4F4XA

Y-family dna polymerase chimera dbh-dpo4-dpo4 #2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
molecule keywords DNA polymerase IV
total genus 113
structure length 342
sequence length 342
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4xA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f4xA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4xA01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f4xA04
3PX6A 2HHTA 1CSJA 4MIAA 1L3TA 1TV6A 1KFDA 4KN4A 3UQ2A 3PHEA 3QO9A 1C1BA 1JLAA 3CWJA 5J2MA 1C1CB 4YQWA 4KITB 4DL3A 5KFFA 3I0SB 2WHOA 4DL2A 3DLKB 4QZAA 3MBYA 5HMLA 1RT7A 3RR7A 2P6UA 8ICTA 4RNOA 4Q45A 2F1HA 1ZQCA 5IIJA 4MIBA 4MEYA 4EYIB 4JV2A 1C0TA 4U7CA 4IDKB 3FFIB 2PFNA 5C24A 3KNAA 3DOKB 3PR4A 5CYQB 3LK9A 5KG3A 4EZ6A 8ICWA 4Q44A 2WRMA 2Y1JA 4K50A 1RTIB 1NJXA 4FS2A 2ISOA 3KLEB 2IAJA 4NZ0A 4WYWA 4YP3A 5J0QA 4QWEA 4M9NA 4QZIA 4C8OA 5KFTA 1DTTA 1RT1A 3IRXB 5HROA 2R8GA 5D46A 1YVFA 3E01A 4ZP6A 3CJ5A 3RR8A 3PX0A 5KT7A 4RW8A 4ZVHA 4YFKA 4ZP9A 8ICVA 4C8NA 1JKHB 4RT3A 1NK5A 2UVWA 3H40A 2KZMA 1RT3B 1LW0B 4PH5A 4M04A 9ICRA 3KLIA 3EZUA 5J0TA 4F4XA 2W9CA 2XI2A 5J2AA 4NLGA 2VG6B 3TAQA 3UXPA 1ZQLA 3V6KA 4R5PB 2OPSB 2BCUA 3CDEA 4PUOA 1TQLA 5KFYA 4M9GA 4F4YA 9ICOA 5F8MA 3C1ZA 2W9BA 2IA6A 4ED6A 4LZGA 5KFGA 3RH6A 4F5PA 1J5OB 3FQLA 2ATLA 4G1QA 4YMMA 1TP7A 4ECQA 9ICBA 4O5KA 1SKSA 3PY8A 1MU2B 1HNVB 3CVKA 3TAMA 2LYHA 2BQRA 2IC3A 2ZTDA 1T3NA 1BQNB 5F9NA 5KG5A 2FMSA 3KK1B 4NCGB 3G6YA 2HNZB 4DQPA 4WE1B 2I1QA 3QGGA 4R5PA 1UA1A 3OL6A 1ZQWA 2WONA 1MQ3A 4TLRA 4I2DA 1J5OA 4DFMA 1N5YB 1D1UA 1RT4A 4M9LA 5JXSA 1ZQNA 2FVQA 3V81B 8ICEA 4RQ8A 4RW9A 9ICUA 4ELTA 4UAWA 3QIDA 4DOCA 4I27A 2GIRA 1KHWA 5KFWA 4O3SA 3DDKA 8ICZA 2J6SA 1NNDA 8ICUA 4TUPA 2NRWA 4IRDA 4MK8A 4UAZA 5DDMA 5DBAA 3NAIA 4IKAA 4JK1A 4DFKA 1U47A 8ICLA 4KB7A 4JWNA 3E51A 5C25A 3FQKA 3HKWA 1L3SA 1T03A 3LP0B 4DL5A 2WK4A 3E01B 3I5CA 4IH7A 4ECUA 1FKOA 7ICTA 4IG3B 1KLNA 2XY6A 4IRCA 4R64A 3DLGB 5FDLA 1SUQA 2OPRA 2PI5A 2I9GA 4K4HA 5K14A 2D7SA 4UBBA 5HP4A 2YNHA 2GC8A 5D49A 5C25B 2IAJB 4F91B 4FO6A 4H4MB 4YN4A 7ICRA 2NRXA 3TARA 1XSPA 3N4MB 4RQ4A 2W8KA 1LWEB 3GIMA 2IM3A 2HNDA 4DL4A 4Q8EA 4NM1A 4GC7A 1L3UA 4NLRA 4KKOB 3MGIA 2ASDA 4NLWA 4MH8A 9ICAA 1NKBA 3DRRA 1JLCA 3H5SA 3T5JA 2RKIB 5L1JA 4EEYA 2WB4A 3UDLA 1JXLA 4J9PA 4DO9A 5J2QB 2JEJA 3ZD9A 4NM2A 3AU2A 1S49A 2B43A 1S1UA 3OHBA 4ZVFA 5F8LA 5J0UA 5J2PB 4NLTA 4NCGA 1TKTA 1EP4B 1HQEA 3RJGA 1IKWB 5J0RA 2ISPA 1VRUB 3RJKA 4RPYA 8ICBA 3GIIA 1ZQRA 2AGPA 5KG4A 2ZD1B 5F8NA 1HYSA 4DFJA 3ITHA 3ZDEA 4ELUA 4GXJA 3ISCA 2IM2A 2FJVA 1ZQAA 1S9FA 4DWIA 4ECYA 1S9GB 2AQ4A 3LP2A 4YG2A 3OLAA 3ZDCA 2E9RX 3HHKA 3AUOA 3SFGA 1L5UA 1DTQA 4NLVA 2FVCA 2KN7A 2J6TA 4GC6A 2AWZA 3HVWA 4IQXA 4QZHA 5J1EA 4O9MA 1RT5B 2DFLA 3MDAA 3MF5A 3BSNA 4BXOA 2DPJA 4PWDA 4MKBA 1U49A 3DRSB 1ZQPA 3JPRA 3TANA 3KLHA 1TKDA 4Z6EA 3EPGA 1N6QB 4KO0A 1ZQHA 8ICMA 4WZMA 3KLGA 3BGRB 3H5UA 3JPTA 2ZJAA 9ICIA 3TFRA 2AGOA 1GX5A 3N6LA 7ICUA 4QZ9A 5HBMA 8ICHA 3M8QA 2BHNA 3IRXA 4UB3A 4WFYA 7ICKA 4K4IA 7ICQA 4DG1B 5C42B 4O3PA 1D8LA 1CEZA 3NBPB 4J9SA 1U09A 5J2DA 1X9SA 3B0YA 4PHPA 1U45A 5KFZA 3MABA 2OPQB 2ILZA 3ZDDA 4BGDA 4O0IA 5D4BA 4B9MA 5D3GB 3BR9A 3V6JA 3C2LA 7ICHA 5EDWA 5C24B 1SL2A 3RTVA 3AU6A 2MUTA 4KLMA 1KSPA 2ILYA 2XCPA 5I3UB 4ZPBA 5EOZA 1ZQFA 3RH4A 2R2TA 2ZUCA 1QE1B 5CWRA 3DYAB 5IILA 1S1VA 1T4GA 5HP1A 4RQ7A 4NLSA 1MSWD 3PJXA 5I42A 4KLUA 3MR3A 4O44A 5HLFB 2FLPA 5DDYA 1C1CA 4O3QA 3PW7A 5CHGA 2PFQA 4H4MA 4KLDA 4YD2A 3Q8RB 2C2RA 4M2YA 4WFXA 2ZKUA 3KMSA 3CDWA 3KHRA 4IOBA 3CJ3A 4NLQA 4R0EA 3EWAA 5KG7A 1S9EA 3H4BA 8ICSA 2FMPA 4ZHRB 4NXZA 3DM2A 4MFBB 4EO6A 5HBMB 4P4PA 3E2EA 5KG6A 5KT2A 1IKXB 4YMEA 1R0AA 1ZQQA 1LWFB 2VA8A 1TKZA 4ICLB 1CUKA 3KK3A 5C42A 4J9MA 2FLLA 4MFFA 1IM4A 5HNKA 1NKEA 1HQUB 2IJNA 3ICLA 4WFZA 4UB1A 1HQUA 9ICKA 1ZETA 3RRHA 4DQSA 3NKYA 5DG9A 5J0SA 1KLMB 3K75D 5KFMA 1RXWA 2JC0A 4I2BA 4RW9B 4ZVEA 5L9XA 1XC9A 4R65A 4DSJA 3ZD8A 4DSEA 1ZQVA 5KFHA 1RT4B 2FVPA 2D3UA 4ED1A 4ECWA 4F8RA 5JUMA 1HUOA 5KT5A 5CR0A 4M0AA 5CYMA 1BQMB 4JV1A 4M9HA 2UUTA 4TY9A 1W25A 3H59A 3KOAA 4J9RA 3EW9A 5DQIA 1S9EB 4NLYA 2FMQA 3M9OB 1EP4A 4DS5A 1HPZB 3RB3A 3KK2A 4ECTA 7ICFA 2HAIA 2I5JA 1XS9D 4TY8A 1T94A 3EPIA 5KFRA 3IGVA 4G3IA 3UR0A 4KLLA 3JPNA 1JLFA 2DPIA 8ICYA 3JYTB 2HHWA 4NLXA 1IKWA 3ORYA 4ID5B 2VA3A 4PUOB 4RT2A 2ASJA 3IS9B 1S1UB 1S0NA 5DGAA 1RT6B 2ASLA 2P66A 3KLIB 4TQRA 4F5NA 3IG1A 1S76D 3V7JA 4F3OA 4NLOA 1HMVA 3RJFA 3IGNA 2HHXA 1TL1A 1FKPB 4J9LA 4I2HA 3NBPA 5BOLA 5CB1A 4TN2A 1JLQA 4RW7B 1B43A 3MTKA 8ICFA 4DOAA 1T05B 1DTTB 2OH2A 9ICMA 3M8PB 2YNFB 4UB5A 4C8LA 4DQRA 1A76A 4B9SA 4QZGA 2IHNA 1SV5A 2IM0A 3MEGB 3OL7A 4I2QB 3T5HA 1DGSA 3DLGA 2AX0A 9ICPA 1NHVA 3RBEA 4K4SA 3BQTA 4Z6DA 2KFZA 1L3VA 3UQ0A 9ICFA 1C0TB 4IDKA 1UT8A 2FVRA 1S1WA 3KLGB 4RW6B 3RAQA 5J29A 2NRVA 3FYHA 4K4ZA 3BQ1A 3IG1B 4XUSA 1B22A 2VG7A 4EZ9A 4P2HA 1RT7B 3DLEB 1Z00B 2GWSA 4RZRA 3IS9A 4F92B 1RT5A 4URQU 2WOMA 4ZP7A 5KT6A 4ID5A 1TKXA 3DM2B 4MFBA 4QW8A 3MECA 8ICQA 1KDHA 1JLFB 5J2MB 5DLGA 2FLNA 2XCAA 2CJQA 1JN3A 4QZFA 1NK7A 2KZ3A 1V9PA 2ZUDA 