBEA 2FJBB 4HTIA 1GK8A 2XNRA 1IQZA 3V81B 3LANA 2VPXB 3MAQA 4KH1B 4KLGA 4Q2MA 5ALFA 1TL1A 3IBWA 4LF5F 1R43A 4DUYH 4Y6IA 1REGX 4PKDB 1Z2PX 4KQNA 2MHNA 2QL9B 4WKYA 4PHEA 2DIUA 4I2JA 1NUEA 4NRUA 2C2RA 3PVXA 4HT5A 1JKHB 4OLPA 5DBAA 3LP8A 1DGSA 2NRZA 1XU4A 3D2NA 2A1BA 3B54A 3QLHA 4ZVTB 4CI0B 1LFPA 1MW7A 2RSQA 3A3NB 2LLZA 3H4DA 2ZXIA 4GO5X 4DV5H 1PYSB 1S9GA 1KBLA 2EANA 2JFDA 4IG3B 3UMGA 2FK3A 4KT0C 4KLOA 4OJ3A 4CQ1A 5J2PB 1REVA 1EYZA 1EAYC 3MHYA 4QPXA 3MM6B 2W9BA 4CEXC 2XCPA 3UW1A 1F5AA 3BQTA 4JI6H 3TQ1A 2IP4A 1IM6A 3UQ2A 4EFAC 5BR8H 4DR6J 4PYDA 2D3OR 2WDTA 5JH7F 5CA1F 2CPJA 2R8IA 1KSPA 3N41B 1ELOA 2UP1A 1P1TA 2HFSA 1KDNA 1E6YB 4NA3A 2AD9A 4GKKF 1FRKA 4U7CA 4OYXA 2R8HA 1UFKA 1UT5A 3PSFA 4CDIA 4RNFA 1HBUB 2W57A 1F9HA 3N7PD 4DSKA 5TISU 4IOAQ 1TK8A 1KBUA 4RDWA 1S1WA 2Q4TA 3BBBA 3ULHA 3F8NA 1ZJNA 2KEYA 2PE8A 3GV5B 1FKPB 2HI0A 3QZ7A 4OX7A 3VVUA 4PG5A 1RAEB 5IYDG 3B78A 1HNZH 4KN4A 1RHMB 5J8YA 4US8A 1PJ5A 1VAJA 3M9NB 2ZFHA 2UU9F 4UB8U 4ECWA 4DSFA 3NRWA 3DLJA 3TA2A 2YNFB 1LKYB 2B9WA 1F9EB 2V50A 2IA0A 2XEXA 5AI6A 4MV3A 4KMUA 2KJ5A 1VQ8S 2DCLA 3NS5A 4NL9A 1SQFA 4R85A 4LVOP 3R97A 4EELA 1SV5B 2PBZA 4PXEA 3DLKA 3FYHA 1WELA 4A3FG 4X5VA 4LRFA 4X64F 2HQFA 2ZHAA 1XDNA 1QSYA 2G07A 4KLUA 3PG9A 2P8IA 3C5FA 1XERA 2X3GA 1CVJA 4EENA 8ICIA 3KK2A 2BKPA 4LMZA 5DKWA 4CCHA 1Q82T 1CS4A 4PG6A 4IOBA 2XYHB 4B6JA 3RJIA 1CQMA 3C6UA 4KLLA 1Z4NA 1NH7A 4RPYA 1HYSB 3O5TB 4KGXB 4U6PA 4R64A 1SJ4P 2VU5A 3QSYB 4RNNA 4DR4H 2DR6A 4M63A 2FJZA 2E7WA 1X4EA 1JLEB 3N0VA 2QYZA 3ISND 1N61A 2LYBA 3NASA 1WC4A 3T79A 1RAKA 4LF6H 3EYYA 2DL0A 1TKDA 3BGOP 3MMBA 4LSNB 5GMEA 3TKAA 2XWYA 2VC0A 5ALGA 2XZWA 3K3VA 2MCTA 2HQ3A 2VPYB 