4F4WA

Y-family dna polymerase chimera dbh-dpo4-dpo4 #1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
molecule keywords DNA polymerase IV
total genus 113
structure length 342
sequence length 342
chains with identical sequence B
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4wA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f4wA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4wA01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f4wA04
3IG1A 3RB6A 2IM3A 5CYMA 2BGWA 4ZP9A 5J1EA 1R0AA 4ED8A 1U49A 4QZCA 3ISBA 1S1WB 4KO0A 3EWAA 2B6AB 3LANA 1RA7A 5C42A 4DEZA 5HLFA 1SUQA 3KLFB 1QE1B 3IN5A 1RT7A 2HHXA 1ZQHA 3UR0A 3PW4A 2YNGB 5K14B 2B6AA 4MKAA 4I28A 3HHKA 4Q44A 4IQUA 8ICVA 4IRDA 4MFFA 4UBBA 9ICQA 1ZQIA 3ICLA 2XCPA 2BR0A 5IIJA 4WFYA 4I2QB 2F1HA 5J2FA 3FFIA 4P4MA 1RT1B 4F3OA 2I5JA 2NRXA 1S9FA 5J2AA 4DL7A 2W7OA 3RAXA 5I42B 2ASDA 4YR2A 1DLOB 2UVUA 4NRTA 4K4XA 3DLGA 2AGQA 4WE1A 1RT5A 2YNFB 2RF2B 5F9NA 2BCVA 1ZQOA 5IIIA 1SKSA 2BE2B 1MQ3A 2W7PA 4Q8FA 4RQ3A 1IKYA 3NBPB 4RQ8A 3H2LA 4DFJA 4J9NA 1GX5A 2HNZB 4MK7A 3V6HA 1UT5A 1QSSA 3IM1A 1TV6B 2IC3B 4ZVGA 5J0TA 2JLEA 3FFIB 4RU9A 4PHDA 2ZTEA 1HNVB 3E2EA 3OSPA 3KJVA 4XPCA 4PPXA 3N6NA 4KLFA 7ICPA 1B22A 4Z6FA 2PFPA 3ZDEA 1L3VA 1ZQLA 5KFMA 2HAIA 1TFRA 1S0VA 4J9RA 4O44B 2BCRA 1RTJB 3LWMA 1ZQCA 1JLBA 4BXOA 3E51A 2FVCA 2OPSA 5KFEA 3BJYA 1HPZA 1RT4B 4DWIA 4LZDA 1S1WA 3PJWA 3G6YA 4I2DA 4LVSA 1JX4A 2YKNA 4TLRA 4B3OB 2KTQA 4RW8B 2WB4A 4B9NA 2XC9A 1TKDA 1ZQMA 3MABA 4NRUA 3M9OB 3T5JA 3AU2A 4ZP8A 3C2KA 4RPZA 2KFNA 5KG5A 1SH0A 4MFAA 3DLEB 1ZQBA 2BPFA 4K4SA 4DSLA 3QO9B 3MEGB 1TAUA 1JLAB 8ICGA 3QIPB 1RT5B 2XCAA 1JLAA 2YNFA 1BPYA 4DFPA 5KFKA 4F5QA 3I0RB 1U09A 1Z00A 4DLGA 4NCGB 3RB4A 4EBDA 1LV5A 4IH5A 3UXOA 5J2CA 3HVTB 4RW7B 4O9MA 8ICBA 1S0NA 4UB2A 2I9GA 2OPQA 2AX0A 3FDSA 2YKNB 4UAZA 5J2HA 5F8NA 3V7JA 1HNVA 1ZJMA 2AGPA 2IM2A 2H5XA 3RAQA 3I5BA 3RR8A 4NLOA 4RZRA 2JEFA 2GC8A 3PR5B 1IKVB 8ICQA 2QV6A 3GIMA 1U9LA 1X9MA 1T05A 4O44A 5J2JA 5J0XA 9ICBA 9ICRA 3KLHB 3Q8KA 2WOMA 2WTFA 3IS9A 4H4OB 4I2EA 3PHEA 2AWZA 1C7YA 1C2PA 4BDPA 2ZTCA 4K4HA 4NLXA 5J0WA 5I42A 4R65A 1ZQRA 4NLSA 2C2EA 4M0AA 2ZJAA 4MH8A 8ICJA 4ZVHA 1TL1A 1TKXA 1XSNA 5CYQB 3QZ8A 1JLGB 1UNNC 2O5DA 3AU6A 3GV8B 4TUSA 4RW6B 3CJ2A 5DLFA 1BPZA 4KLUA 2B43A 1CUKA 4IQTA 5T14A 4RQ5A 4Q0BA 8ICCA 3C2LA 5DB6A 3ISND 4YR0A 1N56A 2MUTB 4TY9A 5CWRA 1S48A 2WHOA 3DI6B 3NTUA 5D3GB 1KSPA 7ICQA 1KTQA 1S6PA 1C1CB 4QZEA 1L5UA 4J9KA 9ICTA 4KB7A 4Z6EA 4Q45A 3KJVB 3KK1B 1S49A 5KT6A 2BQRA 1RTDB 4ICLA 9ICWA 3B0YA 3LP2B 3PX6A 4DS4A 2R8KA 4F93B 3SV3A 3MECB 2EC0A 1SL2A 1N6QB 1JKHB 2HNZA 3NBPA 1SZPA 2D41A 1QSYA 2F1IA 5KFGA 4F4XA 2OH2A 4MIAA 2B5JA 5BOLA 4K4VA 2A1JB 4KMUA 1ZQGA 4IG0A 1BPXA 4UQGA 2BCUA 1D8YA 3CJ5A 7ICUA 4YMEA 2HHQA 1BQNB 1EETB 1IM4A 4PQUA 1RTIB 3HWTA 1ZQXA 5BPCA 2JC0A 1HUZA 3MEEB 2P6UA 3QYYA 4QZFA 3CJ0A 7ICLA 3D5MA 1HYSA 5IIOA 2IMWP 4KLOA 4RW8A 5J2GA 1LWCB 4M9HA 4URSA 4IFVB 5EWGA 1FK9B 4ED6A 1C0TB 4LZGA 3MFHA 1HPZB 4F5OA 4I2FA 2XO7A 4MKBA 2GIRA 3NAIA 4DOAA 4NLKA 3D28A 4O4RA 1QLNA 2KFZA 1OS5A 4UBCA 4DL2A 1LW0B 4NM1A 3KNAA 8ICPA 1NK0A 4ZMMA 4EYHB 2R2TA 2XI3A 3JYTA 4OL8A 3V6DA 4RW9A 2JEGA 3MDCA 2V0NA 4ED3A 4X5VA 2OPSB 3T19A 1IKWB 1XSPA 5DQIA 2FLNA 4YG2A 7ICHA 4BGDA 3RJEA 4ZPDA 3DRRB 9ICIA 3BSCA 4F5PA 9ICLA 4MIBA 3LP0A 4FO6A 2V9WA 4YMMA 3DOLB 2OPRB 3RBDA 1ZQZA 4PWDB 4JV2A 1RTDA 4ED1A 1LWEA 4YCXA 5J0OA 4I2BA 2IC3A 3C23A 3CJ3A 4TURA 1S4FA 2BHNA 4I29A 3KMQA 4QZIA 5KG3A 5DB7A 4M04A 1UA0A 1TK8A 3EZUA 1TV9A 3H98A 2FLPA 1S1VB 1I6JA 5KFYA 1SKRA 4EEYA 4E0DA 4GLXA 5FDLA 3TARA 3DYAB 8ICSA 5KT7A 3G6VA 2QE5A 2JZBB 1BQMB 5C24A 5J2DA 3C1ZA 5KG0A 2YNIA 4KLIA 1NK8A 1WCNA 1LW0A 4IG3A 4MFBA 2D3UA 3TFSA 1EP4A 4HYKA 4Y3CA 7ICNA 5KFZA 3RRHA 1QE1A 2FMSA 1LW2B 2J6UA 4YXJA 2VG6A 8ICOA 4LSNB 2JC1A 3DDKA 1NK4A 5D4BA 4YXMA 3H5XA 3JSMB 3T1AA 2ILZA 4IRKA 4PUOB 1NJYA 4WXWA 4I2GA 2ZUCA 1QUVA 2E9ZA 2BANB 1SUQB 3QZ7A 3EW9A 3DM2A 4QPXA 2ALZA 7ICMA 3KLFA 1S0OA 4TQRA 4DLEA 4ELUA 5J2NB 2VANA 3EPIA 4IR9A 1ZQUA 1R0AB 1ZQFA 5KG6A 1K1QA 3FQKA 4KTQA 1ZQEA 1LW2A 7ICOA 2ZJ5A 3FRZA 4DQRA 2RKIA 4C8MA 3GV7B 4NLYA 4DL5A 4ID5B 5J0YA 3C5FA 4JV0A 3UXPA 3DRPA 5CJ7A 4DQPA 2I1RA 1S1UB 3ISNC 1N5YA 1X2IA 1VRUB 3I5CA 4O5KA 4I2PA 3UQSA 4Y2AA 3ETLA 5KFFA 3C2MA 4P4PA 4NM2A 4XQ8A 4KLSA 2B5JB 1W25A 5HHHA 2BQUA 4GXJA 2WONB 1RTJA 4WZQA 5TZVA 4RNNA 3MGIA 4H4MA 2R2RA 3DRRA 4P2HA 4GC7A 3TFRA 1WNEA 5KFXA 4DSKA 1NHUA 5L1LA 1RYSA 7ICGA 4RQ4A 1A76A 3MFIA 9ICCA 2E9TA 4XA5A 5JUMA 1ZQYA 3QEBZ 1RT6A 3BDPA 8ICLA 3PY8A 3QE9Y 1JKHA 1NK7A 2HMIA 1IKYB 4R5PA 2FLLA 5C25A 3PNCA 1T4GA 5KFLA 5L1IA 4IRCA 3LP2A 9ICGA 5DG7A 1HJPA 5J2PB 3V81A 3IGNA 3UDLA 3HPOA 1JLEA 1S9GB 3FQLA 3V4IA 4BXOB 4EO8A 5IILA 2I5JB 2ZUBA 2WOMB 5J0RA 4QWAA 3ISCA 8ICAA 3CDEA 1NJXA 4LQ9A 4RW7A 2PFQA 2D3ZA 4WZMA 4I2IA 4QZGA 2WONA 3KLGA 4NCGA 3JPQA 5DQGA 3HVWA 3ZDDA 4IFVA 4KLLA 1N4LA 4NY8A 1JLGA 4I2PB 9ICSA 4IH7A 3ITHB 4LSLB 5HHIA 3PW7A 5DQHA 2BCQA 5KFBA 1IXRA 3C6UB 1RT7B 4UB3A 1Y88A 5J0UA 1N6QA 3RRGA 3Q8PB 4K4TA 3UXNA 4WYLA 4TN2A 4ZVFA 4I2CA 5J2NA 5J1EB 