4F4WA

Y-family dna polymerase chimera dbh-dpo4-dpo4 #1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
b'MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase IV
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
total genus 113
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4wA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f4wA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4wA01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f4wA04
3C2KA 5KG3A 1U45A 2CKWA 4HKQA 4YVZA 1XC9A 4JUZA 4RW7A 7ICUA 3TVKA 4I7FA 5KT4A 2XI3A 1IKVA 4EZ9A 2NRVA 4DWIA 4FBUA 3BDPA 4M6WA 5KFTA 1HNVA 2PXIA 4U7CA 1QSYA 4I2AA 5HHIA 1ZQDA 3ITHA 3G6XA 2WOMA 3UXPA 1ZQLA 9ICQA 4MEXA 3RH4A 4K4UA 3BJYA 4RQ4A 4RW4B 5IIMA 3MFHA 1LWCA 4M9NA 3DDKA 4JV2A 1MQ3A 1NK4A 1IKXB 1BGXT 4NM1A 4EYIB 4I29A 5J0RA 2KN7A 4DF4A 4TLRA 1N4LA 3C23A 3RJGA 3JPQA 2XCPA 4I2PA 1GX5A 3C5FA 4QZDA 4PPXA 9ICPA 1B22A 5IIOA 1SV5A 2MUTA 1REVB 1UWBA 4DO9A 4DEZA 4KLGA 3ZDBA 4YMMA 1SZPA 1ZQCA 3RRGA 1ZQZA 4M9HA 9ICLA 1GX6A 1TKZA 4RQ7A 2ZUBA 3Q8SB 3BSCA 4DL5A 3QEBZ 3QIDA 5I3UB 3KLGB 4C8NA 4MH8A 4YMNA 3JPPA 5EWFA 4QW8A 4B3OA 2YKMA 1RT3B 3DI6A 8ICQA 2UVRA 1KLMA 1S1TA 5K14A 5C24B 4EBCA 1KHWA 3CJ4A 3Q8RB 3JPOA 4MFFA 5F8NA 1ZQGA 4NLRA 4Q0BA 4UBCA 1C0TB 5KFVA 3C6TB 1ZQRA 1RTHB 1JLQA 5C25B 4F5RA 3V7LA 4PGQA 4PHDA 3LWLA 5J2DA 4KLMA 2FMPA 5J2MA 4NLGA 8ICIA 1TVRB 1HNIA 1S1VB 2YNIB 2XO7A 3V7KA 4B9SA 4M9LA 4KLQA 1TKXB 2W9BA 1TKDA 3LALA 1S6PB 4UAYA 2R2RA 2RF2B 3DYAA 5L1KA 3PMNA 2IMWP 2FVPA 8ICRA 2W9MA 4UB3A 2RKIA 4I2FA 5F8JA 4TURA 3T5KA 3PO4A 3OL8A 3OHBA 3RAQA 2FPLA 4KLJA 1RT6B 1MC8A 2WRMA 4QZCA 5D46A 2C22A 3RJKA 2HAIA 2PFOA 3PX4A 4QW9A 4RPZA 4I2CA 4ECTA 1NJYA 3LAMA 3CDWA 2VA3A 1T4GA 3LP2B 1WCNA 4J9KA 4O3SA 4QZ9A 3CJ3A 8ICYA 2XC9A 2IBKA 3H8SA 1DTTA 3I5AA 3C5GA 2HHSA 1OS5A 1RPLA 4KHMA 3IRXA 2BQ3A 4LQ3A 4R65A 2R8IA 3MEDB 5KT2A 2BE2B 5KFMA 4G1QA 4KKOB 1ZTWA 1S1XA 4WZQA 4O4GB 1L3TA 4GLXA 4ED3A 4M04A 1J5OA 1NK7A 5HHHA 1FKOA 2BQUA 2VG5A 2HNDA 5KFAA 3DMJB 4R8UA 2BHNA 4K4HA 2JZBB 1L3UA 4I2GA 4M0AA 4F4KA 4IRCA 5C5JA 5KT7A 3H7IA 3MR6A 3I5CA 3ICLA 1ZQNA 4IG3B 2BR0A 2BCVA 4RPXA 9ICKA 4DLGA 7ICMA 3PJWA 4IFVA 4RNMA 4FO6A 4PQUA 1LW0A 4P4OA 1TL1A 2B5JB 3QYYA 3THVA 5D4BA 4IH7A 5EOZA 4EO6A 3KLVA 3PMLA 2NRWA 2V9WA 5J2CA 3MEGB 4NXZA 2ZE2A 3CIZA 2IM0A 5DDMA 3KHRA 1BPYA 2ASLA 4NCGA 3FYHA 5J2EA 1WCLA 4ED7A 4M9GA 4QPXA 5HLFA 4EBEA 1TK5A 2HW3A 4PGYA 4K4YA 4GXKA 4K4ZA 2PI4A 5J2AA 3D5MA 1PZNA 2XWYA 5KFBA 4K4SA 3V72A 4O3NA 7ICVA 4B9VA 3M8PB 1SUQB 3IGVA 3PHEA 3NGDA 4TXSA 1Z4UA 5DBCA 4ECWA 1N48A 3MDAA 3T19A 7ICPA 3CJ0A 3RB3A 4DOCA 5DGAA 2UUTA 4XO0A 4ECZA 4DL2A 5DDYA 5DQGA 3PY8A 7ICOA 1N6QA 3LAKA 3RBDA 3ETLA 5J29A 3TFRA 3TAPA 1D8YA 2B6AB 3KJVB 1T8EA 5HROA 4O5KA 5KG6A 1C1BA 2HVIA 1KRPA 1QLNA 1S6QA 2FJVA 2YNHA 2ZTEA 2AGPA 3H5YA 4YD2A 3GIJA 4IRKA 1ZQHA 4Z6FA 5KFSA 5J0PA 4Q43A 4UAWA 1ZQTA 9ICFA 3I0SA 4IDKB 2YNGA 5HMMA 4H4MA 1RTDA 3V6DB 4YR2A 2BKEA 4FS2A 2LYHA 3NAIA 2IC3A 4O4RA 4I2HA 4ZPCA 1BPDA 3KK3A 1ZQSA 3BQTA 4IQWA 4NLPA 3C2LA 3QLHA 1LB2B 2XY5A 1EETA 4KBIA 3HVTB 3V4IB 2R8GA 1T7PA 1BPBA 1S0NA 1Z00A 3LP1A 3ZDCA 4ZVEA 1HUZA 3QZ8A 1X2IA 2BCUA 3M9OB 1LWFB 2M9NA 5KFLA 3ISDA 2BDPA 3DM2A 1DLOB 2ZD1A 4M2YA 2IM3A 4NZ0A 1T05B 4XPCA 2IAJB 3V6JA 1TK0A 3DOLB 1COOA 3ISBA 9ICXA 1ZTTA 3SI8A 3LK9A 2ZUCA 9ICRA 1JLEA 4J9MA 1ZYQA 2D3ZA 2VG7B 4ED0A 5J0XA 1S0VA 3KLIB 4NLXA 4F5NA 3HVAA 2PFPA 3C1ZA 1BQMB 5F9NA 4I2IA 7ICIA 3JSMB 5IILA 4TYBA 5CWRA 2O5DA 2W9CA 4ZP9A 4TUSA 4IOBA 4XUSA 1ZETA 5KTQA 2ISOA 1JLGB 4NLVA 1U09A 3PJXA 1C1CA 1NK6A 3HX0A 3JYTA 4QWAA 3DLEA 5HMLA 5BOMA 4KLIA 3TAMA 3OJSA 3OSNA 5KG0A 4MFAA 3SYZA 1XWLA 5DKWA 5CR0A 3RB0A 3JPSA 2ZJAA 3N4MB 2ATLA 4KV8A 4RW6B 1HQEA 4J9NA 1XR7A 1JLBA 5I42A 3EWAA 3ZDDA 4TY8A 2R2UA 3RH6A 4O44A 4B9NA 5KG2A 2Q0ZX 1I6JA 1ZQAA 4ZPAA 1QE1B 4Q45A 5J2JA 9ICBA 3IS9A 4XPEA 4PWDB 1TV6A 4KTQA 4P2HA 4IR1A 2GC8A 3ZD8A 4WFZA 4KLEA 1JLAA 4IG0B 2FMQA 1LWEA 3EPGA 3PR4A 2UUWA 2A1JB 3M8RA 4M95A 1LW2B 5F8LA 2FJWA 3NL0A 4F3OA 1RTJA 4LVSA 5J2BA 1RT1A 1IKYA 1C0UA 2HNZA 1IXRA 4CCHA 1JLFB 1ZQKA 5F8MA 4ID5A 5KFUA 2AQ0A 3OL6A 9ICJA 1DOQA 3MTKA 4RW8B 3EW9A 1YVFA 2OPQB 4DG1B 5IINA 3CJ2A 4KLDA 2UVWA 5HP4A 1RDRA 4WE1A 4RQ5A 1ZQMA 4IQVA 3IG1A 3AU2A 3PO5A 5IIKA 3DOKA 4MFBA 1JKHB 1R0AB 5J2PA 3KK1B 5HP1B 2HNYA 2E9RX 1HMVA 7ICTA 4TYAA 4QZHA 3QO9A 4DL4A 3DRRB 4KSEB 3I0RB 4ECQA 3KNAA 4MFCA 1TL3B 2HVHA 3LDAA 3EPIA 4BXOA 3C6UB 3BGRB 4K4XA 5DB7A 1JXEA 4RW9A 3BQ2A 2AX0A 4K4TA 2VG6B 1KFTA 5J0TA 2HWIA 1REVA 4IR9A 3T1AA 8ICMA 2D3UA 4R66A 1K1SA 2JEFA 5CYQB 5EWGA 5HBMB 4C8MA 1SH0A 3NBPA 3H59A 1RT7B 4KLHA 3E51A 1BVSA 4EEYA 1BQNA 3G86A 3GV5B 2JC1A 7ICRA 4ZPBA 4UB5A 3SZ2A 4R5PB 3PX0A 4DSJA 3FFIB 1NKEA 3H40A 3BR9A 2BCSA 1Z3EB 1EP4A 3DLKB 3KHHA 1NNDA 1RYRA 3PW7A 3UQ0A 4BGDA 3N6NA 1T3NA 4RW7B 5F8GA 5CHGA 3H98A 2JEJA 1RXVA 2HMIA 7ICJA 5J2IA 4J9LA 4I7FB 1S76D 1IKVB 4QZBA 5C25A 1N5YA 1SKSA 1S1UA 3DRSB 4M6WB 1HNVB 5IIIA 3FQLA 4YR3A 4ZPDA 3AUOA 3ITHB 9ICTA 1NOMA 1S1WA 1TVRA 4RNHA 2WOMB 5C42A 1RA6A 3ISND 4F4YA 4H4OA 5J1EB 2FMSA 4NLKA 