4F4WA

Y-family dna polymerase chimera dbh-dpo4-dpo4 #1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase IV
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
total genus 113
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4wA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f4wA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4wA01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f4wA04
3ICLA 1DLOB 4QW8A 1XR6A 5DG7A 3C5FA 3OLAA 1N5YA 1QUVA 4F93B 2RF2B 4ZPAA 3ITHB 1Y88A 4DOCA 3QZ8A 5KG0A 5KT2A 1N48A 1S0VA 4F2RA 5J0PA 4UAZA 7ICJA 5CR0A 9ICHA 1FKOA 2YNGB 1HQUB 1SV5A 3CDEA 5KG3A 4URQU 1BPDA 1B22A 3MFIA 1T94A 2BCQA 4O4RA 3ZD8A 2HNYA 4O3NA 1S9GA 4DLGA 5KFHA 1EETB 9ICXA 4UB1A 1HNIB 1T3NA 9ICNA 3C2KA 2IA6A 2YKNA 4RT3A 2BRLA 2HHQA 2UUWA 3BSOA 1KSPA 3BDPA 4TY9A 4WFZA 1RYSA 4LSLB 7ICKA 4TQSA 3IRXA 1A77A 5KFZA 4PQUB 8ICFA 4QWEA 2ZE2B 2W9AA 2R2SA 4R63A 2D3UA 2VG7B 3QLHB 2KZZA 3KHHA 1RTJA 1HJPA 5KFDA 1NK5A 7ICLA 4IH5A 4IRDA 1ZQBA 4BGDA 4NLGA 1DLOA 4LSNA 4I2EA 3GIJA 2ASJA 3RB4A 2OPSA 1SL1A 4YR3A 3RJIA 2BCUA 1ZTTA 1SUQB 5CWRA 1XR5A 2BCRA 3I5BA 1A76A 4Z6DA 3ITHA 4NLWA 1WCLA 3DMJA 4KLSA 3KLVA 3LP1B 1L3UA 4GXJA 4MK7A 2M9NA 4QWAA 4RNHA 1RT7A 3NMAA 4P4MA 2YNGA 1HQUA 4YXJA 4JK1A 1ZQJA 3LAKA 4DSFA 4I7FB 1T8EA 2YNHB 5KFPA 1BVSA 5DQHA 2R2TA 4RQ6A 3H40A 1EETA 2ISPA 2D7SA 4DSEA 3MEDA 3MR5A 4ECRA 4DSKA 3ISNC 4DOBA 3DLEA 1IM4A 5C24B 4KMUA 3C6UA 4TY8B 5J0UA 4MFCA 1SH3A 1ZQQA 4PQUA 3IGNA 2HHWA 4MF8A 4ECYA 3K75D 2FPKA 2FVSA 2ZE2A 1SH2A 2ZKUA 4PGXA 1ZQSA 4EYHB 2CKWA 2C2DA 2JEGA 4YQWA 3IHQB 4DL4A 1HUZA 2HW3A 4I27A 1UNNC 4R65A 2XY7A 3IG1B 3KJVA 4K4WA 5KFVA 4QWBA 4KN7A 2D41A 2E9RX 9ICCA 1JLAB 1XC9A 3BJYA 4RQ1A 5DLFA 4QPXA 5HLFB 3UQSA 5DKWA 4NM1A 5F8MA 3NGDA 2V0NA 4TUQA 1LW0B 4QWDA 5KT7A 1HYSB 2HAIA 9ICPA 4QZCA 4IQTA 2PI4A 5T14A 3OJSA 4DSJA 4EYIB 3G6XA 2YNHA 3HX0A 5KFUA 5KT6A 4U6PA 4MKAA 4EO6A 4C8MA 1XR7A 2WONB 3MGHA 4ED1A 4FBUA 4YMMA 4KSEB 5JXSA 1Z00B 4PWDB 3DI6B 5J0XA 9ICVA 5C24A 4MEYA 3N6LA 1QAIA 2ASLA 3FQKA 3AU6A 1HPZB 4UB2A 1BPBA 2MUTB 3DRSA 4MH8A 5I42B 5EUHA 1S9EB 2PFOA 4KV8A 3EPGA 4ZMMA 1S0NA 4ECUA 8ICOA 4R5PA 3QZ7A 5DBCA 4Z6CA 4MF2A 3IG1A 3DOLB 2PFPA 3OLBA 5KFAA 1XS9D 4B9VA 1JLAA 4B3OB 4ZP7A 3N6NA 4WYWA 4KLIA 3KMSA 1DTTB 1TKXB 1JLQB 1RTHB 2WHOA 1N4LA 1LW2B 3KLHB 2NRXA 5KFNA 1X2IA 3RJEA 3LAMA 8ICKA 1D1UA 5I3UA 1HYSA 3H5UA 5DDMA 2IJFA 2C28A 4DQQA 3CJ4A 2ISOA 3DYAB 4IQWA 2OPQB 4K4IA 2WONA 5KFOA 4ICLB 3HHKA 3EYZA 1D9FA 1Z00A 4KN4A 4YMOA 5DB6A 2ZUBA 4DFJA 2F1JA 3M8PB 4NLVA 3LP0B 2BGWA 1VRTB 4J9OA 1REVA 2JZBB 5HBMA 2QV6A 3TFSA 1ZQWA 1NJYA 3PO5A 4C8NA 5KT5A 4URSA 2GWSA 4O5EA 2PFQA 2HNDA 3QIPB 8ICLA 4NY8A 2A1JB 4BWJA 2H5XA 3HT3A 9ICWA 4MEXA 4B9TA 4UBCA 3DOLA 4YFKA 2QE5A 4UAWA 5HHIA 3PY8A 5DGBA 4F5OA 4B3OA 4BXOB 5KT3A 5K14A 1ZQNA 1DTTA 1JLQA 1RTHA 3BQTA 3I0RA 3I5AA 4QWCA 3KLHA 3V81B 3EWAA 4NLXA 4TURA 1BQMA 4ID5A 5F9LA 5KFJA 5L1JA 3IN5A 4RT2A 4EBEA 4KLOA 8ICPA 4DL7A 1XO1A 4DWIA 3HVAA 3JSMA 2HHSA 3PV8A 3E2EA 1N6QA 4QZBA 2IMWP 3ISBA 5F9NA 4NLKA 5TZVA 1HNVB 2P66A 5HP4A 1S1WB 5HROA 3QEAZ 3RRHA 1GX5A 1ZQXA 1C0TB 4UB5A 5KTQA 2ZJ8A 3KK1B 3V6DB 3M8PA 4PUOB 1VRTA 4QZEA 3MECB 1X9MA 4IFVB 4UBBA 3C2MA 2FPLA 2XY6A 3QE9Y 1IKXA 2IM0A 1TP7A 1S0OA 5DQIA 2HHUA 3KK2B 3CJ2A 2A1JA 2BE2B 2FPMA 1X9WA 1U48A 3DRRB 1JLFA 5DB7A 4DG1B 2R8HA 4R66A 2W7OA 4QW9A 4XUSA 4K4UA 5C42B 3OL8A 1BQNB 2FJXA 2IAJB 5CYMB 2ATLA 1ZQPA 4X5VA 2YKMA 3FDSA 3UXPA 2Q0ZX 3RJFA 3AUOA 9ICQA 4O44B 4EEYA 1NJXA 3I0SB 5HMMA 1RT2B 1ZQAA 4KFBB 3M9NB 7ICUA 2RKIB 1ZQCA 4M47A 5DB9A 1XSLA 1TK8A 1T03A 1C1BA 3PMNA 1N5YB 3C23A 3BSNA 1C0TA 1RYRA 5CJ7A 3V6DA 4Q43A 4PUOA 3UPFA 1FK9A 3IGVA 3MECA 4WZQA 3I5CA 7ICEA 4QZ9A 1C1CA 4ZVGA 3ZDDA 2OPRB 1T4GA 3PX6A 1J5OA 3OJUA 4IG3B 1RT6B 3KK2A 4ECWA 1LWCB 3LDAA 1FKOB 3PO4A 1H38A 2J6TA 4XRHA 4IRKA 4YD2A 2EC0A 2W8KA 3DM2A 1ZQIA 2BRKA 1C2PA 1C0UB 3DRRA 1EXNA 4PHPA 3GIKA 4YCXA 5KG6A 4RW6B 5EWEA 2OH2A 4DFKA 3N6MA 4RQ2A 1BQNA 8ICCA 5CYMA 2XI2A 4DQPA 4RQ7A 5KFKA 3MEEA 3MGIA 3QGHA 4WFYA 2GC8A 1RT2A 4ECSA 5HNKA 1RTJB 4ED0A 1CEZA 2IHMA 4DFPA 4URGA 2RKIA 5KG7A 4LSNB 3PJXA 3RB0A 3NL0A 3KNAA 1RT3A 2AX1A 1NK6A 2OPSB 4I28A 3CJ0A 1RA7A 1N56A 1ZYQA 4I2IA 3TARA 4O3SA 9ICMA 3MFHA 4TUSA 3CO9A 3KLEB 4TLRA 5J2JA 5CHGA 1NKEA 3DMJB 5KT4A 4ED7A 4KLQA 2UVUA 3PW5A 2OPRA 5EWGA 2F1HA 4IG0A 4NRTA 3RJKA 1RT7B 4IG3A 1RT6A 4HYKA 1LWCA 5DG9A 9ICRA 3TAQA 5JUMA 1EP4A 5DGAA 1C0UA 4YN4A 5EDWA 4IFYB 3MABA 4RW6A 4O3OA 9ICGA 4R0EA 4KTQA 1SZPA 4O3RA 2BQ3A 3MEDB 5D3GA 3GV8B 1D8YA 3DLEB 4F5QA 2VG5A 3C6UB 1NKCA 3FQLA 2F1IA 2PFNA 3DLGB 4BWMA 3HVTA 3JPOA 2I1QA 2YNIB 1DOQA 2KZ3A 8ICSA 1RTDA 5J0RA 5KFXA 4RNOA 4F5NA 1KHWA 3T5JA 9ICJA 2IHNA 1AROP 2R8IA 3KJVB 1DTQB 4YR2A 1JLCA 3Q8QB 4IQXA 4IQUA 1RZTA 3KLEA 5J2MA 2J6SA 5IILA 4NLPA 4EBDA 2UUTA 3OHBA 4O4GB 3CDWA 1SKWA 1S49A 4K4HA 5IIKA 1IKWB 4PHDA 4KE5A 1QTMA 4P4OA 1PZNA 4I2BA 4IFYA 2O5DA 4ELUA 3ORYA 4O0IA 7ICMA 8ICJA 1SL0A 2BCSA 4RZRA 3G86A 1JKHB 2XCAA 4ZPCA 1ZQYA 4DL3A 2P6RA 4WXOA 3C5GA 1UA0A 3GQCA 2IM3A 2VA2A 8ICTA 3DLGA 2AJQA 4EZ6A 2YNIA 