4F4XA

Y-family dna polymerase chimera dbh-dpo4-dpo4 #2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
molecule keywords DNA polymerase IV
total genus 113
structure length 342
sequence length 342
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4xA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f4xA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4xA01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f4xA04
5KFTA 3IS9A 1N4LA 5I3UA 1C1BA 4FBTA 2P66A 5CYMB 1RT3A 1XO1A 1RTIB 3RB0A 4YR0A 7ICMA 4QZ9A 2DFLA 3JYTB 1TL1A 3IM1A 1C2PA 3OL9A 1XR7A 2W8KA 1QAJA 3PW4A 1XS9D 2PI5A 3TAQA 1TK8A 1T94A 5L1KA 1COOA 5KG3A 4ED8A 2YNGA 3MEDA 2FPLA 3KJVB 1NHUA 1NKBA 1BPYA 3C2KA 1N48A 4I28A 4O3SA 2ZD1B 4KKOA 5J0YA 3ZDDA 1HQEB 1REVA 3DYAB 2OWOA 9ICAA 1CSJA 4KFBA 4M6WA 1HNVA 3NMAA 3BREA 4BGDA 3OLBA 8ICEA 1RTDA 3H4BA 4UB3A 1ZQUA 1RT5A 5DBCA 4WFZA 4ID5B 5DDMA 2ZUBA 4TY9A 3OSPA 4KLHA 3MFHA 4Y2CA 1X9MA 4KLMA 4YD1A 1DLOB 1EETA 3DYAA 1DOQA 4IFVA 1IKYB 3JPTA 2J6TA 1ZQIA 2JEJA 2ISOA 1RT3B 3M8PB 2VA3A 5KFUA 4P4PA 4GC7A 9ICFA 4RNMA 3EPIA 1BQNA 1KRPA 4XQ8A 4J9MA 4HKQA 3B0YA 1L3VA 2FLPA 4IH7A 4ECXA 2FVPA 3MEEB 5L9XA 3ZDEA 1QE1B 4B9VA 3DM2B 4QZGA 4O4GA 3T5KA 1L5UA 2HHXA 3NGDA 1TAQA 1JLBA 1TVRA 3BGRB 5I42A 2WRMA 3QO9B 1Y88A 4NLQA 5KG4A 5KG7A 2VA2A 4ECWA 1TKDA 4Y2AA 5BOLA 4RW4A 1JLGA 2BCUA 4ED1A 4XA5A 2UVWA 3LK9A 4O3PA 4KLGA 3PMLA 4QWCA 1L3UA 4DQSA 4ID5A 5F8HA 1EXNA 1TV6A 4PGYA 3I0RB 1RT2A 5HROB 2FLLA 3PR5B 4MFCA 5HP1A 3UQ2A 1ZQBA 3E2EA 3KLVA 4PHAA 4J9LA 1VRUB 4ECUA 1KLNA 2YNHB 4RQ6A 5EWFA 1SL1A 2OPSB 1FKOA 5F8JA 4H4OB 4Q0BB 1S6PA 3UXPA 3G6VA 4KLLA 1TV6B 4NZ0A 1S1UA 1IKXA 4I2QA 7ICRA 2UVRA 2FPKA 5J0TA 2BANA 4KV8A 4DL4A 8ICJA 1S1WA 3AU2A 2XGPA 3RJKA 2D3ZA 1XSPA 2DPIA 4DSLA 4I29A 4DL3A 5IIOA 5KFWA 2HNZA 4DG1A 