4X66H 2CZGA 2AEMA 3TJ8A 1BPBA 4I2IA 2MY7A 5LSLA 2CQDA 4USVA 5IC4B 1J5EH 4KE5A 4OX9J 9ICEA 1S1VA 1HR0H 4ETXA 1HBNB 4PHPA 4NLRA 1X42A 7ICMA 3J7A1 4RPZA 2CG4A 1IR1A 4OQJA 2C00A 3CJ2A 2WTFA 2D6FC 3M4IA 4AYBC 3H2VE 2X0SA 3ISNC 4BLGA 5A6WA 4NXNJ 4R7WA 7ICLA 4TUYF 2P6SA 4TUSA 1COOA 2C3YA 2ZUBA 2WVBA 2W2NP 4ZP6A 1DRZA 3E01B 1L8LA 4QWDA 3NGUA 3D6TB 3PW0A 3HHEA 4WCEQ 1S1UA 1MROB 4KPCA 2E1CA 3HPOA 3Q8VA 4UOHA 3GU0A 2WB1F 4QBUA 3M1VB 3R7BB 2UUCH 3GV7B 3C21A 4P4MA 3A0BU 4KHPH 1TFWA 3LWLA 5JVHQ 5AK4A 3BN7A 4XO0A 1BNOA 1TA8A 1HI8A 3UVJA 1VYAA 1FI4A 3LMLA 4UF4A 4AUKA 1QSLA 3MM8A 2IYGA 4H4MB 2I5JB 1L6NA 5U47A 3OTCA 4C2MA 3H4BA 1S03G 2V5HG 4LFAF 2PGCA 1T02A 4UASA 2FDNA 5F9NA 4UW9A 4I50F 3BYRA 2EZYA 4LF5J 1RWXB 2F9DA 2C42A 4OYPA 1JK9B 4FYXB 4O5EA 1VJQA 4WFBQ 4X84A 5C25B 1S6QA 4OI0A 2F2AB 2UXBF 4C4TA 1CBKA 2OD4A 2PN1A 4CQDA 3FCVA 4HHJA 1WC3A 3RN6A 1AQ6A 1FCAA 7ICTA 3P3DA 3UMBA 2V4RA 2DKXA 2LDYA 3IG1B 3H98A 4X62J 5JVGQ 3ONQA 4M5MA 4NLBA 4CLUA 4YAJB 1YKWA 3ZC4A 3ELHA 3IA0A 4DQQA 1NNLA 3DDNA 4GC6A 3Q8KA 4A8QA 2WB1E 2OCEA 3R5XA 3ZTSA 2OSQA 2R42A 3WKCA 4ELUA 4UB9A 4BJHA 2UZAA 3H0MB 2KKVA 2NXUA 4URGA 1GAOA 9ICJA 2VD3A 1K1SA 4HH1A 1ZETA 1HUZA 1RAFB 4PUOA 1Y7PA 1RYSA 4ZHQF 1TUVA 3WKEA 3A8EA 5FSDC 1R9ZA 1JLLB 1RXVA 1F9FA 4OHVA 3KHRA 4JI7H 5EOYA 4M9LA 4C8KA 4O4RA 4GKJF 4C7ZA 4OLOA 1DURA 3GP9A 2BOPA 3D3CJ 1WH2A 2DRDA 2C1EB 4GKKJ 3QEBZ 2KRBA 2VPZB 5KFQA 1N5QA 4PPXA 1EJWC 1MZBA 4IR1A 4NY8A 4ZPBA 1QE1A 4KFBB 1WKJA 1XS9D 3GFYA 1RHRB 2LXFA 3PO3G 2HK2A 3NAIA 4GVBB 4JI8H 1AT1B 2ROGA 3HD2A 4DV0J 4CRJA 2XSJB 1MQ2A 2W8LA 2W03A 1RUSA 1U7LA 3FEQA 2CW8A 3UXPA 1AN7A 1KLMB 1I51B 4HI2A 3H8WA 5BJRA 3GYNA 2UU9J 