4F4XA

Y-family dna polymerase chimera dbh-dpo4-dpo4 #2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
b'MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase IV
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
total genus 113
structure length 342
sequence length 342
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4xA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f4xA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4xA01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f4xA04
7ICJA 1RT2A 1TV6A 2B5JA 3KMSA 4U7CA 3UPFA 4RQ0A 3T19A 3KLFA 2E9TA 5J2HA 8ICAA 1TV9A 1RA7A 3IRXB 3OJSA 4I2QA 8ICWA 3MR5A 3TAMA 2ILZA 5DDMA 2OPPB 2BDPA 5HLFA 5IIIA 4J9OA 4GXIA 4ZVEA 3RH5A 1BGXT 4KLTA 4QZEA 3DOLA 3FSIA 4WXOA 4ECQA 4MK8A 4TQSA 1RTHA 3E2EA 4F92B 1ZJNA 3RR8A 4LZDA 4KFBB 4EBCA 1QSSA 1BQMB 1XR7A 1NNDA 1NKEA 2XY7A 2UVWA 1SH0A 2HHSA 5C42A 3DI6A 4IQUA 4LSNA 3OJUA 4I7FA 2W9MA 4RW8B 8ICXA 2FVSA 1XU4A 2J6SA 2I5JA 4IFYA 8ICHA 1TP7A 1S0OA 4ZPCA 4F5PA 1KLMA 2MAXA 4RPZA 3GV8B 5CJ7A 3UXPA 4KLOA 2NRXA 5KFGA 4DS5A 2UVRA 4ID5A 1JKHB 2B21A 3DYAA 1NJXA 1HUZA 2QV6A 7ICEA 4TY8A 1C1BA 3MFIA 5CYMB 5CP2A 1RTIA 1RTJA 2J6TA 4F4KA 3LAMA 1ZQMA 4NLOA 2R8JA 4UB3A 3BSNA 3KOAA 3QYYA 3KLEA 1ZQNA 8ICGA 2F1JA 3Q8SB 4M9JA 3M8PB 2IMWP 4DL5A 9ICTA 4DFKA 1FKOA 3PW7A 1X9MA 1TVRA 2CJQA 2JLEA 4IH5A 5J2QB 4DQIA 3HVAA 1MQ3A 4Q44A 4MKBA 2AGPA 4M2YA 2VG6B 1S6PA 4DEZA 4MFCA 4F4XA 9ICUA 4ZMMA 4PHPA 4K4GA 3DRPA 1ZQVA 1D0EA 4M95A 1S1VA 1EP4B 2IJFA 4RW6B 3JSMB 3DLKA 3KTQA 2AX1A 4LSLA 5DKWA 4DFPA 4K4HA 7ICPA 5DQIA 4UAZA 4R8UA 1KSPA 2OPQA 2ZTCA 2Y1IA 1LB2B 3QZ8A 4Z6DA 4YP3A 2KZ3A 3HT3A 2YNHA 3IGVA 1QE1B 1UA1A 5KFAA 5F9LA 2WRMA 2WONB 1IKXB 2MUTA 5EDWA 1JLBB 2ILYA 5CA7A 1RA6A 3ICLA 3C21A 4KE5A 5KFUA 3BR9A 4QWBA 3T1AA 4JWMA 1JLAB 4DF4A 1RT5B 4Z6CA 9ICGA 1TL3A 5F9NA 1RT7A 1L5UA 2BR0A 2KN7A 1S9GB 5L1JA 3NAIA 1BPXA 1N6QB 4ECZA 1D8YA 5FDLB 4DOBA 1LWEA 4GC7A 5KT3A 3H5SA 3QLHB 1HMVB 2AQ4A 4YD1A 4IH7A 3RH6A 8ICZA 2FLLA 3V6HA 3HHKA 5D4BA 3OHBA 3DM2A 4I27A 2OPRA 8ICMA 1MSWD 4K4IA 3TVKA 7ICKA 1ZQLA 2YNGB 2VA8A 1FKPB 3SI8A 2WHOA 4Y2CA 8ICUA 3JYTB 4RQ6A 1XC9A 3ZDBA 5DG8A 4JWNA 4PQUA 4DSEA 2ASDA 4O3OA 3MDAA 8ICBA 3UQ0A 2UVVA 2FVQA 1AROP 2HNDB 4O4GB 1S97A 1L3TA 3B0YA 1TVAA 2HHVA 4JUZA 3JPTA 4NLXA 1T3NA 1TL1A 1S1UB 5KFQA 2EC0A 5K14A 2R8IA 4O4RA 1U9LA 1DTTA 1XR6A 8ICOA 4G1QB 1ZQIA 4NY8A 1S1TB 3DLGA 1NKCA 4ELVA 4LVSA 3N6MA 3KK1A 4EEYA 4QW8A 8ICJA 1C7YA 1RT4B 4PGYA 4P4OA 1RTDB 3PO5A 4B9NA 3BQ1A 1S0NA 5KFZA 1ZQPA 1KHVA 5KG1A 3MFHA 4QWCA 4RPXA 1VRTA 1T4GA 3UQ2A 1U49A 3CJ3A 5F8IA 3KHGA 4KTQA 3GIMA 2E9RX 1IM4A 1JXEA 4X2BA 4F5RA 3RJGA 2BCRA 1RT6B 5I3UB 2C2RA 4M94A 5TZVA 3RJKA 4NLWA 4IQXA 4R8UB 4ZHRA 4KLGA 4KAIA 4GXJA 1IKYB 4IQVA 3TFRA 5KFIA 5DB6A 4I29A 1S10A 3KLHA 3VQSA 4UBCA 4GC6A 1DGSA 2JEGA 1T8EA 1S6QB 9ICJA 3PO4A 5BPCA 2HHTA 3KK3B 4DQPA 3HKWA 4ZP6A 2ZUBA 3OHAA 3CO9A 1KRPA 3QIPA 4Z6FA 4H54A 1HQEA 3HP6A 5J2IA 2A1JA 2IBKA 7ICTA 2FPMA 4Q45A 4TUQA 4DOCA 1N5YA 4O5EA 5KFLA 5HBMA 4DLGA 1R0AA 3UPQA 2W8LA 1D1UA 4XUSA 4QW9A 4NLKA 3LP2B 1T03B 3Q8KA 3I0SB 4ZVFA 2ZTEA 3IRXA 2KFZA 5DG7A 2WOMB 3PX6A 4ECXA 2OPPA 2YNIB 2M9NA 4H4MB 3ZDAA 3IS9B 5J2AA 2AJQA 2VA3A 1UNNC 4F91B 2KTQA 4BGDA 3C2KA 5J29A 4RNOA 3Q8RB 3G6YA 1ZQWA 3FYHA 4M9HA 3MEEB 1TQLA 3MABA 1NKBA 1U48A 2RKIB 3GFKB 4KFBA 4J9NA 4U6PA 3C6UA 5KFEA 1BQMA 1BQNB 5HMMA 1ZQEA 3RB0A 3RBDA 3V7LA 3PNCA 3NBPB 4ECRA 4RQ4A 1X9WA 4RW8A 1XS9D 2H5XA 2XGQA 2FMQA 1XSLA 3BQ0A 1SH3A 3C5FA 2W9BB 4C8MA 1CEZA 4ED8A 4O3PA 2XI2A 4MFFA 4YR2A 1S1XB 2KZMA 4B9UA 5KG6A 4KKOA 4NLDA 3PMNA 3SFUA 4K4YA 2HNZB 5EWGA 1JKHA 4ZPAA 1VRTB 3THVA 1C2PA 2FLPA 3MTKA 2JC1A 4UQGA 4Q8FA 3PX4A 2R8GA 4I2DA 1BVSA 1LW0B 5CYMA 1TKZB 1S0MA 4UAYA 4NM2A 7ICSA 3MR3A 1JIHA 2PFQA 4ELUA 2ZE2B 7ICRA 3D5MA 4ELTA 4MEXA 2ASJA 4M6WB 2D41A 5KT6A 3M8PA 5KFMA 2R8HA 2UVUA 4Q0BB 1RXVA 4KLMA 4QZDA 4F3OA 5JUMA 5J2QA 1RDRA 4QPXA 4F50A 3N97B 3MECB 3UR0A 2VG6A 1X2IA 5J0OA 3GILA 4FO6A 3T5KA 4RQ3A 2XO7A 8ICYA 1X9SA 4I2PB 1EP4A 3V6KA 4RW6A 3JSMA 2JEIA 5KFHA 9ICMA 2BQRA 4KITB 1MMLA 5BOMA 3ISDA 1NK0A 5J2MB 1XO1A 4F93B 3PW4A 4YR0A 3I5AA 1QE1A 4F5OA 2OWOA 1S9EB 1ZQDA 2W9AA 3GDXA 4X5VA 4MIBA 2WONA 1IKXA 3H5XA 4IR1A 1JLBA 4G3IA 4IQWA 3TQ1A 4QWEA 1QTMA 2BCUA 3V7KA 4JK1A 3DOKB 1JLAA 4YMEA 5KFKA 1RT5A 4B3OB 2PFPA 5DB9A 4NLSA 1IKWB 1S9GA 4IG3B 4O0IA 3LWLA 1N6QA 3C6UB 3TFSA 1ZQFA 3C1ZA 5FDLA 2XCPA 4DSLA 4K4VA 3QLHA 1HMVA 8ICKA 4ICLB 3MR6A 4BXOB 1UT8A 2AGQA 2D3UA 1ZTWA 3G6VA 4IKAA 1I6JA 5KG2A 5L9XA 2GIQA 1T7PA 4ECSA 2YNGA 1C1CB 1ZQZA 1FKPA 4B9MA 4QZBA 4B9LA 3M9MB 4DLEA 5J2NB 3JYTA 4KKOB 1HJPA 2PI4A 1JX4A 3IGNA 5F8GA 3DRSB 4PH5A 4DL3A 1JXLA 1ZQRA 1ZQJA 3MGHA 1SKWA 3IM1A 2XGPA 3DDKA 2IM2A 2HNDA 5L1IA 2YKMB 3D28A 4O4GA 5HHIA 1DOQA 1QAIA 4NLRA 3KLGB 3CJ4A 1QUVA 2ZJAA 3M8QB 3JPSA 1S1UA 3MR2A 1FK9B 3UXOA 1NK7A 4O3SA 1KFDA 7ICFA 1ZQTA 3BQTA 8ICSA 4KLFA 3I5BA 3V6DB 5D46A 2V0NA 4G1QA 1LV5A 4J9QA 4DSJA 1A76A 3M8RA 3T5JA 1L3VA 1S1TA 5C24B 2OPSB 2DPJA 2OH2A 5KFNA 1RT4A 3Q8LA 4M9LA 4LQ3A 1RTDA 2W9CB 1C0UB 3EW9A 2VANA 4QZHA 5KG3A 