4F4WA

Y-family dna polymerase chimera dbh-dpo4-dpo4 #1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
molecule keywords DNA polymerase IV
total genus 113
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4wA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f4wA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4wA01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f4wA04
4DL2A 4J9MA 4I2GA 3I5CA 1NK6A 8ICHA 1S9EA 4URSA 1MU2B 2HVIA 4UB5A 4KLTA 1T4GA 1T03A 5DBBA 1FKPA 3PHEA 4TN2A 4JV1A 1XC9A 4TUSA 4WFZA 3V81B 2HHUA 4RPZA 1RTDA 3V6KA 3CDWA 4F4XA 8ICOA 1HUZA 1IKWB 2I1RA 1S1TA 1S49A 4M95A 1Z4UA 3H2LA 1RT7A 3EPIA 3GYNA 5C42A 4ZHRA 4EZ6A 2WOMA 2FMQA 2RF2B 4JV0A 4X2BA 4NLDA 2NRZA 5KG5A 3N97B 1IM4A 2HAIA 1BPXA 5BOMA 5L9XA 4DWIA 1J5OA 3KLGB 1T05B 1TAUA 3RB6A 4R8UA 3B0XA 3GIKA 4NRTA 3SV4A 1RT1A 8ICTA 2FPKA 4TQSA 3LP2A 4Z6DA 3M8RA 3PNCA 5HBMB 5J2HA 5C24B 5CYMA 4KLIA 2R8JA 2VA2A 5KFTA 2JEIA 3KJVA 3I0SB 1MC8A 2VG7A 1C1CB 2BPCA 2UVRA 3H5YA 2BCVA 4DFJA 3C6UA 1QE1B 1JKHB 9ICXA 4TQRA 2F1HA 3MEDB 4GXIA 2QV6A 1UWBB 5DLGA 2LYHA 4GLXA 1XS9D 4H4MB 5KT2A 3KK2A 5DG7A 2FJWA 4Q44A 2C22A 3V6HA 4ECSA 4WZQA 1WNEA 3MECA 3CJ2A 5J0PA 4XO0A 4I2EA 3KK3A 3BQ2A 2W7PA 4NLVA 5J2FA 1D8YA 2D7SA 4RQ5A 4NLTA 4NLWA 4RT3A 5IIMA 3IS9B 3C2LA 3MGIA 3ISNC 3HPOA 2FPLA 3ISND 4J9SA 2W9AA 4KTQA 1T3NA 3KLFA 5DB9A 3DMJA 2PI5A 3M8PB 3EZ5A 1SH3A 4MK9A 2WRMA 5CYMB 2HHSA 1TKDA 3RB0A 1DLOB 9ICCA 1RT4A 4RT2A 4I27A 4YR2A 1TKZA 9ICEA 1NHVA 1SZPA 3GIMA 3RBEA 2XY5A 1TK8A 2IM1A 1U4BA 3UXNA 2AX1A 1RTJB 1QLNA 4RPXA 7ICMA 3KK1A 3OSPA 4QWBA 4O3OA 4R65A 2M9NA 3TFRA 4HKQA 4MEXA 1ZQIA 4MKAA 4DL3A 2RF2A 3BSOA 1SKRA 1REVB 4ECWA 2R8HA 4LQ3A 2MAXA 2C2EA 1IKXB 4IDKA 1NK5A 4M9LA 1SUQA 1NHUA 1UNNC 4LZDA 4UAWA 3IGVA 8ICUA 3KLEA 1WCLA 4RQ3A 1EXNA 4IH5A 1XU4A 7ICSA 4KV8B 3SI8A 4M6WB 1FK9B 4PGXA 4UBCA 4F91B 4PUOB 2XGQA 1BQNA 1SL1A 2KZMA 1U09A 4EO8A 3RH6A 4BDPA 1VRUB 2JC1A 2GWSA 4IH7A 4C8KA 4RQ6A 4MH8A 4DQIA 2QE5A 4Q0BB 3H5UA 1NNDA 5EWEA 2YNIA 4WYWA 5HP4A 4BWJA 4DQSA 5KFZA 3GQCA 4DSKA 1PZNA 1UA1A 1LW0B 4B9LA 3H98A 7ICKA 3EZUA 3V6DA 4KN7A 4QZ8A 7ICUA 3QE9Y 2ZE2A 1C0TA 3MR6A 4LSLB 3JYTA 2HW3A 9ICOA 3IG1B 3RJFA 5J2KA 5FDLB 2BCSA 3H8JA 4DL6A 3FQKA 3UXPA 4UB2A 4KLSA 4I2JA 1ZTTA 4P2HA 2FVCA 3H8SA 5HMMA 5EWGA 3UXOA 4R64A 4Q43A 4NCGA 2FMSA 5IIIA 5KFLA 4JWNA 2BCQA 4K50A 2C2RA 2A1JB 3KMQA 3LP1A 5KFUA 3KLGA 1T05A 7ICNA 4IKAA 4PUOA 3ITHB 2FVSA 4K4IA 3HVTB 4YG2A 5KFOA 4KO0A 2ISPA 3CVKA 1X9WA 3CWJA 1S9FA 1HPZB 4H4OB 2W9BA 4YD1A 2VA8A 3GILA 2IM0A 4PHDA 3ZDCA 8ICSA 3JPNA 4YXJA 1L3SA 1ZQSA 1NKEA 7ICJA 2B5JA 1NJWA 1EP4A 4PGQA 2W9CA 4YMMA 2RDIA 4B9UA 2JZBB 1XSLA 1BVSA 3ZDEA 1IXRA 2P6UA 5KFWA 2BRKA 7ICIA 3UDLA 2XGPA 4PWDA 5J0TA 3IRXA 4KLGA 3I5AA 1HQEB 3MEGB 4IQXA 1EETB 1VRTA 1HNVB 1JLBB 3PX6A 4I2FA 3RJKA 1LWEB 4MF8A 3GIIA 2JC0A 9ICMA 3HVAA 4KHMA 4ELVA 1HJPA 2AGPA 4RUCA 4FO6A 2I1QA 3C5GA 4RW9A 1ZQXA 1FKOA 1AROP 4RNMA 4YR0A 1S1VB 1QTMA 1B43A 4F3OA 4Y34A 4QW8A 3IS9A 1ZQGA 2F1JA 5KFRA 4XUSA 2WONB 3QGGA 1RT5B 3QZ7A 1NKCA 3MBYA 1RTHA 3PO4A 4UAZA 4QZBA 4MFFA 5IIJA 3KHLA 3PZPA 2AGQA 1XSPA 9ICRA 5J0OA 3C2KA 2HNZB 2ALZA 7ICEA 1MMLA 1JLEA 1T7PA 3G6VA 1GX6A 2E9ZA 4P4OA 8ICNA 3T3FA 4I2PA 4Y2AA 4PWDB 1REVA 3RRGA 4J9LA 4RW6A 8ICEA 5EDWA 5KFAA 3NL0A 3RB3A 4B3OB 2YKMA 3UQ2A 3EYZA 2W9CB 2XY6A 5J2CA 2XY7A 2FVPA 1U49A 2WHOA 3AU2A 4KLDA 4ECZA 1H38A 3QYYA 5J1EB 4BXOA 3DRSB 4DQPA 5CJ7A 4KKOB 5K14A 1X9MA 4MIAA 1RAJA 3LWLA 4DQQA 4H54A 3V7KA 4F2SA 5KFMA 2IM3A 4KO0B 2MUTA 4ZVGA 5I3UB 5J2QB 3QIPB 1RXWA 9ICLA 5JUMA 2HWHA 4DS5A 1NK9A 3ZD9A 3AUOA 1HQUB 1IKVA 1N6QA 1ZQRA 1S6PA 1TVAA 4ZPCA 3KNAA 2ZJ8A 1SL0A 4F4KA 3I0RA 1D0EA 2BKEA 2J6TA 1S48A 1SV5B 3DLGA 2E9RX 3QZ8A 5F9NA 2J6UA 4J9QA 1T03B 3CJ0A 1ZQDA 2HHQA 2OPSA 3H5XA 3M9NB 3CDUA 4DQRA 1V9PA 4LSLA 4NXZA 4YQWA 3SV3A 1ZQMA 1U9LA 3EPGA 4UB3A 4FBTA 1QE1A 2AGOA 1HMVB 5J2JA 2RKIB 8ICBA 4NLZA 3QLHA 4CCHA 3V6DB 1LW0A 1RYSA 1NOMA 1HUOA 3G6XA 4GXKA 1TV6A 2YNIB 4KFBA 5DB8A 1S77D 1C1BB 3QO9B 2WB4A 4O4GB 3DLGB 5HROB 4P4PA 3KOAA 5D46A 4I2QA 2IJNA 5KFGA 2RDJA 4IRCA 3FSIA 3BSNA 4XRHA 2YNGA 4RQ1A 1IKVB 3ISDA 2JLEA 1MQ2A 1ZQFA 4DSEA 2FVRA 5I3UA 2JEGA 4ZHRB 3DM2A 5C42B 4QWAA 5KFFA 3TFSA 3NKYA 1N4LA 2KTQA 3ZD8A 9ICAA 3T5KA 2IA6A 1R0AA 4O3SA 3ZDBA 1KLMB 4I2CA 4TXSA 2A1JA 4IFYB 1T8EA 3JSMB 4K4TA 1XO1A 3IN5A 1QSSA 2ASLA 3DLEA 5I42B 5KFPA 1TAQA 3H7IA 4MEYA 1TVRB 4ID5A 3LAKA 4RW6B 8ICKA 1N5YB 2OWOA 4J9PA 3BR9A 3SZ2A 2NRTA 4F2RA 1TL3B 2DFLA 4RQ7A 1BGXT 3H59A 3Q8SB 2AQ0A 4I2DA 3PW4A 2ZE2B 4DSIA 2FLNA 3KTQA 2OPSB 3PR5B 4IR1A 1LWEA 3DMJB 3NMAA 4NY8A 3NBPB 2FVQA 3BQ1A 2VA3A 1HNIB 1RT5A 3UPFA 3OL9A 2XO7A 4UB1A 4WXOA 1BPBA 2IMWP 3GFKB 4QZAA 4RNHA 7ICFA 3LK9A 1JIHA 3I5BA 3DOLB 4RW8B 2NRWA 3ISBA 3MEEB 1U47A 5F8JA 1LB2B 8ICIA 3DLEB 7ICGA 4PPXA 5J2PA 4QZ9A 3RAQA 3IGNA 5J2DA 1TKTA 4I2AA 2PFPA 4TY9A 4RW9B 3DLKA 1BPDA 5CWRA 4F5QA 4ECXA 4KAIA 4C8LA 2WTFA 4YMOA 4EYIB 1SL2A 4IQTA 3OJUA 1A76A 4ZPDA 3MF5A 3MEDA 3HWTA 2ZUBA 4IR9A 4RQ4A 1TL3A 1NJZA 5DB7A 3PO5A 5KFJA 4QZHA 3LDAA 3K75D 2AQ4A 4YFKA 3C2MA 5T14A 