5KNIA 4N5SA 5J2NB 2EG1A 2MKYA 3MECB 2XY6A 2N82B 3KHLA 1ZD3A 2M8HA 4AYBF 2W2QP 1J2MA 1APSA 1XBWA 2ZIUA 4NLUA 3LGHA 1KJIA 2AF6A 1LWFB 3D2QA 2EFOA 3QT8A 3MDWA 3W61A 4RBVA 3RBXA 2CQBA 4RNMA 5CYQA 4O0IA 2J7UA 2QJ3A 2Y9TA 1URNA 5ALXA 2EFQA 2HMIB 2IA6A 3SQGB 4P4PA 1DJ0A 4Y2AA 1UEVA 3VAJA 3I28A 3VCDA 2OEHA 2PMZA 3AQOA 5KFWA 1BQNB 2YH1A 3CCWA 3RJMB 4Y8VB 3HILA 2Y0SD 3GFXA 1WOPA 1LXNA 2RQ5A 2JLEA 1YZ7A 4H4KC 2NYVA 3Q8QB 3IXQA 4J9SA 4M47A 4EZ6A 1BPDA 3PZPA 3TAMA 3UDLA 4FF4A 1V3SA 3UM9A 1RDFA 3MOZA 2X3DA 5IIOA 3BJYA 3GYGA 2YX1A 2Y8YA 4C5BA 3HFZB 3DRYA 2DHXA 5KT4A 3PYDA 3HW8A 1WTFA 1NFGA 4AYBE 3HHLB 2DNPA 1OS5A 4TU9A 5A8KA 1WSRA 5C24A 3AM9A 2QV6A 2SXLA 3V7JA 3FMBA 2P53A 4WE1B 1ZQEA 2QLFB 2CJQA 3ETMA 4IH6A 2GIRA 2M7SA 4RNOA 1DOQA 4RQ8A 4LR8A 3HVRA 4DCCA 1FDDA 3HKWA 4IO9Q 3AJDA 2W11A 1K1DA 1RXOB 3UN5A 3PX6A 2KICA 3G8CA 4B3OB 2VICA 4GIBA 8ICVA 2NU8B 4Y65A 3PO2G 3OT9A 2KG0A 2NZ4A 4BGDA 2OEKA 2BE2B 4LIWA 3M8SA 2W7AA 4TURA 1RQLA 4CYUA 2CNKB 4DUZJ 4CH0S 1TWCA 4G7EB 3DRPB 1IOVA 4I4TF 3VGTA 1A9NB 2OGJA 1T9WA 5GAGI 3HVTB 4K4YA 1NZBA 3GRIA 5M2PA 3CCLS 5HQ8A 3OL7A 5DDYA 5T7LA 4DN0A 3PO5A 3GJRB 3HOZG 3PM9A 2LDIA 2FY1A 2N7CA 3KJVA 4L76A 3HK2A 2ZDQA 1I6UA 1TK0A 3LAKA 1K6WA 4NM1A 4M9JA 3EVMA 5EOZA 1UZDA 2BJ1A 3BKUA 4P0QB 5D0GA 2ERRA 5KFRA 2DPJA 3QJLA 2LHTA 2B4UA 2Y9HA 2ZTEA 3L95X 4BY1G 3N79A 1TAMA 4F36A 1Z4OA 1IBMF 2Z4PA 1Q7LB 5J2AA 3TZXA 3BAAA 3KJNB 4UB3A 2V8HA 5B0AA 4A2BA 2ZWOA 1VOMA 3MAAA 2G1DA 1N5SA 3CQZA 3MDAA 5CABA 1BVSA 3BH6B 1JDBB 4KIRA 1S1TB 4DUYJ 2HVQA 3DI6B 3M30A 3OSPA 4UFZA 2V59A 4IDKA 2BJDA 6FD1A 4RQMA 4JK1A 4CF3A 2VC1A 1HNVB 2HQDA 2KHCA 4ZVGA 5DBBA 4IC9A 3KLIB 1RAGB 3VPCA 3HX9A 