3ISDA 1ZQNA 3JPTA 1NKBA 4PGQA 3RB0A 1RYRA 4MEYA 9ICNA 3KLIB 5JXSA 1S77D 3PW0A 3QGGA 3JPSA 3TI0A 1HUOA 2HMIB 9ICUA 8ICKA 4QWDA 4O0IA 2MUTA 1T94A 2PFOA 1D9FA 4IFYB 4O3NA 2Q0ZX 5HMMA 3QLHA 5J2BA 2R8IA 2BPGA 3GYNA 2XGQA 3VQSA 1JIHA 2ISOA 4KLQA 3C21A 4PUOA 1XC9A 2VG5A 1DTQB 4M95A 4ZHRB 1HARA 3RH6A 8ICHA 2W8LA 4KO0B 3QLHB 5DGBA 2AGOA 1RT6B 3DLEA 4H54A 4UB1A 4ELVA 2KZ3A 3C6TA 3E01B 1CSJA 3BQ0A 2J6TA 4ED2A 7ICKA 4NYZA 5F8IA 3Q8MA 2XY5A 3BSOA 4B9SA 1JXLA 3C5GA 3H8JA 3MEDB 4DSIA 1HQUA 1H38A 4KV8B 3HKWA 3CDUA 2R8GA 4ZPAA 4ID5A 4DF4A 4RUAA 4YR3A 2UVRA 2WCXA 4IR1A 5J2PA 3V81B 3KOAA 4YN4A 3C6TB 3E01A 3IS9B 2M9NA 4MK9A 1D1UA 4ECTA 4U6PA 3PW2A 4M9NA 2IM0A 2ZD1A 4DSJA 4FBUA 5KT5A 4KFBA 4YMNA 1ZJNA 4DL3A 2NRTA 4K4YA 5KFRA 5HROB 4M9GA 5KFIA 1S1XA 3DLKB 3RTVA 3IRXB 2DFLA 3QGHA 4I2QA 1JLCA 1ZYQA 1L3UA 2HNDB 4DQIA 1SV5A 2ATLA 3KHRA 4DS5A 2GWSA 4K4WA 4BWJA 2ISPA 4YFKA 4ZPBA 3M8QB 1RPLA 3V72A 4DOBA 2BCSA 2VG7A 4NLUA 1X9WA 1EP4B 5DBCA 4RQ7A 3PMLA 4J9LA 1S9EA 4KHMA 4PGYA 4RW9B 1FK9A 1SKWA 2P6RA 4KLEA 4P4OA 2ZTDA 3KHLA 3GIIA 1C0UA 4ECRA 3DYAA 4RQ0A 4KN7A 4QZAA 4UB4A 1SH3A 4RNMA 5KFNA 1KLMB 1KLMA 3IG1B 4R5PB 1Z3EB 2P66A 4F5NA 2IJFA 2FPLA 1MU2B 5KFSA 4IG3B 4JWMA 5HMLA 5EOZA 1C0UB 1REVB 3KK2A 4FS2A 4F4YA 4C8NA 4ED0A 2RDIA 1BPDA 4ECVA 4K4GA 4M9JA 4NLZA 5KT2A 7ICVA 2F1JA 4R0EA 4M9LA 7ICTA 1S1XB 4MK8A 2E9RX 7ICJA 4WFXA 3M9MB 1NJWA 2FVQA 4KFBB 4M6WB 3H4BA 1DOQA 4KE5A 4YVZA 2NRVA 5DDYA 5KFPA 2ZUDA 1FKOA 2IHMA 5I3UB 4ECXA 5D49A 4URQU 3GV5B 3I5AA 4NLTA 4R63A 2OPPA 4PHAA 4ECZA 4ECYA 3DMJB 7ICIA 5KT4A 9ICHA 1XWLA 1N48A 1A77A 2IM1A 1HQUB 3JPPA 5C24B 1BPBA 3H59A 5J0PA 2W9BA 4QZBA 4RUCA 1S10A 4NLRA 5L1JA 2R8JA 4NLGA 3RBEA 5KG2A 4JUZA 4DQSA 1SH2A 4EBEA 3LALA 4MEXA 4DO9A 1UWBA 5EDWA 4O3QA 3M8SA 3N6MA 4KLMA 3V6KA 4NLPA 4KITB 4RT2A 8ICIA 1COOA 3PW5A 4KAIA 3TAMA 2FJXA 4QWCA 3PVXA 3DOKA 1RAJA 3HW8A 3RR7A 2W9CA 2XY7A 4TYBA 2KN7A 2BANA 1JMSA 3LAMA 4QZDA 9ICXA 4Q43A 1U48A 4FBTA 1EXNA 4QZHA 1T8EA 5F8JA 5KFWA 3JSMA 2BRLA 1DGSA 4YD1A 4ZP6A 2RKIB 5IIKA 3GILA 4RNOA 3RH4A 1NKCA 3KTQA 4KKOB 1FKPB 4F2SA 4I7FB 4I2AA 8ICZA 1FKOB 4K4UA 1NK9A 3T5KA 2CKWA 4CCHA 3G6XA 3UPQA 1TK0A 8ICTA 9ICAA 3OHAA 4BWMA 3Q8LA 5DG8A 1ZQTA 1C1BB 5HROA 2W9MA 3TAPA 3IGVA 5F9LA 2V4RA 3ITHA 1NHVA 4F4ZA 3QO9A 4JWNA 3H5UA 5HP1B 1XU4A 3IRXA 3C1YA 1WCLA 9ICKA 4F4WA 3BSAA 4M47A 4DG1A 3DOLA 3HVTA 5D46A 3OLAA 2IJNA 5KFDA 4KV8A 1NK6A 1TL3A 2Y1IA 1IKXA 4I7FA 2YKMA 2FJVA 3V4IB 4TY8A 3MR5A 4J9PA 5IIMA 2UVWA 3OJSA 1TKTA 5IINA 2FMPA 1S9EB 1V9PA 3TAMB 1RTHB 3MDAA 4F50A 3SFUA 3DI6A 5DBBA 4KSEB 1BVSA 2F8EX 1JLFA 3H5YA 2PI5A 3H8WA 3SFGA 4EO6A 1NNDA 4RW4B 1ZETA 5DB9A 1RTHA 1C0TA 1HMVB 1TQLA 1TKTB 1NK5A 4M94A 1CEZA 1J5OB 3JYTB 4Z6DA 4MFCA 3PZPA 4EZ9A 1TV6A 1T7PA 3V7KA 1NOMA 4KBIA 1T05B 5KFTA 5KG1A 1BPEA 4R8UB 3MEEA 4RPYA 1ZQPA 2J6SA 3KHHA 4H4OA 1KRPA 4PHEA 3OJUA 3KLEB 4RPXA 5KFUA 3RJGA 4KLHA 2RF2A 2W8KA 4ED7A 2A1JA 3DRSA 3OL6A 4JV1A 2GIQA 1ZQSA 3FYHA 4QWEA 4F5RA 4QW9A 1AROP 3N6LA 4I2HA 2XI2A 3I0SB 4KN4A 4KLGA 4PHPA 5DBAA 3KMSA 2FVRA 2OPQB 4ECSA 3M8RA 2ASLA 4KKOA 3DLGB 5J2MB 2PI4A 1S1TA 3RB3A 2YNHA 3HX0A 3PX0A 4DF8A 3BQTA 3GIKA 1T3NA 3PV8A 4G1QA 3KK3A 1S76D 3UPFA 3K4GA 5EUHA 1XSLA 3OL9A 1FKPA 5HP4A 4WYWA 3HVAA 5CR0A 1XR6A 3ZD8A 3MR2A 2HWIA 2BKEA 3LWLA 2UUTA 2WK4A 4WXOA 4J9MA 4RQ2A 1JLEB 1S9GA 5KFAA 1RT3B 2BRKA 3TANA 3QEAZ 2YNGA 5CYMB 5K14A 1JLCB 4UAWA 3C6UA 1JN3A 4F2RA 2VA2A 3ZDCA 2XWYA 4NZ0A 4MF8A 4YMOA 4LSNA 1KFDA 2HWHA 1ZQJA 3NL0A 2BPCA 3BSNA 5DB8A 5HBMA 1XR7A 3OHBA 4ECWA 3THVA 4PH5A 1VRTA 4XUSA 1S1VA 3HP6A 1TL1B 1ZTTA 1UWBB 1UA1A 3OL8A 7ICSA 3CDWA 4B3OA 1KFTA 4ZVEA 5CP2A 2C28A 3DMJA 4KLDA 4Y34A 4MF2A 1JLQA 3GFKB 4ECQA 4PWDA 1LWEB 4O4GA 3GIJA 4O4GB 5I3UA 4RNHA 2W9BB 4QW8A 2IBKA 2HVIA 4IH6A 1T03A 5F8MA 5BOMA 2BQ3A 2AQ0A 5KT3A 2R2UA 4QZ9A 3CVKA 7ICRA 3RH5A 1TKXB 2ZKUA 3FSIA 1S6QB 3BGRA 4UB5A 3EZ5A 4GXKA 5J0SA 2VG5B 1S0MA 3OLBA 4IQVA 3MEDA 3LP1A 3RJHA 1QSLA 1LWFB 3LDAA 3MEGA 1Z4UA 3QIPA 4WE1B 3H8SA 1IKXB 2PXIA 8ICNA 3TVKA 1N5YB 3M9NB 8ICWA 4DOCA 1KEJA 5L9XA 5F8HA 3OL7A 9ICPA 5HNKA 2W9AA 2UUWA 8ICUA 3MR3A 5HBMB 3KLVA 3PO4A 1L3TA 3K75D 3BR9A 1RT3A 1HMVA 2NRWA 5EWEA 2BDPA 2VA3A 4I27A 1MU2A 5J29A 3KK2B 4RNFA 4DSFA 4RQ1A 5J0QA 3G86A 5DDMA 2HHSA 4TYAA 3I0SA 3JPOA 3BREA 5KFCA 1B43A 2ZE2A 5DG9A 3M8QA 4K4ZA 4DL6A 1SL1A 4IDKB 1JXEA 2FVPA 1TAQA 3KHGA 3DRSB 1QAJA 1EETA 4WFZA 1QAIA 5KFHA 1RXVA 5CHGA 1SV5B 1QTMA 1MSWD 4DL4A 5CB1A 4TQSA 3T5LA 4G3IA 4XPEA 4EZ6A 5EWFA 7ICEA 4TXSA 5FDLB 3SV4A 2CJQA 3RJJA 3NMAA 3DLKA 2DPIA 4F92B 3M8PB 2DPJA 4NLQA 3Q8SB 3H40A 4I2JA 1ZQQA 3GDXA 4O3PA 2R8HA 1BQNA 1D8LA 1TKZB 5F8GA 3JPNA 9ICJA 1RT2B 2IAJA 2C2RA 4QZ8A 4O3RA 1K1SA 4J9SA 1LWFA 1J5OA 3PR4A 4G1QB 2XY6A 3KK3B 3ZDAA 1DTTA 3ZD9A 7ICFA 1DLOA 2V4QA 3LP0B 1S6QA 3BGRB 2YNHB 4H4MB 1S6PB 1S1TB 4J9QA 5D3GA 8ICFA 3AUOA 1RT1A 1SL0A 4IOBA 2ZD1B 4JK1A 3IHQB 3KK1A 1MMLA 2AJQA 5J2IA 3NAHA 1NKEA 2HHVA 3UQ2A 3PJXA 4KLJA 2C22A 1C1CA 3N97B 3UQ0A 1S1UA 3HT3A 4ZPCA 1D9DA 4ZHRA 1GX6A 5KTQA 3BQ1A 4YP3A 1HNIB 2W9CB 1VRTB 1TK5A 4B9UA 3SZ2A 4Y2CA 2MAXA 5C42B 3T5HA 