3LANA 4F4WA 1HYSB 1XR5A 4ECRA 2HHVA 3G6XA 5J2QA 3RJEA 4YR2A 4RPXA 3ZDAA 1S97A 4J9OA 4H4OA 5I42B 3DRRB 1NK0A 3MEDA 4RPZA 5CYMB 1TV9A 5KFXA 8ICAA 4B3OA 3MFHA 3GILA 4G1QB 1BGXT 1ZQTA 1TK8A 2J6UA 1C2PA 1TVRB 2VG7B 1SKRA 2D3ZA 4DL7A 2W9BB 4IR9A 4DL6A 5I3UA 2UVRA 2HW3A 1ZQZA 2P6RA 1D9DA 3SZ2A 3PX4A 4KLEA 2JZBA 4OL8A 2MAXA 4QWBA 4WZQA 2XY7A 4IR1A 4KLSA 2PXIA 4JWMA 4LQ3A 2W9CB 1RT1B 5HROB 4UAYA 1S1XA 1KTQA 3C2MA 1RT3A 3D5MA 2BE2B 1RT2A 4KLIA 4I2QA 1RZTA 1S1WB 3MEGA 4I2PA 3OGUA 1S1TA 5CP2A 5EWFA 4ECZA 3ISND 3ETLA 4O4RA 3SFUA 2HHSA 2ZE2B 2IMWP 4B9VA 2HWIA 3NL0A 5KFSA 5DB8A 5T14A 2IHMA 5KFEA 4F2RA 4RUCA 3QEAZ 5CYQA 1XU4A 2BRLA 2NRTA 2R8KA 3LAKA 4ECXA 1LWCA 3HVTA 2C2EA 2XC9A 3GIKA 4NYZA 1RT2B 9ICGA 5DB7A 5L1KA 2ZUBA 1ZQBA 4F4ZA 1UA0A 3C5FA 3DI6A 1IKVB 3DOLB 1XR7A 2BPCA 5HP1B 3I0SA 2JZBB 4QPXA 5DLFA 1NKCA 5IINA 4WE1A 5J2FA 3ISNC 1EETB 2E9ZA 4H4OB 3BSOA 1HUZA 3UPQA 2XGPA 4KBIA 3LP1A 2JEIA 2BKEA 4RQ1A 2BQ3A 2PFPA 7ICMA 1RXVA 3N97B 1ZQJA 1TV6B 2YKMA 3HWTA 4Y3CA 1HPZA 4DLGA 2IC3B 2D41A 1TK5A 4LSLA 1HQEB 1XR6A 3GFKB 3MEEB 5J2PA 1HNVA 1N48A 4PGXA 1UT5A 4K4GA 1EXNA 2HWHA 1Z00A 2OPPA 5DKWA 4KLHA 3DRPA 5J2NB 4Q0BA 4O3RA 5J0WA 4PPXA 3M8QB 3KHLA 4DQIA 3Q8KA 1QUVA 5KFPA 1HNIB 3EZ5A 1NK8A 5EUHA 2WTFA 2R2UA 2ZJ5A 3H8SA 4KO0B 1T7PA 8ICNA 2GIQA 3MFIA 1SZPA 2F1JA 4M94A 3OHAA 2B6AA 3KK3B 3C23A 2FVSA 1JLEA 1JKHA 4ECSA 3RJJA 3H98A 1DOQA 1KLMA 3V6HA 4RW4A 3G6VA 4J9KA 2JEGA 3PW2A 3LWLA 4ZHRA 3T19A 2V0NA 1X2IA 4F5QA 5J0YA 4QWCA 4WYLA 3PVXA 3OJSA 1LWFA 3ISBA 3LALA 4YVZA 3SV3A 3FFIA 3MGHA 2HHUA 1TAQA 9ICHA 2B5JA 5J2GA 1REVB 4Y34A 1MC8A 2HMIA 1JMSA 4MEXA 2AX1A 5HHIA 5J0XA 2W7PA 3RJHA 4R63A 1ZQOA 4IFVA 3RRGA 1C7YA 4MK7A 9ICXA 4KLGA 1NK4A 3ISDA 1JLBB 4DLEA 4I2AA 4I7FB 3TAPA 3PR5B 3SV4A 3PW4A 1XO1A 2WCXA 2B5JB 3THVA 1QE1A 1BQNA 2QV6A 3ZDBA 3N6NA 3C6TB 2PI4A 1IKYA 3QO9B 2BANB 1TK0A 2MUTB 4C8MA 2UUWA 3H2LA 3QGIA 4BWJA 1BPBA 4PGQA 4O3NA 4Y2AA 1ZQIA 1BPZA 1SUQB 2OPRB 4R8UB 4ECVA 1PZNA 5KFVA 1ZQGA 2OPQA 4ED0A 1KHVA 4ED8A 3IN5A 4XPEA 1BQMA 4F93B 4Z6CA 1N4LA 4PHDA 3T5LA 4O3OA 4KLFA 4MF8A 1XSLA 3RAXA 2YNIA 3TVKA 4ZVGA 3KLHB 4BDPA 4IH5A 3JPOA 1S0OA 4ICLA 4HKQA 3BQ2A 4RW8B 5J2KA 2EC0A 4I2FA 1BPEA 4M6WA 3CJ2A 4DSIA 4DFPA 4ZH4A 4WXOA 8ICKA 4MFCA 2V4QA 2OPPB 4BXOB 3CO9A 4LSNB 3GV8B 4ZMMA 1NJZA 5DQHA 1QSLA 4Z6FA 3KLEA 1ZQMA 4IRKA 3M8PA 4I2JA 4K4WA 1SL0A 4Q43A 3NMAA 3PO4A 2C28A 3V6DA 4PHEA 3KLVA 1HJPA 2FJWA 1RAJA 4LZDA 5F8JA 3ITHB 4NLDA 4O4GA 1LB2B 5CA7A 1FK9A 4QWAA 1S1VB 1RA6A 4M47A 5DB9A 1X9MA 2KFNA 9ICCA 3HVAA 4O44B 4IQVA 4EBEA 1QAJA 4ZPCA 3GDXA 3GV5B 1LW2A 1TKTB 3PNCA 4Q8FA 4JUZA 2HNYA 4KFBB 4ED2A 1IXRA 4J9QA 4BWMA 2FJXA 4H54A 3C6UB 7ICLA 2JC1A 1JLAB 4TUSA 1JLCB 4CCHA 4DEZA 1TFRA 3Q8SB 4O4GB 3KK2B 5D3GA 3H5XA 8ICXA 1RTDB 3C21A 1LWEA 4KSEB 5FDLB 1ZQXA 2IJFA 3KHHA 4IG3A 8ICJA 1RTJA 4K4XA 4I2GA 5KFLA 2Q0ZX 4ED3A 3V7KA 4NLNA 4K4TA 2C22A 3PMNA 4TXSA 5K14B 2A1JB 3DMJB 3C1YA 1K1QA 1N6QA 1ZQKA 3QLHA 1K1SA 9ICTA 1UNNC 2PFOA 1FKOB 2R8IA 1T03B 4YR0A 9ICJA 4WXWA 4UB4A 4UQGA 2RF2A 2FPMA 5J2NA 4Q0BB 7ICNA 3RJIA 4R66A 1ZYQA 1TVRA 3BREA 1S6QB 1VRTA 2YNIB 4PWDB 1QSYA 4K4UA 5KFKA 1HARA 2HVHA 3MEEA 3JSMB 3FSIA 9ICEA 4LSLB 1DTQB 4MF2A 3NTUA 3JPQA 1MQ2A 3DRPB 3OL9A 1BVSA 1D0EA 1RA7A 2W9MA 4IQTA 4XA5A 4NY8A 1TAUA 2R2RA 5EWEA 1ZQEA 4ZPAA 5IIOA 1ZQDA 1WCLA 3KK1A 1S4FA 5KFUA 2ZTCA 5KFJA 5KG1A 7ICGA 4RNHA 4KN7A 4URSA 4X5VA 1NHUA 3JSMA 1MU2A 2AQ0A 5J0OA 1KFTA 3I5AA 4B9LA 1XSNA 3QEBZ 3MR6A 4YCXA 1S0MA 1IKVA 3BSAA 3RB4A 1RTHB 2XI3A 4IFVB 3LP1B 1TVAA 4RNFA 1ZQSA 1RDRA 7ICJA 3TFSA 3V7LA 4UB2A 3RBDA 1SH2A 2JEFA 5KFBA 4TQSA 5J2IA 5HMMA 2VG6A 3DI6B 3FRZA 2O5DA 2V9WA 2YNGA 2XO7A 1S48A 2BPGA 2AJQA 4LQ9A 5KFNA 2YNHB 2KTQA 5TZVA 7ICVA 4I2PB 4ZP8A 1JIHA 7ICSA 4PGYA 1NJWA 5KFAA 3Q8QB 2ZJ8A 2FPLA 3NAHA 3HPOA 4TYAA 2CKWA 3HW8A 4I28A 2R8HA 2BDPA 1RTDA 2ZE2A 4GXKA 1SKWA 3PW5A 8ICRA 4RW4B 4RQ3A 5F8GA 2AGQA 4EO8A 3BGRA 3I5BA 1QAIA 2VANA 3V81A 2QE5A 1RTIA 3OJUA 1ZJNA 5C5JA 2B6AB 1SH0A 3SYZA 4KLJA 4DF4A 4KLOA 1T8EA 2XGQA 2VA2A 3DRSA 3KJVB 5DBBA 2WONB 4DOBA 5EWGA 4I2EA 4NRTA 2IM1A 3KHGA 3MR5A 5J1EB 4ELVA 3MEDB 2HNZA 4K4VA 4O5CA 1QLNA 4XPCA 1ZTTA 5IIKA 4B9TA 3M9MB 1C1BB 3K4GA 3LDAA 1N5YA 3TAMB 1BPXA 1WNEA 5BPCA 4TY8B 4Y2CA 1NK9A 4B3OB 4YXJA 1XWLA 1ZJMA 5DGBA 4B9UA 2R2SA 4KLTA 1VRUA 3PZPA 1KEJA 1C0UB 3D28A 5L1LA 2ZTEA 5F9LA 2BCSA 1ZTWA 4GXIA 4RQ5A 5KFDA 2V4RA 3OL8A 4NLKA 2BPFA 2AU0A 2YKMB 1Y88A 1VRTB 3JPSA 3KJVA 5J2CA 4XRHA 1ZQYA 4RQ2A 4KMUA 4NRUA 3CIZA 3V4IA 3FDSA 2HHQA 4I29A 2RKIA 1TKXB 4P4MA 4IG0B 4KHMA 2WOMB 3KTQA 1A77A 1UWBA 2HNDB 4EYHB 1S6QA 2HVIA 3GV7B 4DSFA 4NLUA 3C5GA 2RF2B 9ICVA 5KFQA 4QZ8A 3H5YA 3OSNA 2W7OA 2OWOA 4QZBA 4DSLA 2YNFA 4F5OA 4U6PA 1GX6A 1S6PB 3PJWA 4X2BA 3H8WA 1I6JA 3BSCA 5KFOA 3H8JA 8ICPA 4GLXA 3SI8A 2A1JA 4RW7A 3LP0A 1QSSA 1JLQB 3LWMA 4XQ8A 1U4BA 3H7IA 4IH6A 5DG7A 4P4OA 2BANA 4XO0A 3GQCA 3QE9Y 1IKYB 1WCNA 2YNGB 1S1XB 4IFYA 5L1IA 4E0DA 5HLFA 3T3FA 4RUAA 1RT6A 1NOMA 1LV5A 4I7FA 3DOKA 1Z3EB 1Z4UA 2H5XA 3PO5A 1HMVB 3QGHA 3EYZA 3V4IB 1RYRA 1TL3B 1TL3A 4RNNA 1RTHA 3GYNA 4ED7A 2IBKA 