5IFMA 2XGPA 4FU0A 4DR7H 5G0RA 1RAJA 4ZLLA 4YD1A 3SMZA 3KDNA 5LL6b 4DQPA 5HATA 3I4MG 1HW9A 1CC7A 2GLEA 4I1TA 3TA1A 1HHSA 1KN5A 1NEEA 4UB5A 3OFEA 3QU2A 4JI0H 1RBAA 2FJ6A 2PXIA 2B6GA 1ZQFA 3ZZTA 4A8KA 3KKAC 2RDDA 4KLMA 3ZD9A 3BGRB 1WHXA 4DR5F 4AQLA 2LYAA 1RTHB 2HKEA 4RR5A 1UJ4A 4QR2A 2HNZA 2IHMA 2K3KA 3WO0A 3MEDB 5J1EB 2W9MA 1RK5A 1VQLS 3CDAA 3EVOA 4Y2TA 4LFBH 3C8YA 2CZ9A 2FVRA 1HWUA 1ZQNA 1BE4A 3BGLA 1UPHA 5AHXA 4BUGA 4QWBA 3GJSB 3CT9A 4F4YA 1GX5A 1VFJA 2R8JA 2RQKA 3EPGA 2V34A 4M51A 4B3SH 2EAPA 3DCAA 2IVYA 4CLFA 2HVDA 1KDHA 4IAJA 1OSCA 4I2DA 3RAXA 5L9XA 1IR2A 3MKVA 3PW2A 4LSXA 2V4QA 2HSEB 4RW6B 2RH3A 5ALUA 4M5GA 4RU2A 2W70A 4DV4H 3HFKA 4Y3CA 4C11B 4PWUA 1IKVA 1DV1A 2FVCA 3L4PA 3ISDA 1V9OA 3IR6B 3K8VA 4MTEA 1S4FA 2ZJRQ 2FMSA 2DB1A 5F8NA 4DS4A 1TKZA 5BMVF 1RT7B 4CLPA 3CCUS 1UEKA 4KBIA 1VKZA 3CD0A 2WVEA 3RTXA 3FFIA 3ONNA 2LXUA 4BHQA 4CO0A 2HVSA 4KIAA 3BR8A 3NG8A 3M6WA 3TJAA 3Q0AA 5L1MA 1U2FA 3C23A 1C7YA 2MQNA 4EEQA 3CEDA 2ZIWA 1A5LC 1CULB 4AL7A 1NM2A 1IKWB 4WZQA 5A2QW 2JA8G 2PMWA 4IQWA 5DB6A 3I32A 4DUTA 1N33F 4A8WA 1B04A 1TAQA 4S0MA 3J7AK 2KV2A 1E6VB 2VV5A 4KLSA 4O2AF 2HQCA 1S72S 2C2EA 1FD8A 3W63A 1RCXB 5CA0F 5F8IA 3RAMA 4FZVA 2B51A 3QT5A 2YKMB 2RHQB 4YJ3F 1LK5A 1EJUC 2M4MA 2AX0A 3FQKA 2XLJA 5HANA 5D8DA 4OIXA 5FDLA 1ITPA 5T14A 3R5FA 1N4LA 4QJFB 2D9PA 1YSJA 4F4AA 3M8PB 1RU2A 2HNDA 3AH6A 1W7WA 1IWAA 3P6YC 8ICSA 4QPTA 3PHEA 3BEGB 5D6GA 1MLAA 4U7UD 1HR0J 4NXMJ 7ICQA 4I2EA 3E0LA 2JZ5A 4GXKA 2F4VH 3FGVA 5A8WA 4QIFA 3RB6A 3T1AA 1HWKA 2VG7A 3GB0A 5ALDA 1OUQA 1UC8A 2OOFA 2KKPA 2VB6A 1ZRNA 3GLJA 2I9GA 3I0RA 2BZ2A 1ZA2B 2BZFA 1S12A 1WC6A 1X6JA 2XYPB 4Q0BA 5CHGA 3J7AN 4TKTA 2NPFA 