4B9LA 3PMNA 2HW3A 2FPMA 4RW4A 4M2YA 4RW6A 4O3OA 2HVHA 4NLWA 3LAKA 4TY8B 3BQ2A 4Z6CA 3QIDA 2FVSA 5CYQA 2YKMB 1D0EA 9ICMA 9ICVA 1DTQA 4B9TA 1YVFA 3MF5A 4YQWA 3Q8QB 3CWJA 3ORYA 1ZQAA 1IKVA 1TL3B 3QGIA 2NRZA 4C8OA 2JEIA 2HNYA 3DRPB 4ZH4A 3CIZA 5HLFB 3CJ4A 3KLIA 3ZDBA 4DG1B 5J2MA 5KFJA 5L1KA 3SYZA 4B9VA 4DFMA 2RDJA 2IAJB 2VA8A 2C2DA 2KZZA 3MR6A 4IG0B 2ILYA 4NLDA 4HKQA 2Y1JA 4F91B 1XR5A 2PFNA 2LYHA 2HHUA 3NGDA 4R64A 9ICOA 4RQ6A 5CA7A 1TVRB 5KFQA 4YD2A 5DGAA 1S97A 2YNIB 3I0RA 4ZP7A 4RT3A 2HHTA 4ELTA 5HP1A 3MECA 1RXWA 4URGA 5J2QB 8ICYA 4C8KA 1KHVA 1HQEA 4C8LA 2FPKA 3CO9A 3DOKB 4ICLB 3OSNA 1XS9D 4J9OA 1TVRA 1MQ2A 2AQ4A 1TP7A 5DLGA 3PX4A 2VG6B 5F8LA 2ZE2B 3H5SA 2OWOA 2HNYB 4PQUB 4R8UA 4B9MA 8ICRA 4Q8EA 4K4IA 4F8RA 4LSLA 3RJKA 2HNDA 3TAQA 1ZQKA 2D7SA 4GXIA 4MFBB 1LB2B 5KG4A 1HQEB 3MTKA 3GQCA 4K50A 4X2BA 3KLEA 2JEJA 5KFVA 4TUPA 1BQMA 1RT4A 1U47A 4F4KA 3DM2B 4NXZA 3KLGB 4IDKA 9ICFA 4R66A 4LQ3A 2UVVA 4XO0A 1JLFB 5C25B 4NLVA 3EYZA 3V6JA 3RJFA 1KHWA 3Q8RB 1RTIA 1MC8A 1X9SA 3H4DA 1L3SA 1IKWA 2R2SA 1ZQVA 4EYIB 3SI8A 2B21A 2JZBA 1ZQDA 1ZTWA 5C5JA 3N4MB 3JPRA 1BGXT 3TQ1A 3NKYA 4O5EA 1JLBB 1KDHA 3MBYA 1U4BA 2VG7B 1HNIA 4DQQA 1RT2A 3MGHA 4O5CA 3B0XA 4DSEA 4NLNA 2KZMA 3EPGA 4M6WA 4ECUA 9ICEA 2AX1A 1T03B 8ICEA 3H7IA 4XRHA 1XO1A 2FMQA 8ICMA 3PO5A 3KLHA 2FJWA 5KG7A 2IA6A 4DFKA 5J2KA 2HHWA 3LP1B 5J2QA 3V6DB 2XGPA 4IKAA 4TUQA 1HYSB 4GC6A 2I1QA 1C1BA 4EBCA 4UAYA 5J2EA 4U7CA 1DTTB 3LK9A 4IFYA 2AU0A 5DKWA 1KFSA 4KLTA 1RA6A 4KHRA 2ASJA 2BE2A 4IQWA 1U45A 2WRMA 1KLNA 4Q0BB 4O3SA 2IHNA 4QWBA 3RJIA 2OPRA 1UT8A 1JLQB 1PZNA 1RDRA 4PGXA 1TKZA 1VRUA 1NJZA 2ZJ8A 1LWCA 3V7LA 3T3FA 1REVA 3OGUA 3M8PA 1ZQWA 5KFOA 1Z00B 1TVAA 4FS1A 1RZTA 2OPPB 4IQXA 8ICXA
chains in the Genus database with same CATH superfamily
2IM3A 2VPYB 1V85A 2BGWA 4ZP9A 1RZMA 1EF2A 3J7AK 4I0WA 2U2FA 1X42A 3M32B 4ED8A 2PKEA 3UD3P 4USUA 5A8RB 4QZCA 2W04A 4A46A 3L4PA 4A8XA 4KO0A 3RUBL 3EWAA 1YK9A 3LANA 4DEZA 2WAQA 4X62F 1QE1B 1RT7A 1P1MA 1CC8A 4F02A 2J9DE 2H3FA 2APOA 4DZ6A 2VJ4A 5L39A 3MZIA 2QSWA 8RUCA 1VJQA 4ATNA 2P9EA 1VQ5S 5DDQC 2YNGB 2XLIA 2DO0A 5DZ6A 1VLBA 2KSOB 2HOIA 3D1QA 8ICVA 3LGHA 4ZPTR 3GSDA 3ICLA 4DV6H 2XCPA 3AJDA 5IIJA 4JI1H 4I2QB 4RBTA 3NRWA 1R89A 2K2PA 3ENQA 4F3OA 4DUZH 1GO3F 1AUVA 1X31C 2E1CA 2OLSA 2NRXA 5C44G 2LMRA 5J2AA 3RAXA 5I42B 1DLOB 1H74A 4NRTA 1KBLA 3QYPA 4G1IA 4UCUA 3L9ZA 4WE1A 1RT5A 2HGNA 5F9NA 4K5SA 2BCVA 4C8ZA 1SKSA 2BE2B 2V2KA 1KN5A 3BO3A 2VBWA 4BBRG 4ETXA 1IKYA 2DNLA 4RQ8A 3NBPB 4FKXA 4FN5A 3RZAA 1IN0A 3VCDA 1RUSA 2DYAA 1YNYA 3IR5B 2IFXA 3T81A 2VHGA 5J0TA 3OPKA 2FJDB 3CPWR 1HNVB 2VDIA 3OSPA 3FGVA 3A0HU 3KJVA 1X4BA 4PPXA 3N6NA 4KLFA 2DXEA 4Z6FA 3ZDEA 4P73A 2M9KA 4DV7H 1CS4B 5E2QA 3D6TB 2AJ4A 2VPSA 3C16A 1TFRA 1ZXIA 4G65A 4Y28C 2FDRA 1RTJB 2QT7A 2MXYA 3WX8A 3IWNC 2R7MA 3LWMA 2CW7A 3DNCA 1ZQCA 1PBAA 5AXLA 4BXOA 1DZ5A 2IOHA 3E51A 3EGNA 2KJWA 3ETOA 2AV5A 1HPZA 4IWXA 2WAQD 4M5JA 5BYRA 3WKAA 5CH7B 4DWIA 1S1WA 2M8HA 4I2DA 4LVSA 2YQ3A 4UW9A 4TLRA 3MAQA 3SMVA 2WB4A 4NL5A 5FLXW 4B9NA 4CNSA 2H5IB 3AQEA 4J03A 4NRUA 2G09A 3M9OB 2DNKA 3T5JA 5D15A 1F3FA 4NXMJ 5F0WA 1RQNA 3DLEB 1SB3C 3JZIA 1M1HA 8ICGA 1RT5B 2EXUA 2RU9A 3QRRA 3AOAA 2DNMA 2MDAA 3FMWA 4F5QA 2KKVA 3DLLQ 3MM7A 1Z00A 2GX8A 1X6JA 4EBDA 2C00A 5J2CA 2XSFA 5D4LA 2EEYA 2IOFK 4F7VA 2XYPB 3OUUA 5G4DA 3PIPQ 1E4EB 1WG1A 2QARB 8ICBA 2G1DA 4UB2A 2OPQA 3FDSA 3I9ZA 2O3DA 1TL7B 1ZJMA 1SJQA 2FIUA 2EZYA 5JVGQ 2ZH3A 4RZRA 2OD6A 5IYBG 1Z2ZA 2GC8A 5AM5A 2ABYA 2ZEJA 1IKVB 3WIUA 4X64J 4RBUA 1HIYA 4UBPC 2POKA 2EPIA 4OYXA 5J0XA 4I56A 3Q8KA 2ZC3A 2CPIA 2L48A 5GAEU 2DR6A 1C7YA 1N5VA 1C2PA 4BDPA 2ZTCA 5AM0A 2FVKA 5KL1B 4R65A 3NWRA 6FD1A 1FVSA 2C2EA 4PYDA 2YYAA 2FB0A 5E3AA 2HIYA 3UNGC 3CJ2A 3CIMA 5DLFA 4DV6F 4JI1F 4CLTA 4BJHA 8ICCA 4N5SA 3HK2A 4C5YA 1X9NA 4EGLA 1U02A 2AQVA 1RYUA 5F3XB 4EPEC 7ICQA 2GW8A 1KTQA 2G5IB 1NSPA 1C1CB 4QZEA 5IQ6A 4JI4J 5GONF 2Q4TA 2JA5G 2DHHA 4L3KA 3MOZA 4JI2F 5KT6A 2BQRA 4DV4F 1M0WA 1WJ9A 4DS4A 4US9A 1FEEA 4ZJQA 4DUZJ 3AXKA 1I3OB 4KH0B 1SL2A 1N6QB 1JKHB 4JI3J 4NJ8A 2HNZA 4HNTA 2DEJA 1RWUA 2I0XA 2ZOGA 2D41A 1FWJC 3FJ2A 3UNYA 3Q86A 3KG1A 2OH2A 2B5JA 3I4MG 2VUMA 3WDOA 2KHQA 4IG0A 2YCHA 1BPXA 1D8YA 5ALMA 5D1OB 1W93A 4B3MJ 1OIAA 2KO1A 4YMEA 2K4HA 2FD2A 2HHQA 4P0PA 2X1FA 4LR8A 1NZBA 1RXOB 4K8RA 1PJ5A 2JC0A 3PFOA 3D0GE 2C42A 2F4VH 3SCJE 1HYSA 1P8GA 1HNXH 3Q1KA 4RW8A 2G4BA 2RIJA 5H9FK 5J2GA 1FHTA 4M9HA 4RJVA 1FK9B 1JDBB 1YRXA 4LZGA 3UO0A 4I2FA 5CZVA 1GGOA 3GE9A 3NAIA 3ZZTA 4O4RA 3R7NB 2ZM6H 1QLNA 2GQQA 3I6PA 1L3KA 2KFZA 4TNOA 5GAHU 3FBFA 3HRDD 4OHXA 1X4DA 4DR5F 1NH8A 4ZMMA 2KRRA 4OL8A 3V6DA 5FJ8G 3RBZA 2JEGA 3MDCA 1L2ZA 3T19A 1U1OA 1DV1A 2Q2UA 1N5SA 1OYEA 4ITSA 2FLNA 4DPWA 4YG2A 2QLXA 3K5MA 3M6ZA 4UAUA 5CA1F 3DRRB 3HHLA 5C1PA 1N5WA 2KEYA 1F9FA 1HL6A 1RJRA 3LP0A 1NDLA 2KVIA 2V9WA 2K8GA 3WNZA 1CJUA 2VF3A 1ZQZA 3M8ZA 1RTDA 2RMLA 1RK6A 1WEYA 3ET6A 3VGVA 4UARA 5AT1B 3C19A 2M4MA 5AM4A 5KG3A 2A18A 3HJFA 1S99A 4FZMA 3TZXA 1UA0A 3TX8A 1TV9A 3ISZA 5GAGI 1I6JA 1W96A 4BLGA 2HS0A 4DV3J 4KJIA 4HR2A 1KW4A 2IVFB 2AEJA 4OI1A 2YNIA 