3DLKA 4M95A 3CJ0A 4KV8B 2BGWA 4KFBA 4ZPDA 5DG8A 2HMIB 1NJYA 4LVSA 1DLOB 2RDIA 7ICPA 9ICQA 4NLZA 3JYTA 1U9LA 4TYBA 4FBTA 2E9TA 3Q8MA 1JX4A 1QTMA 5BOMA 4DS4A 2VG5B 5CJ7A 2BCVA 4F5RA 1FK9B 3QYYA 1JXEA 4MFAA 3V72A 3RB6A 4DF8A 1KRPA 5J2BA 4K4YA 4DG1A 8ICOA 2F1IA 5J0PA 5DBCA 4QW9A 4URGA 7ICEA 3MECB 2UVUA 3KLFB 4I2IA 4MK9A 4NLPA 2OPSA 4HYKA 1KFSA 4TUQA 3T5KA 1JLEB 4JV0A 3UPFA 3DLEA 4RNMA 4QZCA 2XY5A 1BPYA 2BCRA 4YR3A 4EBCA 3RB0A 5HHHA 3M8SA 2BQUA 5KG0A 3QLHB 1ZQUA 3CJ4A 1LW0A 1RPLA 5KFCA 1D8YA 4M6WB 4RW6A 1H38A 4I2CA 1R0AB 5F8HA 4RU9A 3BQ0A 4YD1A 3B0XA 3KMQA 1HNIA 5KG2A 3N6MA 1MMLA 3PMLA 2W9AA 3UXOA 2YKNB 1RTJB 2W8LA 3MR2A 1RYSA 2RDJA 7ICOA 3UXNA 4PQUA 3HP6A 3I0RA 3QZ7A 9ICSA 1IKXA 1SV5B 3LAMA 2ZD1A 2VG5A 4PHAA 3TQ1A 2UVVA 3C2KA 4FBUA 3M9NB 1T05A 3CDUA 3PW0A 1X9WA 2R8JA 3NGDA 1JLGB 3GIJA 3C6UA 4YMOA 4KV8A 3Q8PB 1FKPA 2HNYB 1TL1B 1S10A 5KT4A 1LW2B 2JLEA 4O5EA 3QIPB 3C6TA 3QIPA 7ICIA 5KFIA 4YXMA 1DLOA 1S77D 9ICNA 1EETA 2XWYA 4F4KA 4RQ6A 3VQSA 3TI0A 4KKOA 1JLBA 3OSPA 5J2JA 4KLQA 3JPPA 3DOLA 3DYAA 4FS1A 3RH5A 4J9NA 3V6DB 5J2EA 1AROP 3PV8A 4F2SA 1LWCB 3HVTB 4M9JA 4B9NA 3T1AA 2NRZA 2I5JB 4MKAA 4QZDA 9ICWA 1REVA 4UBCA 1JLGA 4PQUB 2BCQA 1S0VA 2I1RA 4IFYB 2C2DA 1S6PA 1SH3A 5IIIA 2FPKA 1OS5A 3QZ8A 3HT3A 3Q8LA 4KTQA 1S1TB 4LSNA 4QZEA 2B21A 1SL1A 3I0RB 3HX0A 2BE2A 3G86A 2ALZA 2Y1IA 4DQQA 4KE5A 8ICIA 5KTQA 3UQSA 4EBDA 2M9NA 5DB6A 2BRKA 4KHRA 1UWBB 4KAIA 2KZZA 2YKNA 3IHQB 4YMNA 1BPDA 3OLBA 2F8EX 3BDPA 5KT3A 1COOA 1S9GA 3LP2B 4R8UA 3M8RA 3DMJA 3H4DA 4TURA 1TKZB 4IQWA 3IM1A 9ICLA 4QWDA 4IG0A 3KLFA 5J2HA 4IQUA 4DSKA 5DQGA 4F50A 1U48A 4C8KA 1C0UA 4RQ0A 3BJYA 1NK6A 3MDCA 5F8IA 2BR0A 1N56A 1D9FA 8ICGA 8ICCA 5IIMA
chains in the Genus database with same CATH superfamily
1FCAA 2CQHA 2KVCA 1TV6A 2W2PP 2ZM6F 3C46A 3ETJA 1R3NA 4Q5VA 1B7YB 2W24A 1C1BA 3BBFA 4B3ZA 2BUNA 5KAKA 5ALDA 2XMWA 2VHGA 5AK4A 2PMZA 5AICA 2YX1A 4XAKA 3CDBA 3TEHB 1AXQA 3M6WA 4DPOA 4DR1H 4DL2A 1GSAA 4QZAA 5HANA 1RT7A 3RR7A 4PYAA 3NG8A 2P9EA 2G2YA 4M9UA 2DXEA 4Q45A 2Q6CA 4ZLNA 4QJVA 4LF7F 5LT5A 1URJA 2PC6A 3MMAA 2G08A 2GGPB 2PFNA 3BAAA 3HKZA 3DOKB 3PR4A 1L8LA 2XHWA 5I3QA 3J80U 4ED5A 4DV1J 3ZZYA 5AXMA 3MOJB 3UBPC 1P9YA 2V58A 3CD7A 1RTIB 1NJXA 2CPEA 2HDOA 3KLEB 4NZ0A 4KQZA 4N5SA 5KOWA 4QWEA 4QZIA 3IBWA 3TINA 3KKAA 2ZDPA 2CJYB 3GJSB 3FKIA 5J8YC 2ZOGA 3PSIA 1RT1A 3IRXB 1FNXH 2O67A 4OYIA 2LHTA 2RGVA 2E8OA 2NR0A 5IT9U 4RW8A 3LPEA 1NZPA 5ETMA 4ZP9A 3AM9A 8ICVA 2GJFA 3HT0A 4C8NA 2E8MA 4RT3A 1EYZA 2CQPA 2WSFC 3D9BA 2KZMA 4QU7A 1RT3B 1ZOLA 1KKHA 1LW0B 3OW2R 2XMJA 3KLIA 3EZUA 2DNOA 2DNPA 4FYWB 1MW7A 2XI2A 4ILRA 2RE1A 4Y00A 2D8CA 4FYDA 4A8MP 4R5PB 1NPPA 2OPSB 1K73T 4EWTA 3MMCB 5L9NA 2VJUA 3N44B 1U2RA 2M70A 2V2ZA 5FLMG 2A10A 1GGOA 5GTIU 3PIOQ 4A8QA 2LP4A 4AUKA 2W9BA 2IA6A 4ED6A 3NGRA 5KFGA 2UXDJ 1VC5A 4F5PA 4Y2XA 2ATLA 4NA1A 1VOMA 1I6UA 3JRXA 1F0XA 3MDUA 1TP7A 4ECQA 4O5KA 1SKSA 3FKBA 2MKHA 4A3KG 3TAMA 2EAMA 1VQMS 3K57A 3Q8VA 1S5LU 2P6TA 1BQNB 1HIYA 3KK1B 3TOQA 2OUGA 1HR0F 1G1XA 2HNZB 4DQPA 3R5GA 3HFZB 3QGGA 2B3TB 4G6VB 1FI4A 1ICEB 2PFFB 4P0PA 1GXLA 4ZVQB 4DFMA 4MTDA 3VGSA 2Y1RI 4NXMF 3OTOJ 5J1PA 3TIIA 3OR2B 5ALKA 1B04A 1I1GA 2L9WA 1SV0C 4RQ8A 2CQYA 4RW9A 2VV5A 4I68A 4UAWA 2RLTA 4UB6U 2F5GA 1GAOA 4DOCA 2MKIA 8ICZA 2J6SA 1XMQJ 3JRWA 8ICUA 1VISA 4TUPA 3WU2U 1MWZA 2NRWA 4IRDA 2XG8A 5D0GA 5DDMA 3K1ZA 4OI6A 8ICLA 5C25A 1S6UA 2RRDA 5B0GA 1Q81T 2NV3A 2ADCA 1L3SA 1N61A 1Y7PA 3I55S 5H9EJ 4I69A 4A3FG 3W64A 2YY3A 3LP0B 3E01B 4NPOA 1IOWA 1L6NA 4IG3B 4MKYA 4RLEA 1EUCB 4K4HA 2Y1LB 2D7SA 1KRAC 1IBKJ 3IWNC 3K5NA 5KKNB 1N36J 2J9DE 4CF5A 1Y5LB 2IAJB 3AXKA 4H4MB 4YN4A 2NRXA 2V63A 3GIQA 2XSJA 5F41A 1XSPA 4RQ4A 2CQ4A 4ZOLF 1Y00A 4DR2J 1LWEB 4K0KJ 3LGNA 2CWXA 2C2MB 2LU2A 1L3UA 1ZA2B 1Z2PX 2VIXA 4NLWA 4YY3F 9ICAA 1NKBA 2OTJS 5IQQA 2CYYA 2RKIB 1NI3A 2PSZA 1NUEA 4J9PA 2XZDB 1B6RA 2AQVA 4NM2A 3AU2A 1S49A 4LF8J 4X4QA 2N3LA 1S1UA 3OHBA 1QD1A 4A47A 1U0HB 4EELA 2ROEA 4WTYA 4NCGA 4RDWA 1HQEA 3IBFB 4OX7A 3W63A 2CJKA 2AYMA 2KJ5A 8ICBA 4IC9A 3GIIA 5ALLA 1ZQRA 2VQEF 3OUYA 4HL9A 2BV3A 3QWUA 2J9EA 5ALUA 1U1PA 3JZIA 4LMYA 4N8OA 2VASA 3PEJA 1S9FA 4NX9A 4BWSC 3OLAA 2E9RX 3SFGA 3AUOA 1L5UA 1DTQA 2F8LA 2KN7A 3M32B 2IDEA 3AQPA 4W92B 1IBLJ 2AWZA 5J1EA 1RT5B 4X4TA 4BXOA 2DPJA 4MKBA 1M90T 2DHAA 2ZH4A 3JPRA 2PGCA 3TANA 2YQ1A 1TKDA 3GYGA 3KLGA 1UC8A 1N32F 2VUMA 2F4VF 2AGOA 4OJ1A 5HBMA 8ICHA 2DT9A 3UM9A 2WF7A 3MPDA 4WFYA 2HQDA 5C42B 3AOBA 2FK2A 1LVHA 2PMHA 2CJAA 2K4IA 1CEZA 5J2DA 5LSOA 1ZS6A 1UC9A 2IOFK 5KFZA 2QYCA 4DUYJ 2NU9B 5ALJA 2ILZA 2MSTA 5LOQA 3BR9A 3HCXA 3V6JA 2YXLA 3CJRA 2MUTA 4KLMA 2ILYA 1CQIB 1HWIA 1IXKA 4TNOA 1LKYA 1ZQFA 3RH4A 2NYVA 2R2TA 1TL5A 2Z2LA 5ALVA 2V69A 4X65F 2WVCA 5HP1A 4RQ7A 2X1AA 4J7CA 2ABYA 5I42A 1N8RT 2R7WA 5DDYA 3PW7A 1FDAA 4H4MA 5L46A 4HTIA 4Y2RA 3KKFA 4I56A 4IOBA 1X5OA 1EX8A 4R0EA 4B3MJ 4A8SA 1AUSL 4IYQA 4DFDA 2R7SA 4QPTA 1FTRA 2DH8A 4GY7A 1FWBC 5HBMB 4P4PA 1EZ1A 2XMMA 2JWNA 3E2EA 3HHLC 2YMMA 1R0AA 1S8OA 4ME6A 5C42A 5F3XB 2IJNA 4M5DB 3CMAS 2ZH3A 3ICLA 3BGOP 4M5DA 4UATA 1BWVA 1ZETA 1FVQA 2RNEA 3J81U 