3HKWA 2BANB 1MQ3A 4J9OA 5KFQA 4BXOB 3DRSA 4KB7A 3CJ5A 1W25A 4Q8EA 4O4GA 1KLMA 2YKMB 5KFHA 5CA7A 5KTQA 4O3PA 4NCGB 4DL7A 1L5UA 1KHVA 1SH0A 1XR6A 4O5EA 2GIRA 4YN4A 4IQUA 8ICPA 5CHGA 5D49A 4X5VA 9ICBA 4K4GA 2V4QA 8ICVA 4K4YA 1IKYA 3PV8A 3BSAA 4BWMA 4ZVEA 3PX0A 1CEZA 1RT7B 2BHNA 3JPOA 2FLLA 4TLRA 1XR7A 4M9HA 4GC7A 5JXSA 3DYAB 3ETLA 4ED0A 2R8GA 1JXEA 2ASJA 3ZDDA 2YNHB 3D5MA 5TZVA 4URGA 3FQLA 5F8LA 4NLSA 2ZTDA 4KN4A 5DGBA 1TK5A 3KLHA 2VANA 3MFHA 3FFIA 2CJQA 5D4BA 1JXLA 4Y3CA 1SKWA 3IM1A 5KFKA 4ED1A 7ICHA 4H4MA 2XC9A 1HNVA 1NK7A 4M47A 1JMSA 5J2QA 1JKHA 8ICQA 3RH5A 3RBDA 4WYLA 4RUAA 1JLBA 2ZTCA 3V7LA 4F4ZA 5C24A 3ISCA 4KKOA 5K14B 3OJSA 3LP2B 4IDKB 4XQ8A 3TAPA 4B9SA 1RT1B 1RXVA 1U48A 4XPEA 3OLBA 4B3OA 3RR7A 2R2UA 3I0RB 4K4XA 2HMIA 4IQWA 3CIZA 4MFBB 3LWMA 1HQUA 4ED8A 2XCAA 1S0VA 3QIPA 2B5JB 2OPPB 1R0AB 2WOMB 3QIDA 4LVSA 1JLEB 2WK4A 4UB4A 2W9BB 3LP0A 4RPYA 4O4RA 1IKWA 3TAQA 3D28A 3ITHA 3CDEA 4DOBA 1JLCB 5KFDA 4F5PA 1S0MA 3V81A 4RW4B 5IILA 5CP2A 2OPRB 3Q8PB 2ILZA 1TKXB 3OL8A 3MFIA 3DLKB 2AU0A 3DRRB 5J0QA 2ZJ5A 1KDHA 1JLQA 5J2PB 4IOBA 4JWMA 2EC0A 3JPTA 1S1WA 3H8WA 2AWZA 4R66A 4K4VA 2XI2A 1S9EB 1CUKA 9ICKA 4ZP8A 3KHGA 5FDLA 3MTKA 2D3ZA 3CO9A 1HNIA 3DRPB 3AU6A 3KK3B 1C0TB 2I9GA 7ICTA 3HP6A 1ZQVA 3K4GA 9ICQA 3V4IA 4J9KA 1EETA 2BE2A 3MEGA 3GIJA 5F8NA 4B9NA 3C6TB 3UQSA 4IQVA 3G86A 3SFUA 4WE1A 5HBMA 5KT4A 3BGRA 2OPQA 1ZQQA 1KLNA 3TI0A 4Q0BA 3HHKA 3JSMA 1LW2A 3RJIA 1SV5A 5KT5A 3DOKB 1TKXA 1JLGB 1ZETA 5KFYA 5DDMA 1S97A 4M9NA 4LZGA 3PMNA 3PW2A 1N6QB 2HNDA 3Q8KA 5F8GA 1HPZA 3KLVA 4EBEA 4DF4A 1YVFA 4I2HA 8ICCA 9ICPA 1DTTA 3JPSA 1C2PA 3KLEB 4PQUB 4KMUA 4IH6A 3N6NA 4F4WA 4NYZA 4MFBA 3GV8B 4IG3B 5C25B 4DL4A 1RZTA 4RQ8A 3PJXA 1KFTA 4ECVA 5J0SA 4YR3A 1J5OB 4QWDA 4IG3A 3DI6B 1TV6B 5HHIA 5KFNA 1KFSA 1SH2A 1TKZB 1UA0A 2XCPA 2FJVA 8ICGA 4YMEA 4H4OA 1OS5A 3LAMA 3JPQA 5BOLA 9ICWA 5L1LA 2PI4A 4KBIA 3UPQA 3QLHB 3M8PA 3H5SA 3RJEA 4R63A 5EUHA 1DLOA 1RT4B 1JX4A 2HNZA 1JLGA 1D9DA 1S9GA 4EZ9A 2UVVA 1RA7A 4ZP9A 4F5OA 3FFIB 2VG5A 5KFBA 1NJXA 4DL5A 2E9TA 4NLOA 4ZVHA 7ICQA 1ZQYA 2HHVA 3BREA 4BGDA 5HP1B 1S76D 2BQ3A 3Q8MA 1VRUA 3QGIA 5HP1A 4O3QA 2HVHA 1RT6B 2BRLA 4LSNB 3BJYA 4NZ0A 3GV7B 9ICFA 4QZDA 2IC3A 3TARA 9ICNA 5KG2A 4R0EA 2HHXA 4DFKA 3BSCA 4YXMA 5J2NA 3MR3A 3M8QA 4IG0A 8ICRA 3KJVB 3DRPA 3V6JA 5KG7A 4NLYA 1LWCA 5F8HA 1CSJA 4KITB 4MKBA 4ECYA 5KG3A 2ZUCA 3FYHA 1B22A 1N5YA 4F93B 3TVKA 3I0SA 2ASDA 3V72A 4M9JA 3RH4A 1KSPA 4ICLA 3MGHA 4KLHA 2R8IA 2IAJB 3CJ3A 3OL7A 1RTJA 1JLQB 4ELUA 3Q8LA 9ICTA 5KT7A 4EEYA 4MF2A 3QEAZ 1FK9A 1JLCA 5D3GA 2ZJAA 2UUWA 3OL6A 4R5PA 4DF8A 8ICYA 1QAIA 4KSEB 2KFNA 4O0IA 4TURA 1ZQKA 5J0YA 4ED2A 3DM2B 1S6QA 4RW7A 4K4WA 7ICVA 4RU9A 3KLFB 9ICGA 1S1TB 2BPGA 3FDSA 4NLQA 2HMIB 1ZQBA 1RT2B 4K4SA 4GXJA 1TQLA 2H5XA 1T94A 3DOLA 4RW8A 1RT3A 4QZCA 1MU2A 3ICLA 3M9OB 4O5CA 3QO9A 3PW5A 5DBAA 2D41A 1S1VA 4JK1A 5HLFA 3BGRB 8ICFA 2J6SA 5CR0A 4UBBA 1S0NA 1ZQNA 2RKIA 1KHWA 1VRTB 3N6MA 4WFYA 4M0AA 1HQEA 3KLIA 2BE2B 2DPJA 3OGUA 2ATLA 4NRUA 4EO6A 4O3NA 2UUTA 2PXIA 3IRXB 5J2NB 7ICPA 4MK8A 2B43A 5J2MA 4UAYA 2KZZA 4PH5A 3MR5A 5HNKA 4U6PA 3B0YA 2IC3B 8ICJA 2F8EX 2JZBA 2V9WA 4B9VA 5DLFA 4YMNA 3G6YA 3C1ZA 5J2EA 2W7OA 1EP4B 3QGHA 1TFRA 2YNHA 4I7FB 3GV5B 3PX4A 2BQRA 3H4DA 2JEFA 3H40A 4O44B 1LWFA 4M04A 4TYBA 3DRRA 2MUTB 4TUPA 3C6UB 3PJWA 5DG8A 1XWLA 3HVTA 2I5JA 3TQ1A 2DPIA 4QWCA 4DOCA 4F5NA 1TK0A 4DG1A 2IBKA 5IIKA 1WCNA 5DBCA 2BCUA 4ZP6A 2IM2A 1ZQLA 3OHBA 2O5DA 1BPZA 1C1BA 3T1AA 1RYRA 4QZGA 4ELTA 4TUQA 3DI6A 2PFNA 4NLGA 2YKNA 2ZUDA 4I2PB 3TAMB 3C21A 4HYKA 4MK7A 2AX0A 2W9MA 5J29A 1ZQUA 3NGDA 3C23A 5DQIA 1ZTWA 1LWCB 1L3VA 5J2IA 3KHHA 4QZIA 1BQMB 4NM1A 1JLFA 1DOQA 5CYQB 9ICIA 3PW0A 1NK0A 1RTHB 4ED7A 1UT8A 3LANA 5KFSA 1TL1A 1DGSA 1TP7A 1L3UA 3PW7A 4KLLA 2WONA 2BR0A 4ZP7A 3E01B 1RT6A 4LSNA 3SFGA 2PFOA 1RA6A 5KT3A 2GIQA 4NLXA 2V4RA 4XA5A 3MDCA 4Q8FA 4C8NA 4RNFA 5DG9A 5HMLA 5HHHA 3ZDAA 2HHTA 1FKOB 3NAIA 2V0NA 9ICUA 4G1QB 4DLGA 1KRPA 2P6RA 1N56A 5DQGA 1NJYA 1C7YA 4TY8A 5J2MB 3MABA 5J2AA 1LV5A 3N6LA 4F92B 1S9GB 1ZQEA 1SKSA 3OHAA 2IJFA 3DDKA 1Z00A 1S1XB 3PMLA 3PVXA 2VG7B 2ZKUA 4DOAA 1TVRA 1XR5A 5I42A 4I2BA 3PY8A 3KK1B 3THVA 3RJJA 4K4UA 4O9MA 3QEBZ 4IFYA 5DKWA 2Y1JA 4NLKA 4DLEA 4ZPAA 1RT3B 4U7CA 1TV9A 3RR8A 3RJGA 4IRDA 1RDRA 5C25A 2B6AB 2R2TA 2R2SA 3Q8QB 2BANA 2C28A 1HARA 4PQUA 1RTIB 1DTQB 5L1JA 1DTTB 4DEZA 4RNNA 4EYHB 1ZQZA 5IINA 4JUZA 2YNGB 5DQHA 2BPFA 2HNDB 2KZ3A 3BQTA 1A77A 4YP3A 4B9MA 4OL8A 3LP1B 2HHWA 4TY8B 4NLUA 2ZD1B 4I7FA 2FPMA 3T5HA 8ICWA 1ZQJA 3Q8RB 4KLJA 2FLPA 4MFCA 5KT6A 4RQ2A 4RQ0A 1TKTB 2OPQB 5DGAA 1S1UB 4I2IA 2Q0ZX 1HMVA 4WFXA 3TANA 2YNFA 4YD2A 3C6TA 3KK2B 3IG1A 3C5FA 4ED3A 3SYZA 4NLNA 5J0XA 5CB1A 1Z00B 1S1XA 2AJQA 1HYSB 4UQGA 1ZQOA 1Z3EB 1HYSA 4FBUA 2C2DA 1JLAB 3UR0A 3JPRA 3NBPA 2HNYA 4URQU 3M8QB 4IG0B 2YNFB 4QWEA 1JLFB 4NLRA 3EW9A 1KFDA 4ECQA 2W8KA 1C0UB 5F9LA 3T5JA 8ICLA 4DSFA 1ZQWA 4Z6CA 4J9NA 5F8MA 4QZEA 4O3RA 3IHQB 4NM2A 2YKNB 2IHNA 3TAMA 4RZRA 4DSLA 4ECUA 4ID5B 4O5KA 2BCRA 4Z6FA 3E01A 1XSNA 3E2EA 2KN7A 3PR4A 2VG6B 2P66A 4DSJA 4PGYA 3N4MB 