2ZBCA 1TMJA 2HQGA 4BUGA 1NK8A 2YY3A 4MFBA 1LXNA 4OZ1A 1VBZA 3MMAA 7ICNA 4OIXA 2FMSA 2LU2A 4YXJA 4HLBA 3HM9A 1WHYA 1ZBTA 4LSNB 2PO4A 3A1YG 2DNQA 5D4BA 4KYZA 4YXMA 2K06A 2DJWA 3SSSA 4PUOB 4KGMA 4WFBQ 2C2OB 3BABA 4OV6A 3M2UA 2E9ZA 3QZ7A 3EW9A 2BX6A 4QPXA 2ALZA 7ICMA 2LQBA 3GTQA 1VI7A 1U8WA 1WC4A 3GTMA 4DLEA 1U2CA 4ELUA 3EPIA 2AXTU 1ZQUA 2HBLA 2RE1A 1ZQFA 2HSEB 1XJWB 5KG6A 1K1QA 3HULA 4KTQA 4FXVA 3H0LB 1F5AA 4C8MA 4ID5B 2I9UA 4FVMA 4S0MA 5CJ7A 2I1RA 1WTBA 1S1UB 3UCUP 1V51A 2KM8C 2YX7A 1X2IA 3M1VB 5E33A 3EM1A 3MEKA 2DKZA 4EX6A 2Y0SA 1UTAA 2FHJD 2WONB 4WZQA 2P9GA 1R6VA 2R7LA 1N32F 4JBCA 4JI3F 3IMQJ 1HNXF 3R1LA 2GIFA 4P2HA 1H98A 3TFRA 1WNEA 1N8RT 1FXDA 5KFXA 4K0KH 1NHUA 3M4XA 2K4EA 4RQ4A 2E9TA 3F56A 4U8YA 4XA5A 5D4OA 2PLMA 3H8YA 2BE9B 2VBXA 5FJ4A 3W5XA 3IBFB 5FPRA 5FIIA 1AUDA 3D6MB 3QE9Y 1PAEX 1FIQA 1VS0A 4UCOA 1XQIA 1IKYB 2FLLA 3PKMA 2B0GA 3J7ZT 3QU4A 4IRCA 1KJQA 5DG7A 5J2PB 2ZH1A 2NU7B 3ULHA 5EE0A 5C2CA 2MYFA 5LXXA 1S9GB 3Q8VA 3OTEA 2G08A 2H4YB 1I94H 5AK4A 4A3DG 4RU2A 5JVDF 3ISCA 8ICAA 4B08A 4LQ9A 1GKRA 3OVSA 4WZMA 3GG0A 3GJQB 1RAFB 2I9SA 3GIDA 4QZGA 2BW2A 4DN9A 4NCGA 2CPJA 3JPQA 3MD1A 2E5GA 2PA3A 4ILLA 4GMKA 2HS3A 1NMEB 1N4LA 1JROA 2DISA 3BGOP 1JLGA 3E3XA 4NL9C 3ITHB 2PFDA 4AQLA 1NM2A 4LSLB 1G2EA 3EUB2 5KFBA 2VPQA 4DV2H 1FEHA 2UUCH 4UB3A 1Y88A 3WIVA 4X84A 2XIGA 4WU2A 3Q8PB 3GP9A 2BE7D 4CNZA 3MOJB 1R31A 4EEKA 4ZVFA 3R6GB 4C5BA 1ZQNA 3AODA 3KLIB 2Z30B 1S77D 3GTGA 3QGGA 3CO0P 3F2CA 9ICUA 2NUAB 4UOFA 5BXIA 2MUTA 4CWBA 4CIOA 4LF7F 2LKYA 4GFJA 1SIJA 3FBCA 1I94J 1MNEA 2Q0ZX 3R5AA 2R8IA 2BPGA 3GYNA 4JI6H 4MA5A 2V4JB 2Z2YB 2ISOA 4PUOA 4RLEA 3DCAA 1XTZA 4M95A 2XZWA 2M5YA 4HACB 3RH6A 5FD1A 2WAQF 3ENAA 3BKUA 3NP5A 5ALGA 3O3LA 3QLHB 3ETRA 1RT6B 1GYFA 2EFGA 3MM9B 2MHNA 4O4LF 4H54A 1P27B 4UB1A 2QA1A 4ELVA 3EZOA 3E01B 1CSJA 4NYZA 4UW2A 1TMMA 1CS0A 1KJIA 3HZEA 5D8HB 2OUGA 4DSIA 4DYKA 3LA0A 1UVLA 2LXFA 3KUHA 1EZ1A 3GJRB 4DR5J 1WUDA 1NSKL 4DF4A 1K70A 4IR1A 3VZIA 3KOAA 4YN4A 3TKAA 3E01A 2FZGB 3CCLS 4MK9A 1NDKA 3J80W 1PX2A 3C46A 2W24A 2K8AA 5L1MA 4UZBA 2GAGC 5KFRA 1CE8A 5GADU 5K8OA 5KFIA 5IM0A 1S8OA 4M7EA 1S6OA 2RQ5A 3SCKE 1PVQA 1ZYQA 2ZH7A 4PWUA 1U2RA 1F2GA 1PVRA 1SV5A 2ATLA 2BEFA 4DS5A 1KEEA 2O66A 4OI3A 2QMUB 2V5AA 2ISPA 3MCSA 2NSCA 3M8QB 3V72A 1IR1A 3AA8A 1WOPA 3PCOB 2VOPA 4NLUA 4CRXA 1GTEA 2VG7A 4JI3H 5DBCA 2Z7JA 3VCBA 4TKTA 3CP8A 2CDRB 1FK9A 3EYYA 1YRTA 1A5LC 1YKWA 4UASA 1NSAA 4D3GA 1D09B 5AKKA 3D66A 1YJNS 1JMTA 4ECRA 4UY8T 1PK8A 1U0HA 4CYUA 4QZAA 4AYBA 2JGAA 4DR1F 4OHZA 2Z8QA 1UEUA 2MY8A 5GVQA 2P66A 5E0OA 1WEXA 5KFSA 2KVCA 4CEUC 3KK2A 4C8NA 1A5KC 1RAIB 3TA2A 3ZZZA 4K4GA 3W8GA 4M9JA 3B82A 7ICVA 2F1JA 2C3UA 5AI6A 4M9LA 3CEDA 1NSQA 4MK8A 3HOWG 2FK3A 2JV3A 1YJVA 5EX3A 2DLNA 3H4BA 4CF4A 1GLVA 4LF5J 2XEXA 1B64A 1IWGA 1FKOA 1UEKA 2K89A 2K8BB 5I3UB 2YPYA 1RLCL 1B04A 3KUGA 2P35A 3GV5B 1IOWA 3I5AA 4NLTA 1FCAA 2HZVA 1WWHA 2GO8A 3PYFA 4L73A 4X66H 4FFDA 1IIPA 2H3VA 2IM1A 5H9EK 3JPPA 2J0WA 5C24B 1BPBA 4E98A 3WK4A 3U1NA 3UMBA 3IGHX 1EQ0A 4A8YA 5HV6A 3W63A 2ADCA 1EJTC 4JUZA 1ZD5A 5JU5A 3PTWA 1HBMB 1FXRA 2EKNA 2LU1A 3IA0A 1QH9A 2MMYA 1UWBA 1RWPB 4UATA 3TRGA 5IP7G 3GRIA 4OI2A 2KXFA 2VQFH 2KB2A 5SZTA 1VBXA 4NLPA 2QYCA 2HG4A 3LP8A 2FJXA 3P5BP 3QSIA 4B3MF 3DOKA 3T6JA 2J5AA 1A7GE 1U8SA 2D9PA 3HF5A 2WF9A 2I6XA 1DQAA 4N76A 4LF7H 2OFHX 4C48A 3JSRA 4TYBA 2HBMA 1R9TA 2JOQA 1U48A 2UUCF 1I50A 2PIIA 2EAMA 1EXNA 4QZHA 1T8EA 4CEXC 1N61A 5CD4H 2LQJA 2BYCA 2G9OA 3GILA 2F4VJ 4Y65A 2OAUA 4DPOA 3KTQA 2VPZB 4F2SA 1Q5YA 1F0MA 3C8YA 1S68A 3PN1A 5E41A 2M3DA 3THTA 2CPEA 9ICAA 1VIOA 3A0BU 1Q78A 4BWMA 3EICA 3RGXA 1C30A 4RQNA 3ADAC 4M5HA 1C1BB 5HROA 2D6FC 4MTDA 3TAPA 4G9BA 4X65J 3ORQA 2GNKA 3H5UA 3C1YA 3GSIA 4F4WA 4M47A 2ZH2A 3QU2A 5D46A 3RF2A 4GO5X 3K8WA 2WVEA 2HFOA 4Y2SA 3WKBA 4V1XA 1UCNA 1TL3A 3UN3A 4B3RJ 1ZRMA 1X5TA 2BV3A 2DTJA 3MJFA 2IY5B 2FJVA 2XMJA 3FUYA 2IP4A 3FBBA 1V9PA 3NRZA 1RTHB 5A8WA 3FCWA 9ATCB 2KXHA 1ONXA 3TA0A 3MMBB 4A8QA 3HHLB 3DI6A 5DBBA 2F5GA 2E5IA 3SDEA 4NEZA 4KPYA 1ZETA 5DB9A 1GFWB 4CO3A 1X60A 5IWAJ 2IVYA 4CP5A 4JI2H 4DV6J 4DV4H 1TUVA 3JYTB 4Z6DA 4P74A 5ETSA 1X4EA 1KN6A 4DL0C 1POKA 4M5DA 1R9ZA 1RA5A 4MV7A 4EZ9A 1TV6A 1KS2A 1T05B 4UCSA 4ZN1A 1F2HA 4HTJA 4H4OA 4J5OA 2VKQA 2UU9F 1WKKA 3EX7B 5D1OA 3ZTRA 1F60B 2A1JA 5ETKA 2HJWA 3FKIA 3DRSA 5IT9W 4JV1A 1FVIA 2BA9A 3O7UA 2GIQA 3H3VH 3HSDA 2X1AA 3ETJA 1FERA 2F4VF 4QW9A 2EFVA 4JV5J 5H9EJ 3ENVA 2XI2A 1A6LA 4PHPA 2XICA 1V3ZA 3A8IA 3HSGA 2UXBH 1SYXB 4ECSA 3QNWB 1UMJA 2PI4A 4DV0J 3MPGA 3K17A 2R85A 4WK3A 2FE9A 3DRXA 2MZQA 3L4KA 2W3SA 1E9YB 2NXUA 3CNQP 3W5YA 4K59A 4N8OA 5F3TA 1FKPA 1Q5VA 4OJGA 5CR0A 3MR2A 3WX4A 2UUTA 2BKEA 3J7AN 5AKHA 1V9OA 1JLEB 1RT3B 3QEAZ 3CJTA 2YNGA 4UAWA 4OHYA 3G87A 3C6UA 2HK2A 3AHPA 3AD8C 1B4FA 1WI6A 1CG2A 4OX9H 3NS5A 1RE1B 3AL0B 1LKZA 1RJPA 1EB0A 2XWYA 4MF8A 4LSNA 2AEMA 1PK3A 2J9EA 2W4PA 4LH8A 4B3RH 1B0PA 4WFAQ 3TVZA 3G8TA 2BPCA 1X9XA 5DB8A 3ICXA 3O2IA 1IBCB 3CMAS 1S1VA 3HP6A 1TL1B 3DXBA 4IS7A 5T41A 2D8CA 1G1XA 2FPHX 5ALFA 3FSXA 3JB9k 1SCUB 4OZ2A 4KLDA 5AKQA 3B4MA 1ZQ7A 3CJSA 4F4AA 