2V6AA 1ULRA 1UPPA 4DSJA 2GO7A 4DSEA 4F25A 2FHJA 2FVPA 2WSCC 1FF2A 4FZVA 4KX5A 3C15A 4RB2C 5KT5A 3P4UB 3SQGB 3NNAA 2UUTA 4TY9A 4DR7F 2FKLA 3QWPA 3SSRA 3VPCA 1X5TA 4EU0A 2DY1A 3SAHA 3M2VB 2I5JA 1XS9D 3EPIA 4A3IG 5KFRA 4CRXA 2C42A 2NVYA 3JPNA 8ICYA 2HHWA 3ORYA 3QJJA 3O5TB 1VQLS 2A3JA 2VA3A 4F26A 3CO0P 3NASA 5GAEU 5ETNA 4ANEA 1SQGA 4PYDA 2HIYA 2ZXHA 2ASLA 2B9EA 3KLIB 2I6XA 3CJKB 1S76D 4OHYA 4NLOA 4JI5H 1UFKA 3RJFA 5DM7Q 3MM5A 1VDVA 3NBPA 4USUA 4RW7B 3MOZA 3HKZC 2EG2A 4TU7A 4DOAA 1WDTA 1DTTB 2E29A 4DZHA 1KRCC 4DX7A 1M5SA 2YNFB 4DQRA 1NU4A 3CC4S 2VC0A 3G4SS 3GFHA 2HLTA 5A8RA 3G9CA 1T02A 1Q5VA 1FXLA 3CCMS 3H90A 1ZRMA 2CPHA 3DLGA 2AX0A 5ETVA 4F71A 2OEJA 2P5VA 5HMEA 1NHVA 4OJ5A 3TWZA 2DGSA 3BQTA 4Z6DA 3GSDA 4R7RA 1X66A 2UZ9A 1UMJA 4Q2MA 2HMXA 2P9BA 4OJ3A 4IDKA 1UT8A 2K3KA 3WNZA 3LA0A 4LF6F 1APSA 1IJEB 4K4ZA 2Q3PA 3KXDA 1Q8BA 2CWKA 4EZ9A 1RT7B 2HLUA 3DLEB 4OV6A 1RP5A 2KO1A 2WOMA 2HOFA 2DNYA 2GSEA 3O2IA 4PDBA 1Z4OA 2N7YA 1TKXA 8ICQA 4KJIA 1X60A 5A0YA 2XCAA 2K4EA 4AYBE 2B4PA 1NK7A 4XYMB 4RAYA 2ZUDA 1HYSB 3GTPA 1XR5A 1JLLB 2F4FA 2Q79A 2M2BA 4CP5A 3OPXA 1XMBA 3RJEA 4RPXA 2Y0SA 4HT5A 3U7JA 3DRRB 4C7YA 2XD4A 2OHDA 3MEDA 5CYMB 3NRBA 2VB6A 1TV9A 1J2VA 4PG5A 4B3OA 3BN7A 3IR7B 3MFHA 3IG8A 3GILA 2DTJA 1U1QA 5C3EG 4DUZJ 3PSPA 1TVRB 2VG7B 2I6WA 1SKRA 1ZQ7A 2CVEA 3QYPA 2D3ZA 3THPA 3TJ8A 4IR9A 5FSDC 3IP4B 1FEZA 2UVRA 1ZQZA 2NU8B 2BJ9A 3MAAB 1XNRH 2JZBA 3PKMA 4ES3A 2LI6A 4OL8A 4QWBA 4WZQA 3IG5A 3KUGA 2R85A 1ZD4A 3RFAA 1S99A 4JI3H 3K8WA 5IWAF 1RT1B 5D4OA 5HVGA 1S1XA 3C2MA 1HNWF 1IQZA 1RT2A 3TO8A 4KLIA 4I2QA 3MEGA 3K2YA 5DDOC 4FZNA 1S1TA 5AKGA 5CP2A 4P2SA 2IY5B 1UCVA 3ISND 4KY3A 1ZRNA 1W96A 1DK2A 2IMWP 3A8EA 2Y0SD 4HH0A 2NYIA 2HWIA 2RF4A 2D69A 4OHVA 1VBHA 5KFSA 1UVKA 2B4OA 3KG4A 1H7WA 2IHMA 2KI2A 4F2RA 4RUCA 4ETXA 4YY3J 3MWEA 2XC9A 3L7UA 1RT2B 1XNQH 1N34H 3IGHX 4YJ2F 3F41A 1IKVB 4FFDA 3DOLB 4C8YA 2P9GA 1DK3A 3W9HA 1EF2A 1WOPA 4QPXA 5DLFA 1M0SA 3ISNC 5GADU 5LMNH 2XVTA 3UPQA 2LQJA 3LP1A 1UVIA 3IAM9 3MM9A 2BKEA 2BQ3A 1WHVA 1VI7A 2F8MA 2JA8G 1ZQJA 2YKMA 4DR6F 3BO3A 2ZITA 4X4NA 1E9YB 1HIWA 4DLGA 2J76E 3GG0A 2HSEB 1KDNA 3G96A 2DUYA 2KE7A 1TK5A 2GVZB 2X0SA 4LSLA 3QT7A 5JVDF 3MEEB 4DV0H 4DV2J 1N48A 1RBAA 4K4GA 2JL9A 2OPPA 2RVJA 1PGZA 1ZAWA 4JI0H 3B8HA 5A0YB 2CDRB 4NWBA 3KHLA 4C4TA 1GQEA 3CXCR 3SQGA 2YWKA 2WTFA 2R2UA 4LFBF 1RCXB 2HBMA 1Z2OX 4CQDA 3PO3G 4U7UK 4KO0B 2FB0A 4ANCA 2RQKA 4JYAF 4ZKAA 1SZPA 4PWUA 4M94A 2R92G 4I67A 3C23A 2FVSA 2B4UA 4HT7A 3H98A 2YQEA 1DOQA 2KT5A 4CQ1A 1KLMA 3V6HA 1C4CA 5CAAA 2MQPA 2JEGA 2OTLS 4A3DG 1URNA 1X2IA 1EJTC 4F5QA 1CJKB 2RUGA 1CS0A 5A8KB 4X62J 1U7LA 3BZQA 5B09A 1OPIA 1BUXA 2RH3A 3DDNA 3OUYB 1DV2A 3MGHA 4QIWF 2VBWA 4OD0A 3D0GE 1Q3UA 2HHUA 3UDVA 2UXBF 9ICHA 4CH1A 2GH1A 5J2GA 2KM8B 4Y34A 2M52A 2DGWA 4FKYA 1Q46A 3RW7A 1M1HA 1RQLA 3QSIA 4MEXA 4OZ3A 5I3PA 1KVJA 4R63A 1HA1A 4V19J 5EN1A 1KEKA 3M8YA 5CCMA 1WDDA 5MAOA 3QFHA 4ZOSA 4WHBA 2DL0A 2D3O1 1WORA 4Q0YA 1UBPC 3CRXA 5IS2A 2E1EA 1BQNA 1SIWB 3ZDBA 3N6NA 3C6TB 3QGAC 4AD6A 1TK0A 4C8MA 3AEVA 3OPKA 1M0TA 2JH7A 4O3NA 1ZQIA 5L1MA 1IVZA 1I50A 1YBQA 2BJEA 2BE7D 4ECVA 2DIUA 2AEJA 3O7UA 4V1XA 1E6VB 1ZQGA 4LF2A 4Y2TA 1HW9A 1NZAA 4DV6J 2A1AA 3IN5A 5LJ5Y 2KICA 1BQMA 4KHPH 2UU9J 4O3OA 2VL1A 4FVCA 4BY1G 4ZVGA 1U6BA 4DZDA 3SBMA 3KLHB 4M5LA 5CA5A 1TFYA 4DPUA 4HKQA 3M6XA 3FAHA 4LREA 2G2ZA 3BQ2A 2VPXB 1VJ5A 2J8SA 3EICA 1IE7C 1R8HA 3KNGA 3I12A 4ZH4A 2DY9A 3ENVA 3B4MA 1RA5A 4MFCA 4Z2XA 4DV5H 4DR2F 1NJZA 4GVBA 4K0KF 3FZBA 1B4SA 2JOQA 4OLOA 2UUAF 2EFPA 1IBCB 3M8PA 3WX8A 4I2JA 4K4WA 5HJYA 3WIUA 3DXBA 2QLTA 2HS0A 5LM7E 2A0FB 2OMOA 3BH6B 1PK8A 4QWAA 3J7Z5 2QT3A 4CH0S 1K6WA 2KFNA 3QT6A 5G4DA 1QAJA 3GDXA 1HBMB 4DV3H 1WACA 2I8EA 1PCAA 3OTOH 4NLCA 4FN5A 3N28A 2VDIA 1IXRA 3PO2G 4FP9A 4CNZA 2AJFE 2CQ1A 3C6UB 3H2VE 4K7QA 1LKYB 1JLAB 3OVBA 4R85A 5ALYA 1YRXA 2KSOB 1Q78A 4CCHA 1Q86T 2X1BA 2K7KA 4F67A 3Q89A 4O4GB 4C7QA 5D3GA 2IRUA 8ICXA 3GYXB 5FDLB 4MHVA 4AC7C 1V4YA 1VFJA 5C1PA 2CUYA 1YMYA 4F36A 4I2GA 3GIRA 4A48A 1EHIA 1HNZH 1IBMF 4NLNA 3PMNA 2A1JB 3OVSA 3AJ2A 1N6QA 1K1SA 1UNNC 2PFOA 2PMZD 1KR4A 1S6OA 1T03B 2ALYB 4LVOP 2MGZB 1ULZA 1WKJA 4GO7X 3SEOA 3CCTA 4X4PA 4CLTA 3D66A 3SQIA 5J2NA 1JB0C 3RJIA 3I96A 3NNHA 1AFIA 3UE2A 1HBNB 4DV7F 1VRTA 4ER8A 2PKEA 2LBOA 4DUYF 4PWDB 2ZC3A 5J2TF 4OYOA 5KFKA 5C44G 4DV7J 4RU2A 3ZZOA 2HVHA 3MEEA 3VWSA 2K8AA 2RRNA 2V34A 4MF2A 2O3DA 3JPQA 2WAQE 3J80W 1MQ2A 2J5AA 2CPRA 5BPHA 3OL9A 1UJ5A 1D0EA 1FFVA 4JI7F 1FFWB 4IQTA 4QQBA 3TQEA 2K60A 1VDHA 3QXGA 5E41A 3ZTQA 3NY0A 1ZQDA 5D15A 2KN4A 2O6KA 3UMGA 2MB0B 4J5OA 1RAEB 5KFUA 1K0VA 2E3TA 2OODA 4EFBA 1WD6A 4RNHA 5AM2A 1NHUA 2XHCA 1RWXB 1O5JA 1J97A 4MYUA 2AQ0A 2B0CA 1KFTA 3QRQA 4ETSA 2JA5A 2EC2A 4C80A 2XZWA 4EUVA 3PG9A 2OSRA 1OWXA 2EBEA 3M2UB 4UZBA 1HWUA 2E2IA 2XI3A 1TVAA 1RDRA 3H8MA 3RBZA 3CGIA 3NUQA 3RBDA 4UF4A 4GOAA 4DZ6A 2V5AA 4C8ZA 3MMBB 5SZTA 5KFBA 3D2NA 5AI0A 2HVZA 1CVJA 3TW0A 4R88A 3EGWB 1EKRA 2CPYA 1ZPWX 2Z57B 1QM9A 5T7LB 2XO7A 1F2GA 2BPGA 2YKQA 4LQ9A 4MV4A 1O12A 1I7NA 4CF3A 2ODGA 1TUWA 2NPIA 4JV5F 5E3QA 3ZFVA 4ZP8A 1PO6A 2AJ1A 