3GFKB 4F4YA 3OL6A 3IGNA 4FBUA 3C5FA 1SKRA 1S97A 8ICXA 3DLEA 2MUTA 3BGRA 1HPZA 5DB7A 3RBEA 5BPCA 4RNFA 1A77A 2D3UA 4DSEA 1S9EA 2YKMA 4NLZA 3JPRA 2IJNA 2GWSA 3ORYA 1IKXB 1KHVA 1VRTB 3MEDB 5F8GA 2YKNA 4DL6A 2JEIA 4WE1A 5KFQA 3RR7A 3OHBA 1JLEA 4EZ6A 4B3OA 3ZDCA 1TL3A 1TFRA 4ZHRA 4O9MA 2HNZB 5KT6A 4NLPA 4B9MA 2XC9A 2AU0A 2IHNA 4UAWA 4EBCA 1ZQKA 5F8LA 1JMSA 3MABA 3IRXB 4DQQA 4RW8B 3DOKB 4O5EA 3UQSA 2WB4A 1FKOB 4LSNB 1PZNA 4UB1A 4IQTA 4MK8A 4ED0A 1RT4B 4B3OB 3CIZA 4M04A 4K4XA 1JLFB 3TAMB 1TL1B 5DQIA 2ZKUA 2IM2A 1TKTB 4MEYA 4KLFA 3K75D 3GV7B 3BSAA 5C24A 4IRKA 2RKIA 2BCRA 5DG8A 2R8KA 7ICGA 2UUTA 3E01A 2ZTEA 4H4OA 2IM0A 4C8MA 2IAJB 4KO0B 4X5VA 3PO4A 4NM2A 3HHKA 2Q0ZX 5DBAA 3DRRB 3KLFA 4F4KA 3FDSA 3N97B 3IG1B 2AWZA 4CCHA 3CWJA 7ICEA 3ICLA 2YKNB 4R5PA 1RA7A 4C8OA 2W7OA 3QGHA 5HP4A 4DL7A 3I0RA 4O3NA 1DTTA 4DL2A 5KG1A 2R8HA 1ZQCA 2IM1A 4UB5A 4GXJA 1HMVA 1UWBA 1RPLA 2BDPA 1ZQQA 1RXVA 2OPQB 3H59A 5KFVA 4WFXA 1VRUA 1XSNA 9ICUA 2C28A 3MECA 1ZQXA 1HARA 3C6UB 2B43A 4NLYA 1C1BB 4ED2A 1X9WA 1LWEA 4IQUA 4H54A 3EYZA 4MIAA 4QZHA 3RJJA 1MMLA 1LW0B 2HWIA 3IGVA 3SZ2A 1IKYA 5J0OA 1SKSA 1SH0A 1ZQMA 4FS2A 3PV8A 4BWJA 4PHDA 2J6UA 4B9UA 3MBYA 4XUSA 1HMVB 4MK9A 1ZTWA 4B9SA 4F3OA 5DDYA 1ZYQA 4Q8FA 5IIJA 7ICUA 4RQ4A 1U9LA 2JZBA 4IRCA 4F4WA 4DFMA 1IKVA 7ICKA 2ISPA 2E9TA 2PFNA 1KLMA 5J2CA 5J0RA 1SH2A 1UT5A 4I2JA 4I2DA 1RT4A 1X9SA 2C22A 5J2JA 4O44B 4I2BA 3M9NB 4URQU 8ICAA 1EETB 4DWIA 1REVB 4NLDA 1V9PA 3GYNA 3BSCA 2FVCA 2ZUCA 3OL7A 4F5PA 4UBBA 3NAHA 4ZP8A 4PGQA 5I42B 1J5OB 1SL0A 3LDAA 4DL5A 3DOLA 9ICIA 4NXZA 4QZEA 5J2MA 4TURA 2OPSA 3MGIA 2OPPB 2I5JA 4IH5A 5J0WA 1U4BA 4NLWA 2VG6B 4O44A 2HW3A 2HNYB 3PJWA 5HMMA 1MQ3A 1BQMA 5EDWA 1BVSA 3N4MB 1TP7A 1S0VA 5K14A 1SH3A 4I2PB 1B43A 2E9ZA 2BQ3A 2FMPA 3QIDA 5KFZA 4K4UA 4J9SA 4IQWA 2YNFB 