4RT3A 4YD2A 9ICLA 4GXKA 9ICVA 4RU9A 3C6TB 1KTQA 4RW9B 1YVFA 3OLAA 3EZUA 2R2UA 1NK6A 2W7PA 1ZQHA 4F4WA 4F5QA 1S1WB 2BKEA 1RT6A 5I3UA 3ZDDA 1WNEA 3FDSA 5D3GB 3OL9A 4K4UA 5J2PB 1TKTB 4FBUA 5HP4A 8ICNA 3LP0B 1HNIB 3BSCA 5CWRA 5KT5A 4PWDB 1IKYA 4TLRA 4F2SA 2W7OA 1T94A 2HMIB 1B22A 2BQ3A 3ZDCA 9ICRA 4O3NA 5KFBA 1QSYA 1S6QA 4J9MA 5D49A 2IHNA 9ICXA 2FVCA 3KK3A 4K4TA 5J2KA 4B9SA 5DLGA 1SKRA 2YNFB 4IDKB 1BPZA 3H98A 2XCAA 1DLOB 3CVKA 1U4BA 1S77D 4F4ZA 1NK5A 5DB7A 4KV8A 3GIIA 3KNAA 4K4XA 4YN4A 5J0TA 1ZQGA 5KFVA 3NKYA 3LP2A 1T03A 1ZQSA 3FQLA 3I0SA 3FQKA 4EYIB 2XWYA 3PW0A 4TYAA 3H5YA 3T5HA 1UA0A 2WOMA 4Q43A 9ICCA 2YNIA 1REVB 1TK5A 4H4MA 3PX0A 1L3UA 3IS9A 1ZQQA 4TXSA 3B0XA 4MF8A 4YCXA 4QZAA 1NK4A 5KT7A 4WFZA 4RW4B 3N6LA 5KFPA 2V4QA 4B9VA 3H59A 4ZH4A 4O44B 4O5KA 4RW7B 2R8KA 4DG1B 5KTQA 1MU2B 4I28A 3RJIA 3MEEA 2RKIA 5CYQB 4I2HA 5J1EB 3RJEA 4I2BA 4P4MA 4RZRA 1BQNA 1N56A 4EBDA 4JV2A 3QZ7A 3NBPA 4RQ1A 5KFWA 3HPOA 1ZYQA 2UUWA 4DL4A 3HX0A 3RRHA 4URSA 2W9BA 2V4RA 3OSPA 2XY5A 3NMAA 3DRRB 1S1XA 3G86A 4R5PB 9ICKA 1J5OA 4IRKA 4ZP9A 4R66A 2HNZA 4YMOA 1EXNA 4KO0B 3FFIA 3V4IB 2BANB 5DDYA 5JXSA 1LW0A 3SYZA 1SL1A 4KLLA 1Y88A 4YR3A 4I2FA 1TKZA 4YXMA 2ZUCA 4NLGA 3CJ5A 4ED3A 4I2CA 2FJWA 1Z3EB 2ZE2A 4M6WA 3JPRA 1TAUA 3ETLA 4ED7A 1D9DA 4Q0BA 1BPYA 5DQHA 5KFDA 3PJXA 5T14A 5HROB 3HVWA 2BRKA 2R2TA 5J2GA 5DQGA 2VG7B 1ZQOA 1ZQKA 2PI5A 4IOBA 3QIDA 4DWIA 5L1KA 4UB1A 3MECA 3TAPA 1PZNA 2JC0A 2P6UA 5HHHA 3PMLA 5J0QA 2HW3A 5KG0A 2LYHA 3BREA 3ITHB 1SH2A 4Y2AA 5C5JA 9ICBA 3LAKA 3K4GA 3TAQA 3EYZA 2PFOA 3MDCA 3MEGB 3RJJA 4NLTA 4I2PA 5J0XA 4MH8A 5IINA 3TANA 1LW2B 4KLEA 4J9SA 2IAJB 1RPLA 2BPCA 3G6XA 1ZQXA 3E51A 5J2JA 4KV8B 4ZVHA 3C5GA 4YQWA 4K4ZA 5J2MA 2ZD1B 1LWCB 7ICVA 5C25B 4ED0A 2XY6A 4IFVB 1S9EA 4EO6A 4NLNA 4ZP8A 1T05B 5KFOA 5EOZA 5KFYA 3QEBZ 5DGAA 5KT2A 2VG5B 4ED1A 1A77A 1S49A 2ZJ8A 1S9FA 3DOKA 4B3OA 3H40A 3LANA 4XRHA 3CDWA 4MIAA 4TUPA 3JPOA 1IKWA 4KBIA 1LWFB 4IG3A 4O3RA 8ICVA 2PXIA 3H5UA 4BDPA 2JZBB 4QWAA 1WCNA 3H8JA 3H8SA 7ICHA 3LK9A 4M0AA 4ICLA 4BXOA 1RT1B 3JPNA 3SZ2A 4JV0A 2D7SA 1C1CA 4KLIA 3KHHA 3PR5B 4P2HA 4J9LA 3RB6A 1J5OB 5J2NA 2VA2A 5IIJA 2IM0A 3DRSA 3FRZA 3H8WA 3GV7B 4HKQA 2AQ0A 3FFIB 4RUCA 2YKMA 3KHLA 1COOA 1NJWA 2XC9A 2B6AB 3KLGA 4TN2A 1HUOA 2GWSA 3M8QA 1FK9A 1KLNA 3T3FA 3V6DA 3UQSA 1JLQB 4EZ6A 4DSKA 5C24A 2OPSA 3KJVA 3RRGA 1IKVB 3IN5A 1JLFB 5I42B 9ICIA 2O5DA 2C2EA 3ISNC 2W9CA 4C8LA 4PUOB 4ECTA 1C0UA 1S4FA 2DFLA 4NRUA 2HWIA 2HNYB 5F8LA 3AU2A 1JLCA 1HPZB 3C6TA 3OLBA 3KLIB 3DLEB 4RW9A 1TK8A 3QEAZ 3Q8MA 1MQ2A 2ZKUA 3BSAA 4QZ9A 4DQRA 9ICHA 1GX6A 9ICFA 1S1WA 3CDEA 4NLVA 4K4WA 5DB8A 1QAJA 3ZD8A 3RH4A 2IC3A 4WXWA 4LQ9A 5HP1B 1NK8A 3I0RB 5D3GA 3TARA 1Z00B 1HNVB 5J2PA 1TKTA 3ISBA 2P66A 3LP0A 2WK4A 1HNIA 4CCHA 3N4MB 1XWLA 4PWDA 4M04A 1CSJA 1RZTA 4TY9A 2HMIA 5KFFA 4IRDA 4QZGA 1NHUA 2NRTA 1EETB 1QLNA 3EPIA 4NLQA 4KN4A 2BCQA 4MFAA 1NHVA 4ZVGA 1KDHA 2FJXA 4UBBA 3RTVA 2IM3A 3UDLA 2YNFA 2ISPA 1NJZA 3RJFA 4IDKA 2IA6A 1HQUB 4NZ0A 4EYHB 5DG9A 1DLOA 1JLGB 5J2EA 4QZFA 2R2SA 3CDUA 4K4SA 4R64A 4KLHA 2YKNB 1SKSA 8ICRA 1S76D 4HYKA 2HHXA 2F1HA 4MFBB 4KB7A 5J0PA 4WE1B 3GIJA 5J0RA 4WZMA 5IILA 1N48A 5EUHA 3PV8A 1REVA 3BQ2A 1TKXB 1BPEA 4IQTA 5KT4A 4NM1A 1KFSA 3DMJB 4XO0A 4RW4A 3JPPA 2XI3A 1NJYA 4O44A 4XPEA 4RW7A 4ECWA 1RT3B 5F8MA 4DG1A 5DBAA 1MU2A 4I2EA 9ICAA 1TAQA 3MEDB 5DBCA 4O3QA 5KFJA 4ZPDA 5CYQA 5J1EA 2R2RA 1XSPA 3HVTB 4ZP7A 3NAHA 2HVHA 4WYWA 4OL8A 4Y3CA 3GQCA 4YMNA 4PHDA 4MK9A 3KMQA 3QGGA 4RT2A 3KJVB 5KFRA 2ALZA 5KFSA 1TK0A 1HYSB 1H38A 4E0DA 1SUQB 2KFNA 5EWEA 3DRRA 4I2GA 4JV1A 1JLEB 4R5PA 5IIKA 5J0SA 5HNKA 3IG1B 4RQ7A 3RBEA 1OS5A 4RNMA 3RAQA 1VRUB 4KO0A 3BGRB 3V81B 8ICFA 1JLCB 7ICGA 4EO8A 4H4OB 3NTUA 3V4IA 3JPQA 2BANA 3M8SA 3Q8QB 4QZCA 2BE2B 3H4BA 4F5NA 1ZQYA 2IC3B 1SV5B 4LZGA 3EPGA 3QE9Y 5KFCA 4O9MA 3GYNA 3ZD9A 4NLPA 3E01B 1ZQAA 4BWMA 7ICIA 4YMMA 4DOAA 1NK9A 4WYLA 4IG0B 5CR0A 5J2DA 3RB3A 4FS2A 3V7JA 5HROA 1C0TB 4Q8EA 3QO9B 5J2FA 4Z6EA 2VG7A 8ICCA 3SFGA 3KLVA 1UWBA 4NCGB 2BPFA 5J0UA 2ASLA 3KK2B 4NLYA 3MBYA 1DTQB 2I9GA 1RT2B 2ZTDA 1TV6B 4ED2A 2B5JB 3LP1A 3SV3A 1SZPA 3ITHA 4MKAA 3C2MA 2ZUDA 7ICMA 4PPXA 4IH6A 4J9RA 3KLFB 2E9ZA 4I2QB 2CKWA 3MEGA 4BWJA 3TAMB 4F8RA 4XA5A 5HLFB 4DS4A 2HVIA 2HAIA 3HW8A 1LW2A 2V9WA 2IAJA 5KG4A 4RNNA 4FBTA 1QSLA 5BOLA 2FLNA 4KSEB 4KHRA 4NXZA 3DOLB 3CWJA 2AWZA 2ZD1A 4IR9A 3PJWA 1LWCA 1RTHB 5C25A 4IFVA 3PR4A 4RNHA 3BJYA 5HMLA 1T05A 3M9OB 5KFTA 4O5CA 5C42B 3DI6B 4ECYA 1JN3A 2HHWA 4RPYA 4XQ8A 1ZQCA 2WB4A 4LSNB 4I7FB 2VG5A 3SV4A 5IIOA 2BPGA 4J9KA 2JEFA 2I5JB 4IFYB 2Q0ZX 3AUOA 9ICWA 4URQU 4DSFA 1KLMB 1LWFA 3OL7A 4K50A 8ICLA 4DL6A 4DL7A 2QE5A 4ID5B 3DYAB 4F4YA 1W25A 1SL0A 2JZBA 1ZTTA 9ICQA 3EWAA 1WCLA 3BDPA 2HHQA 1B43A 4TY8B 1SL2A 1C1BB 2GC8A 2NRWA 1RTIB 3H4DA 3ZDEA 1D9FA 1RTJB 1RT1A 2B43A 2DPIA 3PY8A 3H7IA 2FPKA 1TFRA 4M9GA 4DQSA 3KLEB 1ZQBA 5F8HA 4YVZA 3PW2A 1ZQUA 3T5LA 2BQUA 4C8OA 4KHMA 3LDAA 4KLJA 4WFYA 7ICUA 1FKOB 3ISCA 2BCSA 3RR7A 4J9PA 1TVRB 4WFXA 5DLFA 5J2BA 2B6AA 4TQRA 1MC8A 5KG7A 2C22A 5CHGA 3CJ2A 2JEJA 4URGA 1S6PB 1S0VA 1RXWA 2I1RA 4NYZA 4PGQA 