1LK5A 3D67A 1VS0A 5DZ7A 1NJWA 5KFAA 3Q8QB 3F44A 3HW8A 3KAJA 1SKWA 3PW5A 8ICRA 4H4KA 2XULA 2L5YA 3BGRA 5HI7A 3FBCA 2B56A 2KSOA 1U26A 2DNQA 2XMAA 4HVZA 1FEHA 3OJUA 4LR9A 1SH0A 4BX9C 1RAIB 4KLOA 3KDOA 4HQ6A 1YBUA 2DYAA 2VA2A 3KJVB 2VBZA 4IWYA 5HR6A 5DBBA 4WKRA 5EWGA 2D6FC 3CCLS 4I2EA 1BE4A 5J1EB 2W03A 2P8IA 4WFNQ 4K4VA 1ZTTA 3TADA 4AYBF 3OXFA 3D6TB 3WX4A 4AL7A 3JSLA 4L6V3 4USMA 3K4GA 3LDAA 1NB7A 1FERA 1NK9A 4B3OB 4USVA 2UUBF 2I5HA 2B9YA 1ZJMA 5DGBA 2R2SA 3HKZF 4DR5H 4CEUC 2HBLA 1DQ9A 3DLBA 5L1LA 4HH1A 2DCUB 5F9LA 4C97A 2LPEA 4L3KA 3OL8A 8AT1B 2AU0A 5HBRB 3H8YA 2WSEC 2AT1B 4MV6A 2W4PA 4AE5A 5J2CA 4XRHA 4QR1A 1ZQYA 1HWKA 4NRUA 4ANDA 4OX9F 2NSBA 3V4IA 3ICXA 2LDYA 2PA3A 3M6VA 1VQ6S 1FFGB 3CCZA 1Y3JA 1YHQS 3OFEA 3KXYT 2UBPC 2LKZA 1AUVA 3KTQA 2KRRA 4EYHB 1TMMA 4GRSA 2K1RA 1MZBA 3EDQB 2HVIA 4NLUA 2VFRA 3GR0A 2KYXA 2RF2B 4C5ZA 2WYOA 5AXLA 1Q7LB 3RAMA 5I47A 2OWOA 4OZJA 2CQGA 3D6FB 2YZNA 1YRRA 1WSVA 1S6PB 2HS3A 3BS5B 1FJGH 1SPBP 4CH7A 4PKDB 4L72B 3UCZP 1A9XA 4RW7A 1QSSA 3DEEA 2OP5A 3MURP 3H7IA 2A1BA 2F77X 5DG7A 3P8BB 3QFWA 2BANA 4XO0A 2WB1D 3QE9Y 3BB5A 2KXHA 1B0VA 4HAIA 2BEFA 4E0DA 1FWCC 2ZNZA 5HLFA 4GKJF 3T3FA 3CMES 1LV5A 3Q1KA 1YZ6A 5K8PA 5AI8A 3POTB 1NNLA 1X5PA 2H5XA 3W9JA 3NEKA 3QGHA 3EYZA 5DM6Q 4L76A 3CF5Q 4NXMJ 4RNNA 1RTHA 4ED7A 2IBKA 3W5YA 3T81A 1PJ6A 4AQYH 4USKA 3MUMP 1FESA 4KV8B 5DG8A 4LVSA 4ID8A 7ICPA 2Q2UA 2LECA 2R6FA 1U9LA 4TYBA 4FBTA 2DHGA 3Q8MA 3FJ2A 3RF2A 1A9NB 1GMWA 3CCVS 4OQJA 3SMVA 3IRWP 3DDHA 3MWBA 1JXEA 4NMLA 3RB6A 4I4TF 3HK2A 4X64J 5A8KA 1TFWA 3KOOA 5BYSA 2HFOA 1HD1A 4QW9A 4URGA 3ZTSA 4IZOA 4MK9A 3FMAA 4NLPA 2R18A 4HYKA 1KFSA 3RG6A 1MN8A 4JV0A 2BCRA 2EAPA 2F40A 4EBCA 4A2BA 3QLHB 1ZQUA 4JMUA 3CJ4A 1S5ZA 1RPLA 2ZIWB 3T8LA 5KFCA 1GXTA 2MQMA 4NXNH 4M6WB 1N33H 2Y8YA 3HMJG 4FYVB 1HNXJ 1X4AA 1RTJB 3A0HU 1S03G 3N8DA 2CZ4A 3HP6A 4FXDA 1RWOB 4YUDA 1IKXA 1SV5B 4DUZF 3I32A 2ZD1A 4FBUA 4GIBA 3HD1A 3M9NB 3O1LA 2P50A 1SJRA 3IC1A 1FXRA 3AQOA 3NGDA 1JLGB 3C6UA 2JFDA 4V1Ak 2EKNA 4KV8A 7FD1A 3OR1B 1FKPA 2HNYB 3A12A 3FEQA 2P2CB 1S10A 1LW2B 5ETRA 3QIPB 4JI4F 1KN5A 3C6TA 3QIPA 5A6PA 1KVKA 2ZBIA 2K7JA 1EETA 4WP3A 4FM9A 3QBCA 3VQSA 4IAJA 3FCWA 3VVUA 2P53A 5EE9A 5HO4A 2XICA 3OSPA 3R1LA 3R0DA 1PIEA 5J2JA 2B6GA 1E6YA 2DGQA 3DOLA 3V6DB 2PEBA 3L2PA 1GTEA 2X51A 5D77A 3PV8A 2I5JB 4PZOA 3DU6A 3R27A 2BJ7A 2LEAA 3BKFA 1REVA 3TA2A 2HG4A 3M4IA 4UBCA 3R1HA 2ZBRA 4ZVUB 2I1RA 4ES1A 3CUNA 5LMUF 2N7CA 1FWEC 5ALEA 4CT8A 3IMQJ 2FPKA 1OS5A 2LA6A 4X4OA 3M7DA 2BX6A 4GFJA 2R93A 5JVHQ 1EJRC 3M30B 4M5KA 3W61A 3I0RB 2BE2A 4EK2A 2K4PA 4LH8A 8ICIA 5KTQA 1R31A 3UQSA 4EGLA 2QK4A 3H42A 5DB6A 2YB4A 3HHLB 1N34J 4KHRA 1ONWA 1T11A 2KZZA 2YKNA 3PSTA 3JB9k 4MJKA 3EM1A 2EXUA 4E8UA 3IV6A 3G71S 1Z2ZA 1S9GA 2LXUA 3LP2B 4R8UA 3M8RA 5LMNJ 3RU0A 3H4DA 3IM1A 1LKZA 1Q5YA 4OX8A 1VIXA 3ENWA 3B6BA 3C3LA 4C98A 3W8GA 1FRXA 4IG0A 2ERRA 2UXCH 1B4FA 2RILA 4PPZA 4DSKA 4RQ0A 5ETPA 1NK6A 4UOFA 2FVMA 4UCOA 1YI2S 2BR0A 1N56A 2IPOB 3NS7B 2HHTA 1CSJA 5K5MA 4DV2H 2BB0A 1Y1VA 2AP6A 1JLAA 3N7SC 5J2MA 4U8YA 3FKIG 1C1CB 3VMMA 3ETMA 4KITB 2C2OB 5KFFA 3I0SB 4HACB 2R7NA 3G87A 5HMLA 3HOYG 4C4WA 2H3QA 2P6UA 3RJ0A 2QSWA 1N5TA 5IIJA 4D3GA 3AFGA 4U96A 4IDKB 3BR8A 2CAJA 1WCMG 1XRTA 1YGYA 5CYQB 2GLTA 2KRBA 1XDNA 3DDIA 2UXBJ 4CQBA 4Y65A 2WRMA 1UJ6A 2AYGA 3G82A 4Y28C 2ISOA 1H98A 1UZHA 2W2OP 5KNIA 1YTYA 2ES6A 4WYWA 4YP3A 4X62H 2B51A 1CJUA 1U6FA 2ZFHA 3MM6B 3K1RB 4I55F 2VFSA 5AKQA 2EBGA 3LWBA 2R8GA 4CNUA 4YOEA 2DKZA 4UAVA 3E01A 4ZP6A 1KQQA 1FWLA 2IRYA 4ZVHA 9RUBA 1Q4RA 4DV1H 2MJUA 4OZ0A 1NK5A 1VQKS 3LYSA 3K89A 2E8NA 3I82A 9ICRA 2CW8A 5J0TA 3T1YH 3FMWA 4NLGA 2VG6B 4HDGA 3UXPA 3ZTPA 4FE3A 3NGUA 1NJIT 3US5A 2OOFA 2BCUA 3CDEA 5KFYA 2A6MA 1BXRA 3FVYA 3I31A 3TZWA 4F4YA 9ICOA 1EJ7L 1UETA 4BBYA 3CJSA 1J5OB 3FQLA 5HATA 2EANA 4G1QA 3HF5A 1TWAA 1T0TV 3KJQB 3PY8A 3R5DA 1MU2B 3SCKE 1HNVB 2CRLA 2B8QA 1OIAA 1X7VA 5K8OA 2ZTDA 1T3NA 1XMQH 4G7EA 3R9LA 3ONNA 4OZ5A 3HJFA 2M88A 4NCGB 1WELA 4Z37A 5ALQA 4L1KA 4WE1B 2I1QA 2KV2A 4F0SA 1GEHA 4GKKF 2YWEA 1UA1A 4R0JA 2LA4A 4DYKA 4AYBA 1J5OA 1W7WA 3CVZA 2UXDH 1RT4A 2CJBA 4BJHA 1I94H 2M0NA 3FNNA 1ZQNA 4DI6A 3FZ2A 2PN1A 2GAGC 3C8YA 2LKYA 4ELTA 3QIDA 3VC8A 1N88A 3R6GB 4EMDA 1X4DA 1JKJB 2WB1F 4O3SA 3DDKA 1QH9A 1NNDA 1NPKA 3HZGA 1WUDA 5FJ4A 4YN3B 2YS7A 3NAIA 1NBEB 4JB3A 4JI2H 4IKAA 4JK1A 4DFKA 1U47A 4IOAQ 3E51A 2YKOA 2AH5A 3EUNA 4QYZK 3R23A 1JRPA 1T03A 2CZVC 4ECUA 5T7LA 7ICTA 3TQTA 2D9OA 2XY6A 2FB9A 4IRCA 3DLGB 5FDLA 5L8RC 1D9AA 2OPRA 3DCAA 2I9GA 3RFCA 1FX4A 1RJJA 5A6TC 3CE8A 2Z7JA 4FNIA 3Q8YA 2ZHAA 1OUQA 5HP4A 1FJ7A 4LF8H 2R7ZG 1VBGA 4QIEA 4USAA 6FD1A 3TARA 1RXOB 1I5OB 1S12A 3N4MB 4JI8H 2E1MC 4U8VA 2W8KA 1WF1A 2VUMG 2F44A 4DL4A 4NM1A 1X4HA 2KT3A 3M8WA 1KN6A 4GC7A 4P72A 3VGUA 3SXLA 1YLXA 4KKOB 2ASDA 2IP4A 2GA7A 1EUDB 2FHMA 3DRRA 1JLCA 3T5JA 4MV1A 3V4ZA 3HOXG 2WB4A 4P71A 1UVNA 2KG1A 1JXLA 1IBKH 4BLGA 5J2QB 2JEJA 3ZD9A 5IC4B 1XK8A 2F3JA 3U26A 2RRAA 1N36H 2IRXA 2ZH7A 2H5JB 4ZVFA 4B3TF 3GB0A 2EFNA 5J0UA 1IBLH 4NLTA 1ITPA 1TKTA 2ZXIA 1IKWB 5J0RA 3WIVA 3GTQA 1VRUB 1O08A 4EI2A 4L73A 