5KG1A 2VG5B 4M6WA 4K4ZA 4RW4A 8ICMA 4I29A 4KLEA 4ZMMA 4KV8A 5L1IA 1RTIA 3JPPA 3DYAA 4G3IA 1QSLA 3ORYA 4DO9A 1SUQB 3M8SA 4M94A 4C8OA 1QUVA 1DTQA 1UT5A 9ICHA 2BQUA 2OPPA 3KMSA 4I28A 9ICJA 5KFXA 3OLAA 5J2GA 1FKPB 2D3UA 8ICAA 2IAJA 5KG6A 1L3TA 3E51A 5IIOA 1U45A 2IHMA 1Y88A 2JEJA 1BPYA 5HROA 3V7JA 5EWFA 4KFBB 4QW9A 4XPCA 1S0OA 5J0UA 3JYTB 2NRXA 4K4HA 1QAJA 4IFVB 1K1QA 4KLOA 4FS2A 2I5JB 1KEJA 1RPLA 2VG6A 1D9FA 1X2IA 4Y2CA 4KLQA 3C1YA 5DDYA 4B9TA 1ZYQA 4ZH4A 4F5RA 2UVWA 3NTUA 2W8LA 5KG0A 2KFZA 5F8IA 3KHRA 1BQNB 3CJ4A 3KLHB 4M2YA 5DB6A 1ZJNA 1TL1B 3RJHA 9ICSA 2ZD1A 3MECB 3HX0A 1X9SA 2ISOA 2R2RA 2GC8A 1QSYA 4MFAA 4EBCA 3RAXA 1UWBA 4P4MA 2OH2A 3UQ0A 5KFVA 1S6PB 4QZFA 4ZPBA 1D1UA 5KFEA 1S10A 4YVZA 4RW7B 5J0RA 4RNOA 1IKXA 4TYAA 2XWYA 1COOA 2Y1IA 1C1CA 4LQ9A 1IKYB 2WCXA 3FRZA 1BQMA 1ZQTA 5KFCA 2BGWA 4IFVA 3HT3A 4F8RA 4GC6A 4F4YA 1S1UA 5HLFB 5D3GB 3T5LA 4PHAA 4J9RA 2B21A 1D8LA 4YCXA 4R8UB 3MDAA 5J1EA 3H4BA 3GDXA 4IRKA 1JN3A 1S1WB 1S4FA 1RT2A 1GX5A 4F50A 5KFIA 2XI3A 4ECRA 4M9GA 3NAHA 4FS1A 4ECTA 4PHPA 2OPRA 3T19A 4Z6EA 3MR2A 1S6QB 2BDPA 1NK8A 3LALA 4MIBA 7ICOA 4DS4A 5KG4A 3HW8A 5J2BA 2ZTEA 1LWFB 3BQ0A 4DG1B 3LP0B 2NRVA 3RB4A 1RTDB 2ILYA 1N48A 1ZQHA 4R5PB 1MSWD 2B6AA 3VQSA 4KLMA 4KLUA 4KLFA 1KTQA 4NLPA 7ICRA 4WZMA 9ICVA 3DOKA 1ZQPA 3RRHA 4O44A 1LW2B 8ICZA 4KE5A 4Q45A 5L1KA 4ZVFA 4ICLB 2HWIA 2CKWA 1ZQAA 1NKBA 3MEEA 4WE1B 4C8MA 4I2QB 5J0WA 1BPEA 4JV2A 5EOZA 3EWAA 3RTVA 4KHRA 8ICXA 4ED6A 2FMPA 3OSNA 2F1IA 2PFQA 7ICLA 1C0UA 2UVUA 1I6JA 3KLIB 4DFPA 1ZQCA 2FJXA 4E0DA 1K1SA 4DFMA 5C5JA 3BDPA 4PHEA 5CYQA 3V4IB 2HNYB 4EBDA 1JLAA 3M9MB 4G1QA 4QPXA 2R8KA 1ZJMA 4WXWA 3HVWA 1NK4A 5BPCA
chains in the Genus database with same CATH superfamily
2YMMA 2B0GA 4I2GA 2YWGA 4URSA 1MU2B 2OSQA 4ZVUB 4ZVRB 3PYGA 7FD1A 1T4GA 1GAOA 1KQFB 4DR2H 1N8RT 5GONF 3AD9C 3HHDA 1NSPA 2QLXA 3SCIE 3SSSA 1RABB 5CAAA 4Y6IA 2UXBH 4JI1H 4RPZA 4AQYF 3OR1B 2O03A 1S49A 2KT3A 4M95A 2QLFB 2LQ5A 4ZVOB 3H2LA 3U1NA 4ZHRA 4Q2LA 1HIWA 1UZHA 2R7ZA 4J9UE 4X2BA 2NRZA 1W2BR 2DWCA 4ACOA 2C2OB 1IM4A 4MTEA 2BABA 4C7YA 3GTQA 3I31A 1J5OA 3RB6A 3F0NA 1JJ2R 3B0XA 2BUNA 1RT1A 3EWGA 5AIAA 3CO0P 4FF4A 2MRLA 5C24B 5CYMA 3I0SB 1MC8A 3MOJB 4OZ1A 3HKZE 5AKKA 1EB0A 5GAEI 5ALFA 1FHTA 4GLXA 4ECSA 3CJ2A 4XO0A 2QLJB 1FVSA 3KK3A 2YWWA 3BQ2A 1R6YA 2W7PA 2ZDHA 5GAGU 4QIGA 3ZTRA 4YB8B 1KQGB 3HB9A 4KPYA 2IPOB 4DV2H 4RQ5A 1XTZA 2F8LA 4NLTA 1ZPWX 5IIMA 3L7PA 5LL6d 2V58A 2ROPA 1S03G 5A0YA 2RMLA 2V2VA 2NXCA 3ISND 5HBRB 4DR7F 4V1YA 2MKJA 2W9AA 1RHUB 3KUHA 4OX8A 4DV7J 5F3TA 3J7Z5 4FF3A 4HEA9 2F44A 2D3OR 2YRWA 1N5XA 2CG8A 2HK2A 5K8MA 2CVEA 3BPDA 3M8PB 1IBLF 4UBPC 1WG5A 2W24A 2WRMA 1TKDA 3H8YA 3RB0A 1Z1VA 4HQ6A 3TIGA 4YR2A 2YX8A 1TKZA 9ICEA 3GIMA 3RBEA 2QARB 2XY5A 2G13A 3OUZA 2W6QA 4CE6A 1IUJA 1RTJB 4NLBA 7ICMA 1WTFA 4R0JA 4O3OA 2M9NA 5GAGI 3TFRA 2NS1B 4JB8B 4MKAA 4DL3A 1Q7YT 1PX2A 1SJQA 1DGJA 1REVB 2R8HA 4QU6A 4IDKA 5AM1A 1SUQA 1UNNC 1IQTA 1LQ9A 4C5BA 8ICUA 1CQNA 2KKPA 4RQ3A 2GQ2A 1J27A 3OD2A 4IH5A 1V85A 4BBRG 3KZXA 1P6TA 2AKWB 4BY7G 5AKHA 5EE3A 1FK9B 2NXJA 1MN8A 3SEOA 3CULA 1CJKB 2F8HA 2CQGA 4G6VB 3TKAA 1VC5A 4PUOB 1BQNA 1SL1A 3T1YJ 2KZMA 3U26A 1P1TA 3RH6A 1F5AA 4NL5A 4WBNF 4RQMA 4MH8A 1NNDA 2MZQA 3R3TA 2MY8A 3AA8A 3WKCA 3BO3A 3V6DA 7ICKA 1FESA 2V8GA 4C97A 5EHHA 4CC5A 2E8MA 4L72B 4O2AF 3M8ZA 2XIDA 1TR0A 2JMGA 2ZE2A 4X4TA 3PG9A 3MR6A 3NLCA 2XMKA 9ICOA 3IG1B 3FQKA 1PO6A 1T9XA 2ZIXB 3UXPA 4UB2A 4KLSA 2FVCA 3H8SA 4KH0B 3UXOA 4AXJA 4Y2KA 4Q43A 5IIIA 1FEHA 4I55F 1X4HA 3U1MA 5KFLA 3GZFA 1YGYA 4K2JA 4LBHA 3N28A 4K50A 1CQJB 3CJTA 4KR0B 4CTAB 5LJ3Y 2ZIUA 2XMTA 1WSCA 1T05A 1YNYA 1YRTA 3WX8A 5B0FA 4UCOA 3KG0A 4PUOA 2KN4A 3FJ2A 2Q2UA 1Q81T 3B8HA 2D6FC 2LM1A 4CDGA 3FEQA 2KP7A 4YG2A 3Q2TC 5IM0B 2F1FA 2ISPA 4Z42C 1S9FA 1HPZB 2N4CA 4YD1A 1WF2A 2MHEA 3ZZYA 1TL7B 2IM0A 4PHDA 2IHR1 2KT2A 4OX9F 1YJTA 3H7HB 4F0LA 4YXJA 1ZQSA 2B5JA 1AUXA 2XVTA 4DV4F 1BJTA 2KVIA 2W9CA 1VBKA 4U7UD 4GMKA 3GMGA 1HWLA 1VQLS 4RBUA 4QCLA 3Q22A 2V8VA 3BEGB 1XSLA 3UBPC 1IWGA 1BVSA 2UZAA 1RAEB 2CA9A 4B08A 5BYRA 2DR8A 4DUYF 3UDLA 3QPIA 2HQCA 2K3IA 2HWTA 3I12A 1KOOA 4KLGA 3I5AA 1HBMB 2KHQA 2HJWA 3MEGB 2KEYA 1B70B 2U2FA 4I2FA 2WVFA 2H5IB 3C66A 3RJKA 2I38A 1A0PA 3GIIA 2FB0A 4JI8F 4EGJA 2G2YA 1R9ZA 2GX8A 3HXLA 1TUGB 2JHEA 1GK8A 4RDVA 1U6FA 3C5GA 2E3TA 4KYZA 1S72S 4YDDB 4PR6A 3W61A 1TTHB 5AM5A 2HKEA 4LF9F 5LA6F 2PMWA 3GZ7A 1ZQGA 4P6QA 4ME6A 2IDLA 1WUUA 4DCOB 4LR9A 1RADB 3QGGA 2HS0A 2R84A 1RT5B 3TZZA 3QZ7A 1NLKL 4MKYA 1ZM2A 1V9OA 3PIPQ 2QB1A 4K0KJ 3PO4A 1MMDA 4QZBA 2R92G 1R3NA 5IIJA 3TA1A 1KVJA 3PZPA 2PGCA 5A8KA 5E33A 9ICRA 3SD7A 2KG0A 3W60A 1MMLA 2E8OA 3GTMA 4NLCA 4YS2A 3MURP 4CEUC 4TUYF 8ICNA 3MTWA 2R7WA 4J9LA 4RW6A 2UUCF 2HBQB 8ICEA 1EX8A 5BPFA 3BS5A 3KOOA 1VC0A 4B3OB 2ZUGA 2GA7A 4NXNF 2E1MC 2WHOA 2KJWA 4ECZA 2Q66A 2UU9H 5D4NA 5K14A 3PSTA 1X9MA 2AP6A 2EPIA 2LEBA 5DM7Q 2CZVC 4A8QA 3V7KA 2Z7JA 1HBNA 4OI1A 2M4MA 2MUTA 3QIPB 2A6OA 3B6BA 5B5EU 4K8RA 2HWHA 1KONA 4FPRA 1YJNS 3ZD9A 1ZQRA 2GMLA 4QR0A 3PKMA 3HM9A 5ETTA 4B3SJ 1SL0A 5G5GA 4CF4A 2RS2A 3EGVA 2ZIWA 