5J2NA 5TZVA 2BRLA 3NMAA 4F93B 9ICUA 3HKWA 4O9MA 1UA0A 2I5JA 4DQPA 4YD1A 1LWCB 3EYZA 4KLOA 3SV4A 3CO9A 1TKTA 2E9ZA 5J2FA 1IKWB 9ICMA 4P4PA 3M8QB 1RT6A 2HWHA 4I2PB 3HP6A 2KFNA 5CB1A 3UR0A 3E01A 1NJWA 1SV5B 3C21A 2MUTB 1SKWA 4NY8A 2JLEA 8ICUA 4IRDA 1TV9A 1VRUB 4R64A 5KT5A 4DFMA 3Q8MA 3BSNA 4DOBA 1HPZA 5L1IA 4UBBA 2BGWA 1RT2B 7ICHA 1KFDA 3UXOA 3RB4A 4LZDA 4B3OB 2YKMB 4UB4A 4PHPA 3K75D 3MGIA 2FJXA 3DI6B 1KLMB 5DB8A 3MECB 5IIJA 3PW4A 2ILYA 4Q0BB 2NRTA 4PUOA 3V81B 3NKYA 4RQ8A 4YFKA 2H5XA 7ICFA 1HYSA 4DOAA 5J2MB 1K1QA 3DLGB 4ED1A 1HNIB 1KFSA 3TAQA 4YQWA 1U49A 3K4GA 3HT3A 4B9LA 3B0YA 4Z6DA 9ICIA 3UXNA 1NHVA 1A77A 2BCRA 2W9BB 3GFKB 4ED8A 4J9PA 3MR5A 4F5QA 3DYAB 2B5JA 1UT8A 4IQTA 2D41A 1RAJA 3CWJA 4MF2A 1S9GB 4ZP6A 4ECXA 4GXJA 2AGQA 1L3VA 3OGUA 1UNNC 3KLFA 1ZJNA 4NLUA 3GIMA 5D3GA 5KFXA 4TUQA 2PI5A 4RNNA 3M9NB 2OPPA 2FVRA 3KLEA 2YKNA 1SUQA 2RDIA 1ZQUA 7ICSA 1DTTB 1MMLA 2HHWA 3ISNC 3V7JA 2E9TA 3IRXB 1XSLA 3NTUA 3H4BA 4RPYA 1CSJA 2ZJ8A 5KFGA 3KLHB 4EO8A 2WB4A 4F4ZA 1S1XB 4K50A 1NK8A 1JLCB 2KFZA 8ICGA 1J5OB 4NLQA 1FKOB 2VG5B 2HNDB 1RZTA 4BWMA 4R8UB 1BPXA 2Y1JA 5KFDA 3LP0A 2ZTDA 3BREA 4MK8A 3C2MA 5F8HA 1U48A 1VRTA 2ZUDA 4IKAA 5EUHA 4IFVB 8ICEA 1JN3A 4PQUB 1RT4A 4RNOA 4NLOA 1LW0B 3MGHA 1QAIA 1S97A 4IH6A 1W25A 3H8WA 4O3RA 2ALZA 2W7OA 4DLEA 4MKAA 4LSNA 4BWJA 1S9EA 5EWEA 2OH2A 3M8SA 1RTIA 4UB1A 2WK4A 4WYLA 2OPSA 4LSLA 3CDEA 3HVTA 3V4IA 1ZQWA 1S48A 4QZGA 2R2SA 9ICHA 3GV7B 1N56A 9ICOA 3DRPB 3MEEA 4F50A 4P4MA 3Q8PB 8ICLA 4R0EA 3IHQB 4GC6A 4RT2A 1T05A 4FBTA 3RJHA 2DPJA 1RT5A 1EXNA 2FVQA 2AQ4A 3OL7A 3KK2A 3GILA 5J2HA 2WONA 4Q8EA 3QIPA 4TY9A 2NRZA 4I2BA 5DBAA 3H2LA 4Y2CA 1N6QB 4B9TA 3HW8A 3E2EA 3CJ5A 4DSEA 2YNFA 1T03A 7ICEA 5HROB 4KE5A 4IQXA 1JMSA 1C1BB 8ICOA 3RJFA 1S6QB 1HQUB 2YNHB 1SL0A 1S10A 3QGHA 4IFYA 4ICLA 1QAJA 4NRTA 1Y88A 4Y2AA 4M47A 5CYMA 2IM2A 1ZQYA 2YNGB 3N6MA 4H4MB 4RQ2A 4XQ8A 1D8LA 5KFYA 3FQKA 1NJXA 2DPIA 4IH5A 2IC3B 5J0OA 2J6TA 2HHQA 4DFPA 3TI0A 3KK3B 1QE1A 2OPRA 4TN2A 3QLHB 2I1QA 3KMQA 1S0MA 1Z00B 3QGGA 4IQUA 3LP1B 4I2QA 4IG0A 4ELUA 1MSWD 3KTQA 8ICKA 4NLWA 2A1JA 1QUVA 5DG7A 1AROP 1FK9B 3DM2B 2B21A 8ICPA 2ZD1B 4YP3A 2R2TA 2VANA 3JPRA 2NRXA 3OLBA 1X9SA 2IA6A 4KFBA 4I27A 2VA2A 4O3PA 1U4BA 2GIQA 3RH5A 9ICGA 1SL1A 1TAUA 2CJQA 2QE5A 5KFWA 1XU4A 2AJQA 4KLUA 4I2DA 4DG1A 1MU2A 4RUCA 2AGOA 3RR8A 2W9CB 4B9MA 2ILZA 5J2QA 4WYWA 4YMEA 4UB2A 5KG1A 2F1IA 1C1CB 4DQQA 1S4FA 4K4VA 1RXWA 3SV3A 4ZH4A 3DLEB 4DSIA 3TAMB 2HHTA 2BANA 2FLNA 3PW0A 4MF8A 4TQSA 1T94A 1MQ2A 4O3OA 4QZAA 3H4DA 4ECSA 1JLBB 5KG5A 2JEGA 1DTQB 4ZHRB 2QV6A 4TY8B 4O44B 3Q8KA 2VG6A 3IS9B 1NK9A 1FKPB 5KFIA 4O5EA 3RR7A 1TVAA 5DLFA 3MR3A 3HPOA 4RW4A 1JLAB 2BRKA 1LWEB 3QE9Y 1ZQIA 4ELTA 3OSPA 4KAIA 1RT7A 1IKXA 1D9DA 4KHRA 4GC7A 4URQU 5DGBA 2B43A 4XRHA 4R5PA 4KO0B 2V4QA 5KFCA 4KB7A 1RTJB 3ISCA 3MBYA 5EDWA 1RT1B 2FPKA 5KFQA 1C0UB 2HNZB 5KFKA 2WTFA 3DLKA 3OHAA 2AWZA 4J9RA 5KFPA 4ID5B 4DFKA 3PX6A 5KFNA 3PNCA 1KEJA 1D9FA 3DRSA 4ZMMA 5KG7A 4QWBA 3QEAZ 3RBEA 4KLSA 2W8LA 7ICKA 3BSAA 4WE1B 2JC0A 3IG1B 9ICNA 3HHKA 3DOKB 4MFBB 3GDXA 5J1EA 4NLTA 4Y34A 5I3UA 3Q8LA 5FDLB 5J2PB 3KLGA 2ZTCA 2HNYB 8ICHA 4MEYA 4DL6A 1UT5A 8ICAA 1HMVB 1H38A 1RT3A 3QO9B 3RJJA 5C24A 4ED6A 3N6LA 1HARA 2FVCA 4YR0A 5CP2A 1C0TA 1IKWA 4RNFA 3GIIA 5L1JA 3C6TA 5DB6A 1RTHA 3FRZA 4BXOB 1KSPA 3M8QA 4HYKA 4YXJA 4EZ6A 2HHUA 4Q8FA 4RW9B 2GIRA 2MAXA 1D0EA 3OJUA 4F91B 3MFIA 1S1VA 5J0YA 3KHLA 2YNIA 1KDHA 1TK8A 3JPNA 1BPEA 1VRUA 1TKXA 1JIHA 1HUOA 1S6PA 2RF2A 3NBPB 5J0UA 1IM4A 2I9GA 1NK5A 1BQNB 4F5OA 1XR5A 5KFZA 1RT2A 2WHOA 4DF8A 9ICAA 3V6KA 4EYHB 4JV0A 3MDCA 2P6RA 2BPFA 3SFUA 3TQ1A 4MK9A 2V4RA 8ICTA 1UA1A 1RYSA 3T5JA 4PH5A 1C2PA 3Q8QB 3RJIA 1EP4B 3MECA 2FVSA 1UWBB 3V81A 2HMIB 3LP2A 5KFOA 4JWNA 5KFJA 1N5YB 1S1UB 3H8JA 4DS5A 4UQGA 8ICXA 3FSIA 3H5UA 2EC0A 3DLGA 7ICLA 1TKZB 1S1WB 7ICGA 5C42B 4WFXA 7ICNA 4H4OB 3SFGA 1ZQBA 2ISPA 5J2NB 1KHVA 3MEDA 4G3IA 2BE2A 2I5JB 5J2KA 4KKOA 8ICZA 4DSKA 1S1TB 5K14B 5F8IA 3UPQA 4RZRA 2OWOA 4URGA 4O4GA 2R8KA 1TKTB 4NLDA 4DL3A 2XY7A 4ECUA 4RQ3A 1S9GA 3G6YA 3G6VA 4DQIA 4PHEA 1JLQB 3D28A 3DMJA 1D1UA 3JPTA 1U9LA 1SKRA 2JZBA 3RJEA 3E01B 4JWMA 3BSOA 4F5PA 4H54A 4YXMA 5T14A 2AU0A 4IG3A 4QZ8A 3CVKA 2W9AA 4I28A 3UQSA 4RQ0A 3ZDAA 1TFRA 2ZJ5A 1HPZB 4K4WA 4MIBA 4JV1A 1S77D 2RKIB 2BCQA 1NKCA 3QZ7A 1CUKA 3MEGA 4DQRA 1NHUA 1TQLA 3KLHA 4ZVFA 4DSLA 1S0OA 2FLPA 2GWSA 4PHAA 4QWDA 3T5LA 1QSLA 4U6PA 5CJ7A 2WCXA 2UVVA 1JLCA 1X9MA 1SH2A 4O5CA 4PUOB 2F1HA 3GV8B 1B43A 1HYSB 3M8PA 1ZQVA 1ZQXA 4K4IA 4WXOA 1L3SA 3H5SA 8ICFA 4KLLA 3PR5B 2VA8A 4R63A 9ICSA 1U47A 2FLLA 3LANA 2FPMA 5DLGA 3H5XA 4G1QB 4XA5A 3MR2A 9ICEA 4DQSA 2B6AA 4TUPA 3KJVA 3I5BA 3PVXA 3HVWA 3ZDEA 4F2SA 1NJZA 5KFHA 2J6SA 4ECRA 2R8JA 2F8EX 5DQIA 2V0NA 3KLFB 2JEIA 5KG4A 4URSA 4KN4A 2IJNA 5D3GB 2IM1A 9ICWA 8ICBA 4IDKA 3HWTA 3DRPA 3EZ5A 2KZMA 5BPCA 2OPPB 5L1LA 4ZVHA 3V6DA 4RQ1A 4DL7A 1ZQPA 4I2EA 3KLEB 1XSNA 2YKNB 9ICVA 1TL1B 4KLTA 2IHNA 3RAXA 5KFRA 4YG2A 5JXSA 2J6UA 4E0DA 5KFEA 2ZE2B 3T3FA 2Y1IA 3AU6A 4NLNA 2D7SA 4NCGB 2C2DA 5DG9A 4KLFA 1CEZA 9ICCA 3TARA 4M9JA 3KMSA 4F4WA 