2VB6A 2QN6B 2K4IA 4PWDA 4EU0A 2MZRA 2UXCH 4O4GA 3GTKA 2V50A 1FJGJ 4O4GB 2ZZNA 2A10A 2VUNA 1X0PA 3D2QA 2HBRB 4RNHA 2IBKA 1URRA 1T9YA 3NS6A 3AA9A 1M1KT 2E2HA 5KT3A 3CVKA 2IRYA 3FSIA 1S6QB 2QA4S 2HOQA 3CC7S 1OYDA 3UCZP 3LNPA 4LFBH 3IM8A 4LMZA 1WF2A 3JSNA 2O03A 2OSRA 1ZHQA 1IKXB 8ICNA 4KX3A 2NYIA 1I3QA 2UXDJ 3OL7A 4OYPA 4CE6A 3JSLA 4F04B 4P2MA 3M7VA 1K0TA 3MR3A 3KLVA 2FJEB 5LM7E 2RVJA 2FZCB 5DZ7A 1MLAA 1TU0B 1RT3A 2IBOA 1HMVA 3MAAA 2NRWA 3GTPA 5EWEA 4DV0F 1KRAC 4RQ1A 1WEZA 5DDMA 2HHSA 3VAGA 4DR6H 2CADA 3CNHA 2KV2A 4EG0A 2ZE2A 1HHTP 1KQFB 2B4OA 4DR7J 4DL6A 5I4MA 3Q8YA 1S59A 2DHAA 4DV7J 1JXEA 2GJ2A 1TAQA 2PN1A 5DDRC 1SEIA 2IJRA 2ZUAA 4DV5H 3LPEA 2R7QA 5CHGA 2GVDB 2DRDA 2V2ZA 4CT9A 2VL1A 3PSPA 5CB1A 4TQSA 4EFBA 2XULA 4EZ6A 5EWFA 3SQIA 1ITPA 2MKKA 4F92B 4NLQA 3Q8SB 3I9V9 2HKEA 4ZCIA 2CPZA 1YZ7A 4X62J 1RB0A 2MLXA 3GDXA 4O3PA 1D8LA 5F8GA 3JPNA 2JSXA 5EX0A 1EJSC 4MT1A 4O3RA 4HL9A 4ZVPB 2ZIWA 4LIWA 1LWFA 3PR4A 4G1QB 3F41A 1BGWA 1JRPA 4UTGA 4Y2YA 2LHTA 1FRJA 5LMUF 2BVZA 2WHEA 4H4MB 1F5CA 2V58A 1S1TB 4GKJF 5IV4A 2R92G 8ICFA 3RF9A 2Y0SE 3N44B 4IOBA 4ZIWA 3JQKA 1RU1A 4OMFG 2DIKA 4I55F 2VKRA 2W6NA 3BS9A 1MMLA 2PDAA 1M0TA 2JA5A 2ES6A 5DM7Q 2GO7A 5CAEB 3RW6A 2CAJA 1C1CA 2L5YA 3PACA 1ZPWX 2EFNA 4ZHRA 4L75A 2NU8B 1WSCA 4A8OA 2VV5A 4ZPWR 1VRTB 1KC7A 4B9UA 4F3MA 3MM6A 4A3JG 2Z2MA 2NREA 4RW4A 3EVOA 2F7VA 4GY7A 2FVSA 1YGYA 3T1HH 2V8HA 3OVAA 2QLTA 3MF5A 1I1GA 4A4JA 4CLSA 2VPXB 3DRPB 2XB2D 4ZH4A 3G82A 4WPAA 5HMZA 5KFJA 4RWWA 5L1KA 3B54A 5ALNA 2VFUA 5FLXY 1BY9A 2IAJB 4HKQA 2CJAA 4Y8VB 2NO4A 1T9VA 3ZZ0A 2D3OR 3R5XA 2DH8A 1P1LA 2P6SA 3ZZOA 9ICOA 2ERRA 2L08A 1YJ9S 4LREA 2EG2A 4NI2B 2YNIB 3I0RA 1MWYA 3MECA 4AYBE 2KU7A 5ALRA 4DV3H 8ICYA 4C8KA 4GKJJ 4CO5A 1DAXA 4C8LA 1REGX 1KDNA 3DOKB 4ICLB 1HBOB 4QU6A 1TVRA 5LMNJ 4IZOA 2AQ4A 3PX4A 1RLDA 2YKAA 1WDTA 3NY0A 4HAIA 3M4IA 2OWOA 4PQUB 4R8UA 5BMVF 1A0PA 4K4IA 4GVLA 2VM8A 2CPHA 4MFBB 2C2NA 4GXIA 2V6AA 2XQCA 3GQCA 1BUXA 4K50A 3AH6A 3EGVA 5KOWA 1O8BA 4FF2A 1RT4A 4Y2JA 4G6VB 3I4PA 2IVMA 2B9XA 3KLGB 4IDKA 9ICFA 3RUPA 2HHHF 5ALPA 4E4TA 4OI0A 4XO0A 3ZFVA 3M8WA 1UP1A 3KNGA 3V6JA 3T8LA 1KHWA 3Q8RB 3F44A 1O12A 2GSEA 4ES1A 2RDDA 2KIWA 1WCMA 1KRBC 1VJ5A 1ZQVA 2VJVA 2B21A 2JZBA 4K7QA 1S12A 3VALA 4CM2A 3N4MB 5IOLA 3NKYA 2ZVIA 2P0AA 1JLBB 1KDHA 1U4BA 2VUMG 1IJFB 1RWXB 4O4HF 4UFZA 5FP0A 2NZCA 3D54A 4NLNA 2CPYA 2MB0B 4P6QA 3L5KA 3H7IA 2EFPA 1SC6A 1Y3KA 8ICMA 3QUTA 2C2ZB 4LF2A 4DFKA 2P53A 2G1HA 5J2QA 3V6DB 3QU7A 4WD3A 1VK8A 5ALOA 2XGPA 3LTOA 4GC6A 1AUXA 2I1QA 4MV8A 3NGSA 4USTA 1H72C 4HH0A 3GWCA 3SSRA 3QPIA 5HVFA 4CNQA 2AU0A 4KLTA 4RPFA 2ASJA 1XNSA 4IQWA 3DHWC 2ATCB 5AXNA 3RJIA 4DX7A 4UCTA 3QU5A 3UDEA 4EGQA 1WG5A 2XM3A 2EFQA 1NJZA 1HWJA 4Y2UA 2CNNB 4FKYA 1REVA 3OGUA 3GJSB 1AB8A 1PGZA 2AMCB 4F0LA 2E1MC 3UCGA 1PJ6A 2F8MA 8ICXA 1QM9A 1J5EF 3RB6A 3HSZA 5CYMA 1SV4A 5G0RB 1OPIA 4CI0B 4ES2A 1K44A 4RZBA 4CLWA 1UJ6A 3TUZC 2QB0A 2G3FA 2XS7A 1FO1A 2E5LH 2EK1A 2P5VA 4YDDB 4FYVB 1ZQHA 2DBYA 3KKFA 4N7TA 2OODA 3VVUA 4KY3A 2LXUA 2D3O1 2R7UA 2B6AA 3VGUA 1TL4A 4DCOB 2K1RB 4LFCF 5IWAF 1WOSA 4Q44A 2R87A 3R5FA 3C14A 2ZFHA 3A8KA 3EDRB 1A6SA 1HI0P 2F1HA 5J2FA 3HKZA 4P4MA 1DRGA 3CYMA 3RW7A 4M5LA 3OT9A 4X66F 3OTOH 4DL7A 2F3JA 4UUWA 2KT5A 3MCMA 3D1OA 3MWMA 2YNFB 2NU6B 4NYPA 3L2PA 1VFJA 1MQ3A 3QRPA 2IA0A 4L72B 4RQ3A 1IQZA 3H2LA 4PR6A 2XNQA 4ZITA 3IG5A 1PSDA 1UJ5A 4PEOA 2FDNA 1QSSA 3HT0A 2SCUB 4UY85 4PXEA 4ZVGA 2ZH6A 4LF9H 4PHDA 4CRJA 2FHJA 4X4PA 2R7XA 4XPCA 4BS2A 5MAOA 7ICPA 3AOCA 1B22A 5IQQA 3QFFA 1RWOB 1ZQLA 1FFSB 5DRKA 1S0VA 1VRQC 1XRFA 4K0KJ 2BCRA 3KDOA 2KKPA 3UD5A 4Z37A 4W98A 1KJJA 1RK5A 4QZVB 5KFEA 3BJYA 1RACB 1O03A 1S6UA 1AYEA 2KK0A 2IYIA 4LZDA 3PJWA 3RV3A 3TUPA 3AOBA 2DO4A 4P52A 2I2YA 1M5KC 4AC7C 1UETA 2KHCA 5J8YC 4RAYA 4R0JA 1UWAA 4DZHA 2MZTA 1ZQMA 1FNXH 1U25A 1ACMB 3EUNA 3C2KA 4RPZA 3I76A 3FBEA 1HD0A 2X51A 2F8LA 1SH0A 2ZIUA 1ZQBA 4NPOA 2BPFA 4X66J 4DSLA 5D6GA 3QO9B 3QIPB 1TAUA 2YNFA 2UP1A 1S7HA 3H7HB 4OZ5A 4HVZA 4DFPA 5A2QY 2ZBPA 3WO1A 1K8AT 4OJ1A 3I0RB 1U09A 2I8CA 4NCGB 4QYZJ 2JL9A 2OSQA 1W2BR 2V4JA 5CCLA 2AT1B 4LJXA 1Z4OA 3OVBA 1JK9B 2DZDA 3TOQA 4GVBA 2YXLA 3D3CJ 4OI4A 2V2QA 3J80U 3V7JA 1HNVA 2IPOB 2AGPA 1YZ6A 2VIHA 2RLTA 3AB4B 2OOFA 2DRAA 4TU9A 4OHVA 3D0HE 3P6YC 3PR5B 1XN9A 4O2BF 1X9MA 1T05A 2EANA 4EWTA 1TZ0A 5J2JA 2IOFA 4L74A 4WTYA 1VQOS 2DHXA 2J9CA 2WTFA 3IS9A 4H4OB 4ANDA 3PHEA 2OEHA 4CTAB 3N0VA 4ACOA 5BJRA 1X4HA 4ZOSA 4HHHA 2DIVA 2RNEA 5J0WA 5I42A 5AKEA 2RAQA 4A3LG 1ZQRA 4B3TJ 1VBYA 2GH1A 4ZOLF 3GZ7A 4DHVA 3HHLD 3LSBA 4MKVA 4ZVHA 3UFCX 1TKXA 1UNNC 2O5DA 4B3RF 3AU6A 3GV8B 4TUSA 5HAOA 4ZS6A 4RW6B 3OXGA 4LF9J 4KLUA 2OELA 5T14A 1CULB 4CLZA 4X4VA 1JLLB 4UB6U 5DB6A 1IM6A 3G4SS 3MR7A 2ZJPQ 1LEOA 4TY9A 5CWRA 2WHOA 3OR2A 2ZXHA 2EFOA 3CJKB 1RQLA 3C16B 3H90A 2HVZA 5D3GB 1KSPA 2E5LF 2UUBJ 2LM4A 2LQ9A 4ID8A 1IE7C 3HHDA 4J9KA 9ICTA 4KB7A 2RP5A 4AYBD 1U1PA 3PSFA 1P7DA 4Z6EA 4Q45A 1MG7A 3KK1B 1LKYA 1C4CA 3TO8A 2EZZA 2K60A 4ICLA 2FK1A 5ALDA 2R8KA 1UFKA 3U9TA 3SV3A 3I12A 1RABB 3OUYB 4C9DA 3K2YA 2NYVA 2KD1A 1S4EA 3K5PA 3MWBA 4U8VA 2E8NA 2KG5A 