3KHGA 4C8KA 4MFBB 1TVRB 4JK1A 4JUZA 2AGQA 5J2IA 1ZQYA 2NRTA 3PVXA 1S6QB 1NJYA 4Z6EA 4B9TA 7ICQA 4I7FA 1S48A 3SI8A 1CUKA 1ZQZA 1S1XB 5HHHA 1WCLA 1JIHA 1NOMA 2AX1A 2HMIB 4J9NA 4TYAA 1TVAA 4R66A 4MF2A 3CDEA 2HHTA 2HHUA 3FFIA 3EW9A 4QWAA 1LB2B 4EBEA 4K4YA 7ICIA 3LP2A 5KG5A 4ECZA 4F2RA 1KFSA 1D9DA 4XRHA 3GDXA 1U48A 4EO6A 2WTFA 3M8QB 4WXOA 4QZFA 2P6UA 2BE2A 1L3SA 3EPGA 1KLMB 4RNNA 7ICPA 1NK0A 1C0UA 3HWTA 3M9MB 3THVA 3ISND 2RDJA 3AUOA 5J2PA 4KE5A 2V4QA 1ZQFA 5J29A 4NLXA 4ZMMA 5J0PA 3MR5A 3IN5A 4YN4A 4QWDA 4ZPAA 3IHQB 1ZQJA 4M9JA 4DSKA 4I2AA 4ECRA 1BPEA 3G86A 3KLEB 4P4MA 2V9WA 1RTDB 5KFAA 8ICNA 1RTHB 1S9EB 1UNNC 4QZAA 4KLEA 4QPXA 1ZQEA 5DG9A 4F93B 4RNHA 3V4IA 2HHQA 4YVZA 4I2PA 1LWFA 1ZQHA 3RB3A 4QZIA 4QZBA 1RT6B 4YMEA 4J9QA 3H5SA 3D5MA 1IXRA 3I0SA 4ZVGA 1RTHA 2WOMB 1TKZA 9ICHA 9ICMA 5JUMA 2E9RX 4O4RA 4WZMA 4F5NA 3C6TB 1FK9B 4M9HA 2ZJAA 3MR6A 1XWLA 4PWDA 3PR4A 3Q8SB 3KMSA 4ZHRB 5HP1B 5F9LA 4ECTA 3DMJA 5KT2A 4DLEA 5DBBA 1S76D 4ECSA 1JLCA 1ZQGA 3RB6A 3MFIA 9ICVA 1UA0A 3JPSA 3HKWA 2IJFA 2JEGA 1HNVB 1K1SA 4M94A 1UT8A 3MR3A 5L1LA 3KOAA 4G1QA 2PFOA 3JSMA 3CJ3A 2BPFA 4O5KA 1WNEA 3UXOA 3UR0A 1RYSA 1RT5B 2YNFA 4JWMA 5KFGA 2HNDA 1JLQB 4FO6A 4O4GB 4TY8A 1MU2A 4EBDA 4KAIA 1HUOA 2AX0A 2OPRB 4MFBA 2XY6A 3CJ5A 4ZP6A 3EZUA 1S1XA 9ICPA 3OJUA 3LP1A 2ZTDA 5IILA 1TKXA 1RT1B 2B5JB 3DLKA 2UVUA 4LSNA 7ICOA 1GX5A 5EWEA 4DFKA 3E51A 4NRUA 1RT7A 5CHGA 2VG5A 3N6LA 8ICRA 8ICLA 4I2CA 3C2LA 1J5OA 4ECVA 9ICBA 1C1CA 3V81A 3C23A 4PHEA 5HLFA 5J1EA 2HAIA 4ED6A 1RZTA 4WXWA 5J2PB 1QAIA 4PQUB 4NY8A 5KFJA 2XCAA 5KFNA 7ICLA 1JLBB 3UQ0A 5FDLB 2VG6A 4DQRA 4F2SA 3Q8MA 3QE9Y 2O5DA 4RQ1A 1KDHA 4Y3CA 5D46A 3DLKB 1LW2B 1SL2A 4KLUA 1TV9A 4RUCA 5D49A 4IRDA 5C42B 5TZVA 4J9KA 5DQHA 1TKTA 5C5JA 3OJSA 1LWCA 1R0AB 2I1QA 5KG2A 1ZTTA 1HJPA 2R2RA 1JLEB 