1ZQQA 5HLFB 3EZUA 4WFYA 1LWFA 4KMUA 1DLOA 2BQRA 3UPFA 5F9LA 4YN4A 1HQUA 4F92B 2IAJA 2P6UA 3DOLA 1SH3A 4NLYA 4O0IA 3RRHA 3LP0B 1JXLA 5J0SA 1V9PA 4WXWA 2VG7A 4Y3CA 2W8KA 3KLIA 3CDUA 1BQMA 1VRTB 3UDLA 4RUAA 3JSMA 4Z6EA 1RT4B 2C28A 2I1RA 1RA7A 4B9UA 1QSSA 4KN7A 1XR6A 4NLSA 4FS1A 1KTQA 1KLNA 1JLGA 5CA7A 3LWMA 4LSNB 1S9EB 2C2EA 1RTIB 4ECYA 3GIKA 4NM2A 3IN5A 2HHVA 7ICQA 2BPGA 2OPSB 4LSLB 4ZP8A 4JK1A 3QGIA 2XGPA 1BPZA 2UVUA 3T5HA 3V6HA 3PW5A 4O3QA 1NK0A 3TANA 8ICSA 3MABA 3I0SB 4BDPA 2XI2A 3MEEB 1FK9A 3VQSA 4LQ9A 4DS4A 4DFJA 4RW6A 4C8KA 4NRUA 1RTDB 8ICVA 3PZPA 4ECVA 3PV8A 4X5VA 4KITB 8ICNA 4MIAA 4NLZA 3OL9A 3IM1A 2W7PA 1ZQJA 5DG8A 4DSFA 1XS9D 2BPCA 1RT5B 2DFLA 1XSPA 3KK2B 4QWEA 4QZFA 4PWDA 1EETB 2WONB 5KT6A 3QIPB 1X9WA 1XO1A 1TP7A 1TAQA 5BOLA 4ELVA 4NYZA 5HNKA 4MK7A 2IJFA 1QTMA 2YNFB 3KOAA 1T03B 5DB9A 3GQCA 1LW2A 4Z6CA 4F8RA 5KFFA 5L9XA 3MF5A 2F1JA 8ICJA 5KT3A 4ED2A 3M9MB 1ZQFA 4IFYB 4ICLB 5J0WA 3NAHA 3TFSA 5D49A 3BQ1A 1JLEB 2IHMA 3PW2A 5CYMB 1JLFA 4F2RA 3RB6A 4C8OA 1HJPA 4RW8A 2RDJA 3UQ2A 2OPQA 3RTVA 8ICCA 1DTQA 4ZHRA 1A76A 2ASDA 4RT3A 4K4GA 2ZKUA 1WNEA 3KHGA 2OPRB 1FKPA 4C8LA 4WZMA 1JKHA 1R0AA 3KK1A 3JYTB 5HP1A 8ICWA 3B0XA 3OLAA 3IGNA 3FDSA 4RU9A 5DBBA 4I2QB 4J9SA 2PFQA 4UAZA 5J0QA 2KZ3A 4J9QA 2C2RA 3DRRA 1JX4A 1S49A 3BQ0A 3I0RA 1L5UA 4QZEA 4Q44A 4KV8B 3ORYA 1HQEB 1TL3A 1S9FA 4J9OA 4EBDA 4QZIA 2XY6A 4ZP7A 4KO0A 5I42B 4YCXA 2XCAA 3N97B 4YMOA 3C6UA 3BGRA 2KZZA 3ZD9A 1ZQEA 4KFBB 1ZQOA 4QWCA 5J2GA 1ZJMA 2KTQA 4GXIA 1NKBA 1LV5A 2P66A 1TV6B 2HHXA 4OL8A 1SL2A 2PFNA 4ZVGA 5CYQA 5HBMA 3C1YA 1MU2B 2ASJA 1DGSA 5DQHA 2R8HA 5JUMA 5J2QB 4TQRA 4LZGA 4M94A 3GYNA 4RQ6A 5FDLA 4MKBA 4F4XA 2AX1A 2XGQA 1C7YA 3FFIA 2BANB 4PGXA 4I2JA 1IKYB 4X2BA
chains in the Genus database with same CATH superfamily
2UZ9A 3OTBA 3AN1A 3OPXA 2DWCA 2GGPA 4DPUA 2XYHB 2KP7A 1FJGH 4BUGA 4FBUA 3BDPA 2EFNA 3RV4A 1HNVA 2ZFHA 4U7CA 3EXCX 4CLSA 4A3IG 2YY3A 3C66A 2QO3A 1ZQLA 4KJIA 4MEXA 3RH4A 4YY3H 2J9CA 4MJKA 5ALRA 3K7RA 3C46A 2E5GA 2UXCF 2MU2A 3TQEA 1SWWA 4QIGA 1A5OC 3HDSA 4A3MG 3PJ9A 2Z00A 1IKXB 4EGQA 3HLUA 4FYVB 1FJEB 1FRXA 1PILA 2QYZA 3MD3A 4NM1A 3SSQA 4DF4A 5A0YA 2CQPA 3C23A 3RJGA 1G6BA 3J7ZT 5CH7B 2XCPA 1WUDA 1ONWA 1GX5A 1HWKA 3ENVA 6FD1A 1TFWA 9ICPA 1JJ4A 4F26A 2J0QD 1TELA 2VBYA 3QQCD 1NCLA 1R8HA 2Z8QA 3RYLA 1LQ9A 3DRXA 4Q0YA 4ILLA 3ORQA 3AOBA 2RB7A 3Q8SB 4RQ7A 3A0BU 3N40P 3BH7B 4HDHA 3BSCA 2ZIUA 4I64A 4DL5A 1ELOA 3QIDA 4RDWA 2JRZA 1EHWA 3OOQA 1FRIA 3TZXA 2IVMA 5A8WB 3L3CA 4YMNA 1SCUB 5ALQA 4QW8A 3GSIA 5EE3A 3ED5A 2IOFA 1S57A 3IBCB 3Q8UA 1E9YB 4B3OA 4X4UA 1PK8A 1D09B 2WB1C 4EWTA 4M5IA 4EBCA 2LMIA 1HR0H 2PN6A 3Q8RB 1U1MA 4MFFA 3TO8A 5F8NA 1H3DA 4NLRA 3MM8B 3AEVA 1WJ9A 3PXGa 2MXYA 1H0HB 4CQ1A 5CRXA 2VDIA 3TUIC 3IC1A 3SBMA 2FZGB 2GW8A 2KJ8A 4QJVA 3QNMA 1KRCC 1TVRB 2HVZA 2HURA 4K59A 3DGVA 4W4MA 1S1VB 4J91A 4OD0A 4NXNH 4B9SA 4KLQA 5CAAA 3MM9B 4X4PA 1S6PB 3WKBA 4UAYA 4LRFA 3Q8VA 3S01A 1U1NA 2WAQC 5L1KA 3PMNA 2IMWP 3DYAA 2YS7A 2DUYA 8ICRA 4UB3A 3FGVA 2DKZA 2JR5A 2KRBA 2NVYA 1Q81T 1RJPA 4WCEQ 4C5YA 3SCJE 2G4BA 2DTJA 1Y3JA 2VFVA 2WRMA 5GTIU 4GO7X 3ETHA 2ATCB 1W26A 3EGZA 2PFOA 4QW9A 4RPZA 1GQEA 3LAMA 1PAEX 3HSJA 4IQMA 4J9KA 4O3SA 1AUVA 1N5XA 4LF9F 1S6UA 3IWNC 3H8SA 1SI9A 1DTTA 1OS5A 2Y0SA 1CPZA 2MZQA 1ZPWX 1J5EH 1V3RA 1EB0A 3W63A 2GS8A 2C35B 1SGGA 4G1QA 3R5DA 2AYGA 1ZTWA 1F2GA 1L3TA 5JJBA 4GY7A 4M04A 4KPYA 1NK7A 2LQ9A 1RQ0A 3B82A 1Z1BA 1DQAA 1XO0A 3NQBA 1K47A 1A0OB 3QXGA 2DL0A 1GSAA 4DX5A 4I2GA 1ZA2B 2GMJA 2KXHA 2YS6A 2FUG9 3AQPA 1IBLH 3I5CA 3O0FA 4CDGA 5GMDA 4DLGA 2JOQA 4GIBA 1PK1A 2A0FB 2W1BA 4IFVA 4RNMA 4DMZA 1YZ6A 1MLAA 3AHPA 2M70A 4P4OA 5AM3A 1BY9A 2B5JB 2QN6B 2XG8A 3QT6A 3THVA 2FPGB 2P9BA 1F0MA 4ZPTR 4IH7A 5EOZA 4EO6A 3OTOH 3PMLA 2V9WA 5J2CA 5FLXW 2W01A 2Z2MA 2ZE2A 2Y8WA 3IM8A 4QU6A 3I4NG 1BPYA 3CJRA 3FYHA 3MI7X 1WCLA 4C0OC 1FEHA 2CNKB 3RF2A 4QPXA 4IO1A 1EJ7L 1Q3VA 3E0FA 1PZNA 2XWYA 2K4HA 4LMYA 4B9VA 1P9YA 1KTVA 3D2NA 4TXSA 4DR2F 7ICPA 1WG4A 2PVPA 2IMRA 2Q66A 1PVPA 2YZGA 1YKWA 4DOCA 5DGAA 2MKIA 1EZZB 2UUTA 4EU0A 4YAJB 3DU6A 5DQGA 2R7QA 2WF7A 1PVQA 5FPRA 3SDEB 3Q2TC 2E8OA 2KHDA 2HDOA 1T8EA 2D8CA 4JI8H 2ZWPA 4GKJH 4A8QA 3L4BC 2KJ9A 3A3PB 4DUZJ 1S6QA 2QL7B 1FXLA 3K59A 2ZTEA 2JSXA 1JJCB 2AZ3A 4PYDA 3G96A 1LKYB 3AJ2A 2F9JA 1ZQTA 2FDRA 4RO0A 2NYIA 1KEKA 1W93A 3MAAA 1VK8A 4H4MA 2ZHAA 1GO3F 4GVBB 4YR2A 5B0EA 1VAJA 4J90A 3NAIA 2ZM6H 1E6YB 2HFVA 1SQGA 4TU9A 3GTKA 2HQGA 2EVZA 4HAIA 1SBRA 2VOPA 1S72S 2C2MB 4NLPA 3C2LA 3QLHA 3CNQP 1BWEA 4CNQA 4Y2VA 2R8GA 1Z00A 8ATCB 1VBYA 4ZVEA 2VUGA 1B04A 4K7QA 2HVEA 5HVGA 3RIZA 1X2IA 4C48A 1FWEC 3IFEA 3CRXA 2JRSA 3U26A 2ZD1A 1N63A 4M2YA 3CD0A 2P5VA 2Q1LA 3V4ZA 2HBQB 1TK0A 3F0NA 2LM1A 1COOA 2UXCH 1ZTTA 4MAKA 1YIJS 3LK9A 5EOYA 2D3ZA 1JROA 9RUBA 5K8PA 5ADZA 1S0VA 3KLIB 3C1ZA 1BQMB 1Y4ZB 5IILA 3SFWA 3KWMA 1JI7A 2W3SA 2FB0A 5L39A 2W9CA 4AYBE 4ZP9A 4LFBJ 2ISOA 2QYCA 4UCUA 1C1CA 3AQOA 3HX0A 1MMDA 3CCUS 4ANCA 5ALGA 4QWAA 3B54A 4RKUC 3DLEA 2GX8A 3SYZA 1WH2A 2KN4A 2KIWA 3JSBA 3PG9A 5CR0A 4ZS6A 1B0TA 3QGKC 4KV8A 5HJYA 2BJEA 4J9NA 3PCOB 5AKGA 