2NRZA 3AU6A 4YXJA 4TURA 4PGXA 2KZZA 2BCVA 1JLQA 5EWFA 4DFMA 3DRPB 2J6UA 1NOMA 4KLQA 1IKVA 1JLFA 1S1VB 5I42A 5IIMA 2WCXA 4TYBA 4QWDA 2FMSA 4MEYA 3PHEA 4PUOA 2FPLA 1UWBB 5CB1A 4MK7A 2RDJA 4ECUA 4RQ2A 1Z4UA 3DLKB 4RUAA 4LSLB 3NGDA 4ZPBA 3RB4A 4I2IA 2HNYA 1KEJA 1HPZA 4UB4A 2OPQB 3LP1B 4F2RA 3KLIA 3DLEA 3EZ5A 2YNHB 4GLXA 4DL2A 1N4LA 2FVRA 4C8NA 4C8KA 2MUTB 9ICNA 3ORYA 4RQ5A 2HWHA 1D8LA 4UB2A 8ICPA 1K1SA 4FS1A 5HP1A 3I0RA 1V9PA 5DBBA 1Z00A 1HNVA 2RF2A 1U09A 1TL3B 1RT7B 3C23A 3BSOA 2FVPA 3V6JA 1XSNA 4DO9A 4DQQA 1EETA 3LWMA 4KLSA 3NL0A 1RAJA 3LALA 3PVXA 4EBEA 1LWEB 3CJ0A 2BHNA 1U47A 5L1LA 4NLUA 3TI0A 5KFXA 3OL8A 3I5CA 5J0YA 5DGBA 3IHQB 3DM2B 2OPRB 4KLUA 1HQUA 1IXRA 4EZ9A 2IHMA 2FJVA 9ICEA 2NRVA 4QZ8A 4TUSA 4M47A 1JLGA 9ICSA 4P4PA 2IM1A 2BGWA 2GIRA 4KMUA 1U45A 2YKNA 4PQUB 3CIZA 4R63A 1BPDA 2WTFA 1UT5A 3C2LA 1ZETA 4UB5A 4MFBA 3GIKA 1S48A 8ICIA 4R65A 3QGIA 3ISND 4DSIA 4WE1A 1TL1B 5F8JA 1BPBA 1RYRA 4NLZA 5K14B 5F8NA 1TKXA 1DTTB 4XPCA 7ICOA 3DMJA 4RNFA 3K75D 4PHAA 3RJHA 3DLGB 1RYSA 2FMPA 3Q8PB 3KK1B 4Y34A 9ICPA 4YG2A 2BRLA 5J0WA 1TKDA 3PZPA 4WZQA 3HWTA 1RT3A 3MEDA 2HHUA 4R0EA 3MGIA 4YFKA 4RQ8A 1GX5A 3HVTA 3PW5A 4ED6A 4I2AA 8ICTA 7ICNA 4DF8A 3QGHA 1XR5A 1KHWA 3MF5A 5KG5A 4NRTA 2C28A 1K1QA 3RAXA 4ECVA 2AGOA 1HYSA 4QZIA 3OL6A 8ICEA 1SUQA 4UAWA 2ZJ5A 1JLEA 2AX0A 3UXNA 1KFTA 3IG1A 7ICLA 4PHEA 4B9TA 2D3ZA 4I2JA 9ICOA 1VRUA 4DFJA 2W8KA 3BGRA 3V81A 2PFNA 2RDIA 2AU0A 4H4OA 2P6RA 4ZHRB 1JMSA 3OGUA 2ISOA 4MF2A 3M9NB 1HARA 2UUTA 2C2DA 2BE2A 3KLHB 1L3SA 3N6NA 3H2LA 1SV5A 4KLDA 1CUKA 7ICQA 3E01A 3GV5B 4IRCA 4IG0A 8ICQA 3C1YA 2RF2B 3QIPB 2IJNA 1C0TA 2F1IA 1ZJMA 4KN7A 2F8EX 3QO9A 5J2CA 1HQEB 4M9NA 2A1JB 3KHRA 4NCGA 2ATLA 3OSNA 3V72A 2I1QA 2Y1JA 3KK2A 1N5YB 1DTQA 5HBMB 1R0AB
chains in the Genus database with same CATH superfamily
1U2RA 1FWLA 2CADA 2GAGC 1VBHA 4WWSA 4U7CA 2EPIA 4C3MA 2MGZA 1FD8A 8ICAA 3GSIA 5D0HA 4M5HA 1XQIA 2ILZA 2OPPB 3QWPA 3SD7A 2AKWB 3QFWA 4MKYA 3MAQA 3PRVA 1SIZA 2C3MA 3EGJA 3H20A 4AXJA 5E79U 5K9FA 4DL0C 3RIZA 3MKVA 3MEKA 3FSIA 4B3TF 1X7VA 4C8ZA 5AM2A 1RTHA 1K44A 2WF5A 3E2EA 5LXYA 4A8KA 4F92B 3GZFA 3RR8A 4LZDA 4EBCA 2KT5A 4IOCQ 1UVNA 5ETNA 2XY7A 4B3TH 2XZDB 1FCAA 3K59A 1J5EF 4IAJA 2I5JA 1WSCA 1EX8A 5ETVA 4HTIA 3TQTA 3F2CA 1J5EH 3L7UA 4IQMA 5AM4A 4ENOA 3BS9A 3ULHA 2QARA 5CD4A 1NJXA 1OIAA 4N7TA 3GB0A 1RA5A 1EKSA 1KVIA 4YJ2F 5CYMB 5CP2A 5DDOC 4F4KA 4RUHA 2VV5A 5ETLA 5CCLA 3I76A 3ILJA 8ICGA 2VQFF 3AXKA 3N01A 2W2QP 3PW7A 1X9MA 3IR5B 1KNZA 4I7HA 2Y9HA 3HVAA 2MZRA 2IBOA 4M2YA 2VG6B 1COKA 3HT0A 2K3IA 2KJVA 2F9DA 4ZMMA 3CD5A 1P9YA 2AEMA 2UXBJ 3DRPA 2FJ6A 2KJ9A 2NXUA 2VKZG 2EQYA 2B63A 2JL9A 4C80A 2CPIA 2WB1A 2HBRB 1D9AA 1GT8A 3CYMA 1VQLS 4CLSA 3R7SB 1S57A 2IHR1 4MYTA 2EAOA 4K4HA 1FKAH 1VBXA 4A3EG 3A1YG 4DR3F 3IDWA 2RUSA 2O66A 2MSTA 2Z2LA 3HT3A 4BJHA 3M2VB 5KFAA 5I3QA 2FJEB 5D4OA 4C9DA 1JLBB 2ILYA 5CA7A 1RA6A 2RU9A 3KXDA 4P10A 2GV1A 4XX0B 4KE5A 2R42A 1DAXA 4N56A 4YAKB 4TU7A 2J7WA 4WKRA 4O4IF 1MROB 3D67A 5AK3A 2BR0A 2HZCA 1S9GB 3AB4B 5L1JA 4NA1A 4WJBA 4X4NA 4YY3J 1Y11A 4ECZA 2GHWA 1D8YA 4ICAA 1UKUA 5FDLB 4DOBA 3QU4A 2MHEA 4GC7A 2WSEC 3K0JA 3V2UC 2KK0A 5KT3A 1WSRA 5IWAF 3CCRS 5KKNB 1HMVB 2AQ4A 4YD1A 1JNRB 3RH6A 4OLPA 1O51A 1OUQA 8ICZA 2ZJPQ 2FLLA 3HHKA 3A3PB 1OXJA 1MSWD 2VA8A 2RDDA 4DV2F 1Q78A 1IVZA 1UWAA 1XC9A 4HI2A 3T6JA 3CMES 2EFVA 1KQSR 1W93A 3R0DA 1FX4A 8ICBA 2HAFA 3I4MG 3ISZA 2V8GA 4DV2H 3EWGA 3B0YA 1U1NA 2OGJA 3TVYA 1RADB 4DYKA 4RQMA 2NZCA 2EC0A 4WP8A 5D1OB 1WWUA 4K0KJ 4OHXA 1RBOB 4NY8A 3DLGA 4ELVA 2QSFA 3N6MA 3KK1A 1RT4B 4M5DA 4LFCH 2QA4S 4LH7A 1IOVA 5ALNA 3WK9A 2GGPB 2VUMG 1UL3A 3LF0A 3ZXWA 2RSQA 3HHDA 3MFHA 4BHQA 4USIA 4RPXA 1VRTA 2QN6B 1O12A 3MOZA 1U49A 4DPXA 3CJ3A 2PMZF 2E9RX 3T81A 3PO2G 4QNLA 2E7VA 4X2BA 4QJVA 5T7LA 4F5RA 2K1RB 4LF8H 2XHWA 2BCRA 1FJGF 3WO0A 2KV2A 1HWIA 2PMZD 4LSAA 4AQYJ 3BPSP 4NWIA 2JA5G 1CQIB 4NLWA 1H98A 2D8CA 1LK5A 3NWRA 1MG7A 4CNZA 4IQVA 5KFIA 3LWBA 4I29A 4P74A 4RJVA 2D3DA 1EJTC 4WTOB 3K5MA 2MB0B 3T6BA 2JEGA 1XTZA 2HFSA 3SCIE 2LA6A 2HHTA 5AE1A 4G1PA 2NPFA 2NU8B 2UXCF 4K2XA 1TMJA 3NS1A 3SQGA 4OJGA 3J80Y 1HQEA 5IYDG 3AN1A 4LF4J 4AUKA 3MZIA 5J2IA 2I8CA 5AKYA 2WF7A 7ICTA 2W7AA 2DNNA 2JLFA 2FPMA 2F8KA 1XNQF 3EXYA 1N5YA 3WKAA 2HJWA 3RFCA 2W8LA 1HKAA 4HQ6A 1D1UA 4NLKA 3LP2B 3Q8KA 4LF6J 2ZC3A 3AXMA 4ZVFA 1SCUB 2KFZA 3LVWA 4B3RH 5DG7A 1CULB 1S8OA 2DGTA 1WHVA 2PBZA 4WIIA 4ACOA 3GIQA 4U95A 1PKUA 1HHSA 3Q8RB 4Y2KA 2W2OP 1SC6A 2JDJA 2DGUA 5IP9G 4DV5J 3FMWA 1GK8A 1UC9A 1U48A 3GJSB 3GFKB 2ZH5A 4UT4A 1HI1A 3CE8A 4U6PA 1RSCA 2AJFE 4NYOA 1VJWA 3RBDA 3CJTA 4CEUC 1QDUB 1A5KC 4ECRA 4PR6A 4NZ7A 4QOTA 2N7CA 4DR7H 1YK9A 3AT1B 1XSLA 3L4PA 2AXTU 4PWWA 2GOKA 2UXDF 2O6KA 2V69A 2Y9UA 1Z4OA 3UWTA 2GQCA 4O3PA 2XI2A 1K70A 1YWXA 2K2PA 3GFHA 1O75A 1N61A 3BBBA 4N5SA 1ZD4A 2Y0SA 3OTBA 2ZIVA 4KKOA 1BNPA 1T11A 2HNZB 4HL9A 4G65A 1V4YA 2XWXA 3CJKB 1VRTB 2HQGA 3MTKA 2JC1A 1XMQJ 2Y9TA 4I2DA 1L7PA 4AYBF 2P35A 4XTTA 3GGMA 2VHGA 1TKZB 5KAFU 5THWA 3BM7A 5HL7Q 3MR3A 2ZZMA 2OP5A 3QMQA 4ELUA 2H3ZA 2KDOA 1R6VA 3LVVA 3D5MA 4CIOA 4C4WA 4M6WB 4AYBD 3M6ZA 