4QZDA 5HBMB 2WK4A 2XWYA 2NRXA 3TARA 4TYBA 3E01B 2KFNA 2XGQA 8ICZA 1RTJA 3HT3A 4F91B 2W7PA 3G6XA 4NLUA 4DF4A 3I0SB 2YKMB 3H5XA 3KJVA 1RTJB 1MSWD 5J2BA 1D8LA 3MGHA 1NK8A 2WONB 1IKVB 3HPOA 3LALA 2BE2B 3DDKA 4DSFA 1RT1A 2B5JA 9ICTA 4RPYA 3FRZA 3ISCA 4QW8A 2Y1JA 5J2HA 4RW6B 1NK5A 4DOAA 1KFTA 4NLOA 1SV5A 2OPRA 3RTVA 4DFPA 1FKPB 3PZPA 4RPXA 1MC8A 4MF8A 3RH6A 1D8YA 2FMQA 5EUHA 1NK9A 1ZQOA 3V7LA 5J2FA 4FS1A 3V72A 4J9RA 3LP0B 9ICSA 3GV8B 4K4SA 3IG1A 4LZDA 3JPPA 5JXSA 1DGSA 3QGIA 3RH5A 1T8EA 1VRTA 4LZGA 3UDLA 5DKWA 4KITB 3ZD9A 5DLGA 5F8NA 5J2GA 3DLEB 5FDLA 4QW9A 3QYYA 4EYIB 4UQGA 3GIJA 4PQUA 2IA6A 4RW4B 4PUOA 2F1HA 5CA7A 4IKAA 2YNHA 3RJHA 3DRRA 3H8JA 2RF2A 2I5JB 3LWMA 2IBKA 2QV6A 2I9GA 3KLGA 8ICIA 5HROA 3FFIB 3DM2A 7ICNA 5K14B 3RBDA 4KBIA 3KHLA 9ICLA 1N5YA 4IH6A 4RW6A 3SFUA 5HLFB 4KLQA 3JYTA 2FJXA 4NLNA 5C25B 3TANA 4TXSA 1Z4UA 3QZ8A 3Q8LA 1LWEB 4F5OA 5KT3A 2VG7B 4X2BA 3D28A 1BPZA 3K4GA 5KFLA 3RH4A 3RJGA 2B6AA 3ISNC 1I6JA 3MEGA 1XU4A 7ICVA 5IIIA 4WZQA 2BCVA 4ZP7A 9ICQA 4P4OA 4IOBA 1HYSB 5IIKA 4DEZA 4RQ3A 3DOLB 2IHMA 2WOMA 1QUVA 4MH8A 1HYSA 3DLGA 3RRHA 4YR3A 2W9AA 4DOBA 2CKWA 8ICGA 1LWCB 2ASLA 5J2DA 4F4ZA 4PWDB 4O3OA 3SFGA 5D3GA 3TFSA 4EZ9A 3V6HA 4DG1B 4BWMA 4KKOB 4R63A 8ICKA 4ELTA 1WCNA 2BQUA 4TUPA 4YMNA 3UXNA 5DGAA 1N6QA 4IFYB 4GC6A 1JX4A 2HVHA 2RKIB 4NLRA 4YP3A 1N6QB 5KT4A 3BQ1A 2D7SA 3PO5A 3LAKA 2ILYA 9ICKA 5KFRA 3PW5A 2V0NA 3JPOA 3OHAA 4F92B 5CR0A 5KT5A 1N56A 1JN3A 3H5UA 9ICXA 4QWEA 1TL3B 2HHSA 1T03B 4URGA 3HVTA 4MFAA 4RT3A 3RB4A 1C0TA 3T1AA 3TVKA 2PFPA 2BHNA 4EYHB 2FJWA 3KLIA 2JC1A 4C8LA 4YXMA 1GX6A 4NLVA 1D9FA 2A1JB 3DRSB 2ZE2B 5J0SA 1QTMA 1EP4A 1S10A 2W9BA 4UB2A 1ZJMA 2R2SA 2RDIA 4IG0A 2MAXA 4DLGA 4RW8A 1ZQDA 2GIQA 3FSIA 1LV5A 5DB9A 3SV4A 1W25A 8ICQA 3V7JA 3MDAA 3H40A 1S1UB 2C2DA 3H8SA 3NAIA 