1V5VA 1RKJA 4DL0C 3CPWR 4P75A 3FBBA 2QLTA 1IBKF 2CRLA 4J9QA 4DR5J 1ZQDA 1FIQA 2CVIA 4NI2A 2EZYA 4K7QA 1DQ8A 2JH1A 2G0JA 1A5OC 5HQ8A 2R9LA 1RHJB 1XNRH 4NEYA 1V9PA 1YRUA 2M5YA 3T81A 3SV3A 3EPGA 2NXNA 1HMVB 5J2JA 2RKIB 2JOQA 8ICBA 3VGSA 3GU3A 2M9KA 3EICA 2MMYA 3TACB 2ZH6A 1QCKA 4GXKA 2JHDA 1TV6A 2K1RB 2YNIB 5DB8A 4WD3A 4FN5A 3TP2A 1KEKA 3N2CA 2WB4A 2VOPA 3FUYA 5D46A 3R0DA 5KFGA 4IRCA 3FSIA 3BSNA 3Q83A 3WO1A 3RGZA 1ZZFA 2JLEA 1X7VA 4DSEA 2FVRA 3OPXA 3D6TB 3K8VA 2JEGA 1S59A 3HFVA 2DNNA 4ZHRB 2FJ6A 2EBGA 4QWAA 2GJFA 2YBVA 2E5GA 2MQQA 4JI2J 3V4SA 3WK8A 2RLTA 5KFFA 3RF2A 3NKYA 1N4LA 4OYOA 9ICAA 5JJBA 1KLMB 5LP6F 4TXSA 2A1JA 4IFYB 4PJ0U 4K4TA 1FFSB 4RJVA 2AJ1A 4A4JA 3IN5A 1QSSA 3DLEA 1YJWS 4IC9A 1TVRB 1JRPA 2QS8A 4M5MA 8ICKA 5DDPC 4JI3H 4J9PA 3UCGA 3BR9A 3MM8B 5ETQA 1BY9A 2NREA 4F2RA 3JSBA 2R7NA 2F76X 3QUQA 2XMJA 3Q8SB 2ALYB 1N33F 4X4UA 5HMFA 2FMAA 1CQMA 1EKSA 3CCSS 1WEXA 1H2TZ 5EN1A 3FC9A 1C3OA 1BNOA 5ALVA 2ZC3A 3BQ1A 3I4HX 1R0CB 2VA3A 2R18A 1RWKB 1RT5A 3OL9A 2KHCA 4YHHJ 5IYCG 2IMWP 4UZCA 3GFKB 7ICFA 3I5BA 1NBEB 4RW8B 3W63A 5F8JA 3PIOQ 8ICIA 1Y7PA 5J2PA 3RBXA 2AQVA 1WDDA 2PFPA 4RW9B 3DLKA 1RAGB 1HNWJ 1BPDA 5CWRA 4MTPA 2VUNA 2ZHBA 2DNYA 1VBXA 3D2SA 1TMJA 2WTFA 4LJMA 1A76A 3PSIA 1WELA 1BWEA 1HBMA 1OSCA 1WDTA 4RLEA 1B0XA 2Y0BB 5DS7A 4YHHF 4Y2PA 1XERA 3HKWA 2BANB 1QH9A 2DHXA 3CD7A 4BXOB 1DXSA 1Y3KA 3CJ5A 1Y00A 2IOHA 5ALHA 3BN7A 1JQGA 2YKMB 2Z00A 4MV7A 5CH7B 2DEJA 2RQCA 3CJSA 4P0QB 1POKA 3HHEA 2K06A 4O5EA 4NZ7A 1LKYB 1PBAA 3WIVA 3AHPA 1HBOB 3N8DA 1NM2A 4A3IG 1Q53A 2R7UA 8ICVA 3I82A 2EW9A 1SJRA 2ZG6A 2MPUA 3R5DA 4DV5J 4M9HA 5JXSA 4KGXB 2NUAB 3DYAB 4B3RF 2CKZB 4LF9H 2HBMA 4ED0A 3R1LA 1JJ4A 1JXEA 2YNHB 1HNXH 4URGA 2ZIUB 1VHIA 3TJ9A 3HSJA 3FQLA 3UN3A 1FJGJ 4IO9Q 3RRKA 2ZTDA 2PA8D 2ZH1A 1Z2ZA 2KI2A 1TK5A 3HPAA 3KLHA 2C3YA 2VANA 3FFIA 4WPAA 1U02A 1N5QA 1I3OB 4ED1A 4H4MA 1FWJC 3D6NA 1JMSA 3MM6A 3HKZF 4WYLA 3WKAA 2GO8A 2KE7A 3R1HA 2KM8B 3THTA 1IWAA 5FSDC 5L38A 5K14B 1U1QA 3ETJA 4B9SA 3LTOA 4DV0H 3GSDA 1RXVA 4XPEA 3NGUA 2YX7A 3F8NA 4DPUA 4B3OA 1CJVA 2R2UA 4I6YA 3I0RB 4A8XA 4F71A 2W55A 1BD6A 3LWMA 2RU3A 2BACA 2CPYA 5FJ8G 4UTGA 1R0AB 2WB1E 4V19X 4DBQA 2AEMA 1I3QA 3A0BU 1HNZH 4UB4A 4O4RA 1XRTA 4DOBA 5FPOA 4DR4J 3MWEA 1RJQA 1F3FA 1X4DA 4RW4B 5D4LA 2GAHC 3WKDA 1POJA 2MSSA 1UVLA 5J0QA 1JLQA 3SXLA 2GMHA 4OYAA 2CQIA 1YZ7A 2EC0A 3I1YA 2M8DB 1AT1B 2RILA 4R66A 3JAMU 3MPVA 3EGWB 2GOKA 4ZP8A 3KHGA 3F44A 2HGSA 2NXEA 1HNIA 2KXNB 2KV2A 3JB9k 4UB6U 3AU6A 1C0TB 3J7A1 2CNOB 1HI0P 1W7WA 3RU0A 3V4IA 3MGVA 5HJYA 1M5PC 2BE2A 3MEGA 3FK4A 3R5HA 4NASA 3R9LA 1L7NA 3C6TB 1K0TA 4CLZA 2YPZA 4L74A 4KHPH 4UFZA 3NOGA 1ZQQA 4BX9C 4Q0BA 2E1FA 2AD9A 2KSOA 2YH1A 4MV3A 4R7WA 2JWNA 3ZZRA 4KJIA 3N7RC 3TNVA 4LZGA 4CLKA 1O51A 3OXGA 3Q8KA 5AE3A 4MV6A 3M30A 1Y1VG 3B54A 2LMRA 2DKXA 2FJEB 4DR1H 3IBWA 2RE1A 5B0DA 4F4AA 1H7XA 1DV2A 1XQIA 3GV8B 2I0XA 2AYEA 2F40A 4LF6H 2WSEC 1VBYA 2JA7A 4RQ8A 1KFTA 1BLUA 3PDNA 4KX3A 4JI4F 1J5OB 3V5RA 4IG3A 3K0JA 3DI6B 3FCHA 2VR1A 1KFSA 5KL1B 1EF2A 1TKZB 3SQOP 2VQFH 4UB8U 8ICGA 3MCNA 2KKVA 4C0OC 3AM9A 4H4OA 4G9BA 1UJ5A 3JPQA 4W92B 4KBIA 2PI4A 2QA1A 1DJ0A 2YL2A 2Z56B 2VKZG 2PN6A 5CZXA 2PEBA 4R63A 2PT0A 1DZ5A 3TYTA 2G5IB 3C15B 2UVVA 2O6KA 1VFJA 4LF1A 4F5OA 1RUSA 1L6NA 1RWMB 4L1KA 3G96A 2EDUA 4ZVHA 2HHVA 2LU1A 3M2UA 2JGAA 4WFAQ 2HQ3A 5HP1B 2BQ3A 1MG7A 1V3RA 2HVHA 2HBYB 1D3WA 3BJYA 2WDTA 4NZ0A 1UFLA 2DYAA 9ICFA 2A6MA 1B6RA 5KG2A 1UAWA 2VPWB 2HHXA 2YS6A 4UY8T 4B3RJ 3BSCA 2KMDA 1F6TA 4DPXA 3DGVA 5ALJA 3FVYA 4IG0A 2ZH8A 2L41A 2W11A 1FTCA 4L9XA 4NLYA 1LWCA 4W4MA 4Z2XA 4ECYA 3GJTB 3FYHA 1NDPA 3CD6S 4OYMA 2CQ1A 1N5YA 2HBJA 3D3BJ 2FJAB 3I0SA 2Y8WA 3W1YC 4M9JA 2FPGB 5HL7Q 3QWUA 4EP8C 4P0PA 1KSPA 3MGHA 2MGZA 4I56A 1YK9A 3MM9A 4FXDA 2V9KA 5B0AA 2KJ9A 5KT7A 4EEYA 2J0QD 4I67A 4MF2A 2N4DA 1TAMA 2MHNA 3RGIA 1JLCA 3VAIA 1QAIA 4DF8A 8ICYA 1PSDA 4DV1H 4USJC 1MROA 3RYLA 4TURA 2FHKA 2W2NP 4PCQA 4FXWA 3C8YA 4IL6U 4ED2A 1VQYA 2C2NA 5K2MA 5G4HC 1PK3A 2VHGA 2BPGA 2HMIB 1RLDA 1ZQBA 1RT2B 3DKDA 4K4SA 2PN1A 1T94A 3O7UA 4OD0A 4RW8A 3R7SB 4QZCA 3M9OB 4A3JG 2NO4A 3PW5A 1P9YA 1AFJA 1KWMA 5D0GA 1XBWA 3HK2A 3HJVA 4C8ZA 2MQPA 2ZNZA 3BGRB 2J6SA 2DNPA 3J81U 2B0CA 4CLUA 4ZN1A 1S0NA 1ZM4A 2RKIA 2MTLA 2PIIA 5HVFA 1UQVA 4C5YA 2BW2A 5GMEA 3W64A 4DUZF 3J81j 1HQEA 3AQFA 2BE2B 3OGUA 2ATLA 4NRUA 3MEKA 3IRXB 3ALRA 2CAJA 3CCQS 3FAHA 2KZZA 4CQ1A 4PH5A 2K7KA 3MR5A 4U6PA 3UMCA 3F2CA 2JZBA 3MM5B 2PFFB 2X51A 5DLFA 2PMZA 1PG5B 3QGHA 1V3SA 2V4JB 5AHXA 1KN5A 3H4DA 2YW2A 3CT9A 4O44B 3GTJA 4M04A 3LWBA 3I28A 2HHHH 2MUTB 2ZNYA 2J9DA 3PJWA 4OZ2A 1XWLA 1PYSB 3TQ1A 4RUBA 2DIKA 1SIWB 4F5NA 1TK0A 4GOAA 1RP5A 2P5VA 1WEZA 1I94J 1HWUA 1UFKA 2PMZE 5ITHA 2F2AB 2OHDA 4LH7A 3QNMA 1C1BA 4OZJA 1Q95G 2A1AA 1HBUA 1VIXA 3A13A 1KRAC 2J0SD 3HRDD 2HQFA 4TUQA 1IE7C 3K5OA 2MKYA 2PFNA 2XO6A 1A7GE 5ETVA 3TAMB 2F4VH 4B3SF 1X60A 2MJUA 3F2DA 3JZIA 5LYJF 4MMOA 2W9MA 5J29A 4YHHH 3C23A 4GKKF 4I6AA 1URRA 1BQMB 4DV0J 3GFZA 5ALGA 1YMYA 4DUZJ 1EJRC 3SENA 2G3FA 5AM2A 4PG8A 1NK0A 3AEVA 4O4IF 4WP8A 3UNGC 5KFSA 1DGSA 3QU4A 4OZLA 