4Y2KA 4DPOA 4HACA 3KLHA 2PEHA 5KFDA 5E3QA 3B82A 3BE7A 4DR2F 3C2LA 3I56S 1GKPA 2UUCJ 2MGZB 5GAEI 4RPXA 2MDAA 2F1JA 3JPSA 5CB1A 2H5EA 1IBMJ 1EJVC 1T7PA 2LM4A 1M5HA 3H59A 4ANDA 4IS7A 4O4GA 5ALTA 4DV7H 3V6JA 2DNNA 1RU1A 2IAJA 3M2RB 2MKCA 5ALYA 1HI1A 3G87A 5T41A 2P9EA 1ZAVA 3MPDA 3NBPB 1VRQC 4B3ZA 4U8VA 4PYAA 3LK9A 3T19A 1JIHA 4LJXA 1Z00A 2ASJA 1TV6A 4CGZA 2ZM6F 4QWCA 4URSA 3JQJA 3MTKA 4RQ4A 2CQIA 1SC1B 3OTBA 4DQRA 4R5PB 3M8YA 1AFJA 1FK9A 4US9A 5D1PA 2MKSA 5DM6Q 2YNIB 4PHDA 2WVCA 1FVSA 1ZTTA 3LTOA 2MKJA 2P0AA 2R84A 1Q3UA 1FJGJ 2YNHB 5D4LA 3SAGA 4YBZB 5AXLA 3HVWA 4MIBA 4A2AA 1SCUB 1QQ5A 2K1RB 1HQEA 2HHHH 4RJVA 1X0PA 2H9ZA 2AU0A 4O5KA 2J9CA 2HAFA 1UVLA 1ZQYA 2HOFA 4I68A 2HZAA 1RA5A 5HVFA 3DYAB 1X9SA 4UZBA 4B3MH 2KFYA 3QAEA 2JOQA 4CO1A 5ETQA 2FPMA 1HA1A 1ZQBA 4WWSA 4QIWD 2XI9A 1HHQA 4ANEA 4DR5J 4I2HA 3K2YA 1FKOA 5L9NA 1NB7A 3QATA 1AUSL 1FWLA 4ZLJA 2A2DA 2QLWA 3QMQA 4MIAA 5DG9A 1N5WA 2CW7A 2DRBA 3D6HB 1TL3B 1VLBA 3BQ2A 3CDEA 4ED4A 5KFMA 1QTMA 4OI2A 3BBFA 3ZNJ1 4LT6A 4Y2VA 5EWGA 2F1FA 4FP9A 5D49A 4Q0YA 2DIVA 1QUVA 2ZIXA 3LS9A 1OWXA 1QAJA 2FPHX 2VG6B 5A0YB 1N54B 2QARA 2ZH7A 4ED3A 5IT9Y 4TY8B 2VG5B 2VOPA 3GSIA 3C16A 8ICLA 3TINA 1S6PA 4NMXA 4JWNA 2RRBA 2YBVA 1HPZA 4D3GA 4QIWC 5B0BA 2Q66A 3I9V9 4WP8A 2MSNA 8ICTA 5D0RA 4YEAA 2R7KA 4A46A 1JDEA 4O3RA 2WSEC 2B63G 8ICBA 5AK3A 2RRAA 4USJC 3SIPB 4RB1A 2JA7G 1VR6A 4F72A 3PIOQ 1U1QA 2X1GA 3NNHA 1HEKA 4HAIA 1OXJA 4USKA 1H2UX 1BWEA 2DEJA 3GQCA 3MD1A 1XK8A 4A8EA 8ICNA 1GXTA 1SQGA 5JRTA 3LP2B 1UPPA 4CTAA 1XMQH 3QIPA 2ZH6A 4FM9A 1K70A 2VOBA 4HTJA 4F7VA 5DQIA 1ZQOA 2BBEA 3ZTOA 2LI6A 1BD6A 1JJ2R 4IH7A 3T1YF 3PKYA 4EGQA 1ZQTA 1RT5B 2KXHA 3LVVA 