2J9DA 1KOOA 4M8LA 4DFJA 4UCUA 1SQFA 4GVBB 3DGPA 4QCLA 3BH7B 1EZZB 1TAEA 2FK3A 4K8RA 2XM3A 4ECYA 1EARA 1S9GB 3LP2A 3MGVA 3C14A 3ZDCA 2GQ2A 3HHKA 4NLVA 3C66A 3Q2OA 2F1FA 4F3MA 2J6TA 3SE7A 2LYVA 4QZHA 2Y9HA 3R7SB 5AKJA 2E1PA 3ZZRA 5ALTA 4PWDA 3GTJA 1A5KC 1A6SA 1OO0B 1U49A 5G5GA 1ZQPA 4PABA 3HXLA 1PC4A 3EPGA 1DIKA 1ZQHA 4O4HF 4XDCA 3H5UA 3N01A 2DB1A 4QZ9A 3M8QA 3LSCA 3QFFA 5FIIA 3C14B 3E0FA 2RS8A 1SC1B 3FEYB 2IFXA 4C0OC 3BKUA 7ICQA 4O3PA 3LO3A 4QR2A 3B4DA 4J9SA 2ROGA 2YWGA 3AB2B 1FRIA 4B3MF 3B0YA 2MKCA 2W57A 5FLXW 3MABA 4OYXA 4J0MA 3CSKA 4ES2A 1RADB 5ETSA 4O0IA 1PK3A 1CE8A 1QY7A 1DJ0A 2FPGB 4A3LG 3C2LA 7ICHA 3HHDA 2CN1A 1SL2A 3RTVA 2K4HA 1E4GT 4ZS6A 1ZA1B 5I3UB 2GOKA 5C1OA 1P8GA 2ZUCA 2DWQA 2GIFA 1PYSB 3DYAB 4USIA 2FUG9 1BNOA 4LF4H 2YQ3A 2YBVA 3QU5A 3PJXA 5BR8H 2G06A 4KLUA 1RWVB 1OYDA 4NZ6A 2GLEA 1K1DA 2GOLA 5HQMA 2HZVA 2C2RA 3C29A 2ZKUA 3EVMA 3K3PA 5RUBA 1WC4A 3EWAA 3CJ8A 5KG7A 4NE9C 3VPDA 1R8CA 3H4BA 2BA9A 4LF9H 2KT2A 4EO6A 3DNCA 4NCAA 5KG6A 2CA9A 2ZIXA 5KT2A 1N5QA 2FHKA 4YMEA 1ZQQA 3UFCX 2VA8A 1F6TA 3P96A 1CUKA 4ICLB 3KK3A 2FLLA 5HNKA 1HQUB 2FC8A 2ATCB 4WFZA 2ZH1A 4YDDB 2KL8A 1HQUA 2VPZB 4UQTA 1X4FA 2IVYA 5J0SA 1KLMB 3X3UA 3K75D 2JC0A 4I2BA 2Z56B 2HK2A 1N63A 4RW9B 4ZVEA 5L9XA 1RQ0A 1ZQVA 5KFHA 2HOIA 1G6BA 4ED1A 3A4TA 2YX8A 2SCUB 2XS5A 5JUMA 2ZIXB 4M0AA 3WK4A 1MN9A 1BQMB 3OQ2A 2HHHJ 5ALIA 1M5HA 3KAKA 4RR5A 1RI7A 2LFVA 2L41A 3H59A 1GT8A 4J9RA 2CQIA 1FRJA 3TJ9A 2YWFA 3U9TA 2KHQA 3D0HE 1EP4A 4KT0C 5A2QU 3DUGA 5HAOA 1KW4A 1HPZB 1GKPA 3ET6A 3ZNUA 3L95X 4Y2PA 1HQ2A 4JI5J 1RACB 1FA0A 2CPZA 1D09B 3UR0A 1YDLA 1EJXC 1D8BA 2K8BB 4LR7A 4WK1A 3TVZA 2UUCH 5ALMA 1T95A 4C9DA 4PUOB 3I76A 2ASJA 3VF0B 2WB1E 3KALA 2R7XA 4DCJB 5AXKA 3GIPA 4UCSA 1SJQA 3C0FB 1V5IB 1SJ4P 1SZHA 2LXFA 1RK6A 3IG1A 5AE1A 1COKA 3BV8A 1O03A 3IWXA 4F3OA 4P7VA 4PQAA 5THWA 1TL1A 1KQGB 3JTPA 4J9LA 2ICSA 1Y1WA 5HMYA 1KBUA 1WG8A 3HJEA 1RAHB 3QU7A 3QX7A 3A3NB 4A8YA 5HMZA 4ALZA 1IM6A 4P0QA 3I9V9 2HFVA 4I64A 2H4YB 2IHNA 3MCSA 1X4BA 1V97A 2IM0A 3VAHA 1OSDA 4I2QB 2KJ8A 2QMXA 3P45B 9ICPA 3SCIE 1SEIA 2ZH2A 4K4SA 4IHJF 1L3VA 5EHHA 3UQ0A 4FXWA 2R7ZA 1C0TB 1TZ0A 1VQPS 3OV7A 2HVEA 2VKQA 1YIJS 3BQ1A 4XUSA 4WBNF 1G2EA 4D3HA 2UU9F 2W04A 4DU8A 3W5ZA 4ZDNA 2PMZF 3GU3A 2GWSA 3JSBA 2V8DA 3PEHA 3JTNA 1X6JA 4URQU 5KX5F 1RWKB 3ZNJ1 1VRQC 3DM2B 1EB0A 5AKKA 1V5VA 5J2MB 4MTEA 4JI1F 1FJCA 3V5RA 3DKDA 2YX4A 3NCQA 1JN3A 2KZ3A 3WKDA 3OXGA 4PZNA 2HYIB 2WF9A 4GMKA 5IV3A 4F4WA 4ECRA 5LXTF 5HMXA 4CE6A 3MPYA 2IDLA 2VZ9A 4YR2A 4X64H 4A8KA 3UO0A 5I42B 5GMDA 4LVNP 4C3KA 4EPBC 1R8BA 5FLXU 4P7TA 5D0EA 2CPIA 4JP8A 2YRWA 2O1PA 1X42A 1TK8A 2J6UA 2JA5G 2X1FA 1J5EF 2V2QA 1NSAA 4MV3A 2HW3A 4E4TA 2I80A 2ZEJA 1D9DA 3SZ2A 1Q95G 2PIIA 4KGZB 2WAQC 4LRFA 3SMZA 2WF8A 1RAGB 2E44A 2OLSA 3W65A 5EE3A 1U1KA 2BKOA 4JWMA 1U1MA 2K8CB 1A6LA 2OELA 3M2RA 2BE2B 4NOHA 3F2CA 1RZTA 1DQAA 1ZM9A 3L09A 3KYLA 5FD6A 3ETLA 3SFUA 2HHSA 1SKUB 4NLBA 2VQFH 4EEQA 2DF4B 4W90B 2WDTA 5ALWA 5LL6b 3BE7A 1B3TA 3QEAZ 1XMOF 2KSWA 1H3DA 4KGMA 2LQ9A 3U27A 4ECXA 1LWCA 3HVTA 4ZJQA 4LF5F 1MG7A 1V51A 2MQLA 5DB7A 2PUZA 4X65J 1ZQBA 2O66A 4F4ZA 3HX9A 2VPSA 4ZN3A 3VVTA 4KIRA 2BPCA 3DOMB 2N4DA 1RQNA 4AP9A 2JZBB 1ZD3A 2QKQA 1JALA 2E9ZA 3WKCA 1HUZA 4ILMA 2MHNA 4KBIA 1YSJA 3W62A 4NV0A 1S79A 1TV6B 2Q6BA 2RGRA 2GHVC 4UCRA 2DITA 4LFCH 5IYZF 3QU4A 3HWTA 4Y3CA 3QSYB 1VLOA 1CS4A 2IC3B 2D41A 4N56A 3CULA 1CQNA 4RPFA 5H2FU 1XR6A 3GFKB 1HNVA 2AQOA 2VDHA 2VKZG 2FJ6A 4DPXA 5LJ3Y 5AKLA 5GMKa 4KLHA 4O3RA 1MROA 3M8QB 2W55A 3Q8KA 5FD1A 1I51B 5KFPA 5EUHA 1GFWB 1VK8A 2HBKA 5F3TA 2W6PA 4PXEA 3K5LA 2JXJA 1SJFA 8ICNA 2OFGX 4Y6IA 4P6QA 4AXIA 2KVSA 2BYCA 2VPWB 3OHAA 4RB0A 2B6AA 3UI3A 1J6PA 4C11B 2FJZA 3DU5A 1JLEA 3F2DA 1JKHA 5ALRA 2YKPA 1YJVA 1JNZB 2C1EB 1VGYA 5A6WA 3M32A 5HL7Q 3PW2A 4ZHRA 3F56A 5E5NA 2M9KA 1TA8A 3PVXA 2R3VA 1LWFA 2DK2A 1F44A 2ZJTA 3HOWG 5A8RB 2JLFA 3FFIA 3GPAA 2VR1A 2C3UA 1EQ0A 2W71A 1REVB 2MJNA 3U1LA 2HMIA 1MC8A 3W8PA 2PT0A 4WD3A 5ALGA 3VHQA 1BJTA 1L7MA 3EVWA 5HHIA 1KJ8A 4HHJA 2OD4A 3R5FA 3RJHA 1ZQOA 5CB4F 2DKXA 3RRGA 3O6QA 4MK7A 1H74A 4FF3A 3KDNA 4KLGA 1FE0A 1GK8A 1CQJB 5CXTA 4I7FB 3TAPA 3PR5B 2CZ9A 2RHSB 2K89A 1QE1A 4G7EB 3N7RC 3CB4A 3LS9A 2EDUA 4WFAQ 2MUTB 5B7WA 3H2LA 3RZAA 2DCLA 2DNGA 3T1HF 1VQ7S 1BPBA 4PGQA 3LVWA 2MLZA 4Y2AA 1FNOA 2OPRB 1OSCA 1H73A 1Z1ZA 1GKQA 4ED0A 1CJTB 4FF2A 4ED8A 2R4FA 1SQEA 1R9ZA 4Z6CA 4OI0A 1GMWD 4DV5J 1A0PA 3CEDA 4KLFA 2YNIA 3TVKA 3QNWB 1A5LC 4QIVA 2A2DA 4OI1A 3QUCA 2YH0A 3JPOA 2BW2A 4ICLA 3T1YJ 2BABA 1RHJB 4HDHA 3PN1A 3FC4A 1HBUB 5ALSA 1LFWA 3ULHA 5J2KA 2HHHF 4CYUA 1U8WA 2HSZA 5GAGU 4DFPA 4DV6H 2G4BA 3V2UC 8ICKA 2V4QA 2FPPB 2Q09A 1EJUC 1TL7A 4DV3J 4ZMMA 1QSLA 3T9ZA 5CD4H 4US9A 2E1RA 2ZWOA 1KC8T 3EWGA 3W2WA 3KLVA 3Q22A 1HJPA 3N4WA 1RAJA 2FJWA 4LZDA 3WK5A 4OV1A 4NLDA 5B08A 4O4GA 2G5IB 2C3OA 5CA7A 1RA6A 1Y3KA 4F72A 2ZVIA 4K2JA 2Q2TA 2V59A 2GFFA 3HVAA 4YIWA 1KJQA 3GV5B 1TKTB 3MR7A 2ASYA 2U2FA 4OFZA 4JUZA 1KC7A 4DR3J 1WOOA 2H5EA 2FJXA 2NU6B 2MKKA 2JC1A 2LXIA 4DOZA 1YJUA 4JI6H 2LCWA 2DR9A 5D0RA 1RHQB 1JLCB 1VLYA 2WHEA 3Q8SB 3KK2B 