9ICIA 1Z4UA 4NZ0A 5CYQA 3DRSB 1RTIA 1RA6A 3TVKA 4KV8B 4G3IA 4I2FA 1L5UA 3PX4A 4R5PB 3M9OB 3MDAA 4IRCA 5J29A 7ICIA 2KTQA 4B9LA 3KHRA 4J9KA 3NBPA 1DTQA 2R2RA 4ZP8A 1K1QA 2HMIB 2DPIA 3LALA 2P6UA 3UXNA 4TQRA 1ZQGA 2W9CA 8ICVA 3E51A 2R2UA 4F3OA 8ICWA 8ICEA 3TAMA 2AQ4A 3QIDA 4O4GA 3NTUA 4DSLA 5L9XA 1MMLA 1IKVB 5KG1A 5I3UB 1NKBA 5DDYA 3MEGB 4QZGA 5KG2A 4K4GA 4ELTA 3RRGA 1IKWA 2AGQA 1HQEB 3CWJA 4KLGA 1KFTA 3D5MA 1TKZB 4ZPBA 3PZPA 4LVSA 4UB3A 4LZGA 2ZD1B 2FVQA 9ICKA 1JKHA 3JYTA 4ZVEA 4U7CA 4M9LA 1K1SA 1S1XA 3PMLA 4XPCA 1ZQUA 4NLQA 3B0YA 1S1VA 4MFFA 1REVB 5HBMB 3HPOA 3H5SA 1D8LA 5J2KA 4Q8FA 4DFMA 4DF8A 4F5PA 4JV1A 5J1EB 2HNDB 4KBIA 4RW9B 3QGIA 5J2PA 1UT5A 3UDLA 2BPCA 3IS9B 1QE1B 2HMIA 1U49A 3PW7A 4IH7A 3QO9A 4KHRA 4LQ9A 4RW8B 9ICEA 2XWYA 5K14B 1BPZA 1JIHA 2FMSA 5J2EA 1BPYA 2NRTA 4KB7A 3I0RB 4I2DA 3G6YA 2VG6A 1BQMB 1IKVA 4XO0A 4DLEA 3DRPA 2FLNA 3Q8KA 4QZDA 3MEGA 4ID5B 2C22A 2NRWA 2IM2A 7ICNA 1HQEA 3C2LA 3EPIA 5L1KA 4NXZA 1TV6B 4EZ9A 1ZQHA 3JSMB 1LWFA 4JV2A 4F8RA 1TKZA 3H98A 1KRPA 1N6QB 1COOA 3RAQA 1Z3EB 2VA3A 2ZD1A 2NRVA 2JEIA 3KHGA 1LWEB 5HROB 2BPFA 4P4PA 5J2CA 1CSJA 4R8UB 5BOMA 4Q8EA 4WE1A 5J2DA 1L3SA 4RUCA 3QYYA 4O9MA 4PPXA 2ZJAA 3C1YA 9ICUA 1MC8A 3JPPA 1IKXB 3BR9A 4PH5A 3MR6A 5J1EA 5L1IA 2BANA 2ILZA 4RW9A 5J0WA 5CA7A 4Y2CA 4Q45A 5KG5A 3KLIA 2W9MA 3IS9A 1QE1A 3RB6A 1S10A 1U45A 1JLFB 4RW8A 5KFWA 4H4OB 4ZHRB 4WZMA 5BOLA 4DQIA 3RH4A 1SL2A 4C8OA 4M9JA 3GDXA 3LK9A 5J2FA 1HMVA 2FVPA 3QGGA 4GC6A 3MTKA 3SYZA 3T19A 7ICPA 1RPLA 3THVA 3RB3A 2YKMB 4J9SA 4NLUA 3LWMA 1NK0A 5HP1A 3M8RA 1TV6A 4M04A 1JLBB 1LB2B 1NK8A 1KHVA 1YVFA 5J2GA 4PHAA 8ICIA 7ICQA 4CCHA 1JLEA 5DBAA 4I29A 4IDKB 4RPZA 1LWEA 1T03B 1C1BB 1MU2A 4YXMA 4DL2A 4R8UA 2ZUCA 4PGQA 1ZQZA 4F92B 4J9NA 5KFRA 1FK9B 4EBCA 1C1CB 2GIQA 5IIJA 4YMEA 5J2BA 3OL6A 3RTVA 1J5OB 3T5HA 4RW7B 4RW4B 3PJWA 4LQ3A 4UB4A 2HHVA 3DM2B 1KLMA 2OWOA 3ETLA 3JPRA 8ICZA 1S76D 1LV5A 3ISDA 1NJWA 4F2SA 2RDJA 4H4OA 5IIMA 8ICRA 4ZHRA 2AQ0A 1R0AA 8ICXA 2CJQA 4M6WB 8ICUA 3Q8MA 1TFRA 3LP2A 5C5JA 1S1TB 4Y34A 5BPCA 3H59A 4M2YA 3KOAA 3MEEB 3PR4A 3C6TA 4YG2A 3TAPA 3ZDEA 3QEBZ 3ZDBA 2OPPA 5CP2A 1BGXT 5KFEA 1JLBA 1TK0A 5KFSA 2HVHA 1RT1A 3T5KA 7ICRA 3RR8A 3CIZA 4B9SA 2V4QA 4IDKA 1RT3B 3KLGB 1NHUA 4J9MA 5DG8A 5IINA 1TVRA 4R64A 4I2CA 3H8WA 1QSYA 4DO9A 4JV0A 1V9PA 3B0XA 3CJ5A 4IG0B 4OL8A 4X2BA 4RW7A 4YD1A 4RW4A 4ED2A 8ICQA 1EP4B 2B6AB 1WNEA 3V7LA 2HVIA 1ZQOA 5J2NB 4NLNA 4DOAA 3H4BA 5FDLA 5D3GB 4KKOB 4ECTA 4M6WA 1I6JA 3JPSA 2I1RA 1KLNA 4QZFA 4G1QA 1C7YA 4DS4A 1S6QA 1S1TA 2VG5B 1NHVA 4QZAA 3FFIB 4FS2A 7ICSA 2XCPA 5KFFA 4ZP6A 3RBDA 3M8QA 3HVTB 4K4XA 3Q8SB 1RTDB 3V72A 4M9HA 2IC3B 4NYZA 5D4BA 4ZH4A 4JWNA 2MAXA 2IBKA 1TVAA 3SZ2A 3KLFB 3KLGA 3T5LA 4WYLA 4NCGA 1JLCB 3BREA 3MR2A 4PGYA 2WOMA 3SI8A 2XGQA 3BSAA 5J2MB 1NJZA 3RJJA 5KFMA 2W9BB 1S9FA 2WRMA 3C21A 4H4MB 1NNDA 4KLTA 3RBEA 1RT5B 2XGPA 4NLSA 3UPQA 1S0MA 4KLUA 4RNNA 4O3QA 5KFYA 4KLDA 2C2EA 4M9GA 4F4WA 2F8EX 2B6AA 4MIAA 1KFSA 4DS5A 1U9LA 3RJHA 3M8SA 3E01B 1RAJA 5J2NA 3NAHA 3SFUA 4K50A 4K4SA 1U09A 4KKOA 3DOKA 1T7PA 3KK3A 3JPNA 4NLTA 1SKRA 2BPGA 2B43A 3FFIA 4DEZA 1BPXA 3OSNA 1NK7A 2BCVA 1UA1A 3UQ0A 5CYQB 3OGUA 4KLLA 1IKYA 1S97A 2IC3A 1RTIB 2AU0A 4Q44A 2AGPA 3CVKA 4NLYA 3NKYA 7ICVA 5J0QA 3SV4A 3JPQA 5KFGA 4NRUA 3KLFA 3BQ1A 1U47A 4F5RA 3NBPB 2KN7A 3CJ3A 2JC1A 2B21A 4ZVFA 1ZQMA 1XU4A 3RH5A 3MDCA 2W9CB 4JWMA 3GV5B 4XA5A 4KLEA 4KHMA 2W9BA 4TYAA 4XQ8A 3TAMB 3OL9A 4B9MA 4H4MA 1RT5A 4ED6A 2BHNA 2E9TA 1GX6A 4I2JA 1UWBB 4F4ZA 2AX0A 4DL5A 3RR7A 4GXKA 3V6JA 5KFQA 2RF2A 2JLEA 3TANA 2IM1A 1KFDA 1ZJMA 3ZD9A 3E01A 4IR9A 1TL1B 3C1ZA 4RQ4A 2B5JB 1ZQFA 4K4ZA 1TAUA 4RQ8A 2V9WA 2PI5A 3JYTB 4J9RA 4BDPA 2J6UA 8ICYA 2UVWA 1SH0A 3BGRB 2WTFA 1S1XB 5F8JA 2UVRA 5J0YA 2ALZA 2XC9A 1S1VB 3GFKB 2ZTEA 1S6PB 1XWLA 2E9ZA 1HNIA 4B9NA 4J9LA 1UT8A 2BKEA 5DLGA 7ICHA 1JXEA 4TN2A 4DQRA 4LSLA 5J2PB 4Y3CA 2FLLA 2R8JA 2DFLA 3SFGA 1D0EA 2YNFB 1JLGB 4F4XA 4I2PB 5J2AA 1U4BA 3Q8LA 4NLOA 3MF5A 3QO9B 2VG7A 3UQ2A 1S4FA 3QLHA 1WCNA 2UVVA 4IOBA 3H5XA 3DLKB 1RDRA 2R8GA 3BSCA 2VG6B 4MFBB 1UWBA 3DRPB 8ICNA 5KFIA 1SUQA 4DF4A 2WK4A 9ICAA 2HHTA 2FJWA 4P2HA 2HHXA 1TL3B 5J0OA 3EW9A 3LP1A 1DGSA 1LWFB 1TL1A 1MSWD 2B5JA 2BQRA 2HWHA 4GXIA 1ZQRA 4HKQA 3BGRA 2KFNA 3HP6A 4I7FA 4TYBA 1TKTB 4EO8A 2R8KA 4QZIA 5J2HA 3T3FA 4RQ5A 1FKPB 4NLZA 1S6PA 4WE1B 2ASDA 4I2AA 5F8GA 4MFAA 1KEJA 3T1AA 4NLRA 3HWTA 2BANB 4FS1A 4TY8A 1ZQTA 3KLIB 5L1LA 1TV9A 2YNFA 3RJGA 1JLGA 4I2PA 2FLPA 4RUAA 3TFRA 1TKDA 3UR0A 4KLMA 3KHLA 4ZVHA 3ISCA 2NRZA 2VA8A 3Q8RB 4ED8A 5J0TA 2Y1JA 1HMVB 3DLKA 1QAJA 2FVCA 4Z6EA 8ICAA 5HMLA 4C8KA 1TK5A 2HNZB 4RNFA 4MFBA 1TAQA 3FYHA 1T05B 3CDUA 2C2RA 3V6KA 2BQUA 5HP1B 3MBYA 1TL3A 3PW0A 5HLFA 4J9PA 3OSPA 4B9UA 2JEFA 1IXRA 4O3PA 1MQ3A 3V7JA 1JLEB 1LW0A 4NLDA 5C25B 9ICSA 3ZDCA 3FRZA 4FBTA 3M9MB 3PW4A 3OL7A 1MU2B 3V4IB 1TKTA 4YVZA 4MIBA 5F8IA 1CUKA 4F4KA 2IJNA 1FKPA 4DQSA 2V4RA 1ZETA 2RDIA 4ECXA 1OS5A 3PHEA 4PWDA 5F8LA 3ZDAA 1RXVA 4ELVA 3DI6A 1X9SA 3NAIA 4Q0BB 4WXWA 3TQ1A 1KLMB 1HPZA 5DB8A 4K4TA 5KFBA 3PW2A 2BDPA 4RPXA 2MUTA 4F4YA 5CB1A 4MK8A 