3M8PA 4Q0BB 1FEHA 3K8WA 2WYOA 1R8AA 2MKIA 1XMOF 1Q5VA 1OPZA 1ZQ1C 3G8CA 4DCPB 4C5BA 2E1MC 1RBAA 1H7WA 2RILA 3J7YU 3MOJB 1EAYC 3UR0A 3WNZA 2KT3A 3UCZP 1X2IA 4X84A 1OYDA 4A8XA 2NUUG 2G1DA 5J0OA 1XMOH 4OJOA 3FMAA 1YZ7A 1UZDA 4ZKAA 3T5KA 5AT1B 3QQCD 2K4EA 2ZIWA 1X9SA 5DZ6A 3V6KA 1ZZFA 2DH9A 2FGOA 4PXEA 4NE9C 3JSMA 4EGLA 9ICMA 4C7ZA 1H6KX 4XIUA 3MPWA 1FRLA 5GMEA 2N4DA 4F93B 1JKJB 3HOZG 5A2QW 3C16A 2OEJA 4F5OA 3MURP 1ZQDA 2W9AA 3GDXA 3OR1A 1RLCL 3IRWP 3R5JB 4CF4A 1O8BA 1CE8A 4RLEA 4FXDA 3W2VB 4C65A 2CRXA 3W3SA 2W2MP 3AM9A 1VQ8S 4AYBA 2BCUA 4WF9Q 2BJ8A 2CPYA 4EENA 5C1PA 2LYAA 3PHTA 2E8PA 2GMJA 2E5GA 2XG8A 2YTCA 1KJ8A 3TFSA 1R8BA 2YS7A 3UO0A 2X1FA 4DSLA 1R31A 5EZYF 3QLHA 1WOSA 1E6VB 4BXOB 1SJQA 2FI1A 4HR2A 4EPDC 2WSCC 3G6VA 4IKAA 2EAPA 3ZO7A 5L9XA 4EFEA 4F0MA 2GIQA 2MLZA 4ECSA 1Q8KA 2YNGA 3P5BP 3QGPA 5J2NB 3JYTA 4KKOB 2PI4A 2K4PA 2EFPA 2LQJA 2UXBH 4PH5A 1JXLA 1ZQRA 1FWHC 5RUBA 3IC1A 1LK7A 4DR4F 1A7GE 3ILOA 5HHIA 4BJQA 1QAIA 4P0QB 4Z2XA 5HMDA 4NLRA 2CJBA 2GLTA 3ZZUA 1JXVA 2C3YA 3BZQA 2E5SA 4CNUA 3NS7B 5IOLA 4DX8H 3CNHA 8ICSA 3VC8A 1VJQA 2E5JA 2DD8S 3IAM9 3V6DB 1A76A 3M8RA 2ZIXA 1S1TA 3D9BA 1KJIA 3HX9A 4I67A 4TU9A 2Y1RI 4Y2QA 3Q8LA 3R6LB 2W25A 4FF2A 3EW9A 2QO3A 4QZHA 1UVJA 4GO7X 1SKUB 4QIWC 4RT3A 9ICLA 2MMYA 1HWJA 3K3VA 3MM8B 3OPXA 4NI2A 4TNOA 4RW9B 1YVFA 2AQOA 4WBNF 3FK4A 4A8OA 2R82A 4YY3H 5AKJA 1WKKA 1AUDA 2NVXA 2NQPA 2QLFB 3FDSA 4CO0A 3LW5C 2XYHB 3QJPA 1NO8A 5J2PB 1TMMA 4OHWA 1T9TA 2FGCA 1J97A 5HP4A 1VRQC 3BSCA 1HEKA 4F2SA 4TLRA 2LMIA 2ZUAA 4AL7A 2BQ3A 2KXNB 3GZ7A 2CIMA 9ICRA 4ILMA 3IG8A 4O3NA 2DUYA 5TISU 4J9MA 5D49A 4G7EB 2IHNA 4PZNA 1KCXA 3WK7A 2MEWA 3NNHA 3KK3A 1HBMA 3WO1A 4I6WA 2D74B 1SJ3P 2K3KA 4DCJB 1DLOB 2Z58B 4F4ZA 4K0KH 4QZVB 5IC6B 2R7MA 5HMWA 3E5NA 5H9FJ 1JJHA 3JQMA 2GPSA 2CPRA 3K5PA 1I94J 2M4MA 1T03A 5A8WB 3FQLA 3FQKA 4HI1A 1PK1B 3VGSA 2Z7JA 5DM7Q 2QLWA 2IOFA 1REVB 4H4MA 3PX0A 1L3UA 1H0HB 1UCVA 4TXSA 4QIWE 4QZAA 1NK4A 4L6V3 1OO0B 1WC4A 3N6LA 3AQFA 4B9VA 4ZH4A 5CCMA 2P9BA 3DOMB 1GNKA 4G6VB 3IBCB 4JI4F 4TUYF 5CZXA 3RJIA 3N5BA 3M2RB 5F3XB 3MEEA 4MTEA 1NZBA 4Z42C 4I2HA 2KXFA 3RJEA 2HVZA 4DX7A 3L7OA 1I3OB 3NOGA 2KRBA 5FLMG 4EBDA 3NBPA 4RQ1A 1CQJB 4JI4H 3UMGA 4UB6U 2EK6A 3VZHA 1ZYQA 3V7PA 4P52A 4DL4A 1RKIA 3TUJC 3HX0A 3C46A 1H72C 4URSA 3AD8C 1X4EA 2HS4A 1K83A 3NMAA 1UAWA 1B04A 1JDBB 3I28A 4R66A 3PNIA 5BR8F 2EG1A 2XQCA 1GTHA 1LKYB 3V4IB 3QRRA 1GAOA 5DDYA 2V2KA 2H3VA 2XNRA 1SL1A 3WKBA 1UVMA 1CJUA 4YB7A 2ZUCA 4NLGA 3FKBA 3LPYA 1Z3EB 1WC0A 2VUNA 4ED7A 4LF6H 3D68A 5J2TF 1D9DA 1YIJS 4CNQA 2HFOA 1TTHB 5HROB 3HVWA 4RU2A 2K4IA 2WBMA 3U9SA 5DQGA 2VG7B 1ZQKA 2PI5A 4LRDA 5L1KA 1NDCA 2FZGB 4FZLA 1PZNA 2JC0A 2P6UA 1P1TA 5A0YB 3VAFA 2N82B 2FVKA 4J0MA 5CEHA 1E6YA 1SH2A 4DV5H 5C5JA 2V4JA 9ICBA 3LAKA 3K4GA 4L73A 4F0RA 4A3GG 3MEGB 2YWEA 5FPRA 5J0XA 4DDFA 3T1YF 1WC3A 4MH8A 4USMA 1SJ4P 3M8ZA 2HQIA 2QKQA 4HTJA 1UJ6A 3ZZOA 5KAKA 4DN0A 4ZVHA 1R9YA 1YKWA 2F4VF 1B6RA 4YQWA 3UCGA 5J2MA 4K4ZA 2ODGA 2FHJA 2ZD1B 4Z7YA 2YKQA 4HH0A 3T1YH 3C29A 3ICJA 1Q8LA 5LMUF 3V5RA 5U47A 2B9WA 2R7NA 1RJQA 1FE4A 2VUMA 1LEOA 3Q83A 2DIKA 4M5IA 2F65A 3GTJA 4KIAA 1GO3E 5DGAA 1XMQH 5IYBG 1HNWF 1A77A 1S49A 4ZPWR 1S9FA 1XNRJ 2OAUA 3U1NA 1W7WA 2VICA 4KBIA 3A8EA 4L3KA 3S6JA 3AEVA 2GJ2A 1HNWH 4UQTA 4BDPA 3EDQB 4LRCA 4QWAA 2JA5A 3VQTA 4WFBQ 4M0AA 1TR0A 2FIUA 4DV1J 4KR0B 3MUVP 2ZH7A 2W55A 3SZ2A 1NBEB 1IM6A 2FK3A 1GMUA 1NSAA 3CPWR 5CB4F 3N4WA 2IJRA 5IIJA 5AIAA 1SV4A 1G4CA 4RB0A 3DRSA 3D7SB 3CCTA 3GV7B 3PFOA 3L5KA 4YIWA 3PRDA 1F5BA 2XZWA 4KGKA 3HB9A 1VYAA 1DFDA 2B6AB 1EJRC 4BY1G 3M8QA 3J81W 5GAHI 1F6TA 3IA0A 2QB0B 2KYXA 1JLQB 5E3CA 2MQ8A 3G8TA 4GKKF 2JRZA 4Y2VA 3DDNA 1N60A 3RRGA 3IN5A 2H51B 1JLFB 2KVIA 2XMAA 5I42B 4JBCA 3W60A 2F1FA 1FJEB 4RBUA 1Q1KA 2BJ3A 2AJ1A 2HWIA 2DR7A 1JLCA 1HPZB 4PXDA 2B8PA 4C7YA 3DLEB 3KLIB 3Q22A 4MMOA 1TK8A 3NGSA 3P49B 5HI7A 3ET6B 2B4VA 2LQ9A 1KQGB 1KEEA 1Q8IA 3ZD8A 3OUYA 1VQPS 4WXWA 4OZNA 4JI6J 3K57A 4J9UE 2ASYA 2NV3A 5D3GA 5GMDA 5EGYA 1XDNA 2KXHA 4UW2A 1SIJA 1TKTA 1X4DA 3ISBA 3VTIA 3LP0A 1HNIA 3E0LA 1XWLA 2HMIA 3UDEA 4F7VA 1NHUA 3RBXA 2HFUA 2NRTA 3QUQA 2VM8A 2Q79A 2J9GA 1ZHQA 2LHTA 2BCQA 5IQ6A 1RACB 3NVYA 3D1HA 4WP3A 3QFHA 1N34F 2WDTA 2DTJA 3HF5A 1MN8A 3UDLA 5B5EU 3K17A 2H3IA 2YNFA 2KIWA 1L8LA 4IDKA 1HQUB 2RJZA 4OYMA 4EYHB 5DG9A 1VQ6S 3VPBA 2RD5C 5J2EA 4KT0C 2G0CA 3QBCA 2PUZA 3K7RA 4JV5F 2KH9A 2C35B 1PYOB 3KG4A 1HW9A 3GSDA 2P5VA 3TP2A 1PO6A 4XYLB 4CT9A 2F1HA 4GVLA 3DHXA 4MFBB 4KB7A 2A1BA 3D6MB 3UW1A 1ZM2A 4XK8C 3TKAA 2XULA 2MSSA 4WE1B 5J0RA 4WZMA 1N48A 5EUHA 1C20A 3MAAA 2NPIA 1BPEA 1U1LA 5L46A 4WP9A 2AYEA 3DMJB 1IBMJ 3BA8A 4XO0A 4OJHA 5EX3A 3J81U 2VBWA 3POTA 3JPPA 1X4CA 2XSJB 4LF5F 1NJYA 4O44A 5H80A 4XPEA 2VZ9A 5K8NA 4CTAA 2KG5A 1MU2A 9ICAA 2WSFC 5GADI 2K8CB 2MA1A 2LU2A 3MEDB 4ZPDA 5KFJA 3N2CA 3IP0A 5J1EA 1XSPA 4BCAA 3PSTA 4Z37A 3NAHA 2HVHA 1R43A 2VF3A 3EGWB 4FKYA 5BPHA 4RL1A 4QIGA 4P2MA 1PO9A 3A3NB 1K73T 4JYAF 4YMNA 4PHDA 1Z4NA 2ZOMA 1H38A 4E0DA 3US5A 2KKPA 2HOQA 4I2GA 1YQHA 1BLUA 4R5PA 5HNKA 4A3LG 4YS2A 1JLLB 4CO4A 4JYAH 1OS5A 2QL9B 2HBZB 3I56S 