The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
113
|
sequence length |
342
|
structure length |
342
|
Chain Sequence |
MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb |
molecule tags |
Transferase/dna
|
source organism |
Sulfolobus acidocaldarius
|
molecule keywords |
DNA polymerase IV
|
total genus |
113
|
structure length |
342
|
sequence length |
342
|
ec nomenclature |
ec
2.7.7.7: DNA-directed DNA polymerase. |
pdb deposition date | 2012-05-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00817 | IMS | impB/mucB/samB family |
A | PF11798 | IMS_HHH | IMS family HHH motif |
A | PF00817 | IMS | impB/mucB/samB family |
A | PF11798 | IMS_HHH | IMS family HHH motif |
A | PF11799 | IMS_C | impB/mucB/samB family C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | DNA polymerase; domain 1 | 5' to 3' exonuclease, C-terminal subdomain | ||
Mainly Beta | Roll | Urease, subunit C; domain 1 | Urease, subunit C; domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits | ||
Alpha Beta | 2-Layer Sandwich | Dna Ligase; domain 1 | DNA polymerase, Y-family, little finger domain |