2ZUDA 3V6HA 5I42A 1S9EA 3H2LA 4PHEA 1R0AB 3EZ5A 4RNMA 4GLXA 3LP2B 4IQVA 2HNZA 4YMNA 1T05A 2BR0A 4KAIA 3C6TB 2ZJ5A 5D46A 1JMSA 2OPPB 4M0AA 2PXIA 1TKXA 1XSNA 3EZUA 3RH6A 9ICBA 4JUZA 2HWIA 4I2GA 1LW2A 1RT1B 1L3TA 3OHAA 5KFTA 1L3VA 3ISND 3FSIA 3GILA 5IIIA 5C25A 7ICTA 3Q8PB 4QZHA 4RU9A 1RT4B 3V4IA 4Z6FA 2AWZA 1TQLA 3DYAA 3GIIA 2OPQA 1S1UB 2W8LA 2FMQA 4M95A 3IM1A 3D28A 1TVRB 4UQGA 1ZQDA 4I2HA 3H8SA 7ICFA 7ICOA 4ICLA 9ICOA 1B43A 2DPJA 2FJVA 4ECQA 5HHHA 5KG4A 4ZP9A 4KLJA 9ICTA 1W25A 4F50A 4H54A 3KTQA 3VQSA 3BQ0A 4Q0BA 9ICLA 3LANA 3BQ2A 3PR5B 3V7KA 2KZMA 3LP0A 3GV7B 1XSPA 2ZTCA 1ZQVA 1SKSA 2JZBA 1HUOA 4UAYA 3HVWA 4LZDA 9ICFA 2D3ZA 3DDKA 1NK9A 3TI0A 1KDHA 5FDLB 4MKBA 1QSSA 3H5YA 3QIPA 2AGOA 4MK9A 1VRUB 3JPTA 1QLNA 4G1QB 4K4YA 1S6QB 4IKAA 3M8QB 4BXOA 8ICGA 3SV3A 1ZTWA 3KMQA 4NM2A 4F91B 4I2QB 2VANA 3H8JA 3V81A 4RQ0A 5J2QB 4K4VA 4XPEA 2FMPA 5J2IA 3H4DA 2ILYA 5F8HA 4KITB 1RT4A 5EWFA 1ZJNA 2I5JB 4GC7A 4NCGB 4M94A 2JC0A 3PNCA 5DBBA 1S1UA 2WOMB 2XO7A 3HKWA 4DSIA 4KO0B 4RPYA 1HNVA 5DQGA 5D49A 8ICBA 2GIRA 1S1WA 4KLFA 4E0DA 4RQ3A 2KFZA 1ZQLA 1RXWA 5J0SA 3KK1A 3N97B 1ZQKA 3UXOA 3HW8A 2I9GA 4IH6A 5KFLA 1D9DA 4IFVA 1S48A 2XI3A 1JN3A 4M9NA 7ICGA 4TUPA 4YR0A 8ICMA 3DOKB 1S77D 1VRUA 4O5CA 3KK3B 8ICHA 2BE2A 1SV5B 5EOZA 3PX0A 4KLHA 3AU2A 4C8LA 4FO6A 2ZTDA 3G6VA 4IR1A 2HNYB 4DG1A 2FVRA 3GYNA 3K4GA 1S9GB 3GIMA 1QSLA 5C42A 1IKYB 5KFCA 2YKNB 4YP3A 1BPEA 4ED3A 4I2QA 4Y2AA 4ECZA 1HARA 3PVXA 2IAJA 2WB4A 5J2QA 4ECVA 2Y1IA 3LWLA 2LYHA 3N4MB 3H7IA 1MQ2A 4J9QA 3IRXB 1ZQEA 4O44A 1NK4A 5IIOA 1JX4A 3I0SA 2I5JA 5F8NA 2XY5A 3RAXA 4WFXA 3MR3A 1NOMA 4KFBA 4O5KA 1KTQA 4KO0A 2WCXA 4ZPDA 2JEJA 1JXLA 4QZ8A 2W7PA 4DL6A 4TXSA
chains in the Genus database with same CATH superfamily
3ICLA 1DLOB 4QW8A 5DG7A 1KJIA 3MM6A 3TUZC 2DVIA 2ZZNA 1UVJA 3QAEA 4F93B 3SAFA 4HTJA 2XG8A 1N52B 4ZPAA 2X1FA 4DOCA 4CTAA 4YB8B 1YBUA 5KT2A 3W5YA 5HQ8A 4F2RA 4X62J 4UAZA 4BWSC 4A8YA 7ICJA 4X4TA 1YK9A 2YNGB 1HQUB 4DV2H 4ZVOB 1KRBC 1B22A 4OV6A 5J8YA 2HRYA 2BCQA 2MHNA 4O4RA 3ZD8A 4A8KA 3FSYA 1U02A 4O3NA 1KJJA 1OQ3A 1S9GA 3PM9A 9ICXA 2U2FA 1FRHA 4OYZA 9ICNA 3C2KA 1FWEC 3RZAA 4RT3A 2HHQA 2DRAA 5IOLA 4FYYB 4DCCA 1FD8A 1VFJA 1JJ2R 1QQ6A 1TAEA 2R2SA 3EICA 4R63A 3HJFA 2UU9J 4KJIA 3LMLA 4IH5A 5EGYA 3G6ES 4FXDA 3TACB 1DLOA 2JNJA 1OWTA 1JNRB 5C0YA 2DKXA 1SL1A 2BCUA 3R3TA 4PG4A 3M2VB 5HL7Q 4UY85 2OMLA 3LA4A 2ES6A 3DMJA 4GXJA 4Z37A 3SFWA 4MK7A 4LJMA 3Q22A 1IBKJ 2YNGA 1HQUA 3R6GB 4I7FB 4LF6H 4EX7A 4TNOA 5KFPA 4N56A 4C4SA 2RQMA 2VQEJ 1S6UA 3H40A 2D7SA 2UXCJ 4ECRA 1V4YA 1H7WA 2NXCA 3CCVS 4ICAA 4JB3A 3HSGA 3DN9A 3I87A 5C24B 2B0CA 2C2NA 3CCQS 3VMMA 1FFWB 3IGNA 2HHWA 1EKRA 2FPKA 2FVSA 1HKAA 2KM8C 4JV5J 4EYHB 1JDBB 4DZ6A 3KKAC 5KL1B 5GADU 4YQWA 3IHQB 4DL4A 1HUZA 5CD4A 2HOFA 4KC5A 3C16B 1K73T 2XY7A 4GKJH 3HPAA 3IG1B 4FYVB 3KJVA 4K4WA 5KFVA 2JV3A 4K8RA 1IR2A 4KN7A 2COLA 2EANA 3BJYA 5HQLA 3AOAA 4RQ1A 3UQSA 4NM1A 5F8MA 1F9HA 3N28A 1K5OA 4GVBA 2K8BB 9ICPA 3I4PA 2PI4A 5T14A 4HVZA 4EYIB 3O6QA 1KL9A 2PD1A 3KJQB 4ZK7M 1HI8A 3BPSP 4KSEB 5IT9Y 3CXCR 5C1PA 2QO3A 2LMIA 5U47A 4DV6F 4K5SA 5J0XA 9ICVA 5C24A 2VJ4A 4WIQA 2BE7D 3LH2S 4ZQIA 1IQTA 4UFZA 3AU6A 1HPZB 1T36A 2E8NA 4JI1F 3W8PA 2Z7JA 2KK0A 5I42B 1RHMB 5EUHA 1S9EB 4DR2F 3RAMA 2PFOA 3AD8C 3BH6B 3EPGA 4NMLA 4P7VA 4V19X 5CXTA 4AYBD 2OD4A 3C16A 4Z6CA 1RBOB 4MF2A 3R9KA 3IG1A 4LF8F 2PFPA 3NNHA 1XS9D 4HQ6A 4FYXB 1TE2A 1A9XA 4DUYH 4B3OB 3N6NA 2QJ3A 3KMSA 2DRBA 3V2UC 4G6VB 1TKXB 3H42A 5B0FA 4KY3A 3LO3A 2EI5A 3C3LA 2Y9TA 2HRTA 5KFNA 1YWXA 1KVJA 4OI2A 4HT5A 3M6VA 1X2IA 4KPCA 8ICKA 1U26A 5FSDC 1HHTP 2AJFE 1OIAA 1Q1KA 2NYIA 4EENA 2ISOA 2GQCA 2FGCA 2DGUA 3GJSB 1WJ9A 4IQWA 2KV2A 2WBMA 1KCXA 2EFGA 2M0GB 4C2MA 3NQBA 5B0EA 4BBYA 1K1DA 2MDAA 3EYZA 4B3MF 3M2UB 1D9FA 5LL6b 2K4EA 4OJOA 4CE6A 4B3TJ 4NXMF 4YMOA 1ZQ7A 3WKCA 2LQ5A 2WVBA 2Z8QA 4GO5X 3MAHA 1VIOA 3FZBA 3LP0B 4DR7F 1YJTA 1ZHQA 1UPPA 1ZQWA 2EQYA 2IHR1 3T1HJ 4URSA 2HURA 1Q95G 1Q8IA 1URJA 2VUGA 4BWJA 9ICWA 3I96A 2CA9A 2QE5A 4UAWA 1X5SA 4C5CA 4DR4F 3CO0P 3ENAA 4B3OA 5KT3A 1ZQNA 5JU5A 1R43A 1Y9OA 1WG5A 2BUNA 2CJYB 1X8DA 4NA1A 3D2WA 1B3TA 1AT1B 2VFTA 4C4RA 1U1MA 4PZNA 1V6HA 4LRCA 2Y8WA 2PDAA 5BMVF 4ID5A 5A8RA 2W4DA 2UUAH 3GYGA 3IN5A 4EBEA 3CDAA 1WC1A 8ICPA 4DL7A 3M32A 1HBNA 4OJLA 1EKSA 1JQGA 2YKQA 3PG9A 3WBZA 2HHSA 2DHGA 1N6QA 1XNQF 2K60A 1U7LA 5F9NA 1WACA 5FJ8G 2P66A 2Q66A 3QEAZ 2ZJ8A 4PUOB 1RCXB 4R7WA 4IFVB 4AQYF 4Z7CA 1QVFR 4PKDB 2MY8A 3N0VA 2LYBA 2IM0A 3EVWA 2FP4B 1FRJA 2BX6A 3CJ2A 5T41A 2FJBB 1M5KC 1FFUA 3D54A 2V67A 3WHIA 2W70A 5DB7A 4DG1B 2R8HA 2WAQA 1F1BB 4QW9A 2MJNA 5C42B 2BXJA 4HH0A 2E1CA 1XMQF 2JDJA 2JXJA 4JYAH 4Y2IA 3UXPA 4JOUA 4OX9H 4LFBH 9ICQA 2O66A 3KG0A 2MJUA 2FB0A 4X4VA 4LF9F 4QIWA 2YWWA 5D0HA 2E44A 3L7PA 5JVHQ 4JI4J 3HM9A 2EH9A 4M47A 3CC2S 1IJFB 4OZJA 4P6QA 3RGXA 3IA0A 5AKXA 2CADA 1N5YB 3C23A 1GYFA 2ZBCA 1TZ0A 3RF9A 1FCAA 1WC0A 2B3TB 4PUOA 2R7ZA 2QLXA 3D0HE 4WZQA 6FD1A 1DZ5A 7ICEA 5LOVF 3CCSS 2VFSA 3D4JA 2V34A 4QZ9A 3K8WA 1VS3A 3P6YC 4ZVGA 1SCUB 2B4OA 1T4GA 3PX6A 3I1YA 5HVHA 4IG3B 1RT6B 3U26A 1X4HA 4ECWA 