1JLBA 1IR1A 3ZDDA 2R2UA 2NUUG 2P8IA 3NWGA 2Q0ZX 1UWAA 2NQPA 1I6JA 5BPHA 4WPAA 1ZQAA 9ICBA 5D4LA 2RVJA 2UV8G 4XPEA 1K8AT 5ETQA 2FE9A 3OFFA 4P2HA 4IR1A 3QU2A 1UVKA 2HG4A 4WFZA 1UPMB 1JLAA 2YX7A 1YNYA 1VDHA 2V63A 4JV5F 1LWEA 1HBUA 4CC5A 3PR4A 2ZH7A 2EZYA 2L3MA 3R2DJ 3C8YA 1E9ZB 3VHQA 1N0VC 3D66A 1RTJA 4A8FA 4CO2A 4N41A 2XCLA 4ZHQF 2UUAJ 2JH1A 1FWCC 4JI5J 5F8MA 2LEPA 2WW8A 2MZJA 1REGX 2ZJPQ 4RW8B 3K58A 4Y2IA 5IINA 5A8KA 3M8ZA 2M7SA 4RQ5A 3IG1A 1A5NC 3PO5A 2ZOFA 5LP6F 3AL0B 4DPXA 3UDCA 5GAEU 4Y6IA 2J9GA 2ESEA 1CBKA 2KJWA 2E9RX 2DR6A 3T6JA 3JQMA 5L38A 1UBPC 3UCZP 4LF9H 5AJ3F 1HKAA 2MEWA 4KSEB 3C29A 1H98A 3HHLC 4F36A 3EPIA 2I6XA 2MKCA 1S99A 3CCES 3AOAA 3MCMA 3C6UB 2IHR1 4JI7F 4K4XA 5DB7A 3BQ2A 1KR4A 1MROB 3B8HA 1P1TA 2M8DB 2D3UA 1R9XA 4C6AA 3QPIA 2KKVA 1HFEL 2UUBH 4C8MA 1HBMB 2BX6A 3MXHP 3I31A 5IOLA 3NBPA 3LPYA 3HSDA 3FK4A 4Z2XA 2ERRA 4NLCA 2DVIA 1T9UA 3SQGB 2CQ4A 2VKQA 2ZIVB 4WFNQ 1U6BA 4JI1J 3PX0A 1N32J 3D54A 2B0GA 5AXNA 4B3MF 2BCSA 4RB3C 1Z3EB 1R3NA 4HH0A 3SEIA 2ZIWA 2KDOA 4JI3H 5CHGA 3H98A 2JEJA 1RXVA 4FP9A 2HMIA 1S76D 1PO9A 1IKVB 1Q8LA 1KJ9A 1GLVA 5C25A 1SJ3P 1QAXA 5IIIA 3FQLA 3N44B 3WKAA 3ITHB 3M30B 4K5SA 2X3GA 2HWTA 3HXMA 4RNHA 2WBRA 5LXYA 4I6YA 2LQ8A 4IL6U 3TKAA 1MN9A 4N8OA 5T7LB 4NLKA 4F93B 9ICUA 4LJXA 1KJ8A 5E2QA 3K8WA 3BO4A 4G65A 4FXDA 2ZH4A 1GNKA 4DR2H 5H2FU 2QL9B 9ICMA 3DNCA 3JRWA 3ETMA 3E3XA 3HP6A 2V8DA 2VBZA 5G5GA 4DV2J 3C21A 1SKWA 2R7SA 4NY8A 2JLEA 8ICUA 4IRDA 2G0CA 2LQ5A 4XDCA 5KT5A 3HMJG 3Q83A 2GLTA 4K5RA 3K17A 1RT2B 4FZVA 3UXOA 1VQ8S 2LVWA 4P52A 2YKMB 1WKKA 1OQ6A 2CPJA 1KLMB 4V1XA 4JI0F 2HBMA 2MZ1A 4D3HA 1Y11A 5K5MA 4Q0BB 2IRUA 4PUOA 4DCOB 3G8CA 3T9ZA 1RJJA 4CT8A 7ICFA 2PA3A 4NA2A 2CZVC 1A9NB 2JWNA 1FWDC 4JI2F 4NMLA 3RUPA 4MTPA 1AT1B 2XS7A 1U49A 3R5BA 7AT1B 4B9LA 2DLNA 2CFXA 2PMZA 2W9BB 1TUWA 2EC2A 2QMUB 5FJ8G 5J1NA 3MR5A 4W90B 1TR0A 3Q24A 2R92A 2R7VA 1UT8A 5AKJA 4HI1A 1RLCL 2D41A 1KWMA 4ZP6A 4B6JA 4CH0S 1L3VA 1RHJB 2RU3A 4DU8A 1ZJNA 2E8PA 1Q46A 4NLUA 2CPHA 4DR5F 1XTZA 2LXFA 2Z58B 1XMQF 4OX6A 2J9DE 3MOJB 3KLEA 2VPQA 2PSZA 1U25A 2RDIA 4A2AA 4PWQA 1KCXA 5CHCB 3AOCA 5D77A 1G4CA 1S59A 1MMLA 4EPDC 3VAJA 4F67A 3NTUA 2MGZA 1CQJB 2HOFA 4RPYA 3CCZA 1VC5A 2ZJ8A 5KFGA 4ZLLA 2WB4A 4F4ZA 1FE0A 1JLCB 1B99A 5J2UF 1J5OB 3HJEA 4IC9A 4NLQA 3W61A 3F2CA 2LMRA 3D68A 4FYDA 3VAKA 4LF4J 2Y1JA 1I94J 3LP0A 1M0SA 2MKKA 4DV6H 4JV5H 1EF2A 2YZMA 1FWFC 2PDAA 3BREA 4KH1B 3C2MA 3M32B 2WE6A 3EVWA 1WOPA 2ZUDA 4IKAA 4LR7A 8ICEA 1KDNA 1RT4A 3WK8A 4WIIA 1LW0B 2DQNB 4PWUA 3NCRA 4IH6A 5ALTA 2H3FA 1VLOA 4O3RA 1FTCA 2W7OA 4MKAA 5EWEA 2OH2A 2DHXA 2FLOA 1RTIA 4LSLA 2H51B 3HVTA 3V4IA 1PUZA 2C2NA 1Q78A 4A3DG 4Y2UA 1T9VA 4QZGA 3MMBB 1XNQF 4IOAQ 2P53A 1N56A 2DR5A 9ICOA 5IT9U 2ZWOA 1FWKA 2BM0A 2VZ9A 2LA4A 3DRPB 4IYQA 5SZTA 5C2GA 2EQYA 4R0EA 5AIAA 4ZDNA 1T05A 2OFGX 5HV6A 3AA9A 1NPRA 4ERDA 4CLLA 2AW0A 3DHWC 4A93G 3UI3A 2R18A 2FVQA 1GMUA 2CQCA 4OX8A 4QIWA 2XZDB 2WONA 3QIPA 2NRZA 4Y2CA 4C0HA 2KHVA 2G06A 2DIVA 3R7BB 4AYBD 4B9TA 1Y3KA 4M5DB 2RRAA 3CJ5A 4JI7H 1H2TZ 1ZRMA 7ICEA 4OZ2A 5K20B 2YNHB 4ED5A 5C0YA 4F02A 1DIKA 2BEFA 5JVDF 4KHPJ 4KGXB 1Y88A 3R27A 5GAGU 3RU0A 4HLBA 3J81j 1GKQA 1ZQYA 5ALWA 2RRDA 3N6MA 4DV0H 3I6PA 1UPPA 1D9AA 1NJXA 4HR2A 3SIPB 2DPIA 2CQ1A 2KG0A 3LS9A 2IC3B 5D6GA 1BHNA 3KAJA 5J0OA 1X4FA 1NZBA 4B3MH 2ZBQA 4CNTA 3J7Z5 5IQ6A 3KK3B 1AFIA 1QE1A 2LQBA 2L41A 1U6ZA 1UFLA 3R5GA 1MWYA 4UOHA 1PO6A 2HJWA 2A1JA 3IBFB 4HQ6A 5DG7A 2B9XA 8ICPA 1FWLA 3B78A 1WC3A 3FSYA 3GCXP 4EPBC 3BGLA 4YP3A 3MM5A 3MM6B 3A8KA 3JPRA 4DR7F 1N5TA 4X62F 3I9V9 3EX7B 2IA6A 2GO9A 4YAKB 2C2KB 1PC4A 4N8NA 2XM3A 4O3PA 1U4BA 1KRAC 1NH7A 1Y1WG 3WK5A 1SL1A 5CABA 1LFWA 5A76A 2H5JB 5E3PA 1J6PA 2RQKA 2C2OB 4CO1A 1A0IA 4BWSC 4RUCA 4F71A 4HTJA 5J2QA 4WYWA 1PC5A 4YMEA 5KG1A 1RAAB 1O08A 4DSIA 3TAMB 2JA7G 4OYZA 2ZH9A 2HHTA 1GSHA 2CPXA 5KX5F 1JJHA 1P7DA 4FN5A 1ZD2P 2YMMA 5D1PA 4BS2A 3WO1A 4QIEA 1KBLA 3HKZE 4MF8A 3TR5A 1MQ2A 2V8VA 4C0ZA 4P0PA 2RSQA 2IOHA 3H4DA 4ECSA 3VCBA 3W9JA 2QSFA 2VONA 4TY8B 4O44B 4UCSA 2PKEA 4OHWA 3Q8KA 4IUFA 4JI0H 3PSPA 2VG6A 3MPDA 3IS9B 1NK9A 3RR7A 1WHYA 3M4IA 3MR3A 4RW4A 4FDFA 3MWDA 1NZAA 1E4FT 2B4PA 3D6TB 3QAEA 2YQEA 3OSPA 4KAIA 1RT7A 4LJMA 4KIAA 3JSNA 4JI2H 4URQU 3IBWA 4XRHA 4R5PA 2V4QA 3P3DA 3TZZA 2BJ3A 3ISCA 1SB6A 1RT1B 2WTFA 3OBIA 3PHTA 4OX7A 3O6QA 2KU7A 1ULZA 4BLGA 4DFKA 3PX6A 1WC4A 3GZFA 3PSFA 1URNA 4KMOB 3RBEA 4KLSA 1SQFA 5HK4A 3NNHA 3BSAA 3ELHA 3BKFA 1R9TA 9ICNA 4DR5H 3HHKA 3GDXA 1RCXB 4NLTA 5I3UA 3Q8LA 3L09A 1HIWA 8ICHA 4MEYA 4DL6A 1XMQH 8ICAA 1HMVB 5IYZF 1RT3A 4PXEA 1DHMA 3RTXA 2CWKA 1QM9A 3I4PA 1RADB 2CADA 2GGPB 2AV5A 3GIIA 5DB6A 3J80W 1TL5A 2QMWA 3FRZA 4HYKA 4YXJA 3TADA 2V9KA 3TX8A 3R5JB 4CI0B 4Q8FA 4P0QA 2L48A 3W66A 1H74A 4RW9B 2JFKA 4BJQA 3OJUA 1WORA 3TIGA 5J0YA 2K1RB 4OI6A 1BGWA 1TKXA 4OJ5A 2ASYA 2D3DA 3Q23A 1U0HA 2RF2A 2W57A 5J0UA 1VQ7S 1BQNB 2EI5A 1KVIA 1XR5A 5KFZA 5MAOA 2Z30B 5B0AA 3V6KA 2HVRA 1IOVA 5A0YB 3MAHA 2BPFA 5HR7A 3GJTB 3DC2A 1NI3A 1RYSA 1ZBTA 5ITHA 3GTJA 1EP4B 2FVSA 1U8WA 1RM6C 1KC7A 4V1Ak 3Q0AA 3BGFA 3V81A 2ZKTA 3K1ZA 3OTEA 3P5TL 