4TY8B 4ELUA 3TAMA 4PHPA 5DGBA 5HNKA 1QSLA 3M9OB 5DLFA 4PUOB 5DG7A 1S1TA 2C2EA 4ZVEA 1XSLA 1ZQTA 2F1JA 1JXEA 3DOKA 3DI6A 5IINA 3KHHA 4O0IA 2WONA 3RAXA 3HVWA 4RQ2A 3PW0A 4DS5A 1U47A 4B9LA 4F5RA 5KFCA 3DRPA 2KFZA 4PGXA 4YR2A 5KTQA 2LYHA 3SYZA 3C1ZA 2W8LA 1SUQB 2KZMA 1TQLA 4DSIA 3BDPA 2WHOA 4JV2A 3MEGB 1T05A 2PFQA 3EZ5A 5J0QA 2BRLA 1NJXA 4KO0A 4IQXA 9ICRA 3BQ2A 5KFMA 4I2GA 2NRWA 4M47A 4IDKA 4R65A 1KEJA 3TQ1A 4M9NA 3HVTB 4Z6DA 2ASJA 9ICGA 3MTKA 1RAJA 5CWRA 5J2NA 2BPCA 2XO7A 1NJWA 2B6AB 5CYMA 4M9LA 2IC3A 3H4DA 5DB8A 3OGUA 3RAQA 1S0OA 2FVQA 3QLHB 4HYKA 1A76A 2ZE2A 4I27A 5C24B 8ICFA 2C2RA 4NRTA 9ICOA 1TKZB 3PX4A 2ZTCA 3ITHA 5KFPA 4R0EA 3BR9A 4U6PA 2Y1IA 1RYRA 4ZPBA 3DI6B 4RW9B 1TK0A 5HMLA 5L1IA 4NCGB 5D3GB 1HQUA 1D0EA 3NKYA 4UBCA 3T5LA 2AQ0A 3N6MA 3GIIA 1N5YB 3Q8PB 7ICTA 8ICCA 3I5BA 4I2QB 3T19A 2ZJ5A 4IFYA 1RT2B 3GQCA 3KK1B 1HUZA 3AU6A 3KLIB 1JLAB 4NLSA 2BCQA 3FYHA 1KTQA 5F8MA 4J9PA 1S9GB 3V6JA 4GXIA 2KTQA 4RPZA 4GLXA 3H5YA 2B21A 4NCGA 4RQ7A 3KLHB 3LP0A 2W9BB 4KTQA 4H4MB 1TK5A 2UVVA 4RW7A 4DOCA 1JKHA 3I5CA 3DRPB 4WYLA 1U09A 3KLGB 1DTQA 4I2EA 4RQ0A 4TQSA 1RDRA 5J2AA 4R5PB 2HWHA 1QSSA 1JXLA 4WYWA 3RJEA 4LQ9A 1BPDA 2H5XA 2AGPA 4R64A 2XY5A 2ATLA 3C21A 8ICBA 4XO0A 5CYQA 3Q8QB 4GXKA 4WE1B 4EEYA 1RXWA 4RT2A 2F8EX 4YFKA 2FVSA 3CJ4A 1LW0A 3HW8A 3QIPB 4KN4A 2IC3B 4ZP9A 2PXIA 5EWGA 1JLQA 1C0TB 3ISDA 2F1IA 2XI2A 2CJQA 3LAMA 3NBPA 3QEBZ 4KHRA 5C25A 4K4ZA 1T4GA 1K1QA 4RUAA 4LQ3A 2D41A 1T05B 2J6SA 4ED3A 3DRSA 4F50A 1S1VB 3UPFA 2ZUDA 4DSJA 2XY7A 2V4RA 2OPPA 4J9OA 2IM3A 2P6RA 1KFDA 2KZZA 3DLGB 2FLNA 4UAYA 4EO8A 4ZPCA 2JZBB 4U7CA 3CDWA 5J2QA 5KFKA 4IR9A 1IM4A 1C7YA 3MEEA 3NBPB 3PW2A 4P2HA 4TUSA 1S4FA 2BRKA 3ZDBA 4LSLA 1ZQRA 2FMSA 1DTTB 1FKPA 1NHVA 4ZVFA 3QO9A 9ICJA 3JPQA 4IG0B 4MFFA 4KSEB 1S0MA 4G3IA 4O3QA 4MIBA 