1VRUB 3BGRB 4Y2YA 4FKXA 1JLCB 4ERDA 4H4OB 3OVSA 3NTUA 2XNQA 3LOUA 3HD2A 3DGPA 1VC5A 1MMDA 4CYUB 3GLJA 2P6TA 2DRDA 3Q23A 4LZGA 3QE9Y 2HFZA 5KFCA 3C28A 4PDBA 2EW9A 3ZD9A 1N54B 4NLPA 2AJ2A 4DOAA 3R5HA 2V2ZA 4UCUA 5A2QY 3RB3A 4FS2A 1Q82T 4Q8EA 3O2IA 1NUEA 1SC3B 3I1YA 4NMLA 1H73A 1ZRNA 3HM7A 4NCGB 1IN0A 5KL1B 3BN4A 2YMLA 1FWKA 1M6VA 1D3WA 2FB9A 1WH2A 1O5JA 2BB0A 2E44A 1TV6B 4ED2A 2EKNA 2Z2YB 3C2MA 2ZUDA 3AD9C 2E2IA 3M2UA 4F8RA 2EFOA 1UBPC 4XA5A 4OD0A 5HVFA 2JXJA 5HLFB 1GMWD 4CWBA 4R7RA 1NMEB 2R7UA 4FBTA 2FLNA 3HI9A 1FWPA 3QU5A 3CWJA 2AWZA 4MIWA 4K5SA 2RU3A 3D2QA 3T1HF 1C4CA 2DKOB 2OM6A 2XSFA 5KFTA 2Q1LA 5C42B 3DI6B 1JN3A 2WB4A 1YJNS 4P7VA 3GFYA 2GO7A 1T02A 2BPGA 4A4JA 2H3EB 1VDHA 5CYJA 1XBWA 3MCMA 4CTAB 4URQU 4OI1A 3F53A 3D3CJ 4M5LA 4FXWA 1U0HA 5AM3A 4LVOP 8ICLA 2YZGA 1CG2A 2PVPA 1ZHSA 2KSOB 2HWTA 3OTOJ 4UFZA 2JZBA 1L6NA 1ZTTA 3EWAA 1OWXA 3ZZYA 3GTKA 1WWHA 3BDEA 2KMDA 4A3FG 2PA3A 1CPZA 4J7CA 3O7UA 2IDEA 2VDIA 2NRWA 1FO4A 4X4RA 1RTJB 3THPA 4UZCA 4ANDA 3PY8A 4WPAA 4M9GA 2IDLA 3LGMA 3KLEB 1WC1A 2DY9A 3PW2A 2GAHC 1I5OB 5LSRA 1WSVA 2PGCA 1R89A 2ERRA 4KLJA 4CH0S 2HPUA 3RUBL 1FKOB 3HDSA 4J9PA 3MMAB 3AL0B 2F8HA 5DLFA 4F67A 2CPHA 3V4SA 4OX8A 4U8VA 4TQRA 3HHNB 2JEJA 1S6PB 3KYLA 1OSDA 3U1MA 5D15A 2XS5A 3OT9A 3M30A 4OZ1A 2YWKA 3GE9A 1G7CB 4ZVRB 4R85A 1FTRA 2WCXA 2LXIA 4TYBA 3CC7S 2FMSA 1S5LU 4PUOA 2NU9B 3G4SS 4NXNJ 5CB1A 4MK7A 4ZCIA 1Z4UA 2YCHA 5AM1A 1W96A 3DNCA 3U7JA 3RB4A 1XNRH 4UB4A 2M2BA 2GVZB 2CN1A 4DL2A 2ESEA 5B0AA 5LXXA 3UN2A 4C8KA 2MUTB 4LFBF 9ICNA 1VISA 2G07A 2YB4A 1D8LA 2EBGA 1LWXA 2KVSA 4C0ZA 1WKJA 2Z00A 1RB0A 1V9PA 4P0PB 1O03A 1Z00A 2QLXA 2GSEA 3FEYB 2J5AA 3I31A 1U09A 1TL3B 1RT7B 1K6WA 3LYSA 5KOWA 1NFGA 4EUVA 3V6JA 4NYPA 1JJ2R 5IT9W 1YBQA 4MHVA 1YBUA 2LDIA 3LALA 1L7OA 3PVXA 1TL7A 4OIXA 4EBEA 4J90A 3CJ0A 5L1LA 1BWVA 4KYZA 3N28A 4Q5VA 3F5AA 2GHVC 5IM0B 1LFPA 5K8PA 1V3ZA 3UD5A 1IXRA 4EZ9A 2Y8WA 3QGKC 3T8LA 4W92B 3UI3A 2BGWA 2GIRA 2PKEA 1WJ9A 3RRKA 3ZNJ1 3FGVA 1ZETA 4UB5A 1RAKA 3I4PA 2R4FA 5GAEI 2LYVA 3ISND 3C14A 3VGVA 3MD3A 1ZD5A 2WF9A 2HBJA 3AJDA 4NEYA 4D3HA 4O2AF 2CQ1A 1TKXA 2W24A 1DTTB 3NG8A 1PILA 3DRXA 1YITS 4RNFA 3W2WB 2FMPA 3Q8PB 4A8EA 1YX2A 2XMWA 1TKDA 3PZPA 1U1RA 1UC8A 1RISA 4WK3A 4YAJB 3VAHA 2OJ3A 2DBYA 1GX5A 4WIQA 4JI6H 2IYGA 2HLUA 3MGJA 3J7AK 1QY7A 2RQ5A 8ICTA 3H0GG 4DUYJ 2VC1A 4DF8A 2F77X 3P4UB 3PN1A 1XR5A 3UN3A 4J5OA 3ED5A 4X64F 3K5OA 1CS4A 1K1QA 3RAXA 2AGOA 1X4BA 4GFJA 1SUQA 4C97A 4FZVA 2CQYA 1FESA 1XK8A 2M88A 3UXNA 3ZTOA 4PHEA 2D3ZA 3V81A 4MAKA 3CJ8A 3TQEA 3SFWA 4LJXA 2EANA 1L3SA 4F04B 3K3PA 3TUIC 5ALEA 1CJTB 1YG0A 3LGNA 2W2PP 7ICQA 5LMNJ 3E01A 2LQ5A 3OTDA 3QAUA 3UDCA 1FWJC 1IE7C 1SCJB 8ICQA 2PN1A 4ED4A 3QIPB 1ONWA 2F8EX 1ZJMA 4B3SJ 3QO9A 4EX6A 4DPTA 3KHRA 1IBKF 3P96A 1OMSA 1UPHA 1LNQA 1IBMH 2W3RA 2I1QA 2C2OB 3HILA 3HVRA 2DNZA 5ALRA 1R0AB 1RT2A 2B5JA 3KMSA 1V38A 5IYZF 3VCDA 2DT9A 2G0AA 3MM7A 2JV3A 3QUBA 1SVDA 2CWXA 1IBKH 1TV9A 5A76A 3IRXB 3QPIA 1N33J 4I2QA 1EJXC 1AQ6A 3MR5A 1PSDA 3F73A 3ILLA 2BDPA 4J9OA 1Q3VA 1AXQA 3WK4A 2ZBQA 1VLBA 1N32J 1WTFA 1BGXT 4DPUA 3R5GA 4QZEA 1ZBTA 2R92G 5DM6Q 5HMFA 4B3MJ 2R7KA 4KFBB 4DU8A 1QSSA 2ZJQQ 1BQMB 1ZM3A 2UZ9A 3CD6S 3OJUA 1KOOA 4NMXA 4RW8B 5BJRA 4NXMJ 2J6SA 4IFYA 4USKA 2YQ1A 1TP7A 2F9JA 4S0MA 4U8YA 4HACB 4F5PA 1KLMA 3J81Y 2JVRA 3NASA 5KFGA 4DR5J 2R7LA 3NS6A 2VJUA 4DS5A 2OGUA 4KRWA 2HRYA 1JKHB 3DYAA 4ANCA 2ZIUB 2OMLA 1X31C 3GWCA 5FP0A 3M32B 4IWXA 3M1VB 2QV6A 1SXLA 1NI3A 3HMJG 4OJLA 1N5VA 4V1Ak 1C1BA 2FYXA 1R0CB 3D1OA 3LAMA 5HBRB 4JI3F 1JI7A 1XJWB 5LYJF 2Q3PA 2F1JA 3Q8SB 4IHJF 4M9JA 4BXXG 4DL5A 2VD3A 5E0OA 4AD6A 2CPJA 1TVRA 2CJQA 3L3FX 1FRMA 1YBTA 1RK5A 1P1MA 2UUBJ 1RQLA 4ZVOB 2VFVA 3SSQA 4Q44A 2ZZTA 5HVGA 5HMZA 4RB1A 3TWZA 4PABA 4WCEQ 1X5TA 2DKXA 3AAWB 4F4XA 1VCTA 1VIOA 3HPAA 2EI5A 3ZFVA 1WD6A 1ZQVA 2VDHA 1XERA 3CB4A 1SGGA 1D0EA 3B82A 3OFEA 1J2VA 2YKOA 1EP4B 4ZITA 2JFDA 3LUYA 3DLKA 3D6JA 4APMA 3LSBA 1IR0A 1KSPA 2OPQA 4ZLLA 3QZ8A 4Z6DA 3IGVA 1UFKA 1IBCB 2WONB 2J9CA 5LP6F 1NSKL 5MAOA 1MN9A 3ICLA 3FBBA 2LCWA 1PYSB 3C21A 3BBCA 2WF8A 1GXUA 3Q86A 1G6BA 2CXEA 4ES3A 4UZBA 4LSZB 1U26A 1RT5B 2CJYB 5F9NA 2HIYA 4MA0A 4BUGA 4DFDA 1YBAA 3K2YA 1RCOB 2DXFA 1BPXA 3BS5A 1N6QB 3KUHA 1SBRA 3G77A 4EI2A 1LWEA 3GJRB 3H5SA 2MQLA 3JS9A 3KJNB 3GYGA 2MKCA 1NJIT 3PKMA 3V6HA 5D4BA 4USUA 2OPRA 3HFKA 3LA0A 1F0MA 4U7UD 4K4IA 3MCOA 1ZQLA 2YQEA 1FKPB 2WHOA 1HWUA 2EG2A 4Y2CA 2H4YB 4RQ6A 3DHWC 5DG8A 2V58A 4DR1J 5I4MA 4PAAA 4PQUA 2IP4A 4O3OA 4DR2F 2IIHA 3BKTA 4O4GB 3H2VE 1S97A 2B4PA 1L3TA 1RK6A 3KTMA 3MMCA 4JUZA 1T3NA 1TL1A 1LKZA 1S1UB 5ALPA 4JI1F 1X4HA 2YB1A 3E58A 3QATA 1DARA 3H8YA 8ICOA 4G1QB 4EFAC 1ZQIA 3BGUA 2RRNA 4LVSA 4C48A 2GO9A 5D4PA 4XDDA 2EXUA 3KG1A 2R9LA 3SMZA 3EX7B 4B9NA 3HRDD 2K8GA 2Z2ZA 1S0NA 2VQEJ 4ZI7F 5KFZA 1PAEX 4OV6A 4NL5A 5M2RA 1ZM4A 3ETRA 3KFWX 1SJ1A 5ALIA 4A48A 4R88A 1JXEA 2LYBA 3BYPA 2LM1A 3DU6A 2W11A 5EE0A 2V6AA 2RS8A 1BQXA 2A3VA 3RF2A 4X4UA 4M94A 4IQXA 4Y2JA 4FU0A 2I5HA 4KAIA 1Y1WA 2QT7A 3TA2A 4OCZA 3M1YA 2V8VA 3DXBA 5DB6A 1UW9A 3D1QA 3BAAA 5J8YA 1T8EA 4EELA 4E98A 3H8MA 3HHLC 1VQ4S 