2PC6A 2WONA 3CW2C 2BR0A 4ZP7A 1ELOA 1S5ZA 1HIYA 3SFGA 4U95A 2PVPA 1GMWA 1IBKJ 4M5KA 4CQBA 1NH8A 5KT3A 4FNHA 4WTOB 4NYOA 4PXDA 2V50A 4DR1F 1G3OA 2ZFHA 4ES1A 3POTB 1GT8A 1NSAA 4N5SA 3S01A 4G1QB 1FRHA 4CWBA 3PYEA 2JNJA 4Z7CA 3L7UA 1C7YA 3VAJA 2W2QP 3AQEA 3MABA 4OI2A 4Y2VA 1SPBP 2DL0A 5ALKA 1LV5A 1E4FT 2DQNB 2LXIA 2CDRB 3OTOH 3DDKA 2B4VA 3IP0A 1Z00A 1S1XB 1L8OA 2WF7A 3PMLA 1SI9A 3PVXA 2VG7B 4UARA 1XR5A 2G0AA 4I2BA 2DRAA 2A10A 2SXLA 1AFIA 2FPIB 3NCPA 4OYPA 3KK1B 3THVA 4DV1F 3QEBZ 1AXQA 3CCUS 3DLJA 3BGUA 4LF8J 5IXUA 3W66A 1F60B 5C25A 3E0FA 5J1NA 4ZJLA 1UEKA 4FYVB 1FWEC 2V69A 5L1JA 2J8AA 2ZHOA 1Q1KA 4YN3B 4EYHB 2NO5A 4BBYA 4ILRA 3DRYA 2AT1B 2BPFA 4ZPVR 2HNDB 2KZ3A 2V8HA 2DHGA 2H3ZA 1WJ9A 2E8PA 4QR2A 3HX9A 3B4DA 3L4PA 4PG6A 1SWVA 4AFFA 4MFCA 2QYGA 4RQ2A 1O75A 1L7OA 2ZH9A 5DGAA 2CXYA 5L39A 3D3CJ 1HNWH 1WHWA 3O0FA 2Z0GA 2DGTA 4JB3A 4ZLJA 3W2VA 4Z37A 1P9QC 2YNFA 3IG5A 5AKXA 2KYZA 3W9HA 5EOYA 3IG1A 3VVTA 4NLNA 2LM4A 4UQGA 3HT0A 1N0VC 1Z3EB 4FBUA 2R93A 1WOPA 2HBZB 4KY3A 1A5NC 2C2DA 1VGYA 2H1YA 2MZSA 2MY7A 3NBPA 3BO4A 3HKZA 1LXJA 1Z2LA 1KFDA 1WSRA 4WHBA 4ECQA 1ULZA 4M9UA 4YY3H 3T5JA 5D8HB 8ICLA 4DSFA 1OUQA 2KNJA 4DN9A 4FE3A 2MLZA 1A6LA 2R93G 1LEOA 1GLVA 3MTJA 4O5KA 2DGOA 5D1OA 1WD6A 2XTJP 3E01A 1CLFA 2NU8B 2ODGA 1UEVA 4QYZK 4P2MA 1ZS6A 2GHVC 4PGYA 5J2TF 1ZOLA 4AD6A 5KNIA 2L9NA 4ILMA 2OTLS 3MM7B 4DCPB 3JS9A 4P2SA 1RTIA 4NL9C 1YITS 3AN1A 3NVWA 4DU8A 4KQZA 4DO9A 1V6HA 3M8SA 2KH9A 2GVDA 1QUVA 1IBKH 1UT5A 3H0MB 2OPPA 1ZAVA 2GS8A 1I7NA 4F0MA 3BZCA 3EDQB 2A2DA 4G65A 3TVYA 2E66A 3DDIA 1ECWA 2OKQA 1E4EA 3LMLA 2CQ3A 2AJFE 4C5AA 5LXYA 4QW9A 1S0OA 3LNPA 2MQLA 3EGJA 1G7CB 1QAJA 1VS0A 3S8SA 2I5JB 3H0LB 5LOQA 2C42A 3HULA 1N34H 4DUYJ 2MQMA 2ZBRA 4Y2CA 4KLQA 3UN2A 5FSEC 4B9TA 4OJOA 3THPA 4F5RA 2UVWA 2W8LA 5KG0A 1XNQJ 1S7IA 4OZ0A 5F8IA 4R85A 4NWBA 4LFCF 1BQNB 3I76A 2UP1A 1TL1B 2R7ZG 9ICSA 2DITA 4ZS6A 2EAPA 1U7LA 5DETA 1KRCC 2R2RA 2Y0SA 2QSFA 5A0LA 4MFAA 2D9PA 4EBCA 3RAXA 2F63A 1N60A 2OH2A 2K8GA 5BJRA 1BGWA 3UQ0A 5KFVA 1S6PB 1DY3A 4ZPBA 3WK6A 2MQ8A 3M6ZA 1B0TA 5LOVF 3KG1A 4LQ9A 3NCRA 2X3DA 3CYMA 1OIAA 5AI4A 5FLXU 4F4YA 3WK5A 1DV1A 3T5LA 2RVJA 1IBMJ 3BS9A 1BNCA 1D8LA 1PVQA 5J1EA 3A3OB 2BDUA 2F65A 2G0CA 2V2ZA 1K0VA 4YOEA 2BZFA 3MM9B 5B0GA 4MHVA 1X31C 4DI6A 1SXDA 4M9GA 2D3O1 1FDDA 2DNRA 3U9SA 4PHPA 4Z6EA 3MR2A 1S6QB 4CO2A 2YX1A 5CAEB 1Q8KA 1EUCB 1NK8A 1R6VA 4DR6F 3NS5A 5J2BA 3TVZA 2HAFA 1CE8A 3RB4A 1OMSA 1N48A 2DR6A 1URNA 3VQSA 2I2YA 4FF1A 3J7YI 4PG4A 3IFEA 4CF3A 1ZQPA 1YQHA 5DDQC 4LF5F 4KE5A 2APOA 2YRXA 4QQBA 3MAHA 1C20A 4ZVFA 2PD1A 4ICLB 3MEEA 2HQDA 5BPHA 4USAA 4C8MA 3EYYA 4LFCH 2CJKA 2JH3A 3H2VE 3W9JA 1KTVA 3PXGa 5M2PA 7ICLA 3JAMW 1NZ8A 4DFPA 2FJXA 2FK3A 4H9MA 3ADAC 3UQ8A 4JV5H 2AH5A 1FFUA 5CYQA 2AEFA 3LUYA 2WW4A 4DR6J 3C15A 3KKAC 2AMCB 4G1QA 5E79U 1I94H 5KAIU 3IR7B 5GTHU 3CD0A 2A2CA 5BPCA 3VTIA 5ETKA 4QR1A 4UASA 3OBIA 1S9EA 2CPHA 1TUWA 4TKTA 2ESEA 1A5KC 3PKYA 5DBBA 1WH2A 1FKPA 3TUPA 4JV1A 4X65F 4C0HA 3D7SB 4Y2RA 2FHJD 2BJ1A 3JRXA 3PEJA 2J7KA 3FMWA 4GVBB 1RTDA 5C8YF 3CDWA 8ICOA 2LLZA 1HUZA 3NEKA 1WACA 1IKWB 1S1TA 5D0RA 2LQ8A 1Z4UA 4PEOA 3G71S 1K83A 4HVZA 2W43A 1HD1A 2NU9B 3NVZA 3VALA 5ALZA 1R8PA 1F5SA 1QQ5A 1DBDA 2HVRA 1XNQH 1NDLA 1KVKA 4EGQA 5BOMA 5L9XA 5K9FA 1T05B 2KOBA 1TAUA 1WG1A 2QO3A 2CWKA 3K5PA 4NRTA 2UXCJ 3E5NA 1PAEX 1RAKA 2HIYA 4Z6DA 3PNCA 1VOMA 3KDOA 5HBMB 4WKYA 2R8JA 2VA2A 5KFTA 5AKIA 2VM8A 2VG7A 5L46A 2W70A 4DFJA 1JKHB 9ICXA 4FKXA 4NXNH 4MIWA 2F1HA 2R6FA 4GXIA 4H4MB 2FJWA 4F3MA 2C22A 2BKNA 1UWAA 5BMVF 3D6JA 3VCBA 3KKFA 4I2EA 1JI7A 3QQCD 4C3KA 2DKOB 2GOLA 3R5FA 2FVKA 1WORA 4NLWA 4JI3F 4RT3A 4JYAF 2F9JA 1F9HA 1XEZA 1YX2A 2R4FA 4O4HF 4J9SA 1GTHA 3FNNA 2CQBA 1T3NA 5I4MA 2MKKA 5K8NA 4CO4A 2FK2A 1FXRA 1IM6A 4HR7A 4MK9A 5HANA 2L3MA 4X62F 1UC9A 1K5OA 5CABA 1DLOB 9ICCA 1RT4A 1L8LA 1LKYA 4I27A 3MCOA 4Y2JA 5IV4A 1GO3E 1U4BA 4LF2A 2AX1A 3I56S 4RPXA 3KK1A 1ITPA 2COLA 4XX0B 1MWQA 4R65A 2IA0A 2DXDA 1ZH5A 4HKQA 1ZQIA 2DB1A 2RF2A 2QGFB 3BSOA 5AKQA 2CXEA 3UDVA 4CZCA 4LQ3A 3V7PA 2C2EA 1S79A 5IWAH 4M9LA 1A9NB 3GR0A 4LZDA 1D8BA 5GAEU 5E3RA 4C4TA 3GWCA 1WCLA 2YXLA 1XU4A 3L3CA 4X66F 4AQYH 4A3EG 2UUAF 2QIFA 4F91B 5KAKA 4RQNA 2XGQA 4HT7A 1U09A 4BDPA 2JC1A 2IVFB 1FJEB 5IP7G 2QL7B 4RQ6A 5JQWA 2ACMA 1Z1BA 2QE5A 2BA9A 3FCWA 5HP4A 3GQCA 1APSA 1HW9A 3A8EA 2O1PA 2K3KA 5E3CA 3QE9Y 2KICA 2LQBA 3Q24A 3U9TA 2IVMA 4LH6A 1UVNA 2NR0A 2RT3A 4E2FB 3W8GA 5C1OA 3JYTA 2HW3A 3N01A 4OJGA 2YY3A 3RJFA 5J2KA 1FDBA 5FDLB 4USIA 1ZTTA 2QMUB 5HMMA 3NS1A 2CQYA 4R64A 2R7VA 4AYBA 4CLLA 1G1XA 5E2QA 4FYXB 3H42A 3LA4A 2Q6CA 4ZJOA 1LWXA 2VL1A 2C2RA 1U25A 3KLGA 3A3NB 3QRRA 7ICNA 4IKAA 4DOZA 3K5LA 5ALRA 3TADA 1PYTA 1JLLB 3GFHA 3HVTB 4JI7J 5KFOA 4RKUC 2NVYA 4F67A 3CVKA 1X9WA 1RHQB 2DVIA 1RBAA 5FD1A 2W9BA 2E44A 1X5PA 2VA8A 3GILA 5BYSA 3QXGA 2ZIVA 3SFWA 8ICSA 5I3PA 3JPNA 1L3SA 1KDNA 5ALPA 1NJWA 2ZDPA 2L48A 3TUJC 4LF7F 5GADU 2J7WA 2P53A 2P9GA 2YS7A 2RDIA 1MZBA 2JZBB 3WO0A 3ZDEA 5AIBA 1H6KX 5KFWA 2BRKA 3FMAA 2XWXA 2JA5A 1YZ6A 1W93A 3OUYA 2NZCA 3B82A 2XICA 2QYCA 1RQLA 3F56A 5C1PA 