4JWNA 3MUMP 2W55A 1N5YB 3DU5A 1RWMB 2CQGA 3NS1A 4ZI7F 4UQGA 5JVHQ 8ICXA 3J7AK 3FSIA 1SFOA 2YVSA 2EC0A 2BZFA 1XNQH 5KAFU 5C42B 5CD4H 2YMPA 2NPIA 5J2NB 1UJ6A 4L74A 2BE2A 2I5JB 3VGTA 1N61A 4KKOA 5F8IA 3DDHA 1EJUC 4DL3A 2CPIA 1OY8A 3UNGC 4A8YA 1NRKA 4FF4A 4RQ3A 4UB9A 3G6VA 3FEXB 2CNLB 1FEZA 1A0PA 1D1UA 3JPTA 3WKDA 1FERA 1SKRA 4O0NA 2C42A 4CQDA 3BSOA 4JWMA 2J9EA 4H54A 4YXMA 1U1PA 3I56S 5T14A 2AU0A 4HR7A 3A8EA 3AMZA 4DUZH 2ACMA 4AT1B 2PC6A 2ZJ5A 1QVGR 4K4WA 3DXBA 2VUMG 3MCOA 1S77D 2GHPA 2BCQA 1NKCA 2E1CA 3MEGA 1CUKA 3TUPA 3VCDA 2HRYA 5K9FA 2KD1A 1TQLA 1S0OA 2FLPA 4PHAA 3BGOP 4U6PA 3M6WA 2WB1A 1LXNA 3ENAA 1X0PA 1I51B 3N43B 2YBVA 3GSDA 1R9YA 4Y2PA 2LHTA 3ZNUA 1ZOTA 2LFVA 1H2VZ 3F41A 3J81U 1HYSB 2Z2YB 3M8PA 3HHNB 2CG4A 2KT5A 2OM6A 3HSZA 4K4IA 4WXOA 2F4FA 2A10A 3PR5B 2AKWB 2VA8A 1U47A 2OTLS 1MMNA 5BPFA 4LFAJ 5H9FJ 2FYXA 4X4RA 1L8LA 3V7PA 1U1QA 1ZXIA 2J76E 4G1QB 3US5A 1N33J 4US8A 2GOKA 3MR2A 9ICEA 4DR7H 4ZK7M 4UB6U 2R7KA 3O8WA 2B6AA 1DV1A 1TWGA 3KJVA 4X62H 2E1PA 4UARA 3PVXA 2ZZTA 4O4LF 4UBPC 1VJQA 2J6SA 3K89A 1YWXA 1HNWF 1Q8KA 2V0NA 2H9ZA 3KLFB 4ZN3A 3UFCX 2JEIA 5AI9A 5KG4A 2FHKA 4C5ZA 4UCTA 4URSA 2E1MC 2IJNA 1VK3A 3M4XA 2G09A 1H7XA 3HO1A 4US9A 2ZNZA 2H3IA 2IBOA 2OPPB 4DL7A 2W03A 2HHHF 5LMNF 2YKNB 3RV3A 2IHNA 3GLJA 1C4CA 1TWCA 3JSLA 5JXSA 2J6UA 3NUQA 5IT0A 3POTA 5IFMA 4N56A 2ZE2B 2VIHA 4NLNA 2YKQA 2HLUA 3HKZF 1CEZA 2HFUA 4M9JA 1CS0A 1ZOLA 1ZQQA 1FWJC 2ZZNA 1LWFA 4KMUA 3I55S 4FZLA 1K5OA 2VPYB 2RQCA 3AQFA 3WX4A 3AD7C 2DH7A 5CEHA 1SH3A 4NLYA 4NZ6A 3ZZPA 4QZVB 5J0SA 3W9HA 4WXWA 2NU9B 4Y3CA 1YRRA 2RDDA 1R43A 3CDUA 4RUAA 1SIWB 4Z6EA 4YB6A 4PZVA 1QSSA 4ETSA 4FS1A 1KLNA 1JLGA 5CA7A 3ZFVA 2KNJA 3JAMY 2UUAH 1CS4B 2XNRA 2E7XA 1IBKJ 4M5GA 3IN5A 7ICQA 2HHVA 1F1BB 1QD1A 1M0WA 1HBOA 3H3VH 5JVLA 2OHDA 5FLXY 3SXLA 3V6HA 3HD1A 4Y2KA 2Z7JA 4RU2A 4ALZA 2CZGA 4BBYA 3MABA 1YGYA 1RAEB 1WOOA 4GBDA 2XI2A 3MEEB 3VQSA 1RLDA 4MHVA 4LQ9A 3HB9A 4OYIA 4RW6A 4DFJA 5LMUF 4NRUA 2F3NA 8ICVA 4LF7J 1JLLB 2ZHOA 1V3ZA 4MTEA 5DG8A 2LYBA 5GAEI 3O3LA 1Z19A 3QUCA 3O2IA 2Y1RI 1XSPA 2EDUA 2VBXA 3L4PA 4OHYA 4QZFA 2X0SA 4ANEA 3BDEA 4ACOA 5KT6A 3NGTA 5GONF 1SXLA 2CAJA 4ZVOB 3NRBA 1LXJA 3K8VA 4MK7A 2XMUA 1QTMA 5H9FK 3BE7A 1T03B 2ZNYA 3GQCA 2NXUA 2DH9A 3BPDA 4UB8U 1Q16B 2KJ5A 3UO0A 4CH7A 4ED4A 5KT3A 3NAHA 3GR1A 1TTHB 3BQ1A 3FSXA 4OO1J 2EAMA 2AEFA 2X51A 2YPYA 1JLFA 5HMZA 4F2RA 3MPWA 4P2SA 5LSRA 1WG8A 4B17A 2F7VA 3MAQA 1N32H 1A76A 4X66J 4QR1A 2Y9TA 3FBCA 4G9BA 1WNEA 2YCHA 4ZLJA 1FKPA 1EQMA 4C8LA 1I7LA 1U2RA 4LRDA 1JKHA 5FSEC 3KK1A 2UXDF 2KB2A 2CPYA 3FDSA 5DBBA 2PFQA 3BBFA 4UAZA 1R31A 2DRDA 4J9QA 3DRRA 4BC9A 2M4MA 4X65F 1NO8A 3GU3A 8AT1B 1WKLA 5C3EG 1LEOA 4KV8B 3ORYA 1O6XA 1KONA 4UOFA 1B64A 4KO0A 4C4SA 3BGRA 2YQ3A 2KZZA 1C4AA 4FXWA 4QWCA 2FTYA 5J2GA 1W2BR 2OD6A 1IXKA 2XEXA 1LV5A 2GQQA 1M0TA 1IE7C 2G0AA 5CYQA 3N4WA 4OJ6A 4MV4A 1DGSA 3BAAA 4EFAC 4PL1A 2FPPB 1XQIA 1U1KA 1VHIA 4MKBA 4CF3A 3O44A 4YB8B 1LKZA 4YS2A 5AK5A 1NSPA 2UXBF 4K0KJ 4PGXA 1WWHA 3C2KA 2ZH3A 5G5HA 4RW7A 4OHZA 7ICUA 3S6JA 4I7FA 4F7VA 2XI3A 3M1VA 2DR9A 1SV0C 4M6WA 5KFTA 5A8KB 2R86A 1CULA 2VM8A 2H4WB 4NOHA 1R89A 1R8BA 2WOMA 4ETZA 3NGSA 9ICQA 4K4UA 4MV6A 3G2XA 1F9FA 3A1YG 4YN3B 3PNIA 3K3PA 3L4JA 1LWCA 1NB7A 2DJWA 2DGSA 4LF8J 2JA8G 1MQ3A 4A3FG 4GKKH 1SEIA 1SZHA 4EYIB 2CQ2A 4I29A 2GHVC 5C4XG 4LT6A 3QUBA 3BBCA 3MGVA 4I2PA 1DQ8A 2QARB 4QZDA 4CEXC 4GRSA 3PKYA 1SV5A 4RWXA 2MUTA 4BKNA 1YJNS 4OMFG 1UWBA 5A6PA 3T1YJ 4DO9A 4DEZA 2B4UA 3LPEA 2P9GA 2I87A 1EIYB 3ZDBA 4YMMA 1HNWH 2AIRB 2JA6G 1ZQZA 2OEJA 4M9HA 1GX6A 3TIIA 4DPTA 4USHA 2RGRA 3HPAA 3EUNA 3ZZZA 3H8YA 4MH8A 1X60A 4BY7G 3IMQJ 5JQWA 5IQQA 3QU9A 1RAHB 3W64A 3NGKA 5AICA 1S1TA 2HHHH 1J2MA 1KHWA 4X64H 4LBHA 4JI4F 1ZQGA 3F2BA 2OSQA 3OR1A 3B6BA 1S4EA 2OD4A 2W04A 3HHLA 5JTIA 1RTHB 1JLQA 1Y5LB 5E3RA 5C25B 4F5RA 3N5FA 3V7LA 1NSKL 4PGQA 4KLMA 1R8PA 4WU2A 2FMPA 5C8YF 1XNRH 1XMOF 5J2MA 4NLGA 8ICIA 2XQCA 2CJAA 1TMMA 1HNIA 3F5EA 2B4OA 4DV4J 5AIBA 2XO7A 2R7ZA 3RGZA 1SC3B 3QJPA 2DNMA 1RAIB 2RRBA 2VUNA 3GPAA 3LALA 3WBZA 1R27B 5JRTA 2KL8A 2XZWA 4MTDA 4UAUA 1YJTA 3N28A 2R2RA 1X5SA 1Z2LA 4ZOSA 1FD2A 3GG1A 2LM4A 4HT5A 5K8NA 2CJXB 4A8XA 2FPLA 4KLJA 2V94A 3BEGB 3SMZA 3NEKA 4B3RF 3NS5A 1MC8A 1IUJA 1T11A 1VC0A 4FFDA 1PJ5A 3RJKA 1UJ4A 4RAZA 2HAIA 2IA0A 3PX4A 2ZH1A 2VFRA 3WK7A 2DGOA 2HFNA 3LP2B 3G82B 1AZSB 2QRRA 3CJ3A 3D9BA 8ICYA 4OZ0A 2W6PA 1E6VA 2B9YA 1B0VA 3W5ZA 2HHSA 4PYAA 1RPLA 3T1HF 1VQ4S 4KHMA 2IRYA 2BQ3A 1WSRA 3GTOA 4B3SJ 4NV0A 4LSAA 2DGQA 3KDOA 2KHCA 2G13A 2R8IA 5LMUH 3MEDB 1TMJA 2PMHA 4I7HA 5KFMA 5CD4A 4DV3F 3QT7A 2FHJA 2B8PA 3M8YA 4WZQA 1U1OA 1X40A 4ED3A 2PN1A 4PPDA 4WWSA 2ZXHA 5HHHA 4LF1A 1V97A 1FKOA 5KKNB 3WO0A 2HNDA 5KFAA 2QB0A 5D1OB 3DMJB 1DRGA 4R8UA 5LMNJ 2BHNA 2JZBB 1L3UA 2H65B 4JI6J 4CF5A 3MR6A 3ICLA 4RDVA 4IG3B 4AQYF 2BCVA 2Z0GA 9ICKA 1NM2A 1WTFA 3PJWA 3KJNB 2DCUB 3K1RB 1PIEA 1NAQA 2KG5A 2E5HA 2ZH8A 1FVIA 4FO6A 3C16B 2YYAA 3NY0A 4CYUB 5ALJA 2YQ1A 1A9XA 5ALXA 2CNOB 5D78A 2PMWA 4HTIA 3UR3C 2JFDA 2OSRA 3FNNA 5GAGI 4MIWA 5J2EA 4LH8A 2ZDOA 4ED7A 4M9GA 4V1YA 1Q53A 4DV5J 1TK5A 