3NNAA 1SB6A 2VPYB 2ZUBA 4YN3B 2YWWA 3CO9A 4PZVA 1XMBA 2KEYA 4OZ3A 1Y5NB 3R7BB 4A3JG 2A1JA 2XYGB 3HFVA 4X4TA 4Q45A 3VWSA 1EJWC 4DV4F 2Y1LB 5KFLA 1QCKA 1E9YB 1SPBP 2C3PA 2LM4A 1SJRA 2J76E 2MLXA 2E8NA 2CQDA 3DRYA 1KBRA 5AJ3F 3PX6A 5J2AA 2VA3A 4ZVTB 2HVRA 4CLUA 5SUHA 3QT7A 1KP6A 4OYXA 1EZZB 2GMLA 5GTHU 2GMHA 2HBQB 3MMCB 3RN6A 3G8QA 2RKIB 1Y5LB 1IQZA 3C6UA 2DLNA 5AXLA 5HMMA 1WOPA 2ZG6A 2YWHA 2DWCA 2W43A 1M5OC 2FMQA 3P6YC 1SH3A 2W9BB 2BV3A 1PUZA 2BYCA 4ED8A 1A5NC 3FSYA 2C3UA 3DV9A 2DO0A 4B9UA 3M8YA 5KG6A 3SFUA 5LMNH 2DVIA 3K5HA 4X66F 3RU0A 1DV1A 1B4FA 2WZ1A 4P71A 1N62A 3THVA 2FLPA 3H25A 2VKQA 3EJMA 1B33N 2A10A 4B3SH 2JJ4D 3PX4A 4L3NA 2R8GA 1BVSA 4MA5A 3WQPA 1HNXF 1LW0B 2YMMA 4ES1A 2OIHA 3H0MB 2YU9A 5LJ3Y 4NM2A 7ICSA 2NO4A 1U6ZA 2WF6A 1YJVA 2L48A 1JIHA 1PJ6A 3OBIA 4ELTA 2B4OA 4FZMA 2C2ZB 3Q8YA 2EAMA 1HNXH 5KT6A 4FYDA 3RJMB 1N32F 2E7XA 4F3OA 1N33H 5HANA 3WKCA 5JUMA 1NPKA 5J2QA 1TWGA 2OEKA 3ILIA 1RDRA 1YJUA 4HNUA 3IMQJ 1ZZNA 1TE2A 1G3OA 3OV7A 4LMZA 2E1PA 2CQGA 2OTJS 1N32H 3SDEB 1E4GT 3JAMW 4JI5J 4HLBA 4B3MH 4RQ3A 1B7YB 4L75A 4NL9C 5ALMA 1T3OA 8ICYA 4NLBA 2EVZA 5IFMA 4RW6A 5AM5A 3HCXA 2HMXA 2MQOA 2BJ1A 4DV0J 3B6BA 3SCLE 4BWSC 3OTCA 3ZZRA 2HEKA 5BOMA 5CRXA 2ZJTA 1NK0A 4OMFG 3NOCA 4TV9F 1XO1A 2LKZA 5ETQA 1HBNB 1P6TA 1QE1A 1S9EB 4FF1A 4MYUA 4X5VA 4MIBA 1SFOA 4DR5H 1IKXA 3QNWB 2LEPA 3EGZA 1CJKA 1UVIA 5ETKA 5FIIA 4EEQA 3H0GA 1NSQA 4JK1A 3DOKB 1JLAA 4B3OB 1JALA 2ZNZA 1QAYA 5FD6A 4DR6F 4FNHA 1IKWB 3M6WA 3AOAA 3LWLA 3C6UB 2WE6A 2VJ5A 2XCPA 4GY7A 8ICKA 4ICLB 3F41A 3MR6A 3VCBA 3KJFB 1ZTWA 2UUBH 3JTOA 3R1LA 1I6JA 5AKZA 5KG2A 1M5KC 3MPYA 2L3MA 4BS2A 2VFUA 2BZ2A 5IQQA 1X4AA 2LEBA 1ZQZA 4YB5A 4C5CA 3JSRA 1OW5A 3M9MB 3P45B 2YPYA 1S3TC 3V4ZA 1ZQJA 4EEKA 3IM1A 4J91A 5F0WA 2HNDA 2MKSA 2YKMB 3D28A 2KRRA 2G13A 3W64A 1DOQA 1DHMA 4HT7A 5L8RC 3G82B 2FE9A 2ZJAA 3JQJA 3TUPA 1WG8A 1KJJA 1NK7A 1KFDA 1ZQTA 2DGZA 3BQTA 3X1LB 5E33A 1RHQB 4KLFA 2GVDA 3HD1A 2V0NA 1LV5A 2HZVA 3T5JA 4DV7F 2YX7A 3CW2C 2VODA 2OD6A 2DPJA 5G4DA 2Y3YA 3UMCA 3JAMU 2H4WB 1RTDA 2W9CB 2ZM6F 4ALZA 4DV7H 2CG8A 4DUZJ 5KG3A 1HFEL 1DURA 2XMKA 9ICVA 1DK3A 2ROGA 3C6TB 1EHWA 1SC1B 3OLAA 1T9YA 3R5XA 2MZTA 2ZBIA 2KJ5A 3EZUA 2R92A 4DJBA 2R2UA 3D6HB 4CLTA 1ZQHA 1S1WB 4MV8A 1Q3UA 2RQKA 3ONNA 3FCVA 1RT6A 5I3UA 4LF9F 1EUDB 2AT1B 3FBEA 1Q95G 4K4UA 1XIQA 1UJ4A 4KHPJ 2R7TA 2QK4A 2ZH1A 5KT5A 4PWDB 1IKYA 2KHVA 1T94A 2HRUA 1GGOA 2E7WA 1FVIA 2E5HA 4LR7A 1MWQA 4DR1H 3H0LB 1S6QA 3GTQA 1REGX 2FY8A 3FCHA 3PDNA 4LH8A 4ER8A 2MXYA 2LPEA 3TEGA 5DRKA 2EBEA 2V68A 4B9SA 5DLGA 3G6ES 1VIXA 5BPFA 2XCAA 3DU5A 5HR7A 2LXFA 3TJAA 1U4BA 1S77D 3S6EA 3F2DA 4OYWA 3GTLA 1Y1VG 1A9XA 2WVFA 2Y0BB 5DB7A 4KV8A 3GIIA 1HBUA 1WOOA 2DKZA 1V97A 4NV0A 2HG4A 2F63A 5J0TA 3GU3A 3HOVG 1ZQGA 2E5LF 5KFVA 3NKYA 3MM6A 4GVBB 1ZM9A 2XLIA 3I0SA 3T5HA 2GCFA 1UA0A 2VQEH 2WOMA 9ICCA 2YNIA 3NP5A 3IS9A 2UUCF 3UD4P 1DIKA 2BE9B 5KT7A 1YDLA 5KFPA 2V4QA 2V5HG 4PEOA 4RW7B 1X5OA 1CC7A 5KTQA 4I28A 4C11B 3AYHB 2RF4A 4ZCLA 4ZDNA 5CYQB 1XEZA 5FSDC 5CA1F 1BQNA 5BYSA 3CCUS 4M5KA 4DV3F 3J7A1 1N56A 3ETMA 4JV2A 1DQ8A 3OPKA 1FVQA 3HZGA 3W9JA 5D0GA 1GFWB 4LF7F 3VPCA 2XI9A 1VGYA 1S1XA 4NJ8A 2BACA 4DZDA 4LF7H 2KU7A 2CJAA 2PD1A 4DZHA 5KAIU 3A0BU 3OFHA 2MZSA 5L39A 2BANB 1CI4A 1Y88A 3N6XA 1YHQS 1M90T 2G9OA 2G09A 5AI5A 3WX8A 4PRFA 2X7IA 3CJ5A 4ED3A 5AKGA 2FJWA 2ZE2A 2DITA 1PGZA 1IQTA 1N0VC 1CJVA 3PJXA 1N2XA 3R97A 1DV2A 2BRKA 1UETA 4K8RA 3L3CA 4IOBA 1ZQOA 4GKJJ 1ACMB 2X0SA 3MECA 5ETSA 3D2SA 3QUCA 4C4SA 2DHSA 2XLKA 4Y65A 1HWKA 2FE3A 3PMLA 4USJC 2HW3A 5AE2A 2YWFA 5D8DA 4YHHJ 4USHA 1VKZA 2LYHA 3BREA 1OWTA 4JI7F 3C15B 3P5TL 4D3GA 3O6QA 2PFOA 2MRLA 3OOQA 2ZVIA 4A3BG 3RJJA 1VK8A 4I2PA 2QL7B 2CVEA 3KFUF 5LL6d 4OV1A 3TANA 1S79A 2IAJB 1RPLA 2BPCA 2MPUA 5J2JA 4KV8B 3C5GA 1T9UA 4YDDB 2NXEA 3QUTA 2KD1A 1LWCB 3QSIA 3SENA 6AT1B 4E2FB 7ICVA 4ED0A 3GG0A 2QFIA 2NZ4A 1B0PA 1E4EB 2U1AA 4ZP8A 4LIRA 1T05B 4V1XA 3WKDA 5ETOA 1QTNB 3R5FA 2RRDA 3QEBZ 1F2HA 2VG5B 3OUZA 5AE3A 2JA7G 4MJKA 2ZJ8A 4DPWA 3MM5B 3H40A 4LFAJ 2XMTA 3CD0A 3NVZA 3I6PA 1N36F 4IG3A 4O3RA 8ICVA 4Y2SA 3T41A 4ZA1A 1VBYA 1ULRA 3H5UA 3A8JA 4FF4A 2PSZA 3H8SA 2XBPA 4X62F 1HBOB 5AXNA 2J0WA 3W7BA 2RE1A 4I50F 2BBEA 1RT1B 3JPNA 3KXYT 4RQNA 3AD7C 5FLXU 2P9EA 1C1CA 4J9LA 4CZCA 4PG5A 4JI5H 1X60A 4AQLA 4Y2IA 4HKQA 3DN9A 1LVHA 2P0AA 4RUCA 3CCJS 3IR6B 2CNOB 4CO3A 1NJWA 3TIIA 2XC9A 2HGLA 3C2PA 4HVZA 2MKJA 3KLGA 1KONA 2G2OA 4DV0H 1VQOS 1FK9A 3CCSS 4TU8A 1X66A 4I68A 3T3FA 1POKA 1F2GA 1VOMA 2D3O1 4UTGA 3KKAA 3FEZA 4C4TA 2N4CA 3HBLA 4EZ6A 4FPIA 5C24A 4I55F 3UCUP 2OPSA 5G0RB 3KJVA 4DXLA 1IKVB 2LDYA 3KAJA 2POKA 2C2EA 2JRSA 3ISNC 2UV8G 1WI6A 1C0UA 2W6MA 2D9OA 1Z2NX 2DFLA 5CH7B 3TRGA 2HYIB 2V9KA 4NRUA 1PBAA 2DGSA 3KBBA 3PEJA 1S99A 2HNYB 5F8LA 1GXTA 1SJFA 2DNQA 3I82A 2KFYA 2QGFB 4ZJLA 3NVWA 4DQRA 1GX6A 2JZ5A 3AH6A 3CDEA 4CF3A 3CDAA 2W70A 4K4WA 5DB8A 5ALVA 2IC3A 5ADZA 2R7ZG 4LQ9A 4CO5A 5HP1B 2HHHJ 3TADA 4USVA 1HNVB 3M4XA 1R3NA 1HIYA 4YDXA 3BF4A 2C2NA 3H7HB 1ULZA 4M5NA 3TZZA 1CSJA 3LQVA 3Q2SC 2DR9A 3MM9B 2XIDA 1AZSB 5GMKa 4O2BF 3EPIA 3NMRA 1QQ6A 5K4LA 3OR2A 