3SQGB 4XK8C 3JSRA 3FMBA 1LWEB 2HQIA 4MF8A 4DR4F 3G77A 2EG1A 3HVAA 4KHMA 4FO6A 2RSQA 2H4WB 5C44G 2G06A 1ZQXA 1C30A 4H4KA 1UL3A 3IWLA 4YR0A 1HNXF 4DLKA 3TEHB 4OIXA 2R87A 1YSJA 1B43A 1FWBC 4F3OA 1NUEA 2YWEA 4Y34A 3HJEA 3SEIA 1NI3A 4NA1A 2AZ3A 3GP9A 4DV3H 1E6YB 3HSZA 1RTHA 1ZRMA 2XS5A 1YT3A 1I50A 3KHLA 2AGQA 1XSPA 4KHPF 4JV5J 4HH0A 5J0OA 3T6JA 3MAQA 3RV4A 3G6VA 1GX6A 3NRWA 4K5SA 2ZWPA 3L5KA 3KJQB 4PWDB 3OUUA 2XMVA 4Y8VB 4C2MA 2DNHA 4OHWA 1X5SA 2LYAA 1IR1A 2MLXA 2YWFA 2O01C 3R5BA 3ET6A 4S0MA 2R7KA 3KTMA 2MZTA 3HO1A 3O6QA 3UQ2A 2W03A 1B4SA 5THWA 2VQEJ 2W9CB 2FGCA 3M2RA 2XY6A 2XY7A 2GVZB 1U49A 3BG5A 4KLDA 5A8WA 4N41A 2KB2A 4DQPA 1PC5A 3N43B 3UD5A 3LWLA 4PWWA 2UUCH 2IM3A 4AXIA 3DFEA 3A8IA 3R8YA 5J2QB 2FPPB 3H90A 2K4PA 1R9YA 4NPOA 1TE2A 1NK9A 1GH8A 2CZ9A 1HQUB 4EPEC 1IKVA 3P49B 4OI6A 3DGPA 3RW7A 1FFGB 4APMA 1J2MA 3HILA 3I0RA 2J6TA 3R9KA 4CTAA 1SV5B 3O1LA 2KSOB 3QZ8A 3QU7A 4ZCKA 1OQ3A 1B3TA 1VQMS 3CJ0A 1F44A 5D0EA 4JI2H 4HAIA 3HLUA 5ALSA 2CPDA 2DR5A 1KBLA 3LVWA 3C19A 3CJRA 4A3CG 4USWA 1FFWB 4EWTA 3OTBA 4DQRA 4LSLA 3MMCA 1MLAA 1A0OB 1OQ6A 3QLHA 4DPOA 3ZNJ1 2OTJS 1ZAXA 2FGOA 1YI2S 3GLJA 5HAOA 2W71A 5D1PA 4DX8H 2CG4A 3G6XA 5KOXA 3UN5A 8RUCA 5AXNA 5FLXY 1JKJB 4KFBA 3DLGB 1X0FA 2RDJA 1NB2A 1QJHA 1T9WA 2HVEA 3BS5B 2YNGA 4RQ1A 2YWHA 4GBDA 2FLOA 4A8WA 2B9WA 1L7MA 1X9NA 1IBMF 1K44A 4E8UA 5CHCB 1IOVA 2ZXHA 2GFFA 3TRGA 2YTUA 2KTQA 4W90B 3G82A 2BOAA 4DR7J 3T5KA 1R0AA 4O3SA 1PK1A 2GCFA 4I2CA 1WHVA 3T8LA 1F5CA 1FX2A 3M6WA 1T8EA 1RCXB 1XO1A 3DNCA 3W5ZA 2YTCA 2J9GA 2ASLA 1Z2OX 3NMRA 3H7IA 2A3JA 3W2WA 4UCUA 2NRTA 3ZTQA 3QFWA 1BGXT 4P2FA 2XS2A 4NA2A 4P73A 3M8YA 2DH9A 3GGMA 4J03A 4ITSA 2ZE2B 1AN7A 2OPSB 2NPFA 2LEPA 3DMJB 2CNLB 2FVQA 2ZOGA 5G5HA 2V2QA 1NH7A 1HNIB 2KM8C 1TFYA 4OFZA 2XO7A 4UB1A 2V5HG 4RNHA 2OSRA 3OXLA 2QZ8A 1JIHA 3NWGA 3HCXA 2NRWA 4JI4J 4ES3A 1R9XA 1KNZA 2N3LA 2HFNA 4QZ9A 5J2DA 4DUZH 3ZTOA 2ZH3A 2AJ4A 1MW7A 4LSZB 3LSBA 4ECXA 4HI1A 4KAIA 2ZOMA 5C3EG 2LA6A 2WB1A 4YMOA 2QTWA 4ZHQF 2CJXB 1H72C 2CNNB 5KAFU 1RAFB 2KJ5A 2ZUBA 4IR9A 2B56A 4OJHA 1VYAA 5KFJA 2AV5A 3LDAA 3D67A 1HBOA 3K75D 4I1TA 4YFKA 1KJJA 2GW8A 4KHPJ 3Q23A 3TA0A 3QT8A 5KFQA 3DRSA 3OR2A 2VKRA 4KB7A 1JMTA 1RK5A 2HVQA 2FE9A 3ED5A 3QWPA 2XNRA 1KLMA 2FTRA 5CA7A 4JI8J 4NCGB 3DU6A 3KAKA 2GIRA 4YN4A 1CJUA 5CHGA 4RWXA 9ICBA 2HG4A 3PNIA 1IKYA 2YPYA 4BWMA 4ZVEA 3PX0A 5AXMA 3AXMA 2BHNA 4TLRA 2QT7A 1QAYA 1H3DA 3ETLA 2X7IA 4DZHA 4J0MA 2WZ1A 2R8GA 3K8WA 3GJRB 2O67A 4IWXA 5A2QW 5ALEA 2Y1RI 3DHWC 5F8LA 4NLSA 1IBLH 2KSWA 2YB1A 4KN4A 1FFVA 5D0HA 5DGBA 4LSAA 3RV3A 2VQEH 3R23A 4BCAA 1WSVA 1JXLA 4Y3CA 4MA0A 1VAJA 3K1ZA 7ICHA 3HM7A 1T11A 1A6SA 1NK7A 4TU8A 2Z8QA 4M47A 4ZVTB 1Q7LB 4JI7H 1M5HA 4PRFA 2BJEA 3K5MA 5IV3A 3RBDA 1TU0B 1JLBA 2ZTCA 5IC6B 3SCLE 1X8DA 2VUMA 3T9ZA 4M5DB 1D09B 2E2IA 3ISCA 4YB6A 1RBLA 1SB6A 3LP2B 4IDKB 2I9UA 2XI9A 3OLBA 2KRBA 4XYMB 2IRUA 3W5XA 2E5LF 4LVNP 3D2WA 2HMIA 1H2VZ 2FDRA 2JFKA 2VQDA 2R85A 4MFBB 3HOUG 3VGUA 2FE3A 2D9OA 4LF9J 3QRPA 3QIPA 2OPPB 2JXJA 2ZUAA 3QIDA 1Q0NA 2OMOA 3ETOA 2Z58B 1Q3UA 1KD1T 2W9BB 3LP0A 1EJWC 4RPYA 3D28A 3ITHA 3IA0A 5KFDA 1WG8A 3IR6B 2CDQA 4F3QA 5IILA 2W2MP 2OPRB 4EELA 2AU0A 4I6WA 2ZJ5A 1KDHA 3CF5Q 1KJ8A 4JWMA 1VDVA 2VONA 3JPTA 4OCZA 3H8WA 4DFDA 1WUDA 1YBAA 5CRXA 3KZIU 3ELHA 2XLIA 1CUKA 1VQKS 1FEEA 4B3MF 1H98A 3IDWA 4PWQA 2GLTA 3CO9A 3DRPB 2PEHA 2I9GA 2AIRB 1ZQVA 4KGVB 2B4PA 4ZLPA 9ICQA 1HW8A 2XLKA 3MPUB 5ALTA 4LVOP 2KD1A 4ZPTR 2DHSA 1OW5A 4HHJA 4LRCA 1RQNA 4PXBA 1N34F 1U6ZA 4B9NA 2W57A 2KL8A 4IQVA 3G86A 1QQ7A 4LF8F 2CQ2A 5KT4A 4P7TA 1PUZA 3HHKA 2DGVA 3JSMA 3DOKB 4JI3J 3R2CJ 4JI0H 4MJKA 3ONNA 3HMJG 4DV4H 5KFYA 1S97A 1N6QB 3LOUA 2HNDA 5F8GA 2WAQF 5HR6A 1FWIC 1YVFA 3PRBA 4DV0F 2GNKA 5ETOA 3K3PA 2ZC4A 1LK5A 2WAQE 3M6KA 1YJ9S 4X62J 3KLEB 2XG8A 4F4WA 2Y0SE 2C00A 4MFBA 1UVMA 1RGVA 3D1OA 3OR1A 2HIQA 4EFAC 3BE7A 1I5OB 4PPDA 3KXDA 4IG3B 9ATCB 3KFWX 1FJGF 3UD3P 5J0SA 4N8OA 2J0XA 1TV6B 1H2UX 2XCPA 4YMEA 2CPZA 3KFUF 1PJ5A 3GE9A 1OS5A 5L8RC 3LAMA 1B0PA 2HVSA 2GSEA 5EE1A 2CPEA 2GGPB 3TZXA 1ZHSA 3K5NA 2P9BA 2DH8A 3R5JB 2GMJA 4MT1A 2OLSA 2CADA 4Y2MA 2M0GB 3IAM9 2P35A 2BV3A 2HNZA 5F41A 3D2QA 4EZ9A 5DJBA 3OFEA 4RB1A 3L4JA 5KFBA 3MPDA 3VAKA 3SIPB 5A6WA 4GO7X 3ZC4A 2QMWA 2E9TA 2QX0A 1D8ZA 1KBUA 1FERA 1ZQYA 1AB8A 3BREA 2XZTB 4AT1B 4BGDA 1SFOA 1NO8A 5HSPA 1VRUA 1WC3A 2LKYA 3QGIA 1U26A 1RT6B 2BRLA 4LSNB 4USMA 1BQXA 4QZDA 1Z1ZA 3TARA 3CCES 1UCVA 5AI5A 4R0EA 3I9ZA 5HQMA 1YIJS 3FEYB 1ZRNA 3M05A 4ANCA 1Q3VA 4RDWA 1XMOH 4YXMA 3GTYX 2G9OA 3VAMA 8ICRA 3W65A 4USVA 3V6JA 2E5IA 5KG7A 5F8HA 1CSJA 4KITB 2YY6A 2Y0SD 1UW9A 5LMUJ 4PL1A 1FRXA 1HWIA 2XEXA 3SDEA 5KL8B 4F93B 3SCJE 3D2NA 1E4GT 2ASDA 2YVSA 2AYBA 2DBBA 4UUWA 1O12A 3RH4A 2DCUB 4KLHA 5T7LB 2YMLA 1JLQB 5AJ3F 3CP8A 2XSJA 1TWCA 4EX6A 4ELUA 3Q8LA 9ICTA 2G1HA 2ZZNA 4CGZA 1QM9A 3QFFA 3HHLD 4AYBE 2R86A 2M52A 1U8SA 1UETA 2JA5G 3G8TA 3C14A 5D3GA 2ZJAA 1N33J 4R5PA 5M2RA 4KSEB 1AQ6A 2KFNA 5LXRA 2JRSA 2NXUA 4TU9A 4RUHA 2RRDA 4LFAF 1VQOS 2W4DA 1S6QA 4RW7A 2LPEA 4JI4H 7ICVA 3KLFB 1S1TB 3N6XA 4QZVB 2EFPA 1UHUA 2HVZA 3BKTA 