4NYPA 4K4YA 4K4ZA 2LYVA 4A3GG 2PI4A 5KFBA 4O3NA 1X4AA 2KXFA 2KYZA 2QLJB 3M2VA 2YX1A 2V2VA 3PHEA 3NGDA 1Z4UA 2H3EB 2OEKA 3TUJC 5LJ3Y 1EJRC 4X65H 5DM7Q 2V58A 2OYYA 2FI1A 5IM0A 4LF2A 4XO0A 4WP8A 2GJFA 2V34A 4DI6A 4NE9C 2WFAA 3RBDA 1EQ0A 3ETLA 5J29A 1OY6A 4FKYA 3TFRA 3U7JA 1WHXA 2XMVA 4X4NA 3PM9A 5ALZA 1WR2A 4X4QA 4DL0C 5HROA 1C1BA 5CXTA 3I1YA 1QLNA 3FC9A 4OLPA 4B3TF 1CC8A 4LSZB 2XMJA 5IT4A 3H5YA 1AUSL 4F0RA 4P75A 3DDIA 1X5OA 2DNRA 4Z6FA 5KFSA 4Q43A 1KQKA 4IDKB 4F0KA 1N36J 3EGVA 2ZDPA 1WWUA 1F3VA 1RTDA 3H8MA 3V6DB 4F0MA 2BKEA 1YDLA 4F72A 2HMXA 3NMRA 1FEEA 3GZ7A 3ETOA 4AQLA 3GTMA 2UXBH 1R0CB 4LSXA 3KXYT 3WDOA 2R7MA 1K6WA 4IQWA 1LB2B 1EETA 2YWGA 4Y2QA 3ZTSA 4KBIA 3HVTB 3V4IB 2VHGA 1BPBA 1S0NA 3PO2G 1I7NA 3LP1A 4LRBA 3ZDCA 1HW9A 2GJIA 1D8BA 1BC6A 3M9OB 1YRUA 2BDPA 3DM2A 5LOQA 1DLOB 5LXXA 2W11A 4NZ0A 1X5PA 3B4DA 4RL1A 1CJTB 1T05B 4XPCA 1N34J 1DGJA 2IAJB 4C3MA 3DOLB 3LVVA 3HM9A 3ISBA 1U1RA 2K06A 2EFGA 1JLEA 1ZYQA 2VG7B 5AI0A 4ED0A 4PPZA 3SCLE 4UOCA 3ZTOA 1O5JA 4LF5F 5KAKA 1YLXA 1B3TA 7ICIA 1FE4A 3JSMB 1VGYA 1UP1A 3HBLA 5CWRA 2YQ0A 1JDBB 2R7OA 2A6MA 5KTQA 4CLYA 2FHOB 2RUSA 3PJXA 1MN8A 3D4JA 3JYTA 1FWHC 3NXZA 4HI2A 3ZTQA 5BOMA 2XS5A 4GMKA 3OJSA 4MFAA 1XWLA 4CLPA 3R0DA 1K83A 2JL9A 3C14B 3H0GG 4FYYB 3N4MB 1DBDA 2QMXA 4C60A 2ATLA 1CRXA 2YWFA 2YU9A 1RBOB 3PO3G 3MMCA 1Q4RA 3TZYA 3RFAA 3QGPA 1SV4A 2PD1A 1F3FA 4ZPAA 3PYDA 1QE1B 4USAA 3W2WB 4JI4H 2Q4TA 2AYEA 4OJOA 4PWDB 3N6XA 3M05A 2AEJA 1ZZNA 3BZKA 5U47A 4KLEA 4PG8A 3E74A 1X42A 1HNZF 1VBHA 3EPGA 1N60A 2FB9A 2DXEA 7FDRA 2A1JB 1XMOH 4P73A 2ZH2A 4P7TA 1RABB 2EFVA 1APSA 3W1YC 5F8LA 4ANDA 4ZOHC 1ZHQA 2FJWA 2YTUA 3MM5B 3NL0A 4F3OA 5HVFA 3NCPA 1DY3A 1WCMG 2ZBRA 4K8RA 4LVSA 5J2BA 3BH6B 1HD0A 2CA9A 1IKYA 5HJXA 2HQDA 2LECA 4NASA 4JP8A 4DR1H 2NO4A 1FESA 2ZUAA 3MTKA 2OPQB 4BBSG 1RU1A 1X9NA 3OTCA 1RDRA 4WE1A 2K3IA 5ETKA 3AU2A 1RKIA 1JRPA 5IYBG 3R6LB 3L3FX 1O0PA 1R0AB 5J2PA 4LBPA 2EFQA 1N2XA 4ZIVA 5HP1B 2HNYA 3EE3A 3IAS9 4TYAA 3E8OA 1FFWB 4RB2C 2VICA 4ES2A 2FK3A 2RE1A 2E2IA 4N7TA 3HFVA 1RG6A 4P2XA 2QZ8A 5LXTF 3CJTA 3IWXA 4MFCA 3T1HH 1CJKB 2NCKL 2HVHA 4P0PB 3KZIU 4BXOA 3UD3P 2SCUB 3TJ8A 3UN2A 4DV3H 3KYLA 1OWXA 2AX0A 3D0HE 2PGCA 2VG6B 5J0TA 2HWIA 1YJ9S 2AJFE 4WK1A 4R66A 3S8SA 4OJPA 1UCNA 1WI6A 1K1SA 5EE9A 2JEFA 2OAUA 2HQ3A 5HBMB 5EWGA 5LSLA 1SH0A 5AHXA 2XI9A 4NMXA 1RT7B 3GP9A 4CQBA 4EEYA 5E33A 3GJSB 1CJVA 2I8CA 2LDYA 7ICRA 3SZ2A 4R5PB 2AH5A 2V4JA 3LP8A 5ALHA 3FFIB 3CVZA 2AP6A 4UUXA 4YIWA 1Z1ZA 4KY3A 3HVRA 3M6XA 3RW6A 1RYRA 3PW7A 1W96A 3QT8A 2YWHA 5J2IA 4USKA 1I5OB 4PEOA 1L7OA 3NWRA 2SXLA 3AUOA 4LF6F 4PZOA 1S1WA 3OUUA 1WELA 2BXJA 2ZBIA 4F4YA 1VQNS 4DV1J 3BB5A 4L3KA 5TISU 4O9MA 1UEUA 4DQPA 3VAIA 3H2VE 2P0AA 3EYZA 4KLOA 3SV4A 3CO9A 5J2FA 2MRLA 4R7RA 2WVBA 4P4PA 5ALEA 1T3QA 3WC0A 4WKYA 1KVJA 1RT6A 2KFNA 1FFSB 1Q3UA 5CB1A 2K89A 4FXVA 4RBUA 5EX3A 3UR0A 3AXKA 3THPA 2O66A 3D0GE 3E01A 3DHXA 2B6GA 1FO4A 2QA4S 4NYOA 4CP5A 4QIWE 1JALA 2CUYA 5GAHU 3R23A 2B7CB 4R64A 4B3TH 5DDRC 3FCHA 1F2HA 2HFSA 4F3QA 3Q8MA 1FRHA 1UVMA 4DOBA 1HPZA 5D0HA 2D1CA 4MA5A 4DZHA 4P72A 3U1LA 4OQJA 3SCKE 4RUBA 5B09A 2KKPA 2BGWA 4E2FB 1P27B 1KFDA 4ZPVR 3FEZA 3QT5A 3KUHA 2JH7A 3RB4A 4KR0B 4LZDA 4UB4A 3VAHA 2FJXA 3DI6B 2FIUA 1VQ9S 3N7PD 2FKLA 3ZNJ1 5IIJA 2R7NA 4RX6A 3V81B 4Y2MA 1GKPA 2JNJA 2UUCF 5B08A 1H2UX 2YZNA 2BE9B 3ZZRA 2DR8A 2DNQA 4C11A 4ED1A 4DUYJ 1KFSA 4YQWA 4RBTA 1EKSA 4G6VB 2K7JA 3HKZA 3B0YA 2L9DA 1M5VC 3UXNA 1NHVA 1A77A 3E0LA 1ZQ1C 3LQVA 3G9CA 2XLKA 4F5QA 3BS5A 1HNXJ 4G1IA 3DLLQ 1LK7A 2DHHA 3C0FB 4IQTA 2GH1A 2ZVSA 3DEEA 4NI2B 4MF2A 1VIOA 4GXJA 4LF5H 3CC7S 1UNNC 2GVDA 5ALFA 1ACMB 1BNCA 1GXLA 3ZI4A 2UV8A 3FMAA 5I47A 4I50F 5KFXA 1HLWA 1F60B 2DO4A 1HD1A 4P74A 2JHDA 2R85A 3VVUA 1BWVA 2F77X 4QR0A 1IBMF 3LNPA 2N3LA 3ISNC 2FP4B 3V7JA 3DN9A 1FJCA 3IRXB 2RP5A 2DYAA 3FRYA 2HGLA 2VHLA 4CT9A 3H4BA 4TKTA 3GWCA 2A19A 1CSJA 4EO8A 1EJSC 3BS7A 2HBZB 2YWKA 1S1XB 3LA0A 2QJ3A 3KJFB 2KFZA 2K2PA 5L9NA 1IIPA 1FA0A 2VG5B 3D6MB 3U1MA 2E5SA 3UBPC 1HNZH 3OR2B 5FLXU 3AXMA 3NVVA 2GMHA 3KKAA 2W24A 3P6YC 3HILA 5F8HA 4DN0A 2QA2A 4YB1P 4PQUB 5IV4A 2YPZA 1O03A 3MGHA 1UVNA 4NWBA 4C4RA 1S97A 1YBQA 1SVDA 2LXUA 4CH1A 5EE1A 2DY9A 1X9XA 4J03A 4RR5A 4K2JA 3SSRA 4BWJA 2RMLA 1ZD5A 3M8SA 3I82A 1YRXA 4OV1A 2VD3A 2H54B 4WYLA 2OPSA 2QS8A 1URRA 3KUEA 2UBPC 2MKYA 3DGPA 2DGZA 3WZ0A 2ZIXA 4UOGA 3Q8PB 3IHQB 2ROGA 1WUUA 3M2UB 1X4EA 2XO6A 1FCAA 4XYMB 1N0UA 3GFHA 1RT5A 3CP8A 2CZ9A 3HZEA 4EP8C 2E5LF 5J2HA 4TY9A 5ETPA 4I2BA 5DBAA 1HBNA 4CQCA 1N6QB 3HW8A 3NLCA 1E4EA 3E2EA 2N4CA 4AP9A 2VQFJ 4ZJOA 4IQXA 4ER8A 1BNOA 2VQEJ 3RJFA 5IZHA 1N62A 1R6YA 1TL7A 4WFBQ 1SL0A 1S10A 5IC4B 4IFYA 4ICLA 3AM9A 2G2ZA 4NRTA 2HVSA 3AB4B 2RQ4A 3GONA 2EWHA 4NXMH 5CYMA 2F8MA 4MA0A 2R84A 4U8YA 1YRTA 4HNUA 1NXIA 2YNGB 5L46A 4XQ8A 1S03G 3FQKA 2DD8S 3I76A 5HMEA 2J6TA 3BYRA 4DFPA 2HRTA 3R5FA 3HF5A 4RAYA 3I87A 2OPRA 2R4FA 2CXEA 2W71A 3V5RA 1RA5A 2CDRB 1RWVB 2I1QA 1OXJA 2D6FC 5D0GA 4LRAA 4GFJA 3IP0A 5IT9Y 2H4YB 3MMAA 3QGGA 4IQUA 1KKHA 2RJZA 4IG0A 1V4YA 4JMUA 1KVKA 2OGUA 4Y65A 2GQCA 3CXCR 5F0WA 1IBLF 3FVYA 