1NKEA 5KFDA 3LWLA 4UAZA 1QSYA 1U49A 1BQMB 4IQVA 3RJIA 1S9FA 4ZPDA 8ICOA 4R8UA 1LW2A 1UWBB 4M2YA 3QIPA 1LWFB 1BPXA 4KLDA 9ICWA 4ICLB 1IKWA 3NL0A 2JEFA 4BDPA 1Z00A 1ZJNA 2HNDB 4YG2A 4YD2A 3T5JA 3I5AA 3KHRA 3PJXA 1ZQLA 3MECB 1SZPA 2MUTB 1HNIA 5HBMA 4KB7A 3TI0A 3H2LA 1TKXB 4DF8A 4NYZA 1NNDA 5KG0A 2ALZA 2HNYA 2AGOA 1S6QA 4I2IA 3BJYA 4KHMA 1S1WB 4TQRA 1S77D 5J2KA 5IIMA 3NTUA 4URSA 2M9NA 5J0XA 8ICWA 3H8WA 3KTQA 5L1JA 2DPJA 1SKWA 1DTQB 1T3NA 2R2UA 4NLGA 3V6KA 4KFBB 4M0AA 4LSLB 1TAUA 3OLAA 4KN7A 3KMQA 5F8IA 4DQIA 8ICUA 3QZ7A 4I2HA 1S0NA 1L3TA 4Y34A 2YNGB 3KK3B 4Q44A 4TN2A 4RW7B 2KN7A 3QLHA 5KT7A 4K4VA 3OL8A 1RT6A 3OSNA 3JPNA 3PW7A 7ICSA 1KSPA 3Q8KA 3C1YA 3KNAA 4ELVA 1OS5A 4WFYA 1S1TB 1NK7A 1HQEA 3PY8A 1JLAA 1S49A 1XR6A 3T3FA 3ZDAA 3RR8A 4K4IA 2BKEA 4DO9A 1S6PB 2PI4A 5KG6A 3MDCA 5I3UB 3G6YA 3KK2A 1ZQSA 1JLFA 1NK4A 4MKAA 5KFHA 2VANA 4YXJA 3V81B 3ZD8A 3FQLA 8ICSA 2VA8A 9ICNA 7ICFA 1NJZA 1NK6A 1RTIA 2R8JA 1AROP 1Z3EB 5KFSA 4RNOA 4KMUA 2ZJ8A 4YQWA 2ASDA 2NRVA 5KFOA 4K4HA 4KLTA 4ECQA 2YNIB 4QZCA 5J2NB 3KLFB 4LVSA 4H4MA 1HQUB 4O3RA 5KFBA 2IMWP 2AJQA 5BOMA 2JLEA 3CJ2A 5J0UA 3HP6A 4DFJA 2BR0A 3GV5B 4RQ8A 4TUQA 4KLJA 1UA1A 2W9MA 3DMJB 3CO9A 4ICLA 2ILZA 3C6UA 5CP2A 1JLCB 3V6DB 2OH2A 1S1VA 4OL8A 4IDKB 3JSMB 4M6WB 5CYQB 2XCPA 4IG3A 3M8QA 4K4WA 4K4GA 9ICCA 1X2IA 1H38A 7ICJA 2FVRA 2YNIA 1ZQNA 1ZETA 5J2QB 2JC0A 4JV1A 1FK9A 3V4IB 2BANB 4KV8B 1MQ2A 1IKWB 1SUQA 4NLKA 4NLTA 8ICHA 3H7IA 3IS9B 2VG5B 3VQSA 2UUWA 3M8PA 2BPGA 3CDUA 3KK1A 4IFVB 4QWBA 2W9CA 8ICTA 3BSNA 3SV3A 4ZH4A 7ICHA 2OPQA 4IG3B 2EC0A 4K50A 1NKCA 1U45A 3RJFA 1JLGB 3GIKA 4F4XA 1ZQPA 3V6DA 4C8NA 3LANA 4RW9A 3BQTA 4BXOB 3B0XA 4I2FA 9ICEA 8ICPA 3MR2A 1BPBA 3FQKA 2R8GA 2XI3A 3TFRA 2I1RA 2NRZA 4YMMA 3GILA 3UPQA 1R0AA 1RA6A 4MEXA 3PX6A 4M9GA 5J1EB 1BQNB 3EWAA 