2KOBA 3C0FB 2JEFA 3J7ZT 2FQQB 5ALSA 5FLMG 1Y1WG 4I7FA 4X4RA 4LF7H 1N33J 1FA0A 3S6EA 4YFUA 3WQPA 5AKGA 4G1QB 2ZH3A 2NUAB 3D0GE 1XSNA 1YJRA 2F1IA 1WWVA 2W6MA 1JXVA 1T8EA 3HOXG 2ZH2A 1SJ3P 2EI5A 4ES2A 5F3XB 4LH6A 2J9EA 3SFUA 3L4JA 4LRCA 3OLBA 2C22A 4X4UA 1H0HB 1RAIB 1JLCB 4LZGA 1JQGA 4B3TH 1XNRH 5AIAA 4F25A 2E8OA 4KPYA 1IBKF 4ZPTR 2B21A 1UW9A 4RAYA 4AQYH 2PFDA 3OR2A 2O67A 2GW8A 1RAOA 2F8HA 3HHNB 5DQGA 2WF9A 2I80A 4A8OA 4QW9A 1UW4A 2HG4A 1UZHA 2UUBF 3D4JA 3C15A 3KOAA 4U9RA 2OI2A 4F0SA 3W64A 1X60A 3HKZF 3Q8UA 3S7RA 1FWBC 1EXNA 1S3TC 4EYIB 5BXIA 3LSBA 4CNSA 1S57A 2BXJA 3K17A 1XSPA 4E8UA 3V81A 2I9UA 4O3NA 1RTIB 3C6TB 1ZAWA 4M04A 3JSMB 2CJBA 2DH7A 1DQAA 4NV0A 1G7CB 1NKBA 4OJ1A 3CJ5A 3I55S 4DR2J 2NYHA 1HNWH 3P4UB 3FKIA 1HFEL 3QGIA 4G6VB 3EX7B 5H9EK 1SH3A 1GMVA 2MZJA 1URRA 1Y1VA 1JKHA 3MM9B 5D8HB 3WZ0A 3DLBA 2JVOA 3MD3A 2A0FB 2V8VA 1S0VA 5C2CA 4MIWA 3ZXWA 1XEZA 2CZ4A 2XMAA 1UWBB 4BJQA 4XAKA 4DBQA 1VBZA 2DH8A 1U1PA 3K5LA 5IIJA 4IG3A 1VQMS 4RB2C 1LVHA 3FEYB 5J2PA 4RO0A 2ZM6J 2MJNA 3MWEA 2N3OA 3DM2B 3MM6A 2FPIB 1NDPA 2HBRB 2KT2A 2XO7A 4HDHA 4LSZB 4RBUA 4A93G 2DHHA 1BGWA 3RJJA 4EPDC 3ENQA 2GX8A 3QZ8A 4IFVB 1ZH5A 4MV8A 5A8RB 1XMOJ 2ZJPQ 3VGSA 1IJEB 2VKQA 3MDCA 5A2QY 1HJPA 1DRGA 1FRMA 3RJGA 3C29A 3Q23A 5KT3A 2ACMA 1X4FA 1B99A 2QL5B 2EFVA 4LFCF 2I2YA 4U96A 2ZUDA 5ALVA 3O6QA 1SJ1A 1NJZA 4EG0A 5AI4A 1CLFA 3VMMA 2WCXA 1HBUA 3BABA 2ZOMA 1N36F 5E3RA 3PXGa 3TZWA 4J9VA 4DPUA 1JNRB 3QUCA 4E4TA 4FVCA 4NLPA 1XNQH 1FKPA 4QWAA 5HVGA 3SCIE 1RWKB 5AKKA 2RGRA 3Q2TC 2BDUA 4Y28C 4QIWE 1U8WA 2R7ZG 3F41A 3N6LA 4OJHA 5E3PA 3IDWA 2AJQA 3NCQA 1L3SA 3RBZA 2YNFA 1LKYA 4I7HA 1BLUA 4ILRA 3PO4A 2WAQA 5KFVA 