1GQEA 3UVJB 4FYYB 4DV2J 2XD4A 4M8LA 2XBPA 3U7JA 1OPIA 1RT3A 2HS4A 3UCUP 1LXNA 2V59A 2ZDGA 2FC8A 2KJVA 2ZH2A 2BJ9A 1S1VA 3J7ZT 3CMES 4JK1A 4ZOSA 5HLFA 8ICFA 2OGUA 4LR8A 2EG2A 1YBUA 1S99A 2UUBJ 1VQ6S 1ZQNA 1KHWA 4MV9A 3T9NA 2E8NA 1S68A 1VRTB 4IQMA 2LI6A 2V8PA 2FUG9 4WFYA 1ZD2P 5AKEA 2X1FA 3FKIA 1RA5A 2X1AA 1EJXC 1VKZA 4EO6A 5AK4A 2B8QA 3CCLS 5J2NB 7ICPA 1RHKB 3VAGA 5J2MA 4X4PA 4UAYA 1FO4A 4G1PA 2C2ZB 3TIIA 3B0YA 4WJ3B 1Q4RA 2F8EX 2R7QA 3DN9A 4B9VA 4WIIA 3CCRS 4CI0B 4ZOLF 3G6YA 3C1ZA 2K4HA 4FNIA 1AYEA 1PK1B 2WBMA 2BQRA 1XNSA 3M2UB 1TL7A 5AI8A 1AUDA 2LECA 1WTBA 4P72A 1B33N 3HSGA 4A46A 4YUDA 3ILIA 2IOFK 2I5JA 2DPIA 4DOCA 4WP3A 4AL6A 4QYZJ 1QTNB 1RAAB 5LSRA 4P52A 5IIKA 2MSNA 1WCNA 2FP4B 2QL9B 3CJKB 2GVZA 5AK6A 4FM9A 1VR6A 2O5DA 1BPZA 2A3VA 2EEYA 4NXMF 2E5SA 1F2HA 1RYRA 2VJVA 5D6GA 2M70A 1GO3F 1KEEA 2DT9A 2W6MA 1QAXA 4C4WA 2FHMA 2P6TA 4I50F 3C21A 3I96A 3IM8A 5ALWA 4DV6F 2X0SA 1ACMB 3NGDA 1X4FA 2GWNA 2I5HA 5IZHA 3JSNA 1NDKA 3BGLA 1L3VA 1K73T 1WR2A 6AT1B 3D1QA 2VQFF 4NM1A 4YFUA 3WC2A 2VIHA 2CZGA 4NXMH 2NLWA 4AQLA 9ICIA 3PW0A 4PG5A 2HHPA 1TL1A 3PW7A 3R6LB 2KRRA 1UBPC 3M7VA 1M90T 2HZAA 3U02A 3KYLA 2GIQA 4NLXA 4Q8FA 2VFSA 2VBWA 4RNFA 3EE3A 5HMLA 5HHHA 2F4VJ 1FKOB 2D74B 3DHXA 2VODA 2VF3A 2ADCA 5J2MB 2BEFA 2DRDA 5DDOC 2HOIA 4F92B 1H74A 2HYIB 3V4ZA 1KP6A 3DOMB 5A8RB 3MM8A 2ZKUA 3E0LA 2V8DA 4UB9A 5F0WA 3M6UA 1JXVA 4D3GA 3PY8A 4RAYA 4K4UA 1LOUA 3PN1A 4IFYA 2QLBB 2I8EA 4NLKA 2VPQA 1N61A 1IV8A 4DLEA 2Z4PA 3OTOF 2Y9UA 1RT3B 4U7CA 3RR8A 5DDRC 3RJGA 1RDRA 4DMZA 2B6AB 2R2SA 3BH7B 3CC7S 2R7LA 3MXHP 1CJTA 1NJIT 3IR5B 1YBQB 4O23A 3TQEA 5E3PA 5LMUH 4I64A 1EJSC 1DTTB 2CPFA 1WKLA 1T9VA 5AKGA 1ZQZA 5IINA 3CCZA 4L75A 5MLCV 1XIQA 3DOMA 5DQHA 3EZOA 3AD8C 4LIRA 3BQTA 2HHHJ 2NU7B 4OL8A 5L1MA 3FKBA 2E5JA 3LP1B 4X4NA 2HHWA 4TY8B 3WK9A 8ICWA 3VWSA 2Q09A 1ZQJA 4NCBA 2MA1A 5KT6A 5IWAF 1YDLA 5HI7A 3PSPA 1TKTB 4A8EA 2OPQB 4JBCA 2EH9A 3O2IA 4YB5A 2V6AA 3I4MG 3VF0B 1VLYA 2XYPB 3C6TA 4L6V3 1Y1WG 4ED3A 1GMWD 1Z00B 1S1XA 2AJQA 2QJ3A 2RRBA 3HOVG 1HYSA 2ZITA 2CFXA 4URQU 3M8QB 1Q46A 2YNFB 1N62A 1JLFB 4NLRA 3EW9A 3VPBA 4BC7A 3MM6B 3CMAS 2WF8A 1SIZA 5LXXA 1C0UB 2GZOA 2I6WA 4M5IA 3KG4A 1ZQWA 2WVDA 4ZKAA 1GMUA 3GYXB 2JFDA 4QZEA 3IHQB 2M0NA 4NM2A 1V97A 2YKNB 4ID5B 2VHLA 2EQYA 2QRRA 4Q2MA 3R97A 4FYWB 1EJTC 2VFRA 4FYDA 3E2EA 3P5BP 2HZVA 4AL5A 4BS2A 1HI8A 1CQIB 1WC6A 2VG6B 3CCWA 4OV6A 3OPKA 3N4MB 1PKUA 4RW4A 3EXCX 3U27A 4ZMMA 2VBXA 5L1IA 2OELA 1RA0A 2Z2YB 3DYAA 1NNLA 4G3IA 1GGOA 1SZHA 1U2FA 1N5SA 3W62A 4M94A 2B9YA 2IP4A 2XZWA 1FWCC 2UXBF 9ICHA 1H7WA 4F72A 1M1GA 3GYGA 4FPIA 4I28A 3OLAA 2DXEA 1FXLA 1TL4A 1AA1B 4PZVA 3HOXG 5KG6A 1P1LA 3S1TA 1HBUB 2F8KA 1L3TA 3NOCA 1U45A 3MGJA 2IHMA 1Y88A 1BPYA 4NE9C 2KVCA 2E1PA 4F0RA 3ILJA 2CWXA 4KFBB 5J0UA 4NV0A 3JYTB 3BZQA 4PYDA 3CSKA 1ZZNA 3H8MA 4AC7C 4IFVB 3AB4B 3JRWA 5B0BA 1KEJA 1GKPA 1ZM9A 2P50A 4LIWA 4ETZA 5ALMA 3UW1A 4FZLA 2VG6A 1D9FA 4X4VA 3C1YA 3J80U 3SSRA 2IRXA 1R31A 1MMNA 2BVZA 4ZH4A 2J8SA 1RK6A 1N52B 4YJ3F 3WX4A 3DU5A 1FDAA 3W7BA 2GJ2A 2GQCA 2P9EA 3CE8A 5DB6A 3RBZA 3DEEA 2W3RA 2N1RA 3I4PA 1SV0A 4ETSA 2LEAA 1QSYA 4G1IA 5ALLA 2CJYB 1UWBA 4PYAA 2JX2A 3GCWP 4QZFA 2MDAA 4UOHA 1TWFA 2ZEJA 1NSQA 3F5EA 4RW7B 5J0RA 2X1GA 2RU9A 4RU2A 4LF6J 4TYAA 2XWYA 4DR6H 2Y1IA 2WCXA 3FRZA 3F53A 4LRBA 3A8KA 4IFVA 5M2UA 1S1UA 5D3GB 4O3MA 3LW5C 4NCAA 3HBLA 1FEZA 4DV6H 4YCXA 3MDAA 1F9FA 3H4BA 2DISA 3GDXA 3BGFA 4MAKA 4GKJH 4C4RA 1U1KA 4I68A 2W04A 4YJ2F 1S1WB 1RT2A 1GX5A 5KFIA 5ETLA 1E9ZB 1A5MC 1VJWA 1ZA1B 1REGX 3OFHA 3IRWP 4OHYA 2CQ0A 4K2XA 4ANDA 1CBKA 3LO3A 1FI4A 3TA2A 2W6ZA 4DS4A 2GAGC 2ZTEA 4DG1B 4CNQA 5LL6b 2NRVA 2ILYA 1ZQHA 3BDEA 2B6AA 1VQSA 4RB2C 1KTQA 3L95X 4NLPA 7ICRA 5H9EK 4WZMA 1Y1WA 3DOKA 3PCOB 1XNRF 3RRHA 4O44A 1LW2B 2V34A 2F5GA 3NASA 2DCLA 3J81Y 2OCEA 3CGIA 5L1KA 2B9EA 2CKWA 5ETNA 2NYHA 4I2QB 5J0WA 1BPEA 1X0PA 4KRWA 5EOZA 2NPIA 1RAIB 2HFUA 1TA8A 3RTVA 2YZNA 4ED6A 3QMQA 2F1IA 2UXDJ 3R2DJ 2VZ9A 1M6YA 3KLIB 3DUGA 1K1SA 5C5JA 4AQYJ 3BDPA 4NA3A 1G2EA 3BO2A 2QK4A 1JLAA 1T3QA 2W6PA 2N82B 1Y5NB 4GKJJ 3M9MB 2QLWA 2RH3A 3HVWA 1U1PA 2VFUA 4LRDA 5K8PA 1NHKL 4LREA 4QIWD 4J9MA 2NQPA 2NVXA 3I5CA 2DNLA 4NI2B 1U0HA 2QG9B 2E7XA 4A8KA 1R9TA 4JI8H 4C80A 2HZCA 3D4JA 3M4XA 1T03A 5DO2A 3G4SS 2ZM6J 5J8YC 1YWXA 4TN2A 1XC9A 5E0OA 1MN7A 2VDHA 4TUSA 3AQPA 3R7NB 4WFZA 2IJRA 1B7FA 2HHUA 1M5VC 1RWPB 2E1CA 4ALZA 1GSHA 4XAKA 1WC0A 4B3SH 3VV2B 3EPIA 3GYNA 2F4VF 1UC8A 5C42A 4EZ6A 1HBNB 4JV0A 4OHXA 4NLDA 1SQFA 3L4BC 2D69A 5LMNH 2XB2D 3MDUA 3WK4A 3N97B 4OJPA 2UXDH 2J0WA 1BPXA 1CULA 4MA5A 5L9NA 4DWIA 3KLGB 2W54A 2OODA 4R8UA 1E9YB 2FPKA 3ETRA 3J7AN 3MZIA 3LP2A 2YYAA 5DRKA 3BBCA 4M5DA 1V3ZA 2JEIA 3KJVA 4ZI7F 1W96A 4UAVA 2IRYA 3PJ9A 2YMQA 4X84A 1CVJA 4DR3H 3OTOJ 3K58A 5AI0A 2UVRA 2V63A 5LMNF 5MAOA 1RZMA 2AF6A 3OVBA 4MV8A 1NRKA 1RE1B 4X66J 2LYHA 1XS9D 4Q44A 5DZ7A 3V6HA 1WNEA 3MECA 5J0PA 5FD5A 4CO5A 4MYTA 5JVGQ 2BYCA 4U9RA 4NLVA 1RBOB 1SEIA 5JVHQ 4DX6A 2UXCH 1FA0A 3A0HU 3C2LA 3BABA 3F2BA 4UATA 1SCUB 1VQ8S 5CCMA 3HPOA 2FPLA 3DXBA 3HSDA 3IV8A 1K6WA 3JTOA 1DAXA 3ISZA 