1PJ5A 4O2AF 3H5XA 2DR7A 1RTDB 1VQ4S 3C21A 1LWEA 4KSEB 4UUWA 2IJFA 4IG3A 2PLMA 4XTTA 1RTJA 2AEFA 5E79U 2Q0ZX 2C22A 4EX7A 1CI4A 3DMJB 1K1QA 1T3QA 2D9PA 1WEXA 3QLHA 9ICTA 3IV8A 2G3FA 4DV4F 2FD2A 1FKOB 2K1RB 2CQBA 4UASA 2B8PA 4YHHF 1HWJA 3NOGA 2CDQA 1PJ7A 2KXFA 4I6WA 4YR0A 2RJZA 2RUSA 2WE6A 1RBOB 4YHHJ 5D0HA 4LF1A 4QJFB 2RF2A 2KDOA 1BD6A 4Q0BB 2OEMA 2W2QP 2W6OA 1PYOB 4B3SH 3DHWC 8RUCA 3LH2S 2ZIUB 1HARA 1YRTA 4U67Q 3Q23A 4Y2JA 3JSMB 3FSIA 4JBCA 5L38A 4HR2A 2BBEA 4A8WA 1OYEA 3OTCA 1DTQB 3VZHA 2ZIVA 3DRPB 5BJRA 4YB1P 2JSXA 4F7VA 1YBQB 3UWTA 5B66U 1V6HA 4QU6A 2MQ8A 2HK3A 1ZQ1C 2F7VA 2R2RA 5EWEA 1F9EB 1WCLA 3KK1A 1H72C 3K3VA 1QJHA 3J80Y 2XO6A 5KFJA 5KG1A 7ICGA 2R86A 4PXBA 1A5MC 3GG1A 2Z0GA 1NM2A 3JSMA 2ZH8A 3POTA 2FY1A 3IWLA 3QRRA 2YKAA 1CULA 3I5AA 4B9LA 3PYDA 1XSNA 4YCXA 2XZTB 3GJTB 1IKVA 3BSAA 3EVOA 3UN3A 4YAKB 1RTHB 5ALHA 4LRCA 1S57A 1YK9A 2DGOA 3V7LA 4CLPA 1VQ8S 3OTDA 3Q8UA 2JEFA 1C30A 3H0MB 3BQ7A 5J2IA 2VG6A 3FRZA 2WAQA 2WAQF 2O5DA 2QIFA 2COLA 2OGUA 2YNGA 2JA7G 4I4BA 4P75A 4TLQA 2QC3A 1M5OC 5KFNA 3VAGA 4F0LA 2YNHB 2KTQA 5TZVA 7ICVA 3G8SA 3AN1A 5G5HA 3B54A 1HI1A 4A8OA 4PGYA 1KONA 4IOCQ 2ZJ8A 2FPLA 3NAHA 1Q0NA 4LFBJ 5BYRA 3I28A 1RKJA 2F76X 1O0PA 1FWHC 1RHKB 5F8GA 2AGQA 4EO8A 3MM5B 1VBXA 3I5BA 2B9XA 3MM8B 4C5BA 3CNHA 4M7EA 5D1OA 3N41B 1KJJA 1ZJNA 3SYZA 4KLJA 4BBRG 3D1QA 4O23A 2J7WA 4RJVA 4K2XA 3S6JA 1RHRB 4O5CA 1QLNA 4U95A 4LF4J 5IIKA 4YAJB 4E98A 5AKYA 3DGVA 2VBYA 4CLYA 1N5YA 3UCGA 1XJWB 3CTRA 2NXJA 5IXUA 1WNEA 2YZMA 1Y5NB 2QT7A 5G0RA 2QB0B 1C4AA 1B0XA 4B9UA 1ZOTA 3ISZA 3SD7A 3PZPA 1KEJA 1C0UB 2FJEB 3BBBA 3KG1A 3SQOP 1ZH5A 2W3RA 1ZTWA 2CQ3A 2Z8QA 4NLKA 3RTXA 4XIUA 2YKMB 1BGWA 1Y88A 3E0LA 3KJVA 1U2CA 5D6GA 2IYGA 2ZIVB 3PHTA 5GVQA 3VAKA 1GSOA 4I29A 1HR0J 1YJ9S 4P4MA 1VS3A 4HNVA 1JMTA 1UWBA 2MZQA 2DR6A 3GV7B 4PG8A 1T9VA 1OQ6A 4ZN1A 1KVIA 2RRBA 3H5YA 1RB0A 4LJXA 2W7OA 4G1PA 1SGGA 1HI8A 4QNLA 4NMXA 3NS6A 2DLNA 1FWFC 4U6PA 4F5OA 1WHWA 3BSCA 5KFOA 4OYWA 3SI8A 2F9JA 4O3MA 3LP0A 1JLQB 5AI9A 4H9MA 3DV9A 2GPWA 4DJBA 5AKXA 3O0FA 4P4OA 4AQYJ 1UTAA 2DHHA 3PIPQ 1OW5A 4DN9A 1IKYB 1UW4A 4IFYA 5L1IA 3M4XA 1X5SA 1QUPA 1W93A 1Y9OA 2MTLA 1NOMA 2DGZA 4ZCMA 4I7FA 3VPBA 3DOKA 2GGPA 3WKEA 3A8KA 4PRFA 1GMVA 1FJGJ 2CJ9A 2JRSA 3MDFA 3L4JA 3UMBA 3ZXWA 3M1YA 1VAJA 2AMCB 2QA2A 5B0DA 3BGFA 1WJ9A 2XS7A 1VR6A 3HD2A 4HACA 1CBKA 2B7BB 3CJ0A 3W2VA 2BGWA 4M95A 4KFBA 5CYJA 3HO1A 1FWKA 4P10A 3BDEA 2YRXA 2HAFA 3DC2A 4NLZA 3N40P 3FBBA 2KHDA 3LW5C 3FBEA 1JJ4A 2BM1A 3EMTA 2E9TA 1IR1A 1ZZNA 2HRYA 4DS4A 5CJ7A 3MCNA 2BCVA 3NGTA 1FK9B 2XTJP 2ZUAA 3V72A 1RU2A 1KRPA 4NXMH 4M5IA 1K83A 1C20A 2F1IA 5J0PA 2OD6A 3FSYA 1TR0A 1ECWA 1DBDA 1NH7A 1ZM3A 4RWXA 4CYUB 3CD6S 3I6PA 3KLFB 1SV4A 1HBUA 3NQBA 2OPSA 4TUQA 3T5KA 1O51A 1JLEB 3T41A 3WK8A 4RZBA 5IFMA 4RNMA 2W2NP 1BPYA 1VCTA 2KJWA 3K0JA 3MPVA 3EX7B 1RJRA 2BMBA 4ZIWA 1FDDA 3QUTA 2DNRA 4HNUA 2QA4S 3KMQA 2AJ2A 3ZTOA 2W9AA 4JI3J 4IL6U 2EK6A 4I6AA 4CO2A 2W8LA 3MR2A 2QL9B 1RYSA 3FGVA 2DNZA 1F9HA 7ICOA 5IWAH 1Q3VA 3W66A 5AI6A 1HNWH 3QMQA 3SSQA 4DXLA 3OUUA 2CZGA 3LAMA 2VG5A 2C2NA 1NO8A 2UVVA 3ONQA 2KFYA 2EZXA 3PW0A 1N33J 1X9WA 3G8CA 2JHEA 4MKVA 4FYYB 4UAUA 1FNMA 2OHFA 4YY3H 2ZG6A 2G2OA 2FIUA 2A2CA 3Q8PB 1XNQJ 4J03A 1VJWA 3CIMA 2AW0A 2HQCA 5KT4A 1QCKA 3MM9B 1RAOA 1XNQF 1OWTA 2JNJA 1N34F 1YBAA 1POJA 3AYHB 2QYZA 4RKUC 5KFIA 1DLOA 9ICNA 4X4RA 3TX0A 4UB8U 1JLBA 4OHZA 1LNQA 4DCCA 2D3OR 3HDSA 4WPAA 4KLQA 3JPPA 1NDCA 5LMNF 1IV8A 2ZJPQ 4KPCA 5J2EA 3R9KA 2A3VA 5E33A 4B9NA 3MM7B 4DR6H 3SAFA 3VAMA 3PYGA 2IBOA 1B64A 2Z2ZA 1JLGA 4PQUB 2QS8A 1CJKA 1S0VA 2RIJA 1F3VA 1UCNA 3TEGA 4LFAF 5AE2A 1SH3A 5IIIA 2LQBA 3GFYA 4C7ZA 1BC6A 2MDAA 1P27B 1ACMB 3Q8LA 4LSNA 4QZEA 4TVAB 4WJ3B 3HILA 4NEZA 4JI0J 3CD0A 1SL1A 2W1BA 2ROPA 2ZHOA 1GO3E 2VOBA 2E1AA 4KE5A 1FD8A 1IQTA 1GNKA 1HBOB 4JI0F 4Y2IA 1N32H 1KNZA 3PJ9A 3OTEA 4X84A 2BE9B 2YB1A 2PMZC 3IHQB 1RYUA 3K5MA 2QRRA 1XRFA 1KKXA 3I4HX 5DZ6A 5HR7A 5EOYA 1E6VA 2CNLB 2WBRA 2UUBJ 3KD3A 4JV5J 2KHVA 3DLJA 3AJDA 1TKZB 2KJVA 1Y1WG 4CLWA 9ICLA 5HK4A 4QWDA 1TMJA 3VAFA 2WF6A 3KLFA 2E5LH 4C8KA 3BJYA 1VKZA 4A8FA 5AI5A 3MDCA 3OXLA 2CNNB 1NPRA 2HFZA 3PX6A 4RBVA 1L3TA 4OZLA 4KN4A 1XN9A 5AJ3J 3QO9A 3CWJA 4RWWA 2KVIA 2UXBH 3NVVA 2YMLA 4DL3A 5D4PA 2LMIA 3PFOA 1NLKL 2WHOA 3DLKB 3IR5B 3P49B 3MBYA 2Q43A 1X8DA 3I9ZA 2YCHA 2AYBA 8ICTA 5DRKA 1ZQCA 2DIVA 1VYAA 1C0TA 4U7CA 2LEPA 1F1BB 1NZ8A 2DHSA 2E8PA 4YDXA 2GO8A 8ICWA 3D1HA 3WKBA 2JA6A 1NSKL 3SDEB 1FDNA 4Q44A 2W6MA 3LPYA 2XSJB 4K50A 2JLGA 4X4UA 2IAJA 3O44A 5A0LA 4WP9A 1OPZA 5J0QA 2MEWA 4M9NA 1RGVA 1YZ7A 4C8OA 3AHPA 1RJQA 5KFTA 1DTTA 3NWGA 3TZYA 5HROA 1FWAC 3PTWA 3GP9A 4KHPJ 5D46A 4NA2A 4O0NA 1PUZA 4L75A 1YVFA 4LIWA 1SCJB 5GAEI 2VFTA 5KT7A 5CAEB 4ZIVA 4YS2A 4YFKA 1R0BG 2MZRA 3BO2A 2CG8A 2JA6G 3NCPA 4M04A 1AZSB 1H2UX 5J2AA 3DRXA 3D2QA 3TAQA 3HB9A 3UN2A 1PG5B 3V6KA 3BABA 4CO4A 4PUOA 1TU0B 3VGVA 2JV3A 2PA8D 1SI9A 5C2GA 2FGOA 2XNQA 3TX8A 4LH7A 3RH6A 4ED4A 1PX2A 3JXOA 4YMMA 3LP8A 9ICBA 3D6NA 5B0EA 3CVKA 3U9SA 2AIRB 5C4XG 2UUAH 2BQRA 1R0CB 4OCZA 1DGJA 2G0IA 1X6IA 2E66A 5F9NA 2FMSA 2BVZA 1O6XA 