4JWNA 4DS4A 4E0DA 4Q8EA 1EP4B 1S9GA 5EOZA 1HNIB 5J2MB 3H98A 3TAPA 4XPCA 2R2TA 4BXOA 3KK3A 4NM1A 2QE5A 2VG7A 1RT7B 3PX0A 2WCXA 3PHEA 1BGXT 1T03A 5KFYA 5KFEA 5F9NA 4UB4A 2BGWA 1XC9A 4PPXA 3CVKA 2BQRA 4R8UB 1ZQVA 2HHWA 3V7KA 1B22A 1DLOA 4JV0A 3LP2B 5KFIA 3M8SA 5T14A 3PNCA 4F5QA 4RU9A 5KFFA 8ICYA 4Z6FA 5CJ7A 1ZQAA 4Q43A 5DB6A 3M8RA 2GIRA 4K4TA 3BSOA 2AQ4A 4ZVHA 2HHVA 5DQGA 4MKBA 1T7PA 3PMNA 2W9CB 3C2MA 4QZ8A 1KHWA 3HVAA 5HHIA 4RQ5A 1MU2B 2A1JA 1Z00B 5D4BA 1QE1A 4M95A 8ICVA 3T5HA 4KLOA 4YMOA 1XR5A 1SV5B 4F8RA 5KFXA 4Z6CA 3HX0A 4O5CA 3Q8RB 2RF2B 4Q45A 2KZ3A 3QGGA 3KLEA 3KLHA 4TLRA 4Q0BA 2BCSA 3LP1B 2R8IA 4I7FB 4ECYA 4PH5A 4MK7A 3CJ0A 2IAJA 3QEAZ 4ED7A 2GC8A 1C1CB 1ZQWA 3RRGA 3KK2B 1C0UB 4RZRA 5C42A 1JKHB 2FPMA 3ETLA 5J2EA 1HPZB 4YCXA 3MF5A 4XPEA 4DQPA 2FJVA 3ISBA 3BQ0A 4G1QB 4KLIA 2HMIA 3C5GA 1D1UA 4IR1A 8ICMA 1YVFA 3GIMA 2HVIA 3ITHB 4KLSA 1QLNA 5CB1A 3IRXA 2ZD1A 3N6NA 1CEZA 3C6TA 4B9NA
chains in the Genus database with same CATH superfamily
5KX5F 1HBOB 1YJWS 1SJ1A 2FK1A 4E8UA 3CNHA 4CDGA 4KGXB 3D6NA 2MSSA 1YGYA 4QZ9A 2DK2A 1TL1A 1RZMA 2GJ2A 3MPGA 2I80A 3B4DA 3ZTQA 1GO3F 3OL9A 1XR7A 2LQJA 1IN0A 3OXFA 1JJCB 3G71S 5CXTA 1FWPA 2ZIVA 1T94A 4ED8A 1IWGA 3KJVB 1NPRA 4AE5A 4LRAA 5G5HA 5A6PA 9RUBA 2YZNA 2OFGX 3MURP 3M7DA 4JI5F 2E66A 4I28A 1UVJA 1YMYA 2FC9A 4O3MA 1FWAC 4DMZA 1REVA 3DDIA 4D3GA 5K2MA 2OWOA 9ICAA 4HL9A 2VIHA 3HHDA 2U1AA 3LS9A 2DISA 1TAMA 2KL8A 3OLBA 4RQMA 1XO0A 2VKQA 3UD3P 2AYMA 3WO0A 4EUVA 4WU2A 4AUKA 2ZIVB 4UB3A 3QU9A 4WFZA 4Q7AA 2CWKA 4C8YA 3OSPA 2RDDA 4KLHA 4DXLA 3D2NA 3J7Z5 3MD3A 2OD6A 3LPYA 3EX7B 3DYAA 1DOQA 2FQQB 2R93G 2ZXHA 3I28A 2CW7A 3JPTA 9ATCB 1CE8A 4Y2VA 4CLYA 3W63A 1ZQIA 3M8PB 5HMEA 5ETVA 5K8PA 5KFUA 1CQJB 1SV0C 2OOFA 9ICFA 2UXDF 2RT3A 1BQNA 2YL2A 1DGJA 2IOFA 2G3FA 4XQ8A 2DH8A 