3PRDA 1YNYA 5KX5F 1SKSA 5KG3A 3QU9A 3PW4A 3K5IA 4OZ5A 3KXDA 3EXCX 2JSXA 4BCAA 1KWMA 5FLXU 1SV5A 5FPOA 3OUYB 1M1GA 1F3VA 2VHGA 3C28A 1X40A 4AD6A 3JTNA 3HZEA 3OL8A 3R7NB 1I6JA 2KTQA 1Y5LB 5J1NA 2IMRA 3OBIA 5J8YC 1PJ7A 1B3TA 5JXSA 4LF4H 2D3O1 2K7JA 2XM3A 3AT1B 2H3IA 3MGJA 2B9YA 2R7NA 2M9KA 2A10A 2AQVA 4C8YA 2F40A 3K58A 5L8RC 4A3IG 4DV5F 5BPFA 4IUFA 3NGTA 3BA8A 3V4ZA 3CYMA 3N01A 1HYSA 2IHNA 1QVGR 4NL9C 3M6UA 1M1HA 4C65A 1ZRMA 4DV4J 5ETRA 2LCWA 1JLEA 4ED7A 5J0OA 1J97A 4DFKA 2A18A 4PZNA 1U6FA 3EM1A 2AQOA 3CO0P 5MLCV 2KDOA 2HVIA 3AL0B 4LSNA 1OO0B 5BR8F 3T1YJ 2M9NA 3SSRA 3UD3P 4C3MA 3C14A 3IG8A 4MYTA 3LVWA 1KRPA 2WB1A 5L38A 1GX6A 3FSXA 4YB7A 2AT1B 2VASA 1FJCA 9ICHA 3QT6A 4R66A 3IN5A 3N40P 2YZNA 2P50A 3VZIA 3BF4A 4C8OA 3HHDA 4DG1B 2C3PA 2XO6A 5GONF 5K8PA 2PC6A 3R5AA 5HL7Q 2YY6A 2BJ7A 1HNZF 1WC5A 1MQ3A 1DTTB 5AM1A 2NRWA 4DR3J 4ED0A 3ZD8A 2DNHA 3E01A 2E5JA 1V3ZA 2KYZA 4M5HA 1MROA 2GGPB 3OR1A 2KHDA 2F76X 3M1VA 4J9OA 4M5KA 1NSKL 3AOAA 8ICZA 4ZDNA 5DLFA 4U95A 4DQIA 5DJBA 2HJWA 3UQ8A 4PG7A 1QAYA 2R93A 2XBPA 4C7YA 1G2EA 2VPWB 5H9FJ 1VBGA 4H4MA 1QCKA 3BB5A 4EBEA 5RUBA 1A7GE 1G4CA 1WC0A 5CD4H 3TARA 2QMXA 1M0SA 2VONA 2OEMA 4RUCA 1C30A 3TI0A 2L48A 1LOUA 4Y2YA 2NV3A 2OH2A 1WCMG 2FK1A 1P27B 1SEIA 4I2GA 5HAOA 5C25A 4UY8T 2JDJA 2QEXS 1RYRA 3DXSX 3IBFB 5IYBG 1Z2ZA 3ZI4A 1KEKA 2R7VA 4BXXG 1KRCC 4MHVA 4M5NA 4KJIA 2OELA 3IG1A 5CYJA 1TWAA 1NSQA 5SUHA 4DZ6A 4Y0FA 2OPQB 3KUEA 3ORQA 1RA0A 1IV8A 3Q8SB 4K5SA 1BQMB 4LF6F 2ES6A 4O3MA 1VISA 2N4CA 1ED1A 1FWGC 4NEZA 2UVRA 1NZ8A 4DEZA 4PXDA 4QZBA 1JRPA 3AD7C 3T6BA 3I5AA 4MV6A 4CF4A 1Y00A 2YS6A 2FLNA 3KK2B 3V6DB 3ZDEA 3O44A 4DCJB 2ZC3A 4GOAA 5EX3A 1EUDB 