3LDAA 3MPWA 3EGVA 1G4CA 2A3JA 4ENOA 4PHPA 4F0MA 2IBOA 4RW6B 2ZH3A 5EWEA 2RRAA 1EQMA 2OH2A 4J91A 3QFWA 2DLNA 4YB1P 4F71A 3MDFA 2R82A 2KI2A 5KFKA 3MGIA 3NGSA 1G3OA 2CPXA 5HNKA 1RTJB 2OOFA 1CEZA 3GTQA 2WAQF 1BHNA 4DFPA 4F7VA 3L5KA 1S8OA 3NL0A 1XO0A 3KNAA 2H51B 4CWBA 4P52A 3CJ0A 1HR0F 1PYOB 4OYWA 5B66U 4A3JG 2QL9B 1WF0A 3MFHA 4TUSA 1K44A 2DH9A 1WF1A 4TLRA 4M5JA 3F8NA 5J2JA 5CHGA 3BEGB 5SUHA 1SC4B 3UDEA 5KT4A 1ZAVA 3FEQA 3PW5A 1CJKB 2PT0A 5EWGA 4QIWF 2F1HA 1COKA 4HACB 4IG0A 1QM9A 4IG3A 2VJUA 1RT6A 4HYKA 2YPZA 3CJSA 1EJRC 5DG9A 1NI3A 4BC9A 5DGAA 3JZIA 2G1HA 4RW6A 2QA4G 9ICGA 4JI1J 1HBUB 4KTQA 1SZPA 5MAOA 2YCHA 3K3VA 2DXDA 5D3GA 3GV8B 3R5FA 1M1HA 1U6ZA 1JROA 2V94A 4PAAA 2RQ4A 1NKCA 3FQLA 2ALYB 4PEOA 3Q0AA 2VU5A 2XCLA 2I1QA 1E6YB 1I1GA 8ICSA 5J0RA 3D7SB 3HILA 4M5GA 4RNOA 1KHWA 1ZZFA 5ETVA 4Y2MA 4ZPWR 3N7SC 1HBOB 3AEVA 5GAEU 4IUFA 1XNRJ 3MUTP 1I94F 4YB5A 2BJEA 1DARA 3B54A 4YR2A 5B09A 1RZTA 4JI3H 2G07A 3BKFA 3KBBA 1FO1A 5ALHA 2FB9A 5J2MA 3L09A 3UBPC 2ZDHA 2VFRA 4EBDA 3MCNA 3W9IA 4C5ZA 1CJKA 3P5BP 3ZTOA 2LQBA 3JTNA 4PXBA 5ALPA 5IYZF 3U9SA 4TVAB 3TA1A 2CWKA 3PRVA 4PHDA 3FKBA 1N62A 2J9EA 4DPWA 3H0LB 1RG6A 3ORYA 2ZUAA 7ICMA 1HBUA 2I2YA 1FJGH 1K0VA 3BA8A 3G86A 2CWXA 3J80W 2DL0A 1TWHA 4U7UD 4DL3A 4UUXA 1LK7A 2VA2A 4EZ6A 4NX9A 2RB7A 1E6YA 9ICIA 1Z4UA 2FZKB 1RA6A 2P50A 3EJMA 2UU9H 3UCGA 2W4CA 4IRCA 5J29A 2RQCA 1R8PA 3U1NA 4GO7X 2ZIXB 4CQ1A 3MMJA 2WF8A 4TQRA 2W9CA 1OPZA 1FRMA 2R2UA 2Y1RI 2C3PA 4J9VA 4CNYA 2AQ4A 4DSLA 3K8VA 4MTEA 3AHPA 1EJWC 1MMLA 2KB2A 4I56A 1N0UA 5KG2A 2AGQA 1POKA 2CW8A 4LBIA 4CEXC 2EZXA 4CM2A 3HVRA 2M05A 3EWGA 3HKZE 1O12A 1TKZB 1NSPA 4RAYA 2HOQA 4ALZA 4LH7A 2HAFA 1QY7A 4MKVA 2BA9A 3SBMA 3CCJS 4LZGA 2ZG6A 3QU2A 1QDUB 3C2PA 5L9NA 2WW8A 1HHQA 4MV3A 3KG4A 3Q24A 2PMZE 3PRDA 3VZIA 1ZQUA 5ALJA 4NLQA 1S1VA 3IRWP 3HPOA 5D1PA 1OPIA 4Q8FA 4DF8A 4UB8U 1VISA 5AIBA 4KBIA 1W93A 2E5IA 1AUXA 1Y1VG 2ASYA 5J2PA 4Y2UA 3PSPA 2BPCA 2HFNA 4LH8A 2ZIXA 4MAKA 5K14B 3KFWX 4CT9A 4CNUA 5ETQA 3L3FX 4CLUA 2FMSA 1YBQA 3POTA 3TUIC 3I0RB 2NQPA 4LSXA 4I2DA 1J5EF 1BD6A 5IC6B 1BQMB 4DLEA 2ZIUB 4QZDA 1YJVA 3Q2OA 3GSDA 2ROGA 2MTLA 4F26A 7ICNA 3EPIA 4RB1A 1TV6B 3U1LA 2IOFK 1Q53A 1HNWJ 4EZ9A 2PMHA 1TKZA 1HEKA 1SI9A 4I1TA 4DR3J 3B9JA 1Q79A 5ALZA 1RHRB 1V5VA 2KKVA 3KHGA 1LWEB 2BPFA 5HMDA 2OAUA 5BOMA 4US8A 4EMDA 2GLEA 2W6PA 4O3MA 4WE1A 3WIVA 2FE3A 2QS8A 2MGZB 2VPWB 2C3YA 3C1YA 2QA4S 1CPZA 4CDIA 5L1IA 4LRAA 4UATA 3FMWA 2CKZB 2R93G 5B08A 3TIGA 3QRRA 5KG5A 2K7KA 4L3KA 3RB6A 4NXNH 3L95X 2LDIA 4CO0A 4LF4J 3D1OA 4ZHRB 5BOLA 2O1PA 1U1PA 1E9ZB 4LRBA 1HMVA 2E2HA 3MOZA 3T19A 3SYZA 2JA5G 2UZAA 3OT9A 1RPLA 3AN1A 3RB3A 5D4LA 5BR8F 5CZVA 2ZIUA 1NK0A 2OMOA 2Z00A 2P6TA 1TV6A 1BQXA 1RLCL 3LOUA 3JRWA 4PHAA 2EK1A 4CCHA 1AA1B 1N5VA 2HZAA 2MXYA 5J2TF 4IDKB 4GRSA 3K58A 4RPZA 1LWEA 2H3VA 1T03B 1M5PC 3GG0A 1FEHA 4Q0YA 4ZJLA 4TV8F 4MV8A 3V5RA 5KFRA 2GHVC 5LM7E 3J7YU 3T81A 2DNRA 2LQ8A 4PXDA 2MGZA 1SXLA 2F5GA 2KT5A 2FLOA 2XM3A 3FJ2A 3T1HH 2RIJA 1YTYA 1J5OB 3WC2A 4ME6A 2KHCA 4RW4B 2VDIA 4LQ3A 5A2QW 2HHVA 3DM2B 1SJQA 1DXSA 3MXHP 4LRDA 3IBCB 3ZC4A 1LV5A 4M5KA 2RDJA 1S5LU 8ICRA 4ZHRA 5KNIA 1VLOA 3A0BU 3I82A 3MGVA 4M6WB 8ICUA 1EX8A 1C3OA 3Q8MA 4PRFA 3QT6A 1M5SA 5C5JA 1I94J 4RR5A 1TU0B 2O03A 5DRKA 3PR4A 4YG2A 2OPPA 5CP2A 1BGXT 4UW9A 3T79A 1KVKA 5KFSA 1ECWA 3QU7A 3TW0A 3VWSA 1RT1A 3H2VE 4CDGA 1DURA 3CD5A 4P0PA 1AFJA 4NPOA 4IDKA 3KLGB 1Y7PA 1JB0C 5LA6F 4J9MA 5DG8A 2E7WA 3HJVA 1WDTA 2CQ2A 4LH6A 4CNQA 4ANCA 3MMBB 2OI2A 3L3CA 2E1RA 2B9WA 3H8WA 5HANA 1QSYA 4DO9A 3KUEA 1H98A 1IBLJ 1SCJB 2QYGA 3UMBA 1TUWA 3MCSA 4RL1A 4OL8A 2KL8A 1MG7A 5LSOA 2CNLB 4RW4A 3QT7A 3S8SA 1EP4B 2B6AB 1WNEA 2PO4A 3BAAA 4UCTA 4DOAA 5FDLA 3PO2G 2VL1A 2ZJPQ 4M6WA 1S5ZA 5D4OA 2I1RA 1OY6A 1HL6A 2PA3A 5D6GA 2HJWA 3LWBA 2A10A 3ZXWA 1GH8A 3FFIB 3MAAB 1H74A 2XCPA 5KFFA 4BC7A 4ZP6A 3FM9A 3Q8SB 2WYOA 5DS7A 3MOJB 1IM6A 4M9HA 1RK8A 2CZ9A 2KJWA 3NWRA 2C00A 1Y10A 1VJ5A 2MAXA 4O2BF 1U1KA 1TL4A 4DV3F 3KLGA 3VF0B 3HFZB 5L1MA 3CCRS 4LMZA 3K1ZA 3BSAA 3MMBA 3CC7S 8RUCA 1I5OB 1SJ1A 2OD6A 2WAQD 1NNDA 1V3RA 1Y14B 3UPQA 1ACMB 1RADB 1S0MA 1S4EA 1WI8A 5E2QA 4C0BA 2GQ2A 2XYPB 3A1YG 4M9GA 1GEHA 2E5LF 1XDNA 2F8EX 4HLBA 2UUBF 2B6AA 1KFSA 4DS5A 2BW7A 1KQQA 3U7JA 2OTLS 3CD0A 1TMJA 3G8TA 1F2HA 5IZHA 1Q86T 3J7AK 3JXOA 1Q7LB 4NLTA 2ACYA 2CPHA 4WJ3B 2Z2MA 1O03A 3FFIA 3MAAA 3OSNA 1UPHA 1NK7A 4LF7J 4GKKF 2MU2A 2KO1A 3CULA 4LVNP 1PBAA 3CRXA 2UXDF 1RTIB 2AU0A 5HMXA 4P2MA 3R6LB 5ALWA 3ILOA 5LJ5Y 2AGPA 2LLZA 2WFAA 3SV4A 3JPQA 2J8AA 2DJWA 1GO3E 4F5RA 2KN7A 3CPWR 2B21A 1ZQMA 2P0AA 2KVCA 2QL7B 4JWMA 4ZJOA 4A8FA 2PKEA 5H9FK 4B9MA 2ZBQA 2BB0A 2OFGX 4X66J 4ZCIA 3RRKA 1AZSB 4F4ZA 2AX0A 2YY3A 4YN3B 4DL5A 3RR7A 4DV6H 4LR7A 3V6JA 2IM1A 2J9DE 5EX3A 2KHVA 3MM5B 2BJ9A 4HI2A 3DHXA 2CVIA 4JI1H 5AKIA 5A6WA 2O3DA 3MPUB 4X64F 4C97A 3RJ0A 3HOYG 5AIAA 4DR2H 1TAUA 2FY8A 3Q2TC 4HNUA 3JYTB 4BDPA 3AL0B 2EEYA 2UVWA 1SH0A 2KYZA 3OV7A 2WTFA 2DQNB 1E4EB 3FC9A 2HZCA 5F8JA 2UVRA 5J0YA 4LF8H 3EGJA 1P9YA 2ZTEA 2OIHA 1HNIA 2DIKA 4B9NA 3IWXA 2KG1A 1UT8A 1BNCA 1PK1A 2WF5A 3LW5C 3TZWA 