5A8RA 2W54A 3MWMA 4I4TF 2HQDA 2MZJA 4UOCA 2CW7A 5JTIA 5JU5A 1UPPA 3NGKA 4NZ0A 4L74A 4DU7A 3M6KA 1AYEA 1JLGB 3K8VA 3BO2A 4J37A 4KLHA 1URRA 2YKNB 5H9EJ 1RWMB 2HHXA 3SEIA 2Q09A 3R5CA 5B08A 4WJ3B 1U7LA 2HRTA 4DUZH 2WB1F 2BX6A 3BQ2A 3CCVS 1FFVA 1H74A 2BOAA 2JGAA 4RW4A 2WB1D 2G2YA 1ZAXA 2IMOA 2PDAA 5EX0A 2GW8A 4KQNA 3HOUG 1KL9A 4DG1A 5DBAA 4I2EA 5A8KA 2MSNA 2OFHX 3HVTB 1L7NA 4HNVA 1DQ9A 5KOXA 4KHPH 2W4PA 4OL8A 2KKVA 1VLOA 4Y2TA 4IUFA 3IWXA 3R7NB 1WC5A 2IY5B 2BXJA 4MK9A 3KJVB 1NZAA 3R9KA 2V67A 1N5SA 3DRRA 5EWEA 4RDVA 2F8MA 3HXLA 1RWPB 1JLEB 3NEKA 2CNKB 4FN5A 1VFJA 3VZIA 3JAMY 2CNNB 4KO0A 1HW8A 4EO8A 2R7OA 4MKVA 3JPQA 1IWGA 4DN9A 4F3MA 3DF7A 3GTMA 3BKFA 5ALJA 3H4BA 1ZQYA 4ZOLF 2UUAJ 2IC3B 3GP9A 3EPGA 1J27A 4O9MA 3GYNA 1VR6A 2DQNB 4RBTA 2Z0GA 1NK9A 5H2FU 5CR0A 1H3DA 1S6UA 1FKAF 4OX9J 1F5CA 3IM9A 2RRAA 2YKAA 2NSBA 3R6GB 3RF9A 1UWBA 1RCXB 4EPBC 1IBLJ 2ASLA 3RGZA 3MBYA 4HDGA 2I9GA 1KQKA 4OZ5A 4JB3A 4X65J 4OFZA 3LP1A 4Z7CA 3SV3A 4FVCA 2ZDQA 3ITHA 2CG4A 4MKAA 2EWHA 1L2ZA 2MGZB 1KJQA 4IH6A 4J9RA 4QJFA 3SR6A 2YZMA 3LNPA 5EHHA 4CQCA 2GJIA 4I64A 2ZHBA 1AB8A 2UU9J 3K5IA 3PYDA 5GAGI 2IVYA 1LW2A 3PIOQ 1QSLA 1PX2A 4YJ3F 1WG5A 1VQYA 4LBIA 4KHRA 3UE2A 4UASA 3ZC4A 2MY7A 8ATCB 3UFCX 4DV6F 1RTHB 5C25A 2XMJA 1V3SA 2X1AA 4IFVA 1RG6A 3BJYA 1U02A 5HMLA 4WD3A 4LIWA 5ALXA 9ATCB 2AD9A 3M9OB 2VOPA 1WDDA 4DV6H 5FSEC 1VS3A 1RLDA 4UUXA 5IIOA 4ZVSB 4KGZB 2YW2A 3W5XA 3Q0AA 2JEFA 2I5JB 2NCKL 9ICWA 3GJTB 4DSFA 2V2QA 2H3QA 4J03A 3ZTSA 4OJ1A 2XEXA 1LWFA 3OL7A 3EVWA 3GMGA 4DL7A 2QE5A 3JSYA 3SAFA 2QARB 3O1LA 3Q2TC 1ELOA 5H1SV 3GIDA 2W04A 1B43A 4ZN1A 4GKJH 3TEHB 2DHGA 2W4DA 1BY9A 5JVDF 3HXMA 2HSEB 2V63A 1HR0J 2OEHA 4OYPA 3CCLS 4LFCF 2FZCB 1A0IA 2FPKA 3N79A 4DQSA 3MMBA 4MV3A 2B4UA 2A6MA 4YHHH 4NASA 2DBBA 3I96A 2BM1A 5EE9A 7FD1A 3BGLA 4WFYA 3ISCA 3RR7A 3WC0A 1HNZJ 3L09A 4HH1A 1N5QA 2C22A 4URGA 4NYZA 1F3VA 1RXWA 2VPWB 4PGQA 2NRZA 4LF8F 3AU6A 4YXJA 2QMUB 2EFNA 4PGXA 3T9ZA 3DRPB 2J6UA 1Q79A 1YJWS 1S72S 1NOMA 5AKEA 4DCOB 2SXLA 4QWDA 3LMLA 4USTA 5E3AA 2IFXA 1UZHA 1UWBB 2RDJA 4ECUA 2Z8QA 1FRJA 2FK1A 3LP1B 1WHYA 3LP8A 4LRFA 1KRBC 3F2BA 2FHOB 1EQMA 4OI3A 2FVRA 4RQ5A 2HWHA 5CAAA 4I6AA 2B0CA 2WAQC 2ZOGA 4UB2A 8ICPA 1K1SA 2Y0SF 2WAQA 2LBOA 3I0RA 1T3QA 2ATCB 3MJFA 4LRAA 3RAMA 2RF2A 2FHMA 1RAOA 3MPGA 2Z2MA 2Y0SD 3CMAS 3OTQA 5H9FK 3C23A 1RGVA 3K89A 4B3RF 1EETA 3LWMA 4KLSA 1RAJA 2HLTA 4Y2PA 2FY1A 2BHNA 2DNLA 4AE5A 3PIPQ 4NX9A 1WELA 4NLUA 3M6UA 4ZJQA 3OL8A 3I5CA 3IXQA 4W4MA 2VJVA 4GOAA 1TA8A 5J0YA 2DYAA 2OXOA 2IRUA 2NRVA 4QZ8A 5ALSA 2ZEJA 3B9JA 2F7VA 4C6AA 2YZNA 2N3LA 4JI2J 1UT5A 4PPZA 3D2NA 4JI8F 3W66A 2IMRA 4PPDA 3GIKA 3BB5A 1S48A 4ZK7M 2AF6A 4DR7F 3BGOP 2JH7A 5F8JA 1RYRA 2ZOFA 4NLZA 2AJ4A 5L1MA 5HQLA 2FPHX 3W9HA 5SZTA 1E4FT 3MAHA 4JI8H 4C0HA 3KUEA 4XPCA 4PHAA 4ZLPA 3DLGB 1JJ4A 2J8AA 3KK1B 2BRLA 3Q8VA 4M5DB 1RT3A 2KAUC 1IJFB 2J0XA 2CJKA 4CC5A 2HHUA 2UBPC 3WIVA 3MGIA 5B0FA 3EYYA 5C8YF 5HMYA 2HHHH 3PW5A 3K1ZA 2WAQE 4ED6A 5ALGA 2ACYA 2FKLA 4CH1A 7ICNA 2CNLB 3L2PA 3VF0B 1KQQA 3QGHA 1WACA 3CP8A 3IBFB 5KG5A 4R0JA 2CDRB 4CM2A 1DXSA 4NRTA 4P9SA 5BYQA 2IOHA 4HDHA 1HYSA 5T7LB 3WK6A 4OJPA 3Q1KA 4HEA9 2ZJ5A 1OQ3A 2AYGA 1JNZB 1GMVA 2QYGA 2I8EA 3IG1A 7ICLA 1FEEA 4B9TA 4PXBA 1H2UX 4I2JA 1EQ0A 4YUDA 2CQIA 2RDIA 2AU0A 2JA7A 3SAHA 2KL8A 1VHFA 2ISOA 3R1HA 4MF2A 2WVEA 3TA1A 2BE2A 3UVJA 4WGXA 3VPDA 6FD1A 3GONA 1SV5A 1FTCA 3CO0P 4KLDA 3OD2A 1RU1A 3GV5B 5GADU 4IRCA 3JSBA 4IG0A 2RF2B 3SQGB 1G2EA 1FFSB 2IJNA 1C0TA 4KN7A 1HQEB 4O4HF 3AA9A 1IUJA 4AC7C 2ATLA 1QD1A 4PYDA 5HAOA 2YN4A 3RYLA 3RJ0A 1N5YB 3KK2A 3E74A 1DTQA 2GIFA 2LP4A 1KJ9A 1VQMS 3EGVA 4QYRA 3T19A 3KLFA 2ZHOA 1A5MC 3D0HE 3TAMA 4B17A 5DDMA 1Q7YT 3FAHA 1NSPA 4US8A 4UBPC 4GXIA 3NCQA 2I38A 2X3DA 4FYXB 3DOLA 1KTVA 4ECQA 2MHNA 4C5ZA 4A47A 1T9WA 1UEVA 3BN7A 4ID8A 1RJPA 3LTOA 1F3FA 1ZJNA 2UV8A 4QIWD 1XR7A 5B0DA 2EK1A 3CVZA 1NKEA 2UVWA 1SH0A 2VPZB 2H48B 4BC9A 4IQUA 4LSNA 1UW4A 4NWBA 4I7FA 2YY6A 3G9CA 1V5IB 5JRTA 5HK4A 1XU4A 3IP4B 2UXBF 8ICHA 2GQQA 1S0OA 1VMBA 1RTZA 4IYQA 1SV0C 4GRSA 2MAXA 4RPZA 4F26A 3GV8B 5AHXA 4CRJA 2NRXA 2ZIVB 4P6QA 2R7ZA 3W62A 5IC4B 4JI0J 2DWQA 4ID5A 5DDQC 3NUQA 5E41A 2Q43A 1HUZA 4FZNA 1VDVA 4GO5X 3NNCA 4OX9H 5FD5A 4TY8A 1RTIA 3CXCR 2XZTB 1UFLA 4R7WA 3HKZC 3QT5A 3TNVA 1FXLA 1ZQMA 2DCLA 2R8JA 1IBLH 3BSNA 3KOAA 3A12A 2A3JA 4X65H 1ZQNA 4LMYA 3CMQA 3M8PB 4V19X 1WEYA 2EH9A 2GFFA 4B3TJ 2KNJA 2DGOA 3IFEA 2JLEA 4IH5A 4IL6U 4UF4A 2UU9H 3O0FA 2MQQA 4MKBA 4EG0A 2AGPA 3G96A 4BY7G 1FXDA 3VGUA 4YY3F 1QH9A 2FD2A 3M8WA 3W65A 1HI0P 5LOVF 4DEZA 4MFCA 1H2TZ 2DY1A 1J5EJ 4QIWA 4PJ0U 9ICUA 1RHKB 2AJ0A 2W57A 1NDPA 4OJ5A 2MY8A 4CLLA 1GKPA 3HSJA 2G2ZA 4ZVUB 2ZIWB 5EE1A 1S1VA 4ZVQB 1C30A 3D3BJ 2IJFA 1OYEA 3G2XA 3JSMB 3O44A 5HJYA 2HSZA 2D6FC 4LSLA 5DKWA 2V2VA 2C00A 7ICPA 1IJEB 2R85A 4R8UA 2HVEA 1F0XA 2YNHA 4OZLA 4CNYA 2CAJA 1UA1A 3C16B 4RB3C 3OR1B 4P75A 4ED5A 5F9LA 2WRMA 1NHKL 2M8HA 5EDWA 1KC7A 1A9NB 2B9XA 3GTGA 2QMXA 3GJQB 4K0KF 1IWAA 2VQFJ 5KFUA 5AI0A 3KUGA 3PTWA 2HGMA 4JWMA 2DCUB 3QX7A 4Z6CA 9ICGA 3UR3C 2M5YA 1R9TA 4X4QA 2I2YA 2PFDA 4M7EA 1FDNA 3NRZA 