3R5CA 1SZPA 1F6TA 4OO1J 4F4XA 3JTOA 3W8PA 5BOLA 2ZH9A 2J9DA 4K4VA 4KMUA 1DHMA 2BCUA 2CRLA 2NUUG 1HBUB 3MC1A 1ECWA 1J6PA 1RWNB 5GMEA 1BQNB 1IM4A 1LXJA 2B56A 4A8SA 4PQUA 1WHWA 3HWTA 3IWLA 4DR2J 5BPCA 2GWNA 2R7WA 4U7UD 3MEEB 2P6UA 3WKCA 1CRXA 3IXQA 3RJ0A 1F5SA 5HR7A 1N60A 2OTJS 3L3CA 3CJ0A 3MMAB 1VQKS 1FFGB 2OYYA 2WF5A 3Q2TC 2KT2A 1OY9A 2ICSA 1LWCB 4KMOB 3TQTA 1X66A 4DV5J 3M2RB 3DLJA 3TADA 2ZH4A 2N3LA 1C0TB 3K5IA 3MFHA 4Y2KA 2RRBA 1Y1WA 3NXZA 4F5OA 2AD9A 3D28A 3Q24A 3IP4B 1OS5A 1Y4ZB 5B0AA 4KGXB 4N41A 1VGYA 3KNAA 2VBYA 4J37A 3ZI4A 1Q79A 1FA0A 2VONA 4DCPB 3HVRA 4RW9A 2V0NA 4X5VA 2R9LA 5TISU 1XSPA 5ETQA 1N54B 1Q95G 4BGDA 4RX6A 3NGKA 3IAM9 5AI9A 2OI2A 4F5PA 3BSCA 3VAIA 9ICLA 4MIBA 4QIEA 4DX6A 4FO6A 3RBDA 3CCVS 4JV2A 1LWEA 3P5TL 4YCXA 5J0OA 3K5HA 2NCKL 1BNCA 2IC3A 3C23A 2Z0GA 3CJ3A 1NRKA 1S4FA 2BHNA 2JR5A 1RAGB 4RWXA 3KMQA 4CQ1A 2Y9HA 1Q1KA 2LI6A 4GKKJ 1FRIA 1NDCA 5ETNA 3PKYA 3EZUA 3H98A 2G0AA 3IBWA 3F2BA 2DR5A 1ZH5A 5KFYA 1FO4A 4EEYA 1SKRA 5FDLA 2IRUA 1B0XA 5AE3A 1M5SA 3TARA 2FPGB 1UPHA 2QE5A 2O1PA 1BQMB 3Q8UA 5C24A 2PMZC 2HVRA 5ALTA 2JJ4D 4A2AA 3S1TA 4JI0J 1WCNA 4IG3A 1TR0A 2D3UA 1HKAA 2VJUA 4IO9Q 2CNKB 4HYKA 2NZ4A 1F44A 2RQ4A 5HATA 3UMGA 4O23A 5KFZA 2J6UA 4BY1G 5FSEC 4LF5F 1Y7PA 2BB0A 3C14B 1SV0C 1TTHB 3MGJA 3E58A 3J81j 1NK4A 2J7WA 2FJAB 3IWXA 3AM9A 3CC4S 1F5BA 3JSMB 4LSAA 4IRKA 4FYDA 2LYAA 1VQ4S 2IYGA 1SUQB 4YY3H 3KLFA 5J2TF 2R93G 3MGVA 3HFVA 5J2NB 2V8GA 4KPCA 3BO2A 1R0AB 3HCXA 2W70A 3WBZA 2Y9UA 7ICOA 3B8HA 3C15A 2F9JA 3GV7B 1ZOLA 2C3OA 5J0YA 1HNXJ 4DR3H 2V34A 2I5HA 1XO0A 2E5LJ 1SZHA 3E8OA 2MU2A 3ZTPA 4AQYJ 3I5CA 1PILA 4I2PA 2YZMA 3C0FB 3TA1A 3EDQB 3QRQA 4CNUA 1YBQA 2RRDA 4FPIA 5HHHA 1U1LA 2NLWA 4V19J 2WVBA 2JLFA 2XHWA 5I3QA 4WKYA 2QEXS 3TADC 1KJ9A 2R2RA 1A5MC 3I56S 4RDVA 1PO6A 4MAMA 3K59A 4ANCA 4QBUA 4KT0C 5L1LA 2B4PA 7ICGA 5LXTF 5I3PA 2E3TA 3ZTQA 4F3QA 4WKRA 1OMSA 5JUMA 5ALJA 3UE2A 4QIWA 3EXYA 4PWQA 1YJWS 5IT9Y 3QEBZ 1G4CA 3JTNA 3BDPA 3PJ9A 1RSCA 2FHOB 3GTJA 5ETTA 1XMOF 1JKHA 2A19A 1X4AA 2HMIA 4EPDC 4R5PA 5C25A 4X4SA 3PNCA 3QBCA 9ICGA 1Y0HA 3V81A 4NXNJ 1B7FA 5D4PA 3GLJA 2CPDA 2ZHAA 3O8WA 5AI0A 2ZUBA 4DMZA 3BR8A 4HTIA 3MXHP 2UUBF 2AJ0A 2QTWA 3SR6A 2VOOA 4RW7A 1PKUA 2JA7G 1WOOA 2CA9A 2DB1A 3K89A 2WDTA 4FF4A 1LNQA 5DM6Q 4IFVA 4DV3F 3HM7A 5M2UA 3UD4P 4I2PB 3AJ2A 2D9OA 3SCIE 3KYLA 1UVJA 4IH7A 1M5OC 5HHIA 3NCRA 2HHPA 1IXRA 3C6UB 3L7OA 2FK2A 2UZAA 2VIXA 3RRGA 3N01A 5E7OB 1WHVA 4WYLA 1Q8BA 1VQ9S 5G0RA 2F3NA 1WI8A 3O44A 2Y1LB 3OBIA 5CA5A 1KWMA 2NO5A 5JXSA 2B7BB 2PEHA 1VDHA 4KQZA 3CF5Q 4DFDA 1HUOA 4LF5H 4IWYA 3DC2A 4QWDA 2J8AA 3A12A 4CO0A 2RD5C 4MV3A 2PFOA 1PYSB 4DN0A 4O3NA 1R7IA 2GOLA 4P2FA 2XGQA 3VQSA 5AI4A 4IOAQ 1NPRA 3QFHA 2E8MA 4BWSC 3ED5A 5AHXA 1XC9A 2VG5A 5K8MA 4DR4F 4ZHRB 3BDEA 4EMDA 4JB8B 3CCTA 2AYGA 5HSPA 1JJ4A 3DLEA 2A3JA 1AW0A 2XO6A 1IV8A 2V8DA 4LRAA 3BQ0A 4K2JA 2N7YA 1XNRJ 4C11B 2M70A 1JXLA 5E3RA 1UPPA 3DKDA 2HQFA 1H38A 3LS9A 4C5AA 3CDUA 3R7SB 2AW0A 2RHFA 2DGVA 2IMOA 3KFUF 4RUAA 2R42A 4YR3A 2UVRA 2WCXA 2XMMA 5J2PA 2UBPC 4OZJA 1SWWA 3IS9B 2M9NA 2GCFA 4ECTA 2YB4A 4M9NA 1UCVA 2CJBA 1FWCC 4J9UE 1ZJNA 2YN4A 3RG6A 1IBKH 3NCPA 4ZVQB 1S1XA 5D77A 3K1ZA 3RTVA 1OO0B 1BJTA 2DFLA 2V2VA 3QGHA 2EW9A 4I2QA 1JALA 1JLCA 2DGTA 1U6BA 3J81U 3K3VA 2HNDB 4DQIA 2DCLA 2XYHB 2GWSA 4K4WA 4BWJA 2AJ2A 5CZXA 2K3KA 3GU0A 3DFEA 1U0SA 1RPLA 2ZWOA 2R7TA 2PBZA 2I6WA 1S57A 1EHWA 1X9WA 3BPDA 3GFHA 4RQ7A 3PMLA 3WK5A 1UFWA 3MDWA 4J9LA 2H54B 2ZIXB 4RW9B 3BE7A 2P6RA 4JI1J 4KLEA 4P4OA 1TWGA 1RK8A 5ALXA 2HQ3A 3N79A 2PT0A 3L7PA 1SH3A 1CBKA 4A3IG 1KLMB 1KLMA 4GKKF 2K3IA 4R88A 3UDCA 1Z3EB 4DR3F 3QX7A 2FB9A 2IJFA 2FPLA 2GLEA 1TA8A 1C0UB 5EOZA 2YKQA 4FS2A 3ET6B 4ED0A 2RDIA 3GR1A 4OLOA 8ATCB 1BPDA 4XDCA 2DHGA 3KOOA 4USVA 4ZJOA 4NLZA 3QQCD 2CXEA 2OKQA 4KIAA 4C7ZA 1JI7A 1O0PA 5GAHI 3M9MB 4USJC 2GFFA 4QIWE 3ONNA 1RCXB 4WFNQ 4JI8F 2P9BA 2QGFB 5ALQA 1UEVA 5KFPA 3NUQA 3BPSP 1A9NB 3HKZE 5FD5A 5D49A 3DXSX 1VJWA 4OJ5A 1VS3A 1WYGA 4C2MA 1COKA 2OPPA 3I55S 1ZM2A 4PHAA 5M2PA 4ECZA 4ECYA 2WF7A 3DMJB 4FVCA 4B02A 4R25A 3TEGA 2FTYA 2JNJA 2ZBQA 1N34H 3N42B 5J0PA 1S72S 2W9BA 2E29A 4PL1A 1HNZJ 1WC6A 1S10A 5L1JA 4NLGA 1KNZA 4MV6A 2QC3A 5ETLA 4LFAJ 3HHLC 3JAMU 3PSTA 4UQTA 1H0HB 3ZXWA 1SH2A 4EBEA 2N3OA 1M5PC 3LALA 3CUNA 2Z2LA 1FJGF 4DO9A 3MUTP 2RS8A 4NA3A 3V6KA 4AQYF 1EAYC 1Y5IB 5RUBA 4LF4H 1GMVA 2JFDA 1L8LA 4C97A 2CRXA 3BH7B 1WHXA 4J90A 4DV5F 4QWCA 3PVXA 2D3DA 1Q8LA 2CUYA 4I67A 5LSOA 2G5HB 3R0DA 2KN7A 4CO2A 4TV9F 9ICXA 4YAJB 5KAKA 4JI0H 1U6ZA 4OX7A 4ZP6A 1WACA 5F0UA 2RKIB 3CC2S 1YTYA 1KOOA 2DKXA 3W65A 5AK6A 1EJ7L 1NKCA 1R8CA 1F0XA 4KKOB 4I7FB 8ICZA 4AE5A 1FKOB 3DV9A 1E4FT 3T5KA 1TK0A 1IOVA 2CG4A 2KSWA 2YMQA 1OSCA 4IAJA 3KWMA 1FESA 3Q8LA 2G0JA 4MTEA 2YQ1A 4ES3A 1TELA 3OTCA 1N36J 1Y5NB 3IGVA 4N77A 5HVGA 5EN1A 3GFXA 2LDYA 4K5RA 4HH1A 4WTOB 5KL8B 2M52A 4DG1A 5LSRA 5CA0F 3LOUA 3OLAA 5F3ZA 2IJNA 1HHSA 1MROB 1EYZA 3H25A 1VQYA 3CMES 2Y1IA 3MMJA 1IKXA 4CYUB 1IBKF 4U7UK 4YB7A 1UVIA 4I50F 4I7FA 3J7YI 3V4IB 4TY8A 2W2QP 4NWIA 5B09A 4Q2LA 2WF6A 1GSAA 4CC5A 5IIMA 1HWIA 5EGYA 2WVDA 2VQEJ 