4F0RA 2HK3A 4DQRA 3OUYB 1RABB 2RUGA 3SFGA 3BO2A 1YJRA 2ZEJA 3MF5A 5CD4H 4ES1A 4UTGA 2QLWA 3UQ2A 1S4FA 3NXZA 3QLHA 2DR5A 5AJ3F 2CRLA 3H5XA 4P72A 1ICEB 4B3MH 2LCWA 3EGZA 1XMOF 4DF4A 2HHTA 5H9EK 3FZ2A 3NUQA 4GOAA 3H2UB 4DPUA 1N36F 5J0OA 4YHHF 3O8WA 3LP1A 3MM5A 1P1LA 2Y9UA 4DR7H 1ZA2B 1G1XA 1ED1A 5ALRA 2BQRA 3MWEA 3OPKA 3KUGA 3GTGA 1TKTB 4W90B 5B5EU 4EO8A 1E4EA 3VAJA 3ORRA 4RQ5A 5A8WB 3OBIA 1OO0B 2LVWA 2VKQA 2ASDA 1HWJA 1J2MA 4I6AA 4DR4H 5F8GA 3T1YF 5AKHA 4PABA 4A8XA 3HWTA 4JBCA 1NPPA 2H3IA 3BPDA 2F77X 4FS1A 3OUYA 2C42A 1CS4B 3EYYA 1ZQTA 1MLAA 3KLIB 1VQ7S 3RJGA 1FWKA 4RUAA 4JI7F 1BXNA 3PFEA 3VPBA 2VA8A 2XZTB 1PCAA 2OM6A 3CUNA 4FNIA 2EPIA 5DZ7A 1MMNA 8ICAA 2HWTA 1XNQH 5IWAF 1SIJA 2MQMA 2D3OR 3U9TA 4CC6A 1T05B 1ZOLA 1EIYB 2BQUA 1C20A 4NEYA 5HP1B 4EGJA 4JI8J 3MBYA 3P5TL 3PW0A 3HCXA 4O4IF 4J9PA 3HHLB 1VI7A 1RE1B 4B9UA 4Q2MA 1Y00A 2HS3A 4P74A 3JQJA 1JLEB 1FWPA 1CG2A 2JOQA 1MNEA 3ZDCA 2ZIVB 4UF4A 4FBTA 3CSKA 3O5TB 4ZPVR 3OL7A 1MU2B 1WWUA 1TKTA 4ZA1A 1DV1A 3SCKE 4MIBA 3M7VA 3MI7X 5F8IA 2RRBA 4F4KA 1A6SA 4MAMA 3RUBL 2IJNA 2B9YA 5A8WA 3N7RC 2XB2D 2V4RA 4ZKAA 4OD0A 1ZETA 1PX2A 4KHPJ 2BKPA 3PHEA 4QU6A 1WR2A 3ZDAA 4ELVA 3DI6A 4KGZB 4Q0BB 3NAIA 4Q7AA 3PYEA 1XQIA 2EKYA 1CS4A 1S12A 2Q2TA 5EE1A 5DB8A 4K4TA 3SDEB 2BDPA 5HMYA 4RPXA 1VR6A 1UZHA 5A0LA 1U25A 3QWPA 2HQ3A 3KFUF 4MK8A 1JI7A 2PMZF 1WOSA 4NZ7A 2L9WA 3H2LA 4FKYA 4FVMA 2H5JB 1EB0A 4DV7F 4EFBA 4IQVA 4RDWA 2AYGA 4R7RA 1SEIA 5E3CA 1T05A 2BR0A 4KAIA 3C6TB 1IBMJ 4M0AA 3P45B 1I50A 1VDVA 2W3RA 3RH6A 3HHLA 3HSDA 1PGZA 1N63A 2VC0A 4I2GA 2JR5A 4KRWA 2IOHA 1L3TA 2W6ZA 2WVFA 2QTWA 3TYTA 3GILA 5AM3A 1WI6A 2ZIVA 3R23A 4RU9A 1RT4B 2AWZA 3DYAA 3GIIA 2KHQA 2OHFA 1NHKL 3GTOA 1WC6A 3R1HA 2GLTA 4NYOA 3ICJA 1TVRB 4HTIA 4ICLA 2AV5A 9ICOA 2DPJA 3I4MG 5AK5A 1K47A 3M6XA 5KG4A 3ILIA 1W25A 9ICTA 4F50A 8AT1B 3VQSA 4C3KA 2W7AA 4M5LA 4DUZF 4Q0BA 2QB1A 3L7UA 1IWGA 4DV1F 3PR5B 3V7KA 1A5OC 5AXLA 1HWLA 4BXXG 4CF5A 1XSPA 3SDEA 3HXMA 3BBBA 1ZQVA 1SKSA 4UAYA 4GKKJ 2X0SA 3HVWA 1M7JA 3HHDA 9ICFA 4LF1A 3Q8VA 4WJBA 4I69A 4WTOB 1KDHA 4MKBA 1X5OA 2QT3A 1QSSA 1A5NC 4I4TF 3VGUA 4G1QB 2HBYB 1QJHA 1RHUB 2MY7A 5CZXA 4IKAA 4U95A 1BLUA 3MUVP 1N32F 3M4IA 2HHHF 2DHSA 3M8QB 6AT1B 1HR0H 1P6TA 4XIUA 2KJVA 5C4XG 4DR5F 4DV4J 3G2XA 2ZH8A 1R31A 1RU2A 3V81A 5T7LA 5E3RA 3H4DA 2RHQB 5IYDG 3O44A 3FNNA 3P96A 4LFAF 4KITB 1PJ7A 1RT4A 2VOOA 4M94A 2XLKA 1VK8A 3HJEA 5DBBA 5AKGA 4DSIA 1YRRA 2OODA 4KH0B 3L9ZA 3CJTA 5C44G 2CQYA 3T41A 3TADA 1RM6C 5DQGA 1W7WA 8ICBA 2R86A 4KLFA 1U2CA 2IVYA 2KFZA 7AT1B 5J0SA 1GMWA 2DIVA 3N97B 4WU3A 1VBZA 2WSCC 2I9GA 2VBXA 1DJ0A 3HZGA 1GMUA 1S48A 1JN3A 3I76A 4M9NA 7ICGA 4XTTA 3MURP 2VKRA 1Z1BA 4X4OA 1TWAA 3DOKB 1WSRA 3AA8A 1S77D 3BM7A 2BE2A 1SV5B 5EOZA 3PX0A 4QIGA 1RK5A 4KLHA 4C8LA 1C30A 2D3O1 2B6GA 1I94H 1CULB 1RWVB 3K4GA 2RD5C 3S1TA 2QMUB 3A3OB 1IKYB 1DK2A 1QVGR 2RLTA 3SCJE 1SJFA 4Y2AA 1RHKB 3W1YC 3PVXA 3HB9A 3QRQA 2Y1IA 2LYHA 2VBWA 4J9QA 3BO3A 5IP9G 3SQIA 5IIOA 1JX4A 3HXLA 1AFIA 1NPRA 4Y6IA 4ZPDA 1JXLA 4QZ8A 2W7PA 4NASA 4DL6A 1FX4A 4TXSA 3WK9A 1IBLH 1RISA 1FNXH 4P2XA 1ZA1B 2ZNZA 3GFHA 1QUVA 2JA8G 5AM4A 4RBUA 1Y88A 4EUVA 4P2FA 2E66A 3QZ8A 2QGFB 1S0VA 1HI1A 5J0PA 4IAJA 2O67A 2IOFA 4Q5VA 4ILLA 2H3ZA 2VBZA 4EEQA 1SV5A 1YZ6A 2WVCA 4NWBA 7FD1A 5J2UF 4URQU 2FK3A 1CULA 2KXFA 1WELA 3FBBA 3DLJA 3TIIA 2HSEB 1ZXIA 2ODGA 2DBBA 2FJEB 1EJ7L 2GWNA 1T3NA 3QYPA 2UUWA 1F5CA 1PIEA 3DKDA 1RYSA 4LSLB 2HEKA 2Y0SA 4TQSA 1A77A 3QSYB 4CQCA 2R18A 1FWFC 2V63A 2ZE2B 3ZZUA 5H1SV 2W9AA 4PXCA 4CLWA 2VG7B 4DX6A 4MYUA 5KFDA 3GYXB 2YW2A 4LSNA 3M2RB 2P9EA 2LEBA 4EPEC 4IL6U 2OPSA 3RB4A 4YR3A 1N33J 1SUQB 1OY8A 1XR5A 2BCRA 4A8QA 4GY7A 3I5BA 1DQ9A 1A76A 4P0QB 3A0HU 1WCLA 5ETOA 3B4MA 2DITA 3MM8A 4ZJQA 4UAVA 2RHSB 1VBGA 1R6VA 4QWAA 4HI1A 1RT7A 4RNHA 5THWA 3NMAA 2R93A 4YXJA 4JK1A 3EXYA 3LAKA 4DSFA 2PSZA 1BVSA 4ZHQF 4ID8A 4LBPA 4AYBE 5BPFA 3KJNB 4OYOA 2ISPA 4DSEA 3MEDA 3MR5A 2MZRA 3EDQB 4WK3A 3MPVA 2JA5A 2AJ4A 2V69A 3DLEA 3ISNC 4MV7A 2JZ5A 2JH3A 4WIIA 3T6BA 1N54B 2VFVA 3I32A 4DV0J 5J0UA 4MFCA 1SH3A 1ZQQA 1YJUA 2IMOA 4CLZA 1J5EH 5LMNJ 1WTFA 1RWKB 2ZE2A 2ACMA 3IM9A 1YJ9S 2CKWA 1T11A 4N8OA 4I27A 3MM9B 4C5YA 4I7HA 3SEOA 2XD4A 3M2RA 1N5QA 4X66H 1A5LC 4CO4A 4USMA 1CJVA 1GO3F 4OJPA 2E9RX 9ICCA 1JLAB 2Y0SF 1XC9A 4P0QA 2B7CB 2VODA 1WWHA 4PL2A 3DV9A 2W11A 3NGDA 4Y2KA 4TUQA 4DR1F 1SIZA 2JH7A 3KJFB 4QPTA 2HBQB 1LW0B 4LREA 1RBAA 5KT7A 1B0PA 2HAIA 2GVZB 4DSJA 4DUZJ 3TR5A 2VPYB 5KFUA 1YMYA 5KT6A 4C3MA 4U6PA 4C8MA 2RMLA 5GMEA 2WVEA 1RSCA 4OZ3A 1IUJA 3QT5A 4YMMA 3MTWA 4WKYA 1Z00B 1CQNA 3TNVA 4A8MP 2XQCA 1QAIA 3MM7A 1VQPS 2LI6A 2R4FA 1N88A 1N32J 3MKVA 2FDRA 2NVYA 1BPBA 2MUTB 3W2WA 4FPRA 1Q81T 2KD1A 4PWQA 1YX2A 1S0NA 3TZYA 3QZ7A 1RKJA 3J81U 3HULA 2B8QA 4U7UK 3OUUA 3B8HA 3DOLB 2GV1A 4F0KA 4OZ1A 1JLAA 2OYYA 4ZP7A 4WYWA 3H0RB 2IPOB 3HT0A 1JLQB 2WHOA 1IE7C 3DCAA 3AH6A 1LW2B 3KLHB 2NRXA 3U1MA 4ZPTR 3LAMA 2KE7A 4X84A 2GVZA 5DDMA 2IJFA 1N34J 1DK3A 3GTLA 3J7Z5 1LXJA 3CJ4A 4RBTA 3WK4A 2CZ4A 2OPQB 1WUDA 4P75A 3H3VH 4RUHA 2JLFA 4ZVQB 5KFOA 1FWIC 1SJRA 3HHKA 3ENQA 3VCDA 