3UMCA 3K5IA 4LF6H 4KGMA 4AC7C 3ET6A 2M3DA 1OIAA 4PG5A 3GTPA 3M2RB 3AD9C 5CCLA 1X9SA 1A6SA 2AT1B 4C3KA 4M9UA 5ALLA 1B4SA 3RH5A 1TAUA 2QE5A 3FCVA 3ISZA 4X84A 2FDNA 4ZCKA 1VJWA 4I2DA 1MU2A 2VQDA 4LFCJ 4JYAJ 2E5JA 4UB2A 2ADBA 1Y7PA 4DQQA 2IMOA 1RXWA 3SV3A 4QIWF 2FJZA 1ZM9A 2OLWA 2NR0A 2FLNA 5ALMA 3FM9A 4A8MP 2I0XA 4FKXA 3QGAC 1KOOA 1CJUA 3VPDA 2CWXA 5FP0A 1YJVA 3TJ9A 4O3OA 4QZAA 4A8WA 5KG5A 3D1OA 3BS9A 2EK1A 3AODA 1Y1VG 1JMTA 5AE3A 1FKPB 2F76X 4O2AF 2Z2ZA 3B9JA 4RZBA 3HPOA 3DOMA 2ZUGA 2Q09A 2UUCH 5GTHU 2BRKA 2MY7A 1ZQIA 4ELTA 2DCLA 2WB1E 3SR6A 1IKXA 4KHRA 1GO3E 4FNHA 5DGBA 2B43A 3CB4A 1FX2A 4KO0B 3MBYA 4CO5A 4I1TA 4O23A 1C0UB 2HNZB 5KFKA 2CJYB 3DLKA 3IXQA 2RS8A 2H5IB 4J9RA 2FY8A 5KFPA 4ID5B 2NS1B 3BG5A 5KFNA 4TLQA 1VQ6S 1NPKA 5LL6b 3DRSA 1PSDA 4F04B 2ZBPA 2KSWA 4ME6A 2DNHA 3RGXA 2JC0A 2OMOA 2WAQE 3TOQA 1R7IA 4AXJA 1IG6A 2K4IA 4USVA 3DOKB 4MFBB 4OIXA 1F44A 5B0CA 5J1EA 2HS3A 2N3OA 3CJKB 3CC2S 2BKPA 4EFEA 2A3VA 5A8WA 3HT0A 2BE7D 3FUYA 3LGHA 1HHTP 4YDXA 1YJ7A 2PE8A 3QO9B 1WTBA 2WF5A 3RJJA 3AFGA 1HA1A 1HARA 2FVCA 1XEZA 4C0BA 1IWGA 1IBMH 1IKWA 1Q1KA 3MM8A 2OEMA 4QBUA 5L1JA 3GYXB 5GADU 3P49B 3OTQA 3NCQA 5AM5A 3M1VB 1G7CB 4EZ6A 3KALA 1L2ZA 2CW8A 1XJWB 3WQPA 5K2MA 2B7BB 1WACA 5L1MA 2MAXA 1KD1T 2Y0SC 4F91B 1PX2A 1S1VA 2XSJB 4QIWD 1TK8A 3JPNA 1BPEA 4GOAA 3MM9A 1JIHA 1S6PA 2KKHA 3MPVA 1ECWA 3KDNA 4EEKA 2FGOA 3GB0A 3SAFA 1NH8A 4JI6H 2HBLA 5JMNA 2L08A 9ICAA 4NA1A 4ZVPB 3KKFA 2A2CA 1B6RA 3GMGA 5AKYA 4YHHH 5E3CA 4X4VA 3EYYA 3OPKA 2V67A 4ZCMA 3RJIA 1V3SA 3MECA 3GE9A 2JZ5A 4OI3A 1RUSA 2VJ5A 4QU7A 3G8SA 4IWXA 1UWBB 2CQHA 2BJDA 3T79A 1RK5A 2QA1A 3ENQA 1EZ1A 1S1UB 1SV0A 3H5UA 1U2CA 2YH0A 3NS6A 4UASA 3QWUA 2G9OA 1WSVA 3HHDA 4DV5H 4H4OB 1N52B 2RRNA 1FJGJ 3K5MA 3CD6S 3IDWA 2HOQA 5J2KA 2XWXA 5AE1A 4DSKA 1S1TB 4JB3A 4WHBA 4RZRA 1FRLA 1Y9OA 4AE5A 4DZ6A 4FM9A 1IJEB 1TKTB 4YY3J 3PACA 4NLDA 4ECUA 3OR1B 1S9GA 3CJ8A 3G6YA 3GLKA 1L7MA 2E5LH 1JLQB 2K3KA 3D28A 4WBFA 4ZQIA 4UF4A 1V38A 1U2FA 2I9SA 1ED1A 5ETOA 5AK6A 3NVWA 3I4HX 4F5PA 3S1TA 1MWZA 2QFIA 3BV8A 2ZH5A 3MPGA 1TUGB 2Q6CA 2W9AA 3CMQA 3OW2R 1DQ9A 5DZ7A 2WVDA 2Q3PA 3GFYA 4EUVA 5CYJA 2FJAB 5C7PA 3NGUA 3R5AA 1FRKA 1L7PA 3TINA 5FPOA 2BACA 2AZ1A 2QGFB 1ZD4A 3KLHA 4QWDA 3T5LA 1UEKA 3BA9A 4WD3A 2H3ZA 2UVVA 1Y1WA 1SH2A 3N7RC 4WJBA 2JV3A 4DV7F 3N7SC 2M9KA 1M90T 3CCMS 2F1HA 1RAGB 4EPEC 2VKRA 2UUBF 4A3EG 1NZ8A 1RYUA 4TVAB 3AB2B 1S5LU 3P45B 2G2YA 1ZQVA 4LRCA 1ZQXA 3D7SB 4RQNA 1NSQA 1HR0J 2QIFA 1L3SA 1YHQS 1X4HA 1SIJA 3ZZOA 5IV3A 8ICFA 4R63A 3ILOA 1ULRA 2JA7A 3ONNA 3NRZA 1K0VA 4P6QA 1N5VA 3DCAA 4XA5A 3TZWA 4DQSA 1U24A 4CF4A 4RB1A 4JI3F 3ZDEA 4NXNJ 5E41A 4F2SA 1KNZA 4ECRA 1TAMA 2F8EX 2FC8A 2E1RA 1LKYA 2W6ZA 2COLA 4KN4A 5D3GB 3OVAA 2JVRA 3L7UA 2EW9A 4OI4A 4ZPWR 4IAJA 2OXOA 2UU9F 3ZXWA 5A2QW 1FI4A 2HVDA 1XSNA 4U96A 1E6YA 5ETLA 2OOFA 1I3QA 4P9SA 1V6HA 1KJQA 2NREA 4WK3A 4I67A 3T3FA 3DUGA 3AU6A 1K0TA 2D7SA 9ICCA 3HOVG 3KMSA 4F4WA 2V59A 3EZUA 1J5EJ 5ETTA 3D1HA 3J81Y 1KKXA 3UPFA 4DR3J 5F9LA 4PCQA 2PAJA 1VBZA 2YWEA 2KICA 1UETA 1PGZA 3DXSX 1DFDA 4HH1A 1B6SA 2M0GB 2WB1F 3KLIA 1BQMA 1VRTB 3UDLA 2C3YA 2N1RA 5AKHA 2LP4A 3H0PA 5B7WA 5LSOA 2C28A 4OZNA 4FF3A 1UL3A 3G4SS 2HPUA 4LSNB 2FE3A 1S9EB 4ECYA 2DXFA 2FVMA 2P6TA 3OFEA 2LPEA 2DNYA 4JK1A 2V50A 3LW5C 2HZAA 2BKOA 2RHFA 4O3QA 1MA7A 4PG4A 4DOZA 3TANA 8ICSA 3OTOJ 1JNZB 2E1EA 1XBWA 2WAQF 4BDPA 5DDQC 2ZZMA 4C8KA 3ULHA 1RTDB 3WK6A 4KH0B 4ECVA 5IP7G 4X5VA 8ICNA 4MIAA 1L7NA 3FKIG 3NVZA 1OPIA 2W7PA 1W2IA 5HMFA 1ZQJA 2GFFA 4LR9A 5KOXA 5LOVF 4CLUA 2DFLA 3IM9A 3KK2B 2UZAA 2WVFA 2EBGA 1EETB 2IJRA 1X9WA 2CVIA 4I4TF 2GAHC 3FBBA 1XO1A 3CCVS 3MPUB 1UCVA 3CMAS 2ZJQQ 4NYZA 3SCIE 2YNFB 3KOAA 1RAFB 3D6HB 5EX0A 3M6UA 2HLTA 2EANA 5KFFA 5L9XA 4F8RA 3MF5A 2GO8A 5T41A 5HO4A 5E3AA 1FTRA 2B63G 2MQQA 4RPFA 1JLEB 4JI8J 1GTEA 2OUGA 5ALDA 4GKJJ 4RW8A 3UQ2A 8ICCA 4PG7A 3QATA 2F4VH 3IRUA 1YBTA 3RN6A 2FVKA 1F5SA 2ZKUA 4FNIA 3N41B 2V69A 1FD8A 1ZM3A 3JYTB 1EUCB 3B0XA 5AKEA 2DNLA 3HZGA 2IRXA 2ZM6J 4RU9A 5I4MA 4I2QB 3L2PA 1LVHA 4DV6F 3D6FB 3J7A1 2WB1D 2XTJP 2CPFA 2C2RA 1COKA 3MCSA 2HKEA 3D2QA 1L5UA 4QZEA 4Q44A 1S9FA 4UW2A 4DV1H 2NO5A 4WFAQ 1RP5A 4ZP7A 2XCAA 1YG0A 2MLXA 3C6UA 2VUMA 1RBAA 3ZD9A 4KFBB 1ZQOA 1MROA 4CEUC 2KTQA 4UQTA 1FXDA 2YB4A 2P66A 1SPBP 2HHXA 3UMBA 5HMYA 1SL2A 4YBZB 5G0RA 5DS7A 2E29A 4DR4F 2UXCJ 1HBMA 2ASJA 2GPWA 3R8YA 4HACB 1AN7A 5DQHA 2R8HA 1I3OB 1IOWA 4Z42C 4LZGA 4M94A 3GYNA 5BMVF 4RQ6A 2RQ5A 4F4XA 2ZC4A 2AX1A 2XLJA 1YJUA 2YW2A 1JB0C 2DXDA 2BANB 4I2JA 4QJFB 3GRIA 4P2MA 1IKYB 2DR7A 5KG3A 2CKWA 5GAHI 2E2HA 2CXYA 5IWAF 3TVKA 2RU9A 1IKVA 1VBKA 4EZ9A 4DWIA 3D2SA 3LTOA 3B4MA 5ALVA 2PXIA 2NYHA 4QIVA 4I2AA 5HHIA 1ZQDA 3ITHA 3M30A 5BR8F 1GSOA 2C3UA 3G6XA 2VC1A 2B0CA 1HWIA 3I32A 4DR6F 2R6FA 4DV7H 3BJYA 2CJ9A 1OSDA 4RQ4A 2DK2A 4XYLB 3BR8A 1QUPA 1S79A 2X1AA 3MFHA 4JV2A 5B0BA 1YX2A 3A0HU 1BGXT 2RHQB 2CJKA 4DUYH 2OCEA 4DV0F 3P5BP 2KN7A 1N4LA 3THTA 3JPQA 3OUYB 3P8BB 2PO4A 4XTTA 3CC4S 3GJRB 4PPXA 5IIOA 1HNXH 1NPPA 2PMZC 1KN6A 2AJ0A 4KLGA 1SZPA 1Q5VA 1ZQCA 3RRGA 2OJ3A 4KX5A 1QH9A 2LA6A 4C5BA 9ICLA 4DLKA 