2NVYA 1T95A 4B3SJ 1YMYA 1MZBA 2DGUA 3SMZA 4DR4J 1ZPVA 1S3TC 1BVSA 3PXGa 5CCMA 5EE3A 1SC1B 1HQ2A 2BJ7A 2MJUA 3H5YA 3TZYA 2XHCA 2DNHA 2O67A 1T9WA 4DU8A 2H4WB 1HLWA 2VQEH 4M94A 1CEZA 1J5OB 4Y2PA 2CZ4A 5FSDC 2XS5A 2JHDA 4MFCA 3PZPA 3DDHA 2HFSA 1Q4RA 1T9XA 1T7PA 1RAHB 3V7KA 2RGRA 5CD4A 2CQ2A 1Z1VA 2AH5A 5KG1A 1BPEA 4R8UB 4PG8A 5B7WA 3BG5A 1AN7A 5A0LA 3CMQA 3MEEA 2GHVC 1ZQPA 4PXDA 3K5OA 2J6SA 4V1Ak 3L3FX 2KDOA 3MPYA 2B51A 3MURP 2A2CA 3PRDA 4PHEA 4YHHJ 3D1HA 2RF2A 1WKLA 1GSHA 4Q7AA 5HN0A 4XZ3B 4LRFA 2RQCA 2W1BA 4OYBA 4F5RA 1NEEA 2ZC4A 4I2HA 3D6NA 1GMWD 3HD2A 5DBAA 2OLWA 4GOAA 3OUYA 3WZ0A 2H48B 2ZG6A 4NXMH 1V5IB 4DR6J 5J2MB 1VOMA 3RB3A 1U24A 3GCWP 2YQEA 2GO9A 3IP0A 3V5RA 4AXJA 2BDUA 9RUBA 2ZDQA 3E0FA 5EUHA 1L7MA 4Q2MA 3OL9A 4LF8H 3M8YA 5HP4A 3JSYA 4WYWA 3MM5B 1XR6A 4WXOA 3LWLA 4QJFB 1S9GA 4X65H 5KFAA 1OSDA 4PWWA 4TV8F 1UW9A 4NA1A 5CYMB 1JLCB 1KQQA 4NE9C 1GQEA 2M0GB 2W6ZA 5BPFA 1JN3A 4F2RA 1YRRA 4M5KA 2YTUA 2JVOA 5LL6b 4OYWA 1FWPA 3ZDCA 3I1YA 4NZ0A 5AKZA 3KBBA 3PRVA 5EE9A 4AQYH 1KFDA 5AIAA 1URJA 1WSVA 3ETHA 4YN3B 3R2DJ 5HBMA 4QR0A 2CPFA 3R5HA 1I5OB 1UAWA 4PH5A 4ZLLA 5GAGU 1MN9A 4L6V3 5ADZA 3UVJB 3RV4A 3M6UA 3G8CA 3GPAA 1LWXA 7ICSA 3CDWA 2DGQA 3C28A 1LFPA 4JYAJ 3V4SA 3G6ES 5KOXA 3PO2G 1JJCB 1MMNA 2CQYA 5KKNB 1NZAA 3D2SA 3VQTA 1FD8A 1SFOA 1WWVA 5I3UA 2W9BB 3MUMP 1T03A 1O5JA 5F8MA 4IL6U 4USWA 1Q53A 1Z19A 2BQ3A 2AJFE 2QLBB 7ICRA 3HJVA 1TKXB 2ZKUA 1FJGH 4FXDA 2HIQA 3QFWA 2VG5B 2OEKA 4IQVA 2GJIA 2MPUA 3LP1A 3IRWP 2R7VA 4KHPH 2ZKTA 1XDNA 4BBYA 1QSLA 1PK1A 5AI5A 3MEGA 1Z4UA 5J1NA 5LMUJ 5B0DA 1XNQF 4QNLA 3TVKA 4XDDA 1N5YB 4CLPA 1Z2OX 8ICWA 4DOCA 1ZRNA 4QCLA 1KEJA 5L9XA 1XMQF 2J8SA 5F8HA 4Z2XA 9ICPA 3OR1A 2RSQA 2W9AA 2W7AA 3MMBA 5LSLA 3D4JA 2NXCA 3M6WA 3M2RA 1H6KX 1L3TA 2XG8A 3AEVA 2QT3A 2VA3A 2D1CA 4I27A 1MU2A 2CJYB 5J0QA 3IG0A 2ZZTA 4HQ6A 1EUDB 1H7XA 2N1RA 3NRBA 3BREA 1VQPS 1B43A 5SUHA 5DG9A 4M5IA 3VZHA 2FVPA 1IVZA 1ZA2B 4WFZA 1RXVA 4N47A 4LFAF 2LYBA 4DV2F 1MSWD 3MPUB 4DL4A 2LP4A 4IYQA 2VOBA 3DOMB 2W6PA 1X5PA 4ETSA 2F63A 2ZIUB 3BGFA 3DLKA 3ENWA 3QJJA 4R7WA 3KDNA 3M8PB 2MQMA 3HXLA 3GONA 4I2JA 2K7KA 4AL7A 2Q3PA 1NLKL 2C2RA 5AKGA 1SB6A 4OYOA 3JS9A 3AD7C 3KK3B 1J5OA 1AFJA 3EGWB 4OJ6A 4G1PA 3FEYB 2PC6A 3BGRB 3P8BB 3H0MB 1S6PB 2PMZF 3ZTOA 4OYAA 2OD4A 2DGZA 3M30A 4J9QA 2HRTA 1UPMB 3AUOA 2R7NA 2VBZA 3QJPA 2RGVA 2CFXA 3IHQB 3KK1A 1JWWA 1CQIB 2DL0A 1NKEA 4A3FG 4OX9F 1RADB 4KLJA 2C22A 5FLXU 2WSCC 3HT3A 4ZPCA 2QMXA 4ANEA 1D9DA 1SC4B 1RHMB 2HPUA 1CI4A 2JXJA 3BQ1A 4YP3A 4DV4J 1N34J 4JI2J 2W9CB 2VZ9A 3CJ8A 3SEIA 4DUYJ 4IHJF 1WD6A 2HW3A 1IBLF 4M2YA 1DQ9A 4RW6A 3V7PA 1N36H 3LAKA 3BQ2A 3CTRA 3H20A 3VPDA 9ICMA 5T7LB 2J7KA 3MMCA 4U96A 3T9ZA 3ZZYA 3Q8QB 2RHQB 1IKVA 2NRZA 3GFYA 4C8OA 2UXCF 4OYZA 2V94A 2GPWA 3CIZA 5HLFB 2V67A 3KLIA 2HK3A 3BO4A 3SIPB 1X6IA 4Q5VA 1SJRA 2NPFA 4DFMA 5CABA 1Q7LB 2M8DB 3MR6A 2QARA 2R18A 2RQMA 2PFNA 2HHUA 1Y10A 1KRCC 1B6SA 5LMUH 3VMMA 2Y0BB 3LF0A 5KFQA 4YD2A 2N7CA 5D8DA 1NI3A 4RT3A 2HHTA 3MMCB 4HT5A 2KJ9A 1J5EJ 3NVZA 1RXWA 4URGA 4DXLA 2CQDA 4PKDB 4QIVA 3Q83A 1PAUB 2FPKA 3FM9A 3CO9A 4I68A 1K47A 3OSNA 1XS9D 3PEJA 5DLGA 3PO3G 3RBXA 3HX9A 2VG6B 2GOKA 2R4FA 2ZIVB 4PXBA 3BN4A 1Q0NA 1HR0H 4NOHA 4F0MA 1HWUA 4UOHA 2HGLA 4LSLA 3RJKA 1GK8A 3GJTB 1ZQKA 1LB2B 4M5DB 2J7UA 2PMHA 2XMKA 1H73A 5DETA 3HHNB 4X2BA 1J2MA 3KLEA 2VJ5A 1RBAA 1U47A 3LW5C 2JH1A 4F4KA 3KZIU 4R66A 1NZ8A 1N63A 1PC5A 4B3ZA 4PG4A 2UVVA 3ZNJ1 4F67A 1JLFB 3RTXA 1EJXC 2DWQA 1T9UA 2QLWA 1WC3A 4F36A 2QJ3A 4C4SA 3UN5A 1AA1B 1JQGA 1X9SA 4JV5F 1L3SA 1L7OA 3HMJG 5CQGA 5L38A 3GYGA 3G71S 3DF7A 4M1KA 2X3DA 5HK4A 3K3PA 3TQ1A 2QZ8A 5IC4B 4M5NA 1WORA 3MBYA 2VG7B 4DQQA 3SDEB 2WB1E 1RT2A 2YS7A 3MGHA 4RUHA 4DSEA 2W6QA 4QJVA 2CQCA 1CC7A 2KZMA 3QT7A 3EPGA 4ECUA 9ICEA 2AX1A 1QTNB 1CJTA 4XRHA 5IT9U 5E79U 3PO5A 2QYZA 1RBLA 3QGPA 2YRXA 4LIRA 2HHWA 4LFAH 4DPXA 4MHVA 1WKJA 1RHQB 2DH9A 4TUQA 2DXFA 2MSNA 1B0VA 1C1BA 4UAYA 4ZPVR 1DTTB 2ADBA 1EQMA 4NZ7A 4X62H 5DKWA 1KFSA 2ZDHA 2C2MB 4Z7YA 4US8A 2GS8A 2ZBIA 4NWBA 4QWBA 1UT8A 1PZNA 4PGXA 1TKZA 7AT1B 2ZJ8A 5D0HA 2CG8A 1QAYA 1LWCA 3TWZA 1M0SA 2HBJA 1GO3E 4MAKA 1Z00B 4LRBA 4FS1A 1KQKA 2R7RA 1URNA 2OPPB 4IQXA 5J1EA 2AEFA 2FQQB 1R0AA 1U49A 2QYGA 2UUAH 1NBEB 3ISBA 1AZSA 1FTCA 2JX2A 1S1WB 2EC2A 2R7ZG 2B6AB 1HBUA 3KKAC 1SUQA 4EFEA 2HHXA 3UR0A 3PW4A 2Q2TA 1KOHA 2HBQB 4ZQIA 1JXVA 2YX4A 4JI8H 2HZCA 1BD6A 2YWEA 2UXDH 4IQUA 2HSZA 4IRDA 2IMRA 4WFYA 4YB5A 3FFIA 3RIZA 1RT1B 1AFIA 3KAJA 4A8EA 4QIWC 3QGKC 4AT1B 1S9FA 2ASDA 4YR2A 4BCAA 3KG0A 4K4XA 3KJQB 3O6QA 1FRLA 1C20A 5IIIA 1YBTA 2FKLA 2CN1A 3R27A 1CULA 2W7PA 4OJ3A 5J1PA 4J9NA 1GX5A 3A3PB 3HZGA 4MK7A 1MN8A 4K0KF 2JH3A 4WCEQ 2B8QA 1UT5A 3U7JA 2J0QD 1VAJA 1TV6B 2IC3B 3UWTA 1FWIC 1YG0A 3FFIB 2H3IA 4PCQA 3E2EA 1BWEA 2BOPA 1LK5A 1FWAC 2PFPA 2VQFJ 3QSYB 3AXMA 3QWPA 2BABA 3VVTA 3C3LA 1YJRA 4YB1P 3TACB 3UVJA 4J9RA 4O44B 2FJBB 3KFWX 1UC9A 4QOTA 1JLBA 1VQMS 2DF4B 3VHQA 2CNLB 4OZNA 3NOCA 3OTBA 3CB4A 1FFUA 3J7Z5 2LYVA 3BZKA 4AFFA 2W2PP 4PG5A 1JX4A 2E7VA 2YKNA 2J0SD 4RW8B 4YS2A 1Y11A 4X4QA 3UQ8A 1TKDA 5A6WA 4A3BG 4JI7F 