3D6HB 3W3SA 3SQGB 2MKKA 1Z00A 4DDFA 4KN4A 3BE7A 4ZS6A 4DJBA 4CLSA 2FD2A 2ZUBA 1PBUA 1H2VZ 4DFJA 4WFAQ 2BGWA 1VRTB 9ATCB 4J9OA 2K3KA 1D9AA 4DV5F 1REVA 4NA2A 2JZBB 1DV2A 5HJXA 1JUDA 4C8NA 5KT5A 2WB1D 2GWSA 3O0FA 2HNDA 1KOHA 8ICLA 1YBAA 2IRXA 2A1JB 5GAHU 2YPYA 5HMFA 4B9TA 4UBCA 3PSTA 1LKZA 3I9ZA 2HCFA 3DOLA 4KGXB 4YFKA 5DGBA 3QGPA 1WOOA 1EJUC 1G7CB 3LVVA 2NZ4A 1FNOA 1JLQA 3OXFA 3BQTA 3BH7B 4A2AA 2YB4A 2YX4A 3DNCA 3KLHA 3L4BC 4QIWC 4NLXA 4FYDA 3GG1A 1FXDA 4A8EA 1WC4A 4F0LA 1A0PA 3ORQA 2DD8S 3EMTA 2R7RA 3B6BA 4RU2A 3AD9C 1XO1A 2O6KA 1FKAF 4M1KA 2Y3YA 1X42A 4DWIA 3HVAA 3MWDA 2ZM6F 3NRZA 2U1AA 4WCEQ 1RAKA 1VQNS 3PV8A 3E2EA 3T9ZA 4QZBA 1F6TA 3THTA 3SQGA 3ILJA 3CF5Q 5HP4A 5AI9A 3N41B 1S1WB 3SCLE 3UD5A 3AA9A 1VQLS 3RRHA 2FHMA 1GX5A 3AODA 3H8MA 3UMGA 9RUBA 4UB5A 5AE2A 1N61A 1VC5A 3V6DB 4V1Ak 2MKSA 1VRTA 5SZTA 4OJ3A 1YRXA 5HO4A 3C2MA 4WFBQ 4OV1A 2CQ0A 1IKXA 1P8LA 1EQ0A 2QL5B 3R1LA 2A1JA 1H2UX 4ILMA 1F5SA 4CO2A 4LBHA 4DV3H 4C65A 5D8DA 1IIPA 4D3HA 1JLFA 2BM1A 2FGOA 2VPZB 3JSYA 4NCAA 3DLLQ 3DRXA 2IAJB 1F0XA 1RWNB 2YKMA 4H9MA 4DPYA 3RJFA 1KN5A 3F2BA 3I0SB 1T9VA 2YX8A 4KFBB 2E5LH 3M9NB 2ZHAA 4AP9A 2UUBH 2YL2A 1A9NB 2GJIA 2QYZA 4NL9C 4X65J 1ZQCA 5DB9A 1TK8A 3TUJC 1WCMG 3HSZA 4K0KJ 3NWGA 2QN6B 5CJ7A 3V6DA 4USWA 1FK9A 1MROB 3IGVA 3HMJG 3I5CA 1K83A 4GKKH 1Y5IB 1C1CA 5M2RA 5FSEC 3N8DA 3ZTRA 2FTRA 2UXDH 3C28A 3HHLD 1LWCB 1FKOB 1H38A 2YWKA 4YD2A 5LT5A 2I87A 3GCXP 1CJUB 2HMXA 2ZITA 1C0UB 2DR7A 3B4DA 5TISU 4IOCQ 1T9UA 3TQTA 3CD7A 1R0BG 2RQ5A 2DR9A 1UC8A 4RQ2A 1ZH5A 1RA5A 2XLIA 4DV4H 1TAMA 2EG2A 3C14B 4DV2J 3E5NA 3PYGA 2W2OP 5KX5F 1MW7A 1XTZA 1X5PA 4ZIVA 1PSDA 2DNHA 4RB0A 2V50A 2R7TA 3OFHA 2QLBB 2E5HA 4F3MA 3RB0A 5GMKa 4KYZA 2AX1A 1NK6A 5HSPA 1RA7A 2KJ9A 1ZYQA 3TARA 3OTBA 1S7IA 4A3MG 3IR6B 3CO9A 1MROA 2IYGA 1Q8KA 1NKEA 1KR4A 1L7NA 3J81Y 2UVUA 2YMLA 4BCAA 4NRTA 5F41A 3FMAA 1LWCA 1SWVA 4RBVA 3LGNA 1ZQ1C 5ETTA 1EARA 1C0UA 4FYWB 5IYCG 3M6WA 1NJIT 2G06A 4O3OA 2IJRA 1FT8A 3S6JA 4R0EA 4LIWA 2PA8D 2BQ3A 1OMSA 3C14A 4CQDA 4F5QA 4LF6J 2VG5A 3C6UB 2F1IA 5ETKA 2PFNA 1IR1A 2DNMA 3HVTA 3JPOA 2E8PA 2KZ3A 3BV8A 3WQPA 1RTDA 4I6WA 3DF7A 2KJ8A 4F5NA 2R87A 9ICJA 2P9GA 4YHHH 2IHNA 1YRTA 2R8IA 5HK4A 2K4IA 5KAIU 4GBDA 2GSEA 1O75A 1JLCA 2F4FA 3UN3A 1VK3A 3MPDA 4IQXA 1SXDA 4IQUA 3I28A 3R0DA 3DC2A 4RLEA 3K5HA 4TV9F 4KR0B 2J8SA 3AQPA 3N79A 2UUTA 4GKJJ 2OEHA 3AYHB 4A3LG 2K1RA 3BDEA 3CDWA 5ALNA 2Q3PA 3T1YH 2YMQA 2F44A 3PSIA 3G82B 2P9CA 3QJJA 5IIKA 3MMAB 4QYRA 1ZBTA 2RNEA 2BJ7A 2CPRA 3LGMA 1QTMA 3J80U 4AFFA 1PJ5A 2O5DA 3W65A 2PEHA 5M2PA 4DV5J 1SL0A 4JI7H 1IR0A 4RZRA 1K6WA 2HVDA 4JMUA 2V4JB 5D77A 4A46A 1EHIA 2MA1A 2N7CA 2GVDB 4ZPCA 4JI2F 3GFYA 5K9FA 5CYJA 4WXOA 3A4TA 1UA0A 3F5EA 2PGCA 5IWAH 2LDYA 3K59A 1GK8A 4NZ0A 1N0VC 3DRSB 1H6KX 3PHTA 4Y2SA 4KV8B 4G3IA 4BKNA 7FDRA 3KXYT 4R5PB 1LFPA 3BS5A 1FDDA 4Y00A 4B3RF 2R2RA 2WZ1A 2BOAA 2HMIB 5A6PA 1N33H 3Q83A 3J81j 4UT4A 3IV6A 5AM5A 3E51A 4F3OA 3WNZA 2YH1A 3TAMA 3QIDA 2B7BB 3TJAA 2W6MA 1IKVB 5I3UB 1NKBA 1SGGA 3G82A 1PC5A 4DUYJ 3N44B 3GU3A 4KLGA 2ADBA 2BVZA 2OXOA 3LF0A 4UCVA 1F3FA 3HOVG 4Y2TA 2QT7A 2Y0BB 3M8WA 3RW6A 2CG8A 2ZD1B 1NDCA 2V4JA 2AF6A 4QU7A 4ZVEA 2QB0B 4U7CA 2DO4A 4DV7H 3RW7A 2R92A 1S1XA 3FRYA 4XPCA 1M0WA 3B0YA 4MFFA 4U67Q 4ES2A 1RHJB 5HBMB 3H5SA 4C5BA 5AXMA 4MKYA 2G5HB 3PRBA 3QGIA 3IO1A 2FPIB 3V4ZA 3WZ0A 3UDLA 1B33N 1QE1B 3KKAA 1R8HA 4TU8A 2HMIA 4USUA 1U49A 4KHRA 4RW8B 9ICEA 2XWYA 2LKZA 3BN4A 2DXEA 1ZAXA 1MWQA 4CM0A 2XZDB 2HDOA 2MPUA 1NFGA 3G6YA 2VG6A 1RK6A 1IKVA 4XO0A 2FLNA 3K5PA 1VBYA 4DFDA 2IM2A 4DUZH 2M5YA 5L1KA 4NXZA 1RAIB 1X4DA 2R3VA 1WKKA 4DV1H 1FWBC 3JSMB 4CNSA 3H98A 2G08A 4MTDA 3D6MB 1YDLA 1COOA 1NDPA 2ZD1A 2UUAJ 3IRUA 2AZ3A 3M05A 5HROB 1NB2A 1FE4A 3PFOA 5J2CA 1KQSR 1OYEA 4M9UA 1VBXA 1KD1T 4Q8EA 1N32H 2HHHH 2G0AA 2DCUB 4RUCA 5H9FJ 2OSRA 2FK1A 1KBUA 4PH5A 3MR6A 4FZMA 2DNOA 2BANA 1AUVA 2KU7A 2EAPA 4DR5H 5D0RA 2DBYA 5ALTA 4UOCA 1RQLA 1KNZA 4Q45A 2MQLA 1QE1A 1S10A 3K2YA 4LFAH 1P9QC 2JMGA 4RW8A 4H4OB 1TA8A 3R7SB 2UUCF 4DQIA 2AQOA 1SL2A 4M9JA 3GDXA 5EX0A 3MTKA 3GRIA 3VPCA 2UBPC 1RGVA 5ALYA 1EJXC 4M5HA 4KQZA 2N4DA 1QUPA 1NNLA 3GTMA 2XS7A 4B3SJ 4P73A 1FO4A 4ETXA 2EAOA 4Y2VA 1N34H 4IQMA 2L5YA 2C2ZB 4M04A 3D68A 1NDKA 3OXGA 2FVKA 3AOBA 1KKHA 5J2GA 4UAUA 4JYAJ 2Z2YB 1KTVA 2QEXS 1I6UA 5DBAA 4LFBJ 5FPOA 5HMZA 1DIKA 4DXLA 3MJFA 4CLPA 3PKMA 1C1BB 3CC4S 2E1EA 2ZHBA 3UMCA 5CEHA 3D0IE 4J9NA 4PG7A 1E4FT 3W8GA 5DO2A 5F0UA 4OYPA 2GH1A 4OYMA 3T5HA 2RU9A 1CVJA 4K2XA 2NSCA 3UDCA 3VAIA 2R7UA 2M2BA 3PJWA 3BB5A 5I3QA 2MZJA 3GIPA 1NB7A 2KSOA 4YB7A 2VUNA 3VAGA 3R5BA 3JPRA 8ICZA 1XK8A 2ATCB 3MDWA 4H4OA 5ETNA 2Q43A 2DUYA 4ZOHC 2LA4A 4RQMA 3JAMU 5JRTA 1HW9A 1WUUA 4OJ1A 4G7EB 1TL7B 3LP2A 4UASA 3J80Y 1S1TB 1WG1A 2UXBF 4Y34A 3L4KA 3MEEB 3O2IA 5CA1F 4FE3A 3ZDEA 4BS2A 3UQ8A 1R9YA 2WAQE 3VC8A 2XSJB 1BNPA 3CCWA 1VQ8S 5A76A 1XRTA 3CIZA 1RT3B 3BA9A 2OELA 4C8ZA 3R5DA 3R2DJ 5IINA 3W63A 1FRKA 3IWLA 4QIWE 2NYVA 2JRSA 2C35B 1WHXA 3K17A 4OJHA 3Q1KA 4ED2A 2CZVC 3OTQA 1CQMA 1KQGB 1YNYA 2HVIA 1RYUA 1M5OC 3NEKA 1QAXA 4Y2XA 3IXQA 4OZ0A 1NM2A 2NXEA 