5A6TC 3IV8A 1ZM2A 4ZPWR 2YKPA 4WBFA 8ICYA 1FRIA 2GQ2A 4H9MA 4TQRA 1YBQB 2Q79A 3ENAA 3DHXA 5ETVA 3CMES 5AI5A 3V4SA 3AD8C 5H80A 3UDCA 4EO8A 4B9UA 4LSAA 1FTRA 3OTOF 2R85A 1RWPB 2RP5A 1D8BA 3RR7A 3ETOA 1K0VA 4LFCJ 1QUPA 5HR6A 1HARA 1X4GA 3K3PA 4JI5H 3ZZZA 3Q89A 3KHGA 4LIRA 2R6FA 2VBYA 1AUDA 5D3GB 2KSOB 2D3ZA 3UPQA 5C2GA 3D5MA 4PGXA 2R2TA 2V68A 4KFBA 1ZAXA 4A4JA 2Z2MA 3GE9A 2IVMA 4UAVA 2OYYA 2E1AA 4GVBA 2L5YA 3F2CA 5DETA 2HVEA 1FRXA 2XSJA 1WD6A 4KHPF 1KJJA 5ALWA 3BQ7A 1X4CA 4WFYA 1KLMA 3WBZA 3CDUA 3KDOA 2C2MB 2DNGA 3CF5Q 3GLKA 3Q2OA 5J2NA 3H0GA 3MECA 4YB6A 3AY0A 5FPRA 5KFSA 4ZVFA 3BH7B 1FIQA 1SC3B 4EU0A 3X3UA 4NASA 3RF2A 3I0SB 2CYYA 2IRUA 2XY7A 2UBPC 1AUXA 3MOJB 3PYFA 1LWFA 3WKAA 3CCJS 2VQFF 3W9JA 2FC9A 5L1JA 4JYAJ 4I2FA 3ZDCA 2EW9A 2HMIA 2PMZD 3EZOA 3SQGA 1KQGB 7ICOA 3DEEA 3E51A 3ISCA 3R5GA 3AA9A 4A3DG 1Q95G 1TWFA 3SV3A 1Z2OX 4UCVA 4ZS6A 1BQNA 2R92A 2QSWA 1I1GA 3H8YA 2HBJA 1DLOB 4J5OA 1EHIA 2PDAA 2I38A 5KKNB 5KG5A 1Y4ZB 3UE2A 1NZAA 1WNEA 3H7IA 1FVIA 2W4DA 5G4DA 9ICRA 3FRZA 1QLNA 3W9IA 4NLTA 3NVYA 1SVDA 4N76A 5ALZA 4MEXA 3QYYA 2OHDA 5ADZA 1JLAB 4DF4A 3A3OB 1KQFB 1EJRC 4YMOA 3HHLA 3MI7X 2P2CB 4QZVB 5GTIU 3RV4A 4DR1H 1ZXIA 3V6KA 3KG1A 2PMZC 1IG6A 4WXWA 3RH5A 4B08A 4WE1A 2EQYA 4OI3A 4JI7F 4DPYA 4I29A 2R2RA 4F4ZA 2DLNA 3MGHA 1X6IA 3B4MA 3HVAA 2KI2A 2QL7B 2XI3A 2RD5C 3J81Y 1S1XB 5GADI 4B3OA 3N6NA 4CWBA 4YN4A 2B4OA 5M2UA 2COLA 3WK6A 2ZBCA 3G6XA 5EGYA 3G96A 1EJXC 2D1CA 1EIYB 4C4WA 2BE2A 2KXNB 2A6OA 1TKTB 1XRFA 1HNXH 4FZLA 5JTIA 2F44A 4G7EA 3RFAA 3DRPA 3OVSA 3QE9Y 3G8TA 1EB0A 2ABYA 1CC8A 3HVTA 3U9TA 3NY0A 1XR5A 3G6VA 4DV3H 4F4WA 2E44A 1VDVA 3N2CA 2DGUA 2GS8A 4IWXA 2JZBA 2DUYA