1KBUA 1DV2A 2I8EA 3MI7X 3AU2A 5ALYA 5KG5A 4MFAA 1RWVB 1FKAF 4WIIA 4AD6A 2BMBA 5BR8J 1JLAA 1BPYA 1DFDA 5KFKA 1RTZA 4B6JA 4DLGA 1ULZA 1JJHA 1OUQA 3K58A 3HJEA 1EUCB 1LV5A 2A1BA 3DEEA 3MPDA 4WJ3B 1K5OA 4RW7B 4HT7A 2SXLA 3Q89A 1I94F 3OOQA 4O9MA 2MZJA 5A8RA 1NZPA 1RHKB 3M6KA 4UB8U 1N0UA 4A3GG 2QL9B 4DPYA 5J2HA 4TUYF 2QL5B 4UF4A 4C8YA 1HNWH 2PSZA 2R93A 3RAQA 1FD2A 2CVIA 3RR8A 2JEFA 2Q66A 4FNIA 3MPVA 8ICQA 2QV6A 5AJ3F 1TWHA 2YW2A 1U9LA 1IBMF 4YFUA 2YS6A 1GNKA 3KLHB 2WOMA 1BNOA 2KHVA 1VIXA 4RZQA 2B4UA 2VUGA 5CYJA 2JA6A 3NVVA 4BKNA 4WHBA 2MJNA 2PMZA 4K4HA 3OTOJ 1DARA 2DUYA 1S03G 4J0MA 3K1RB 4MH8A 1FWKA 3CVZA 4N56A 1KJ8A 8ICJA 1PCAA 3RFCA 1TL1A 3CD5A 4XX0B 5CYQB 2DEIA 3BYPA 5LT5A 3R5GA 4FE3A 4DPTA 4IUFA 1CUKA 3AMZA 4RQ5A 5AM1A 3V2UC 3C2LA 1HNZH 1GAOA 4EELA 5CHCB 2CW8A 2AP6A 4YR0A 4YHHH 1N56A 2MUTB 4DCJB 1J97A 3QAUA 3NTUA 3QXGA 1IR0A 3AQFA 1FFWB 3F5EA 4ZKAA 2DITA 1S6PA 1PO9A 1L5UA 2HGMA 1DK3A 3ICJA 1OQ6A 3U26A 1ZAXA 2W43A 4PL2A 1RTDB 1A0IA 3LP2B 3PX6A 3FZBA 4BJQA 2ZDOA 4OD0A 3W66A 3A8EA 2CKZB 2EC0A 3PM9A 2HAFA 1Q81T 5HMFA 4LFBF 2OEJA 2QLFB 2F1IA 5KFGA 3N2CA 3DOMA 4B3SH 1SJ1A 2A1JB 1ZQGA 4UQGA 3OFEA 3R97A 1NXIA 2J76E 2K4PA 3G77A 3N6XA 1EETB 4PZOA 3CJRA 1RTIB 3TIIA 1HUZA 3TVYA 2ROGA 2Z56B 3D7SB 5A0YB 1WF0A 3D5MA 3QNMA 2ZDGA 5AKYA 3FSYA 1YSJA 2E1PA 2HCFA 4URSA 1P8LA 4A8FA 2EVZA 5EWGA 2UXDF 3SAHA 1FXLA 3W64A 3JXOA 4ED6A 1HPZB 4QU7A 3QATA 2GIRA 5B08A 1FDDA 2CZVC 5A0YA 4NLKA 5HO4A 1NB7A 4DR5H 2VC0A 3DDIA 4HEA9 3FEZA 4OZ3A 1D3WA 4UBCA 4DL2A 2EBEA 2H3ZA 1NK0A 3TJ8A 4EYHB 2M88A 2XI3A 3JYTA 3T1HJ 4DX5A 4ED3A 2VU5A 2OPSB 2Y0SD 5G5HA 1EARA 5B0CA 2CQ1A 2CJKA 7ICHA 2Q1LA 3UI3A 1Y9OA 3B78A 1FI4A 9ICIA 1UVNA 3I31A 4JI7H 1CJKB 4YMMA 3TJAA 3J81Y 2OPRB 2ZOMA 2YRWA 2GMJA 4PWDB 1ELOA 4ED1A 2R6FA 5A2QW 4TURA 1TAEA 1FRHA 1SIZA 4I29A 1HBNA 2FY8A 4QZIA 4PXCA 5DB7A 4QR2A 1F9EB 2FLPA 4E0DA 4GLXA 3CXCR 3L95X 3DYAB 4DDFA 2F44A 1SGGA 5ALKA 8ICSA 3G6VA 2JWNA 1WG4A 2JZBB 1KCXA 4YB6A 5LMNF 3C1ZA 5KG0A 2DNYA 4KLIA 2ZIXA 5B0GA 1LW0A 2KVSA 3TFSA 1R9XA 1EP4A 3I32A 3BS7A 3QUCA 5JVHQ 1VISA 1NNLA 4NYOA 3RRHA 1QE1A 2GMLA 2ACMA 3PRBA 4MV9A 2KH9A 1GEHA 4CM0A 4USHA 2JC1A 3DDKA 1BWVA 2UXBJ 5DDPC 4OLPA 2ILZA 1OY8A 2YZGA 1NJYA 4WXWA 2DY1A 4I2GA 4I1TA 5I47A 4LH6A 1QUVA 3AQOA 3W3SA 1N5QA 1EZZB 2UZ9A 2JZ5A 1X4FA 3ILOA 1F9HA 1M5HA 2B6GA 1IUJA 4C3LA 4IR9A 3AN1A 1ZM4A 4ZCKA 5HMYA 1U1MA 3FRZA 5LXYA 4FP9A 5JRTA 2KJ5A 4DL5A 2W4CA 3G82B 1SV0A 3UXPA 3DRPA 2KIVA 4DQPA 5IYDG 1PYTA 4B3MH 4B3SF 1ICEB 3ISNC 4QYZK 1N5YA 1Z4NA 1VRUB 4LF1A 3UQSA 2RT3A 4Y2AA 2MKIA 2W11A 3ETLA 3ILIA 4I6YA 4DR3J 2XYGB 5E3CA 1KVIA 4P4PA 4NM2A 2QIFA 4XQ8A 4KLSA 1W25A 4ZK7M 2BQUA 4GXJA 3W5ZA 1RTJA 4V19X 1ZM3A 2CQGA 2QB1A 5TZVA 2NXJA 2UV8A 2YBVA 3TR5A 1RJJA 2DNGA 4RNNA 4LFBJ 3MGIA 4H4MA 1NO8A 3C29A 3DRRA 4GC7A 5C3EG 1L7NA 4DSKA 1FT8A 1SC3B 1QVGR 3M6VA 3MFIA 9ICCA 1GXLA 4CDGA 4LF6J 2JH7A 1M1GA 4BC9A 2DNZA 1YHQS 3AT1B 3ZZUA 3IO1A 8ICLA 1VQSA 3PY8A 1VR6A 3BZQA 2MGZB 2ZUGA 2OGJA 4C3KA 3DLBA 2CJ9A 4ZLPA 4Y2VA 1T4GA 2CDQA 5L1IA 5ALUA 3HXMA 2D74B 4V1YA 1HJPA 3MTWA 2YWWA 3UDLA 5ETOA 1BQXA 4DZDA 4AP9A 2KG0A 3V4IA 1ED1A 4BXOB 3H0GA 4EO8A 5J0RA 4QWAA 4RB3C 5E3QA 2X0SA 3CDEA 2XNRA 1NJXA 3C2PA 3CT9A 2R7KA 1QVFR 1MROA 1BE4A 5DO2A 2XLKA 4PQAA 2QX0A 2ZIVA 2D3ZA 1BMQB 2NR0A 4OJOA 2WONA 3H42A 1Z2NX 1RWKB 3ZZPA 1EIYB 2WBRA 3ZDDA 2YVSA 1Y00A 4KLLA 4NY8A 1HEKA 1YX2A 3ETMA 3UBPC 5HI7A 9ICSA 2G06A 3W1YC 5EZYF 2VD3A 1HNWJ 1TUWA 1RT7B 1HIWA 2HYIB 1YLXA 3CCSS 5J0UA 1N6QA 5E3PA 2FVMA 1TWAA 4W90B 4MIWA 3FKIG 4NEYA 4QJFA 2M2BA 1FWFC 3HKZF 3UXNA 3L7UA 3NGUA 4PG7A 4TN2A 2UUCJ 4LF7J 4EEQA 4I2CA 3MWEA 1T11A 3HI9A 5J1EB 2WYOA 4PJ0U 4PGQA 3RB0A 4WGXA 3CCMS 1WF1A 9ICNA 1NB2A 3D3BJ 4LUBA 1NU4A 4FU0A 3PW0A 1SIWB 5IC6B 3U1MA 3JPSA 2WE6A 4LMYA 4P7VA 2G07A 3TI0A 4DLKA 2HMIB 4FXWA 2C35B 4O0IA 1SXLA 4CF5A 2FGOA 4AUKA 3G9CA 2I87A 3JAMW 3I82A 1T36A 1GSOA 2OTLS 1O6XA 3QLHA 5J2BA 4LJMA 5K9FA 5FPOA 1IJEB 3EGJA 2GGPB 1JIHA 1RAAB 4KLQA 2BXJA 4JI7J 1XK8A 2MQNA 2HMXA 3N9UC 1XEZA 4JI4F 3J81W 8ICHA 4KO0B 2QG9B 2YWFA 2Q6BA 5DGBA 2AGOA 2HRUA 3IDWA 4GRSA 2AYBA 5HMEA 1XIQA 4KRWA 2KZ3A 2G2OA 2J6TA 4ED2A 7ICKA 5HQ8A 2XY5A 3BSOA 3C5GA 4KQNA 1FNOA 3H8JA 1KTVA 3PIOQ 3MEDB 1HQUA 4KV8B 2CJXB 3CQZA 3CCJS 3HKWA 3OD2A 4LVOP 5ETPA 3HOZG 4ZPAA 4OJPA 2K8CB 1R0BG 3V81B 1HFEL 4TLQA 4W92B 1R8PA 2MLYA 2H65B 2Q43A 1NJIT 2XZTB 2B7CB 4DV1J 1NH7A 2V69A 4NX9A 4DR1J 1N62A 1HI8A 2H51B 4DSJA 4NXNH 4EGJA 4YMNA 4DL3A 1N88A 1VMBA 4K4YA 4Y0FA 4DV0H 4M9GA 2VR1A 2NSBA 3N5FA 3N43B 5LJ3Y 3DLKB 5IZHA 1KVJA 3NGTA 1HW8A 2LA6A 2JLGA 1ONWA 2CQIA 2DNNA 2NPIA 1TL7A 2KP7A 1L3UA 2ZM6F 3RAMA 1FJCA 2JA8G 2H3EB 3A13A 1CJUB 3KHRA 4NZ6A 4P10A 2RQKA 1HA1A 4CC6A 2HURA 4DOZA 1QUPA 1RKIA 3QU9A 2KL8A 3X3UA 4DOBA 4O2AF 1FTRA 3KJFB 2BCSA 1MW7A 4USMA 1BXRA 3LYSA 4FZLA 2KJ8A 1EJUC 4KHMA 2ZH8A 3CCES 2B9EA 2QB0B 3KHLA 3BKFA 4WBFA 1PVPA 3GIIA 3BBBA 1C4AA 3BEGB 3P49B 3TZWA 4KN7A 2P50A 2LDIA 2ZDPA 3IG1B 1P9YA 4F5NA 1ULRA 5K2MA 4KIRA 4IG3B 4JWMA 2EWHA 5HMLA 1REVB 2F4FA 4F4YA 1RA0A 2K1RA 1JKJB 5LL6d 2OEMA 2W25A 3GYXB 3ONQA