4CH0S 1BNOA 4EX6A 3EXCX 2EAMA 1RBLA 1Q5YA 4L73A 1X0FA 2MKJA 1FJCA 3OR2B 1H72C 2F8KA 1RAHB 1KDNA 1S6QA 1S1TA 1HNXF 3AQEA 2HS4A 1AYEA 1NHVA 1BY9A 2CQ3A 5IV4A 4UB6U 2MLZA 1RWOB 3MD3A 4B3RJ 2GFFA 4OI1A 5C7PA 3V72A 3OR1B 4NYZA 5KOWA 1NLKL 2ESEA 2XSJA 1YGYA 1CS0A 1VQYA 3FKIG 3E0LA 2IBKA 4U96A 3AQFA 3SZ2A 4C6AA 1ZD2P 2YVSA 1IBCB 1VQ4S 4WYLA 4OI4A 4PGYA 2DNYA 3K57A 3SI8A 5ALFA 3RJJA 1Z19A 2VV5A 4H4MB 2R7LA 3LGHA 1RT5B 4NLSA 4PWWA 2CQPA 4RNNA 2MLYA 4JI3J 2C2EA 1F2GA 2Q09A 4F4WA 1SC6A 4Y2JA 1Z2ZA 3BGFA 2CPIA 1RAJA 1JDEA 2LXIA 3NAHA 3SFUA 4UCRA 2MLXA 3MEKA 3KK3A 1ZM3A 3OR2A 1B0VA 1TR0A 1UKUA 3JPNA 1SKRA 1X6JA 4NJ8A 3I55S 4DEZA 1BPXA 2BCVA 4DN0A 4NZ6A 4IHJF 3TKAA 5JH7F 1FJGJ 2VH7A 5CYQB 1VC6A 2CPFA 4USAA 3ZTPA 5AKKA 4LT6A 4TU7A 3O3LA 4NRUA 1EUDB 4DR1H 1U47A 1PK3A 3UN2A 3NBPB 4L3NA 2JC1A 1XN9A 1KRAC 3D66A 4LSZB 1XU4A 2XICA 2VJ5A 3OOQA 4LF5F 4H4MA 2NU7B 3HKZC 4LRFA 4C4TA 1RT5A 1RWXB 4ED6A 2BEFA 1UVMA 1Z2OX 2MZTA 1AXQA 2HGLA 1R8BA 4WK1A 2QMWA 2XEXA 4OI0A 3ALRA 5KFQA 2M9KA 4FXWA 2JA6G 3OTOJ 2C2KB 1ZJMA 1ZD3A 3WKEA 3R5CA 2CJBA 1TL1B 2PMZC 1UFKA 4RQ4A 2P35A 2G2YA 1MN7A 4K4ZA 4JI6F 5L38A 2PI5A 2V9WA 1Y3KA 2V9KA 4J9RA 8ICYA 3BGRB 4N76A 4C7YA 2V2KA 3KNGA 1VDHA 3J7ZT 2F4VF 4HT7A 2X1GA 2E9ZA 1XWLA 4USTA 3MC1A 4AXJA 4J9LA 3OTEA 3NCQA 2J0SD 5K2MA 5DLGA 4DR6F 4A3EG 3CVZA 3C8YA 1JXEA 5ALMA 4TN2A 1Q5VA 3NOGA 2XWXA 2LECA 1WC5A 1ZD5A 5JVGQ 2FLLA 3NGUA 1FVQA 4F4XA 1DQAA 1FA0A 4NLOA 1PUZA 3QO9B 1B04A 3KZIU 2ZBIA 3A12A 1WCNA 1Q16B 2CNNB 1Z4OA 1X0PA 2R8GA 5ALEA 1OUQA 2A19A 3DRPB 3M2VA 2WK4A 9ICAA 3QATA 3K89A 5D1OB 2M4MA 3EW9A 3JAMY 3Q2SC 4USKA 2FC9A 1LWFB 2PC6A 1TL1A 2DY9A 4DV5H 3FUYA 4A93G 1UHUA 2DNZA 2HWHA 4GXIA 4HKQA 1UTAA 3NNCA 2CIMA 3A8JA 3BGRA 2KFNA 3HP6A 4I7FA 1YRUA 3SIPB 1ZRNA 1ITPA 1YJWS 1UETA 3R5AA 2QLJB 4I2AA 1U2FA 2L48A 4MFAA 3R8YA 3T1AA 2B4VA 1FERA 1GSOA 4NI2B 1VQOS 3IR7B 2N1RA 1NZBA 5HBRB 3D9BA 2W54A 4IZOA 1TV9A 3U27A 5EOYA 1TKDA 3UR0A 4A3KG 3TZZA 4ZVHA 3ISCA 2QKQA 4EPDC 3N2CA 4LFCF 5J0TA 1FKAH 2ZM6H 2FVCA 5HMLA 1T3OA 1TK5A 4NXNJ 1WCMA 2Z56B 2EFQA 2B9EA 4PJ0U 2UP1A 3E0FA 2IDLA 2MRLA 4I55F 2VHGA 2HZVA 2AH5A 1GTEA 3V7JA 2YTUA 5C25B 5AICA 2CNKB 3M1YA 3FRZA 2CPDA 3M9MB 3C0FB 2YX7A 4YB6A 4MTPA 1OSCA 1C4CA 4HEA9 3AM9A 4XAKA 3N01A 1CUKA 3C15B 1F60B 5K8NA 1X31C 4PXEA 1WOPA 2RDIA 4ECXA 4EG0A 4EFEA 4WXWA 3NASA 1X40A 2RSQA 1HNXJ 1KLMB 1HPZA 5GAGU 3Q8UA 1LXNA 3KAJA 5I42A 1S9EA 2E3TA 4ZCMA 4PHEA 1R0AB 4N8NA 4JI0F 2DNLA 3BZQA 2WF7A 2LBOA 4MYTA 4RNMA 4GLXA 3UD4P 1L7MA 4ZVSB 1ONXA 3HFKA 2Y9HA 2J5AA 3KTMA 1JNZB 3HOWG 1JMSA 2FHJA 2X3DA 5GADI 2PXIA 1TKXA 2DWCA 1M0TA 3EZUA 1K70A 1FHTA 2B51A 5AK4A 2AXTU 4ZN1A 4LJXA 3C29A 1F44A 3M1VB 3OHAA 3PO3G 1NAQA 3H25A 5KFTA 4WKRA 3FSIA 5IIIA 5C25A 1X4BA 4Z42C 1FTCA 4QZHA 3BGOP 3N5BA 1WD6A 3DDHA 2NV3A 2WW4A 1D3WA 3PNIA 2FMQA 3C15A 1B43A 3ONNA 2FQQB 5CB4F 4QYZK 3M2UA 5B7WA 4ZP9A 2GZOA 1YITS 4HR7A 3TO8A 1MWZA 5L39A 1F9FA 4C80A 3K5IA 2YTCA 4ETSA 1BWEA 2WSFC 1U8SA 3LP0A 3GV7B 3FGVA 4H4KC 2YBVA 2LKYA 3CYMA 4I64A 2JHEA 2CQ1A 3H5YA 4MK9A 2FJZA 4OHWA 4K4YA 2R42A 1YG0A 2KFYA 4FVCA 2XHCA 4B3SH 1ZTWA 3BS9A 2VOBA 2V2QA 2E1MC 3ET6B 3PYFA 4I2QB 4FKXA 2A2DA 2VANA 1LK5A 1Y1WG 3BZKA 4RQ0A 1UAWA 4K4VA 4FF3A 2OGJA 5IV3A 5F3XB 2ILYA 3PJ9A 4DZHA 1RP5A 4NCGB 1R6YA 2C3UA 1E4GT 2WOMB 2XO7A 4KO0B 2VQDA 3B78A 5LMUF 2ADCA 2RGRA 4C7QA 1IOWA 2GIRA 3SE7A 1S7HA 1ZQLA 1RXWA 3SXLA 3UXOA 3SENA 4IFVA 4YAKB 2BZFA 3QPIA 3SCIE 1JJHA 4YR0A 4O5CA 1FDNA 1R8CA 2ZBPA 1T95A 2F7VA 4I6YA 1VKZA 2K4PA 4FZVA 2R7XA 2HNYB 4DG1A 2FVRA 3NNAA 3N6XA 5AT1B 5IQQA 3GIMA 1FRIA 2Y0SC 2POKA 5C42A 2DGXA 5KFCA 5HVGA 2FY1A 5AKJA 3DUGA 3ET6A 4I2QA 1BPEA 4WHBA 2ZIWB 4Y65A 1EUCB 2I6XA 1HARA 4RO0A 4D3GA 3W62A 3CNQP 1ZQEA 3DXSX 1I7LA 3GTKA 1SXEA 5F8NA 3UM9A 1BC6A 4P9SA 4U9RA 3RAXA 1SBRA 4WFXA 1CQIB 3MR3A 4KO0A 4CLFA 4PWUA 1ZPVA 4HL9A 2FPGB 2ZH4A 4X4QA 1UW9A 4O23A 2W2MP 3DGPB 3N4WA 1VIXA 1N5YA 1J2NA 3QAUA 4JI2H 2RF2B 1VBHA 3CMQA 4J9UE 4M7EA 2JRZA 5HR7A 5LXRA 5KG0A 1N48A 3ENVA 5L8RC 2YZNA 4PG8A 5AI6A 1Z2NX 1SFOA 3NRBA 4DV6J 2OEMA 2I5HA 2AKWB 2CXEA 4OLPA 1OWXA 1FWJC 2FZCB 3P49B 2HNYA 1CJTB 4O0NA 4W4MA 4B3RH 2KKPA 5KFHA 1EETB 2BKNA 3FMBA 2DNPA 2GO9A 4DR2J 4XYLB 5CA0F 4L1KA 1U1RA 3JSBA 1KSPA 1RWWB 4TY9A 4WFZA 3AJ2A 4WP8A 3NVVA 7ICKA 5F0WA 5KFZA 4PQUB 3GMGA 4LF8J 1FTRA 5BYQA 1N2XA 5D0EA 1G6BA 3VGSA 4BX9C 2D3UA 2JWNA 2KZZA 5F3ZA 1RTJA 4UOFA 4BBRG 1NK5A 7ICLA 1BMQB 4IRDA 5CABA 5E33A 1ZQBA 4BGDA 2KMDA 4NLGA 1GFWB 1SIWB 3HSJA 2UV8G 5AM1A 3GIJA 2ASJA 1SZHA 1T9WA 1ZTTA 3QFFA 1A0OB 2XLJA 3WIUA 1KP6A 4Z6DA 2AMCB 2N4CA 4NLWA 4KLSA 4I0WA 3KLVA 1L3UA 3W7BA 2M9NA 4ATNA 4B3MJ 2ZH9A 4HACA 2EZYA 1TWGA 1IXKA 2NZCA 2ZOMA 5IS2A 2FIUA 5ALOA 4NXMJ 2D3DA 2YYAA 3VGVA 3I9V9 1F5BA 2YNHB 2F9JA 5DQHA 2PMWA 2R2TA 4DR7J 2GPWA 2FPPB 1EETA 2E1PA 5ALQA 3OVAA 4DSKA 1Q8LA 2EFPA 1PYTA 3CCZA 4KMUA 5FLMG 2QFIA 4TY8B 2WF9A 3M6KA 1QD1A 4PQUA 3CJRA 3SSQA 4MF8A 4ECYA 2XNRA 4UUWA 2ZKUA 4PGXA 4DR4J 2MKHA 3IV8A 1UJ6A 2WBRA 2K2PA 2JEGA 2YQ1A 2VM8A 1X9XA 2HW3A 3W5ZA 2W55A 2MMYA 1HBOA 4R65A 1B6RA 1U1LA 4QWBA 4ZOLF 