2L08A 3G6YA 4BY7G 2WW4A 3OBIA 1FX2A 5C8YF 3OL6A 1ZQWA 3WK9A 1N5WA 1MQ3A 2B4VA 5FP0A 4CI0B 1RU1A 5IT9Y 2MU2A 3L5KA 1WC0A 5JXSA 2FVQA 1NEEA 8ICEA 3H0GA 1UFWA 2MGZA 9ICUA 2XLJA 1BWEA 2FE3A 2RHQB 1P9QC 4M5HA 3BN4A 5KFWA 2EVZA 4M5JA 3TR5A 3BPSP 4MK8A 4X66F 5ADZA 4KB7A 4JWNA 2MPUA 3FQKA 2CIMA 4DR4F 2VICA 2HPUA 3HKWA 1A0IA 1RLCL 2QLXA 4IH7A 2WK4A 3I5CA 3UVJA 3J7AK 1I94J 1KLNA 1RHUB 4R64A 1VBKA 4CNYA 2VQDA 1SUQA 1CJVB 3DF7A 5K14A 3JSNA 4C3MA 1RHMB 4UBBA 2M4MA 1HNZF 3RYLA 2MA1A 5KL1B 3GLJA 2YNHA 3S6EA 3UFXB 3F5EA 2ZDHA 5C25B 4JI1J 3PDNA 4FO6A 7ICRA 4M1KA 4JI2J 1UL3A 2NUHA 1K0TA 3GIMA 1Y4ZB 1RABB 2IM3A 1F0MA 3IAS9 4A8XA 1HD0A 1NSPA 3MGIA 4MH8A 1IBMJ 4DR3H 3J7A1 2CADA 2DEIA 1KQSR 2DD8S 2J7UA 3RUBL 1KRBC 4DDFA 5IP7G 2V68A 4DV7H 1X40A 2B43A 3WKAA 2BM0A 5F8LA 1N5XA 5ALPA 3WZ0A 1E4EB 3BGLA 2HWTA 4R25A 1EP4B 3RJGA 1VQNS 2BKPA 3ETHA 2AV5A 2ISPA 3RJKA 3ENAA 1I3OB 2HQGA 5M2UA 4C0ZA 2M7SA 2AGPA 5LXRA 2ZD1B 3G8TA 5F8NA 4B3RH 4OO1J 1LXJA 2RHFA 2J9CA 4CO1A 4CNSA 3ITHA 1PBUA 2W54A 2H54B 3ZDEA 4ELUA 2VODA 4GXJA 3ISCA 2FJVA 1FKAH 2BJDA 3S7RA 1ZQAA 4N8NA 4DMZA 5E0OA 2OKQA 5M2PA 3UQ8A 1XNRF 1ZAXA 4M5MA 2FVCA 5EX3A 5HV6A 4GC6A 1SCUB 2DFLA 4JI3F 3MDAA 3MF5A 3BSNA 2EI5A 2R93G 2XYPB 1EJSC 3GZFA 1WC5A 3F53A 4A8EA 3KLHA 2DO4A 2E1CA 8ICMA 4WZMA 3R8YA 4Q7AA 3M30A 3JPTA 2ZJAA 3TFRA 2QB1A 3R5AA 7ICUA 1M5VC 2PE8A 2G07A 2LDIA 4DCPB 3HPAA 3HHLA 4P74A 3HHNB 4UB3A 2VH7A 3HOVG 2CG4A 3NBPB 4F3QA 4O4IF 4C2MA 4PHPA 1U45A 2OPQB 4FXVA 2MZSA 3UN5A 3ZDDA 3A1YG 2ZZMA 1E4EA 1B0PA 3QGPA 2H51B 3W2VB 4I50F 4B08A 4OI2A 4QZVB 5C24B 2QLWA 2YZGA 1DURA 4DCOB 3AU6A 2DXFA 5AM4A 4ZPBA 2DBBA 1QE1B 5CWRA 2A18A 3WC2A 1S1VA 1YJNS 2XQCA 4LF9J 3B82A 1B7FA 4NLSA 1FWIC 1IR0A 4QIWD 4EX6A 1SB3C 4DR1F 4O44A 1U24A 3MAQA 5HLFB 2FLPA 1C1CA 4O3QA 5CHGA 4LFAJ 2DKOB 3MTWA 4KLDA 3Q8RB 4M2YA 4L3NA 1Z19A 4ATNA 3CDWA 4LF7H 1W2IA 2GMLA 2YWWA 4IUFA 3W3SA 3CP8A 3CJ3A 2R82A 2HBRB 2IOFA 5A2QW 2MSSA 1S9EA 1SYXB 8ICSA 2RQMA 3L9ZA 2FMPA 4KPYA 2V5HG 4ZHRB 3DM2A 4LFBH 2W11A 1P6TA 2B0GA 2YL2A 4BKNA 4Y2KA 2FDNA 4UUXA 2GS8A 4Y2SA 1TKZA 3W1YC 3VCBA 4MFFA 4UFZA 1U1OA 1IM4A 4XZ3B 2PEHA 2NXUA 3UD5A 3ETRA 5EX0A 2GW8A 3CDAA 4PG4A 2KD1A 1DRZA 5KFMA 1RXWA 5M2RA 5CRXA 3A3OB 3VCDA 4WU3A 2AZ1A 2BDUA 2KHCA 3ZD8A 1H6KX 4GVLA 2JA7A 5AKZA 1Q8IA 2W01A 3D4JA 1UEUA 2D3UA 5EE1A 2Z2MA 3NVWA 3CW2C 2R7VA 1HUOA 5CR0A 1UZDA 3H0PA 5CYMA 4ZQIA 2EAOA 1NSQA 3GWCA 2DGTA 1RE1B 5J8YA 1W25A 2OFHX 2EFVA 5IZHA 5DQIA 1YJ7A 4LT6A 2FMQA 1JJHA 2WVDA 5CZVA 5D8HB 5D8DA 5K20B 3KK2A 4ECTA 3IA0A 7ICFA 2HAIA 4TY8A 3AH6A 1T94A 3AA8A 4HR7A 2KYZA 3LOUA 2MZJA 3IGVA 2E7VA 4G3IA 2GVZA 4HEA9 5E3PA 4ZI7F 4KLLA 1G3OA 3HFVA 1JLFA 2DPIA 1UQVA 3R5BA 3JYTB 2HCFA 1KTVA 3TRGA 1IKWA 1UWAA 2IMOA 1FXDA 4ID5B 4MAMA 5FJ8G 3M6KA 4HHHA 4RT2A 1KCXA 1S1UB 1HR0H 2P9CA 3CPWR 3IXQA 5FLXY 1RT6B 3I4PA 3RBXA 1ZBTA 2P66A 1AZSA 4TQRA 4LBHA 1RCOB 5ETLA 2MMYA 3R2CJ 2DRDA 3IGNA 4LSAA 1FKPB 4I2HA 5BOLA 5CB1A 5E2QA 4TN2A 1JLQA 1VLBA 2OO4A 1YQHA 4GO5X 4J90A 4OX9J 3MTKA 8ICFA 3ZZPA 2F9DA 3HFKA 2G13A 4USTA 1T05B 2UUCJ 5IYCG 2KMDA 2UP1A 3GFXA 2OH2A 9ICMA 4RB3C 5D4LA 1WG5A 4C8LA 1A76A 2AEMA 4B9SA 1SV5A 3VQTA 2DWCA 3MXHP 3MEGB 1QAXA 3ICJA 1N0VC 2DNNA 3T5HA 3CCSS 2HQ3A 2K06A 4RQNA 1SBRA 3RBEA 3GCXP 1A5NC 3DRYA 2KFZA 1Y11A 9ICFA 2PN6A 1TWCA 1KBRA 5JU5A 1S1WA 3KLGB 4RW6B 5J29A 3FYHA 3IG1B 2BJ3A 4CM0A 4NXNJ 2JZ5A 2IOHA 1TAMA 1B22A 1DFDA 1Z00B 4Y2QA 3NLCA 5AT1B 4RZRA 3IS9A 1RT5A 1H2VZ 4WIIA 4ZP7A 5KT6A 5F3ZA 4USJC 5K8NA 4MFBA 2B63A 3MECA 1FRHA 1IUJA 1JLFB 5DLGA 3SSSA 2V50A 4HTJA 2D1CA 3EE3A 1U2FA 5A76A 1V38A 2H48B 2H9ZA 2V4JA 2BZFA 5AIBA 1VIOA 2KXNB 4CC5A 3CCES 2F8KA 4MV8A 2HHVA 1ZPVA 3L3CA 4QYRA 3UW1A 3Q0AA 3G6XA 5J2QA 3ZDAA 1S97A 3K58A 4J9OA 4NA3A 1NK0A 1U1RA 4RPZA 5KFXA 8ICAA 1M6VA 1TWHA 3ALRA 4MAKA 3M6ZA 4G1QB 4EP8C 1GXUA 1ZQTA 4NCBA 3MHYA 5FSEC 4JI4H 4DL6A 5I3UA 1S72S 2YYAA 4BUGA 4NWIA 2BXJA 2P6RA 3MM8A 1N5VA 1URRA 4C4SA 3PX4A 2VOPA 4DR4J 2VBXA 2XY7A 4IR1A 2PXIA 5J2UF 1HKAA 1IG6A 4LQ3A 2W9CB 3IM8A 5HROB 2ACMA 1RT3A 3D5MA 3MPWA 1S1WB 2H5IB 3OGUA 2FJBB 1HNWJ 5EWFA 4ECZA 4O4RA 4Y2MA 5IV4A 1NMEB 2GVDA 3D7SB 2F4VH 2J7KA 3NL0A 3LF0A 4UY8T 4PG7A 1V3RA 2MHEA 5T14A 1HNXF 1JK9B 3R5CA 2BRLA 3A0BU 4KC5A 2HBZB 3LAKA 4U7UD 2IHR1 1P1TA 3BGUA 8ATCB 4LFCJ 4NYZA 3PYFA 5L1KA 3WDOA 2J0SD 4M5GA 1JJCB 3C5FA 4Q2LA 2QSFA 4WTOB 1XR7A 5HP1B 3I0SA 2MZ1A 2VQFJ 3MUVP 1NKCA 2DH7A 2DR5A 1EETB 1FVIA 3JSYA 3GONA 2G0CA 1POKA 2XGPA 1VBYA 1KJ9A 2B63G 5U47A 1YJWS 4JI7H 4RQ1A 7ICMA 3N97B 3P6YC 4I1TA 2UXCJ 3LNPA 3QJPA 3JQKA 5K9FA 3G6ES 2V4JB 2Y8WA 4X65H 4LSXA 4BS2A 5CA0F 4F04B 3NS1A 2RQCA 4NYOA 1QQ6A 1PVQA 4OJHA 4OZ2A 3T6BA 4ZLPA 4P2XA 4NL9C 2GMJA 2WZ1A 5J2PA 4ZJLA 4ENOA 1B70B 3PXGa 4EFAC 1Z00A 2HGMA 5ALZA 3DRPA 5J2NB 3N5BA 2HBJA 1CRXA 5J0WA 4CM2A 2R7MA 4FVMA 1HNIB 2YX7A 3EZ5A 1V3ZA 1WHXA 2PBZA 3H8SA 3LSBA 2KU7A 1T7PA 4YB5A 2GIQA 3MFIA 5LYJF 1GYFA 1K47A 3KK3B 4FU0A 4JV5H 4ECSA 3RJJA 2W6QA 4OHWA 1X9NA 4RW4A 1Y5IB 4ZVSB 2MQOA 3AQFA 3G6VA 2F8HA 3UDCA 5J0YA 4QWCA 4WYLA 2XLKA 4DLKA 1F5BA 3OJSA 2L9DA 2MKSA 1RUSA 5HJXA 3ISBA