3N5FA 1X6JA 3DMJA 1N32F 4A3DG 3IWXA 3EZ5A 1SH3A 4HH1A 3FBEA 3GB0A 5CYMB 4K59A 4RT2A 1HA1A 3EVMA 4B3RH 2RQMA 4NMXA 2NU6B 3GG1A 3S7RA 1T95A 2NUUG 4V1XA 1SZPA 1Z4OA 3JTNA 3UXNA 3JQJA 3GU0A 4W98A 4JI5J 1JB0C 1I7LA 1YRXA 2YH0A 4QWBA 1E6VA 5CA1F 2HRYA 2FQQB 1VBGA 1SYXB 1BC6A 1HHQA 4ECWA 4B3MH 2YQ1A 3T79A 4DCCA 1U1RA 4UAWA 2KKHA 1F3VA 1PO9A 3R5XA 1JJHA 2H54B 1ZXIA 7ICSA 3ETMA 2FZCB 3GFXA 5AKYA 4RL1A 2F3NA 4CO0A 3D66A 2DGZA 2FYXA 1M5OC 4ICAA 3ZZUA 2YWKA 5LJ5Y 4DV2F 3F5AA 1V51A 4C8YA 1CJVB 2F77X 2VQFJ 5GADI 2GWSA 4IH7A 3X3UA 4Q0BB 4BWJA 4UCTA 2OEMA 4DQSA 5KFZA 1PZNA 1UA1A 4ED5A 3CCTA 1LW0B 4B9LA 2EC2A 3EZUA 3CMQA 4KN7A 4Y65A 1QVFR 4P71A 1U1LA 3KD3A 7ICUA 2DHHA 1J6PA 4QOTA 2B6GA 1C0TA 4LSLB 3UM9A 2DO4A 5AK5A 2ZM6F 4QIWC 3H8JA 2R7OA 3GTGA 5LSOA 4I2JA 4P2HA 2CQCA 1GXLA 1RDFA 5EWGA 2ZJRQ 3ENVA 3N7PD 4NCGA 2FMSA 1VCTA 1VDHA 1KJ9A 4JWNA 4ZIVA 3P5TL 4EPDC 1SJ3P 4F7VA 2B4UA 4YB1P 2QYZA 3H0GG 3KMQA 1VC6A 5KFUA 3H2UB 1LKZA 1UPPA 2C1EB 2N3OA 2Z57B 1X42A 1GEHA 2FVSA 3CD5A 2D8CA 3UDEA 4EG0A 2R7RA 4RR5A 4WJBA 2KVSA 1OY9A 3CWJA 2B9XA 4CQDA 2A18A 3ORQA 3ENQA 3ZDCA 2LXUA 1SXEA 4Z7YA 7ICJA 1NKEA 4A3FG 1XNRJ 4PGQA 4DZDA 3IG0A 1TELA 3CCMS 4AL7A 3JXOA 3HD2A 4B9UA 4PZOA 1E6VB 2AQOA 1S8OA 4WGXA 3T1YF 2AJ2A 1IXRA 2HMXA 1SJ1A 7ICIA 2IMOA 2XGPA 4A8OA 4PWDA 5J0TA 4RBTA 5C2CA 4GO5X 4OLOA 3OV7A 5GAHU 1ULRA 4A2AA 4TLQA 1WKJA 3MMCB 4IQXA 1EETB 4CM0A 1Q8BA 1VRTA 4LRAA 2OO4A 3PX6A 2KHVA 4BC9A 4HDGA 2K89A 1SQEA 9ICMA 2J5AA 1HJPA 2AGPA 4QPTA 3FC4A 4RW9A 2ZM6H 3HJFA 4RNMA 1M0WA 1S1VB 1QTMA 3MMAB 3WBZA 1U6BA 1KL9A 1OYDA 4QW8A 2EVZA 3AJ1A 4KIRA 4HNUA 2F1JA 3K1RB 2QT3A 2WONB 6FD1A 1JNRB 1NKCA 3MBYA 1DRZA 3U1LA 3BYRA 2D1CA 4IOAQ 2ASYA 2MZJA 2VICA 1R7IA 3C2KA 2HNZB 2ALZA 2EI5A 1YKWA 4F0SA 2DGXA 1DFDA 4CC6A 1T7PA 3SQIA 5A2QY 2E9ZA 4P4OA 2MB0B 2VV5A 4I2PA 2G09A 4Y2AA 1REVA 5HJXA 2G1DA 2R92A 2PDAA 1F0MA 1GXUA 5EDWA 5KFAA 3NL0A 3RB3A 2YKMA 3EYZA 1XMBA 1FJ7A 1HHTP 3I9V9 5J1EB 3QYYA 4QIWF 3GR1A 2EKYA 4BXOA 5CJ7A 3TO8A 1CULB 4KKOB 1CRXA 1NPRA 3AFGA 1WCMA 3HXMA 3GTKA 1RAJA 4DQQA 1FWLA 2JVOA 4H54A 3AJ2A 4KO0B 5AI9A 3AXKA 2C3PA 4ZVGA 4C3MA 4LF7J 1RXWA 3LVVA 3RF9A 9ICLA 4ZOHC 3C28A 1RM6C 4UOCA 2HBKA 1N6QA 3AA9A 1S6PA 3MMJA 3KNAA 2W4PA 5U47A 2ZJ8A 3D6MB 4F4KA 1UEUA 3C16A 5A6PA 2ZZTA 2BKEA 2B63A 3QGPA 1S48A 2E9RX 4KIAA 3CJQA 5F9NA 1NAQA 1UZDA 4OLPA 4DZ6A 3IV6A 3CJ8A 4A8SA 1T03B 2DF4B 1X40A 4C0ZA 3QJJA 3T41A 1RACB 1SJ4P 3WKEA 4WF9Q 2Y3YA 1R0BG 4CQCA 2F4FA 4A8YA 2HURA 4KPCA 4O2BF 3VC8A 4YQWA 3TEGA 1ZQMA 2E1EA 2FVMA 3AMZA 4FBTA 2AGOA 1R8AA 5RUBA 2FJDB 3VHQA 4KGMA 1RYSA 4F0HA 1NOMA 1N34J 2ACYA 2BW7A 1PBUA 4LRFA 1ZHQA 1RXOB 1H0HB 2OD4A 4QBUA 5K4LA 1S77D 1C1BB 3N7SC 3M1YA 3S6JA 5HROB 4P4PA 3KOAA 3IXQA 5G0RB 4I2QA 2HOFA 1QD1A 4O0NA 1GFWB 3ET6B 3KUEA 8ATCB 2ERRA 3IAS9 4ILLA 4XRHA 4UZBA 3ISDA 1RAOA 4JI0F 1T9TA 1ZQFA 5GMKa 4AYBC 1SVDA 4RO0A 1RWWB 4EK2A 3DM2A 5C42B 4DU7A 1PVRA 1UMJA 1FX4A 5AT1B 3TFSA 3N79A 2JDJA 3VCDA 1TWAA 3ZZ0A 1G4CA 3ZD8A 2P8IA 3RZAA 2FK1A 1SB3C 3BKUA 1B04A 3JSMB 3TADC 4UUXA 4F36A 1S7HA 2YMPA 5KFPA 1TAQA 4MEYA 2JLFA 3NY0A 1OWTA 3LAKA 1R8BA 4RW6B 2LBOA 2OLWA 1RK8A 1XN9A 2GLEA 3G8QA 1N5YB 3IWNC 3T1HH 1K1DA 2K1RA 4YDXA 2CUYA 1OJ4A 1TL3B 2DFLA 4PL2A 4C11B 2HVDA 2Y9TA 2AQ0A 3CC4S 3EUB2 3PW4A 5HMYA 4DSIA 2FLNA 2XSFA 4Y0FA 1NZBA 3KTQA 3PR5B 4IR1A 1LWEA 2EFNA 3NMAA 3NBPB 2QFJA 2C2MB 4D3HA 4B3ZA 4CYUB 3GIPA 2G2OA 2LP4A 3NS6A 1SKUB 4LSXA 3CDBA 3VMMA 4WXOA 1BPBA 2Y0SF 3RUBL 4QZAA 3LK9A 1U47A 2DUYA 3DLEB 7ICGA 4PPXA 4KX5A 3L3FX 3MDWA 3RAQA 1N36F 3G8SA 4I2AA 4NXNJ 1RCOB 1FXDA 1RB0A 1Q8LA 2OYYA 3SAGA 4M5NA 1M1HA 4P9SA 1IJFB 2VC0A 2BJDA 1VQ7S 1SL2A 4IQTA 3BBFA 4ZPDA 3GIQA 3MEDA 3HWTA 1RHMB 3BV8A 1NJZA 3MCSA 4XYLB 5DB7A 2KXFA 1UW4A 4BHQA 4QZHA 1RWOB 3PO2G 2Q1LA 3C2MA 5T14A 4C65A 4WWSA 2MGZB 4J9OA 2DTJA 2WAQC 3W5YA 3KDNA 4JI1F 3AT1B 3R7BB 3DDHA 4CEXC 2ZH4A 2CW8A 1R43A 2JL9A 2RGVA 2HGMA 5KTQA 4O3PA 4DL7A 1SH0A 1XR6A 5FLMG 4US9A 4IQUA 8ICPA 5D49A 5D77A 3RW6A 2WHEA 3G87A 4X5VA 2V4QA 1Y11A 4JYAJ 4B6JA 4NX9A 4ZN3A 3BSAA 2HLUA 1RT7B 4ZLLA 2UZ9A 2OIHA 3JPOA 3MWDA 1XR7A 4GC7A 1VS3A 4LFAH 4OMFG 2WW8A 2CJBA 1UTAA 3K17A 3ZZZA 2ASJA 3D5MA 5TZVA 2C35B 3MMBA 2WYOA 1OSDA 2OHFA 2H5EA 4GKKJ 4R7RA 4BXXG 3POTA 4WU3A 5AXKA 5E41A 1I1GA 5IS2A 5HR7A 3VGTA 4X4RA 1SKWA 3BBBA 2BJ7A 2K8AA 1XDNA 2GV1A 3CC2S 1IXKA 4L73A 5LT5A 2IVYA 1JKHA 8ICQA 3RH5A 2G07A 4KH1B 5ALOA 3F73A 2PMZD 4YEAA 3V7LA 4F4ZA 5HO4A 2H3EB 2WVCA 3DV9A 3SMZA 4KKOA 5CA5A 3OJSA 5B0CA 4C9DA 3TAPA 2Q4TA 3I32A 3MKVA 1BHNA 1U48A 1ONXA 3W2WB 5G4DA 3UFCX 3RR7A 4EEQA 5B09A 4IQWA 3LGNA 1HQUA 4ED8A 1HL6A 1CJKA 2XCAA 3Q8YA 1S0VA 4GKKH 1WWHA 2B5JB 2DH7A 2WOMB 4DR3J 4E4TA 3UMGA 3A4TA 3G82B 2PBZA 4LVSA 5SZTA 4I7HA 3E3XA 4OYXA 2DXFA 2M8HA 1IKWA 3TAQA 1X5TA 3N0VA 1UVKA 5A8KB 4HR2A 2E5LH 5H9FJ 4F5PA 1S0MA 3V81A 1SIJA 4OJLA 3Q8PB 2ILZA 3OL8A 3MFIA 2WSFC 3DRRB 1IBMH 4XDDA 3L2PA 5BYQA 1EZ1A 4CH7A 3CQZA 3K7RA 3IMQJ 2VOBA 3OTDA 1TZ0A 4XTTA 1IR2A 1S9EB 3ULHA 1TAEA 1OPZA 1XMOF 9ICKA 3AL0B 3VZHA 3JTPA 3DDNA 2UXCF 3MTKA 2D3ZA 1OY6A 3TX0A 1EJ7L 3C29A