2G5IB 2HIQA 3RFCA 3OTOH 3C66A 5DLFA 4QPXA 3G71S 5HLFB 1L8LA 1HFEL 3N42B 1G2EA 1XNQJ 1TMMA 1NBEB 3J7A1 3PKYA 4QWDA 5B0BA 4QZCA 4CT8A 3OJSA 3RFAA 2YNHA 3R7NB 3HX0A 4WPAA 5ETLA 2WONB 1JLLB 3MGHA 3VAKA 4AQYJ 2GO8A 3A8EA 5JXSA 4X62F 2HBLA 3IC1A 4PWDB 5HN0A 4MEYA 2ASLA 2IVFB 1HBMB 2FZGB 4PG5A 4NA3A 5AK3A 5E41A 4MH8A 2JX2A 2F40A 4ZMMA 4QIVA 1XMQJ 4N77A 5DBCA 5B0DA 2AW0A 4OZLA 4F72A 3OLBA 3TJ9A 4B9VA 3RU0A 4RWXA 4UQTA 4QJFB 4KLIA 4L9XA 4LF9J 5AI8A 3QU5A 1RTHB 1B7YB 4F3QA 1X4EA 1ZAWA 5GAEI 2XMKA 2LU1A 1KC7A 1D1UA 4GMKA 2B8PA 1NZ8A 2C28A 4IO9Q 3DDNA 2RU3A 2XZWA 3R5HA 5E7OB 1PKUA 3D6NA 2GO7A 2I38A 4K4IA 1XERA 2WONA 2F8HA 3QNWB 4OYIA 2A1BA 2RRNA 2ZC3A 4OI6A 2FYXA 2E7XA 3TX0A 1IBKF 4MV6A 1CE8A 2HBKA 1UC9A 2G1DA 2EXUA 4KMOB 2DISA 1FF2A 3M8PB 4NLVA 2E5JA 3VQTA 2VQEF 2UXBH 3R97A 2OSQA 4C11B 2LFVA 3D2SA 2UXCF 1NJYA 2BE9B 4V1YA 4O5EA 3FKIA 3QIPB 5ALUA 2AYEA 4F02A 3BZCA 4MEXA 2MCTA 5LL6d 2C2MB 2DRDA 2VPQA 4WD3A 2W03A 3PY8A 4K59A 4F5OA 2HKEA 2XHWA 4JV5F 3LPEA 4BXOB 5K14A 3LP8A 2LA6A 2KEYA 1YJ7A 3F44A 1RTHA 3ICXA 5AKEA 5A6TC 2A3VA 1U0SA 3I0RA 3EWAA 3DEEA 3IAM9 1BQMA 1FRXA 2ZOFA 4KGMA 1U1QA 5F9LA 4RT2A 1HR0J 4G1IA 4KLOA 1WKLA 3M8ZA 3LYSA 4EEKA 3QXGA 1RAAB 4RX6A 2OHDA 2IMWP 3ISBA 1HNVB 4NLKA 5TZVA 2M7SA 3TWZA 4OX7A 2VKZG 3FK4A 4USIA 5IXUA 5H2FU 4HDHA 1HD0A 2YMMA 2DKOB 1ZQXA 1C0TB 2GNKA 4A8SA 5GMDA 4F4AA 3KK1B 3M8PA 1HNXH 3GB0A 2IFXA 4OCZA 2DO0A 4AE5A 4C11A 1X9MA 2JVRA 2FPLA 5B0GA 1VQ6S 2XY6A 1ZRMA 3N40P 5DQIA 4G9BA 1V97A 3UCZP 5IM0B 4UB9A 2HHUA 2W71A 3CCUS 1X9WA 2CJXB 3RN6A 3SMZA 2NR0A 3FBCA 4R66A 4FU0A 3ETOA 3CT9A 2XI9A 4XUSA 3OL8A 2W1BA 1BQNB 5BYRA 2DEIA 2HVEA 1ZQPA 4X5VA 1B64A 3MPYA 3FDSA 2C3MA 3CJKB 1U0HB 2Q0ZX 3HOUG 3K5NA 3AUOA 3GZ7A 5K5MA 2ZVSA 3MMCB 4O44B 4EEYA 2D9OA 2JA6A 4ILRA 1VC0A 2DGSA 1JALA 1KBLA 3OVBA 1EJVC 3W2VB 2FTYA 7ICUA 4E98A 2RKIB 4JI5F 3KUHA 4LMYA 2HHPA 4DLKA 2R7KA 1T03A 3PMNA 3F5AA 1U1NA 2G09A 1C0TA 4X4RA 1RYRA 4L6V3 4YIWA 5GTIU 2ABYA 2Q1LA 2CJAA 4CTAB 4C48A 3ZDDA 5JMNA 2J7KA 2FHJD 4B3TF 1J5OA 1WEXA 4J37A 4QR0A 2J6TA 2MZSA 4IRKA 2YX1A 2HS0A 3DM2A 4MV4A 3ZNUA 2MQNA 1ZQIA 1HWKA 2HI0A 1TL5A 2PLMA 3HF5A 1S03G 4UY8T 5AKZA 1H2TZ 3GFXA 1DRZA 5KG6A 4OHYA 3AD7C 4NL5A 4YS2A 2MKCA 2A6OA 5AI5A 1R0CB 3T1HF 3TQEA 1BQNA 3D6FB 2LU2A 8ICCA 2W2NP 2Z30B 3IFEA 4LF5H 2XI2A 1AW0A 2X3GA 2LP4A 2YWGA 1DGJA 5DJBA 4RQ7A 1NEEA 2OO4A 2VPSA 2R7OA 2K8GA 3WK5A 1I7NA 2KSWA 2K89A 4HHHA 1S99A 5F3TA 4M5NA 4ECSA 4C5AA 1B4FA 3EVMA 2JJ4D 2DH8A 2YKOA 1PO6A 2RKIA 5KG7A 2RHFA 1PVPA 2HYIB 5JVLA 2ZUGA 4QJVA 2J9CA 4I28A 4RWWA 3IBWA 2J7WA 4OFZA 4JI6H 4I2IA 1Q0NA 3VV2B 3DOMB 3TX8A 3DMJB 4KLQA 1GXTA 2F4VH 2YZMA 1HQ2A 4AYBC 2HGMA 1ZD4A 4FXVA 3RJKA 2HBRB 3NVZA 2G0IA 2K8AA 2IP4A 4ZLNA 4DR6H 4WP3A 5JUMA 1URNA 1EP4A 4YN4A 5EDWA 4DU8A 2DTJA 2R6FA 3J7YI 4PCQA 1RB0A 1F3VA 2FJDB 3RTXA 1D8YA 4CNTA 3MDUA 4UCSA 2NPFA 4PPZA 1B0TA 1HD1A 3EE3A 3FC4A 3DLGB 5HMWA 1DOQA 5BPHA 3SSSA 4CLYA 5KFXA 2EBGA 1ZS6A 1RQ0A 3T5JA 1VQ9S 2K8CB 3WX8A 1BXRA 1AROP 4DOZA 2JA7A 1J5EJ 4EK2A 1RDFA 3KJVB 2Y0SE 2RUSA 1DTQB 3Q8QB 1M6VA 1Z2PX 3ZTQA 1KVIA 1YZ7A 3DOMA 2J6SA 4N47A 4AD6A 1P1MA 4NLPA 3MD1A 2WHEA 2L41A 3NVYA 3KG1A 4JI4F 4N7TA 2XBPA 4PG6A 2QSWA 4GVBB 1OSDA 2ROEA 2MSNA 1S49A 3GTJA 2QSFA 2NU6B 1HIWA 2V2ZA 4CRXA 2JL9A 1A5MC 4KE5A 4FP9A 4P4OA 1FJ7A 2XULA 1PZNA 4I2BA 2FMAA 4ELUA 4DX7A 1F5AA 1UEVA 4ZN3A 1UL3A 2DNKA 5FLXW 1PG5B 3TZXA 2L9DA 2NPIA 5AE1A 4LFCH 4QCLA 1LFWA 2ZWPA 1ZQYA 2DNGA 2P6RA 2GOKA 2IYIA 4OYXA 4WF9Q 3DLGA 8ICTA 2AJQA 5ETPA 2JFDA 1PC4A 1RA0A 2W6QA 4ES3A 2C3OA 2OFHX 3SD7A 3GIRA 1RTIA 3TVKA 3H0GG 1HA1A 4ZVRB 3RGZA 4X4SA 3M9OB 3MDAA 2KTQA 3F2DA 1KWMA 4E2FB 5BR8J 1DTQA 1Z1VA 1K1QA 1RQNA 4DCPB 2DPIA 2ZC4A 2P6UA 3LALA 4ED5A 5G4DA 1ZQGA 4Y2RA 3KALA 2NREA 8ICVA 3CMAS 8ICEA 3NTUA 2Q6BA 2ZVIA 4QQBA 2HVQA 1TELA 3WC0A 2LM1A 2R7WA 1AZSA 3GFZA 2F8LA 2Z2LA 1CC7A 2YRWA 3MEGB 2YKAA 4CI0B 4NXMH 4K4GA 2WB1A 3RRGA 3G8CA 2DR6A 2VIHA 2KT2A 3WKAA 4ZPBA 3PZPA 3D2NA 2PVPA 4LVSA 1NH7A 3VTIA 3JYTA 3CE8A 4JI0H 1NSQA 5FIIA 1EAYC 1K1SA 3BF4A 3PMLA 5A8KB 3DU5A 4UW2A 1M1GA 3FCWA 4F0HA 1FNMA 1E6VB 1A6LA 2FDNA 1D8LA 1GKQA 3GPAA 5J1NA 1SV0A 1Y1WA 4JV1A 5C3EG 3PIOQ 3A3NB 5JJBA 3OFFA 3CCTA 4OO1J 1URRA 3H0PA 1KJQA 4LQ9A 1VHFA 4DN9A 4F67A 3J81W 4XZ3B 1XNRF 1JK9B 1WH2A 3LTOA 4JI5J 4C0ZA 3Q8KA 3OD2A 3MEGA 4ID5B 5A8RB 1S72S 3C2LA 2J0WA 3M32B 3NS6A 1HBNB 5AKYA 1ZQHA 2EBEA 2ZH6A 4MMOA 5LXXA 3M30B 2NS1B 1N6QB 3UFXB 3CGIA 3LNPA 4AQYH 3RAQA 1Z3EB 1SWWA 2VA3A 2C2OB 2CPZA 2M3DA 4CEUC 3UE2A 4P4PA 2RAQA 1CSJA 4R8UB 4FFDA 4OJGA 4P2SA 5A8KA 2KVIA 1RTZA 5J2DA 2WB1F 1E6VA 1RHQB 5E3QA 4PPXA 2NXNA 9ICUA 1MC8A 3JPPA 2VPXB 3LPYA 1ROFA 2PIIA 1XMQH 5J0WA 4WFNQ 1FWDC 1GXUA 5CA7A 3OTCA 3KLIA 3MTJA 4DMZA 3V4SA 2VIXA 2WF6A 2BZ2A 5AHXA 4WZMA 3OPXA 3A3PB 1XMBA 3ZZZA 3IBFB 2Y8YA 3LK9A 4LF9H 2FVPA 5G5GA 3QGGA 5LMUH 2HQGA 1EHWA 1T0TV 4NLUA 3LWMA 3AXMA 4DV3J 2A0FB 1S6OA 1LVHA 5ALXA 5HP1A 3M8RA 5ALKA 2CZGA 2D69A 1LB2B 2GA7A 3M30A 1KHVA 1YVFA 2MHEA 7ICQA 2EVZA 1JLEA 2FHOB 2MQOA 1MU2A 3MWBA 5IT4A 2D6FC 2E5LJ 4R8UA 3QUBA 2UUBJ 2F9DA 2DHAA 2W4PA