4OYBA 1TKZA 3HOUG 2CPDA 3SENA 3TEHB 3J80U 1NDPA 2OLSA 2DIKA 1RBLA 1POKA 2W2QP 2IYIA 3BM7A 3KLGB 2W6MA 2GNKA 4A3LG 2NZ4A 4DCPB 3CSKA 2UU9H 3QUQA 2YKMA 5AM2A 8ICQA 1KLMA 3CULA 5K14A 3JTOA 5C24B 3CJ4A 5K8MA 1SJQA 4Q0BA 4UBCA 1C0TB 3PRVA 1FNOA 5KFVA 3C6TB 1ZQRA 3K5PA 5H9EJ 1J97A 2B51A 1XDNA 2MPUA 4ES1A 3EUB2 4LF9J 5J2DA 2FPHX 2IY5B 3A8IA 3VZIA 2YNIB 2KFYA 1F9EB 3PEJA 4A48A 4M9LA 3ZZUA 2VODA 2PT0A 4I6AA 2W9BA 1TKDA 1Z2ZA 2CQIA 3W5YA 3A3OB 4ZVTB 2HK3A 3WNZA 2W9MA 2K4PA 1WF2A 4I4BA 2RKIA 4XIUA 3RAQA 1RT6B 1X8DA 2LYAA 5AM4A 2QG9B 4QZCA 3VGSA 5D46A 2C22A 2Q2UA 1PJ7A 4I2CA 4ECTA 1NJYA 3D2WA 2R42A 1WCNA 1BXNA 1UTAA 1I1GA 4QZ9A 2XC9A 2QX0A 3RUBL 4JI3J 3I5AA 3C5GA 2CQ3A 4LQ3A 3W8PA 1HI1A 2EBEA 4OYWA 4J5OA 1WOSA 5KT2A 4IS7A 1S12A 3QAUA 3EXYA 5I3QA 2IYGA 1FWAC 4O4GB 2NLWA 3MUVP 3OXFA 4GLXA 2HK2A 1J5OA 2Z56B 2BQUA 5DETA 3CW2C 1X66A 3EGWB 1FNMA 2PEHA 3IAM9 2F40A 3LYSA 4LIRA 4J7CA 4F0HA 1R0BG 5ALUA 3UD4P 4NA3A 4DR2J 4CE6A 4F4KA 4Y00A 1M5KC 2MJNA 4C11B 3LGMA 1ZQNA 4B08A 3M32A 1B7FA 3QU4A 3T41A 1ZA1B 2HQCA 3O7UA 4WIQA 2VPWB 4QYRA 3UDVA 3F56A 1LW0A 5E3QA 2DGVA 3OQ2A 3KTMA 3UCUP 4UCRA 5D4BA 3TA2A 6AT1B 9ATCB 5EHHA 1OUQA 3CIZA 2IM0A 5F3ZA 5DDMA 2GHWA 3KHRA 3MWBA 4NCGA 2HSZA 2VF3A 3MMBA 3C2PA 2NZCA 5HLFA 2HW3A 4PGYA 4GXKA 4Y2XA 3H0RB 2EFPA 3W2VB 5AI8A 4YDDB 2LEBA 3D5MA 1T36A 3NASA 4K4SA 1IWAA 3W9IA 4OYMA 3C15B 2K4EA 3IGVA 2QYGA 1VFJA 1N48A 3MDAA 4QYZJ 1MG7A 4A2BA 5H9EK 2VJ4A 1Y5NB 2VFUA 3RB3A 4USJC 1TE2A 2EKNA 3CYMA 1VQMS 4MV8A 2CRLA 2X1FA 3QJLA 1U02A 5DDYA 4DZDA 3NNAA 3LAKA 2MQOA 2EPIA 3TAPA 1D8YA 4FYXB 4M5DA 1NDCA 2LCWA 2APOA 1A6LA 4DXLA 2AXTU 5KG6A 2NU6B 1KRPA 4NCAA 2AJ4A 1KQFB 2YNHA 1RAKA 4NL9C 5CA0F 2AGPA 1RWKB 4YD2A 1Y14B 4DR4H 4LFCH 3VMMA 1A5KC 4UAWA 2NVXA 1X0FA 3VC8A 9ICFA 3I0SA 3PSTA 2NSCA 4AL5A 5HMMA 1VS3A 5AT1B 3RFCA 3L4KA 2HZVA 3K5OA 4FS2A 2IC3A 3LMLA 1YBQB 4CNSA 2YX8A 1OWTA 4ZPCA 4YFUA 1VRQC 1BPDA 3KK3A 2CW7A 4NEZA 3BQTA 1SQEA 2JH3A 4A8OA 2NUHA 3UQ8A 2BJ8A 2W3RA 4WF9Q 5IWAH 2XY5A 1CQIB 3ETJA 2ZITA 3TJAA 2VH7A 3F73A 2XMWA 4DHVA 1HUZA 4CO0A 1Q82T 4TU7A 1Z4NA 2VDHA 4OX9H 2L9WA 4LBIA 3T9NA 4R25A 1IR0A 5BR8H 2BCUA 3DGPB 3UWTA 2DITA 2M9NA 2GVZB 2HFZA 3HHLD 2IM3A 2JA6A 4DUZF 2LKYA 4DR6H 3N2CA 3MM6A 3V6JA 1UVIA 2KAUC 3W65A 4QNLA 1T9WA 3SI8A 2ZUCA 2W54A 3MTJA 4AL6A 1X4DA 2CPEA 4F5NA 4BJHA 3W62A 3EZOA 5AE2A 4TNOA 3ZZTA 1RACB 4I2IA 5FD6A 4R7WA 2N7YA 1CQNA 1RKJA 1FFUA 3RG6A 3AQEA 2O5DA 4JV5J 4TUSA 4IOBA 3AY0A 4XUSA 1ZETA 3KG0A 4HHJA 4NLVA 1ONXA 1U09A 4L75A 5L8RC 1NK6A 5HVHA 5HMLA 2AJ1A 4KLIA 3TAMA 1RXOB 3OSNA 2F8HA 1IBCB 1HI8A 2ZOMA 4P7VA 3CCLS 3RB0A 1WG1A 3JPSA 2XVTA 2GWNA 1KL9A 1R9ZA 4CTAB 2HEKA 1HQEA 4NZ7A 1UVJA 2GPSA 1XR7A 3EWAA 3TWZA 4TY8A 3RH6A 4O44A 4B9NA 5KOWA 4KQNA 1C3OA 4Q45A 3IS9A 2I5HA 1B70B 1F5CA 1WDTA 2BM1A 4KTQA 1ZRNA 2F9DA 4DX6A 4PQAA 4QYZK 2WZ1A 4C4WA 3ZZYA 3RBZA 4IG0B 3M7VA 3F8NA 2FMQA 1J2VA 2KE7A 2FHJD 5GMKa 1YTYA 4LFBF 3CEDA 4I69A 2UUWA 3KOOA 5AJ3J 2MQPA 4M95A 3OT9A 5GADI 2OTJS 1UEVA 4LVNP 1LW2B 4Q2MA 4N76A 3UDEA 1ZS6A 4FVMA 5C2CA 4N47A 2YH1A 5E7OB 1H73A 3S7RA 3RRKA 2LDIA 1RT1A 4JI7J 1IXRA 4CCHA 2V8GA 1ZQKA 1OPZA 3OL6A 5MLCV 2XMMA 2XIGA 3EW9A 4EEQA 5AKLA 4KLDA 1TA8A 3IR7B 3EWGA 4JOUA 1DK3A 1ZQMA 2CQYA 4LMZA 2ABYA 1EJTC 3I4MG 2YKAA 3G71S 4HNVA 4DV0J 1UW9A 1GMWA 4ZVQB 4EGJA 1H72C 2HFOA 1HMVA 1P1MA 4QZHA 4ZITA 2DGWA 4B3MJ 3UVJB 4DL4A 5H1SV 2E3TA 1Q0NA 2ZJTA 3I0RB 3KNAA 4HHUA 1CJUB 3PIOQ 5IYDG 1TL3B 1ITPA 3LDAA 3BQ7A 4FYWB 3HOZG 2W2MP 2NSBA 3K5NA 1JXEA 4RW9A 3HULA 4A8SA 1PAUB 4K4TA 2UUAF 1KFTA 4JI5F 2K1RA 1REVA 3RF9A 3DOMB 3MMJA 2DGTA 2XD4A 1G3OA 2W25A 1WC5A 3U1NA 2RS2A 2HIQA 1RTZA 4KLHA 1BVSA 4M5HA 1BQNA 3LA4A 5A0LA 2HIYA 1T02A 3CMES 2X3DA 1S3TC 1NKEA 4OFZA 2JHEA 4EX7A 5A8RB 1CQMA 2VOOA 4ZVSB 1EP4A 4CIOA 3DLKB 1EAYC 1NNDA 3UQ0A 4BGDA 3CD7A 1T3NA 1Q7YT 7ICJA 2R3VA 2DIUA 2JLGA 4USWA 4QZBA 3PYGA 1N5YA 3DV9A 1SKSA 3MWMA 3DRSB 1Y00A 2VU5A 1HNVB 1JWWA 4OI0A 4A47A 4M5MA 9ICTA 1TUVA 2D69A 5C42A 1RA6A 4M7EA 1A5LC 5J1EB 3ILJA 2LLZA 2DHAA 5J2NA 3QUTA 5TZVA 2BRLA 3NMAA 2LU2A 1GMVA 2HAFA 2I5JA 2CDQA 4KX3A 3VAGA 4JI0J 4CC6A 2LI6A 4HVZA 4ATNA 2V2ZA 5EN1A 2AQVA 3LSBA 1K44A 1IKWB 3G87A 2HS0A 4ILRA 4JI1F 1N32F 2HWHA 5IXUA 1JUDA 2FZCB 4EG0A 4NX9A 5CA5A 1RISA 4JI2J 1N88A 1IJFB 2G1HA 4UW9A 1TV9A 3CGIA 3E58A 2QL5B 4ES3A 2J8AA 4USMA 3IO1A 4L3NA 4DFMA 2DRBA 2ZIUB 4UBBA 4GVLA 7ICHA 1NB2A 2QKQA 3BZQA 5J8YC 2YL2A 4B3OB 4PHPA 4MKVA 4NJ8A 4PAAA 3K75D 4FU0A 2WHEA 2Q43A 5DB8A 1URJA 3I28A 3MECB 4DR5J 2NUAB 2KYXA 3PW4A 2NRTA 4L73A 2KM8B 2E8NA 1XMQJ 1MNEA 3NKYA 4RQ8A 4BCAA 4L72B 2FC9A 4C2MA 1HYSA 3C3LA 4DOAA 2JA5G 5HMXA 2WDTA 1K1QA 5HATA 4DV2F 2ZHBA 3IG5A 3HT3A 2C3PA 9ICIA 2HOIA 2MHNA 2BCRA 3O1LA 4DR3H 4ED8A 3H0GA 1B0XA 5CQGA 3K3VA 4J9PA 3DYAB 3UD5A 1RAJA 1O75A 3R7SB 1S9GB 4ECXA 2AGQA 5B5EU 2HZCA 4OZ1A 4ZJQA 1BD6A 3OGUA 2DGUA 3ZTRA 3KLFA 1U8SA 4E4TA 4JB8B 1Q8IA 2KRRA 1RHRB 5IP9G 1SXDA 3M9NB 2OPPA 2KH9A 2YKNA 1SUQA 3JAMW 1SJRA 4X4SA 4C65A 1XN9A 1DTTB 2HHWA 4GKKF 3VPBA 1SYXB 1XSLA 1WCMA 1XK8A 4U7UD 3UNYA 3KLHB 1VQKS 4A3CG 1XNQJ 3N0VA 1VQ5S 4FZNA