3UBPC 3HKZE 3NAIA 2HVDA 2BE7D 2K8BB 3HZEA 1VQSA 3BO4A 1B70B 3QLHB 1HNZH 4Q0YA 1RYUA 2RH3A 4C5AA 1WF1A 2NVYA 3CDBA 3OHBA 3DM2A 8ICMA 2CFXA 2XS2A 3TVKA 5AKKA 2YNGB 4X4SA 1YRTA 3SI8A 2HS3A 1AT1B 3DFEA 8ICUA 3JYTB 4USWA 2JHEA 4JWNA 1FA0A 4QPTA 4AQYF 3H42A 2ASDA 4DR3J 3H0RB 4EPEC 2F40A 4OI4A 4FYVB 2ADBA 2FVQA 1AROP 1RI7A 3TACB 4BX9C 2RUGA 2QFJA 2BA9A 2RLTA 2HHVA 1KRCC 3JPTA 2KHQA 1KDNA 3MPUB 4XYMB 2DIVA 1SQGA 1V9OA 1WG1A 4HHUA 4AQYH 5K14A 2R8IA 5KL8B 4UCTA 1U9LA 3TO8A 1K8AT 3AODA 3I32A 2B9EA 3GR1A 2ZIXB 1S1TB 3PCOB 3QGAC 2OSQA 1K0VA 2PE8A 3PO5A 3CT9A 4LF4F 3KALA 2R18A 1QAXA 1ZQPA 1BMQB 1TZ0A 5GONF 3UNYA 3K5NA 5KG1A 2FHJD 3CUNA 4QWCA 5IWAJ 3HM9A 4CC6A 3UQ2A 4NI2B 2MQPA 1ZRMA 5F8IA 1QUPA 4DLKA 4LF4H 4LF6F 4JMUA 1RUSA 4LF2A 5AI9A 4WFAQ 1ROFA 1WHXA 5AKQA 2NO5A 2GZOA 4DV2J 1M0TA 4Q2LA 2RAQA 3CC4S 4RAYA 4FDFA 5GAEU 4YFUA 2DEIA 4PZOA 3KJQB 3FC9A 4R8UB 4YB6A 1YI2S 3NCRA 2R7SA 4ZHRA 3C3LA 3LPEA 1RAHB 4C98A 2XMMA 4DV5F 3CC2S 3TFRA 4EP8C 2QA2A 3QJJA 3KLHA 4F0LA 3VQSA 4X4PA 4UBCA 4GC6A 3SBMA 1Q86T 3MPDA 4JI2H 3PO4A 3GTPA 3TA0A 5BPCA 2GJFA 3KK3B 4DQPA 3HKWA 2ZH8A 1HBMB 3OHAA 4QYZK 4Z6FA 4H54A 3IWNC 3F8NA 3NLCA 4KIRA 5JVGQ 3AQOA 2UP1A 3L4KA 1FO1A 4N47A 1SEIA 1O6XA 4O5EA 4FM9A 5C0YA 5HBMA 3R2DJ 3UPQA 1NLKL 2M0NA 2PT0A 4U67Q 2QLBB 4CH7A 2LU1A 4XUSA 4QW9A 1T03B 2HKEA 4MAMA 3EUB2 4CLKA 1XMQF 2AYBA 4JB8B 4ECXA 2OPPA 1FJGJ 4H4MB 2VFRA 2AJQA 4WU2A 1UNNC 4F91B 1B6SA 2A1AA 2KTQA 4UAUA 4BGDA 4W98A 2ZH4A 2IA0A 3C2KA 5J29A 4RNOA 2VH7A 3R27A 5A0LA 4WU3A 1MNEA 1FFWB 4A8YA 2DNOA 3OTEA 4M9HA 2JH3A 3MEEB 1TQLA 3MABA 2PC6A 2QA4G 3G8SA 1M7JA 1FD2A 2I87A 4OJ3A 2VC0A 3C19A 1WEZA 3RB0A 3V7LA 3NBPB 2B8QA 1LOUA 3H3VH 1VC0A 2UXCJ 1XS9D 2XGQA 2F76X 1KD1T 1X5SA 4ZQIA 4C8MA 5CABA 2A6OA 4MFFA 4YR2A 3P8BB 4PG7A 2KZMA 2B3TB 1XNQJ 4NLDA 3PMNA 4K4YA 1F60B 1HD0A 2ROPA 4ZPAA 3LS9A 2MYFA 2FHKA 3ZI4A 4U7UK 4UQGA 3NRWA 1EJVC 5CYMA 1CJUB 3AJ2A 1S0MA 4UAYA 1M5HA 3MD1A 1N5TA 2PFQA 7ICRA 2GO8A 1TUVA 2ASJA 1R9XA 2O3DA 2D41A 1FRIA 1V5VA 3O3LA 5KFMA 2R8HA 2UVUA 1RXVA 4QZDA 2PLMA 2KP7A 3N43B 3DLBA 1ED1A 1U1OA 5AK6A 4QPXA 1BD6A 2PEBA 3RUPA 4QCLA 2VG6A 1DBDA 2ZBPA 2BM0A 5L9NA 3GILA 3GLKA 1RAEB 2XS7A 1E6YB 4L9XA 2FMAA 3ZZZA 1SI9A 2AQVA 2V4JB 2XO7A 2UXDJ 1EKRA 3JSNA 5HN0A 1Z2OX 3QU2A 1Y3KA 5KFHA 3QRPA 3HJFA 4CEXC 2BQRA 3CCQS 5AIBA 4KITB 1WTBA 2OFGX 4NCBA 4YB1P 2M7SA 2FTRA 3VAMA 3ISDA 5B09A 5J2MB 5E3RA 2N7YA 5C2CA 2HQ3A 3PW4A 3CEDA 4PG4A 1RHJB 1NEEA 4YR0A 3M2VA 3AQPA 5ALUA 1SXEA 4ETZA 3WU2U 2JA8G 2HK3A 2SCUB 2B9YA 1UP1A 1MLAA 3H5XA 1O08A 4JI0H 2NYHA 4G3IA 1JLBA 2GWNA 1DK2A 4ZOSA 4QWEA 3LO3A 3U9TA 1QTMA 2B56A 1XMOJ 5KFKA 2LQ8A 3KOOA 1P7DA 4DMZA 2PFPA 5DB9A 1MROA 1Y10A 2OSRA 1S9GA 2KT2A 2ZH2A 1RAFB 1YTYA 1QVFR 3VAIA 2BJEA 2D3OR 2CDQA 3C1ZA 5FDLA 2C2KB 2CXYA 4O23A 4K4VA 3UQ8A 3F44A 5D8HB 1HMVA 1VQKS 1UT8A 3N7PD 1T9XA 2D3UA 1J2NA 3TW0A 4C8YA 3DC2A 1MW7A 5ETMA 1T7PA 1U6BA 4QZBA 4B9LA 4DLEA 1HJPA 2RRBA 1JX4A 1ONXA 3DRSB 4DL3A 1GXLA 4UOHA 1S6OA 4TVAB 5L1IA 2OD4A 2C42A 4YB8B 1ZXIA 1WDTA 2FPGB 1QUVA 3M8QB 2KM8B 3JPSA 3UXOA 4O3SA 5D1OA 2X1GA 2K7JA 4J9QA 4DSJA 3VV2B 3RV4A 2W6ZA 5L38A 1PC5A 3FC4A 5JQWA 1YRUA 2OH2A 2HGNA 1RT4A 2CWKA 4M9LA 4LQ3A 4LVNP 5G4HC 2RHQB 2GGPA 2QRRA 2V94A 2VANA 4EX7A 2CA9A 2VQFH 2HFVA 2R7VA 4YD2A 4O4LF 4GXKA 1BNCA 3N41B 1KBUA 2DNMA 3OXGA 1NPPA 2VASA 1KTQA 2I9SA 1I94F 1VQNS 2WB1C 3B8HA 2GOLA 2WW8A 2D69A 4F4WA 3WBZA 2P9CA 3WHIA 2K1RA 4Y2XA 3OUYB 2XIGA 3F56A 4OQJA 1WNEA 2MCTA 3D6NA 4O3MA 2CPEA 2EEYA 5D3GB 1I94H 1G1XA 2V8PA 2BUNA 1JROA 1TKTB 4DR4J 4NCAA 4FBUA 1CRXA 8ICNA 3LP0B 3ZTPA 1HNIB 1XO0A 5CWRA 2OHDA 2ALYB 1MZBA 1UEUA 2HMIB 3BPDA 1NZ8A 1B22A 1PIEA 1M1HA 4CQDA 1YNYA 1RA0A 1QSYA 1Y00A 4OI6A 4DR3H 2IVFB 2E3TA 1RAGB 1UVLA 2FVCA 2BKOA 1U2FA 2HK2A 5G5GA 5J2KA 2CPXA 4AL5A 3HHEA 3VVTA 2YNFB 2ZBCA 1SKRA 4IDKB 3H98A 1TWHA 2QG9B 3CVKA 2L08A 3GR0A 2Q2UA 4MT1A 3MPVA 3CCZA 4RWXA 5D4LA 4DHVA 1JK9B 4NLCA 4K4XA 4YN4A 3LP2A 1KKXA 1V3RA 1ZQSA 4ZJOA 2C1EB 2XWYA 3PW0A 4I56A 4TYAA 5C7PA 1CULA 3MAAB 1ZD3A 1TK5A 5IWAH 3B0XA 2E5IA 4MF8A 4WFZA 3POTB 1VHIA 4O44B 4A8QA 2OHFA 2R8KA 2WB1E 1MU2B 3J7AN 1Q46A 1SC4B 2DNPA 5J1EB 1CQMA 4F3QA 4I2BA 4P4MA 4RZRA 2H5EA 2H5JB 2LEAA 3QZ7A 1YLXA 1UEKA 2IPOB 2UUWA 3CNQP 5HQ8A 2CJXB 2KO1A 1WCMG 2B51A 1M0SA 2XY5A 3HSGA 4R5PB 3OXLA 3PYGA 1J5OA 1GTEA 4QQBA 4ZP9A 2WHEA 2HNZA 3S8SA 3CJKA 1EXNA 4QR1A 3M6VA 2KVCA 3SIPB 3B4DA 1KKHA 1VQ9S 1F9FA 1N5WA 2LMRA 2FC8A 1L8OA 3DGPB 3SYZA 4DBQA 5K8OA 2A19A 4YR3A 3D4JA 1PVPA 2A2DA 4CLYA 1TKZA 1PJ7A 3ZTRA 1I3QA 5E3QA 2NLWA 4M6WA 1TAUA 3ETLA 4Q0BA 1BPYA 5DQHA 2J7KA 1UFWA 4JI4J 3D6FB 1XNRF 3QIDA 3UN5A 4DWIA 1FJGH 2BDUA 3TAPA 2YX4A 5K5MA 2YH0A 2YQ3A 3UMBA 1DY3A 3T9NA 2YMQA 5I3PA 4X4VA 1GEHA 1PVRA 3U27A 3N42B 3L4JA 1RXOB 2W2NP 4M63A 5KG0A 4LBHA 2VPXB 1OY9A 2HURA 4DV1F 1FJ7A 3TAQA 3M2UB 3MDCA 1RWVB 3UM9A 1JB0C 2G0IA 1AW0A 2YL2A 4KLEA 3FSXA 2Z30B 5BR8J 2J0QD 3W5ZA 4DV1H 3G6XA 1U0SA 4EWTA 1ZQXA 2UXCH 2EZXA 4OO1J 1UHUA 3QT6A 3MTWA 2V5AA 3U26A 5AKIA 2ZVSA 2DRBA 1TUGB 2XY6A 1GSAA 4EO6A 1XNQH 1QM9A 1S03G 1OSCA 3W2VA 5KFOA 2PMZC 2KG1A 5KFYA