1P8LA 4QR1A 2YPZA 4XYMB 4C3LA 2YS6A 2BE7D 2CDRB 3VZHA 1Q78A 3HI9A 3B0YA 2VF3A 2CPYA 2NSCA 6AT1B 2DNRA 4QIWD 3PRDA 3ZZZA 3DM2B 4QZGA 2G4BA 5AJ3J 2DHHA 1LXNA 2K2PA 3SAHA 5CA0F 4A8SA 4Y2AA 2VPXB 1DZ5A 5BOLA 4Q2LA 4RW4A 1RLDA 1JLGA 2BCUA 1I6UA 1HW8A 2VUNA 1CBKA 5HK4A 4O3PA 1RWKB 3O2IA 3PMLA 3AFGA 4ID5A 1EXNA 2W11A 1ZM9A 3ENQA 1WH2A 2HQFA 3HM9A 3TEHB 3PR5B 4MFCA 3FZ2A 3UQ2A 2GPWA 3KLVA 1EJVC 2YNHB 4ZPVR 3R9LA 3HHLC 1SB3C 2PA3A 2H4YB 3GFXA 2OPSB 2Z0GA 5C2GA 1X7VA 1XIQA 4KLLA 3KAJA 4ZPTR 3ZZPA 4FF4A 2FPKA 4UUWA 3OV7A 4LF9F 4M5IA 3FBCA 2UUCF 4PZNA 3RJKA 5CH7B 2D3ZA 4MHVA 4DSLA 1OW5A 5E3RA 5IIOA 1YJ7A 4F4YA 3SSSA 3OL6A 3MMJA 1WG5A 1SKRA 4N56A 3DLEA 2BE9B 3LVWA 3G96A 3RBEA 1A77A 1A9NB 1S9EA 1NZAA 4NLZA 3JPRA 4CO5A 4ETZA 1IKXB 1PCAA 4DR2H 4B3SF 4WE1A 2PO4A 1BE4A 3OHBA 1JLEA 4EZ6A 4ZHRA 3GJQB 4O9MA 5GAHU 3U1LA 2G1HA 3QSYB 3NMRA 2HEKA 3CO0P 2XMVA 1VQ6S 5D4OA 4N7TA 5KAIU 3VV2B 5DETA 2V5HG 3Q2SC 2CJAA 2KVQE 2Y9HA 3G82A 1RJJA 3H0PA 4LJMA 4P71A 3EM1A 4C0OC 2BVZA 4DV0H 4LFCH 4UB1A 4IQTA 3MAAB 4OYZA 2GO9A 4B3OB 5IWAH 3CIZA 2QFJA 1KD1T 1RDFA 4PCQA 4DV1H 4OI0A 4G7EA 1RU2A 4JI1J 3NY0A 2EG2A 3HZEA 1YG0A 3K75D 3AB4B 2RKIA 4I6AA 4LFCJ 1YBQA 4WIQA 1CI4A 3OVSA 5DG8A 5CAAA 7ICGA 2ZEJA 3I9V9 3E01A 2OTJS 4K7QA 2PSZA 1V6HA 1F9HA 1YHQS 3AXKA 1YK9A 3PO4A 2C2ZB 3SMVA 1Q8KA 5C7PA 1X4EA 3N79A 3HT0A 3FDSA 4CCHA 2VPZB 7ICEA 1EJXC 1HLWA 4KH0B 2QL5B 3UMGA 4MA0A 3K58A 2W7OA 1XMOJ 3I0RA 4QYZK 1VQ5S 1WG4A 4FYYB 2YY3A 1UVMA 4UB5A 1M0SA 4CP5A 1ZQQA 1E6YB 2NZ4A 4M7EA 3H59A 5L8RC 1QH9A 4WFXA 2GSEA 1VRUA 3NCQA 1UETA 1XSNA 3MECA 1ZQXA 1LQ9A 2HWTA 3LA0A 3VWSA 4YB1P 2XYHB 2DNHA 1GH8A 4NLYA 2WB1C 1C1BB 5KAFU 3R5JB 1X9WA 2PN6A 1FO4A 4MIAA 3GTMA 4CNTA 2V8PA 3BM7A 2W43A 2FJDB 3SZ2A 2MKKA 2YQ3A 4X4SA 2OLSA 3M7VA 3L3CA 2M8DB 2ICSA 4MYTA 1ZQMA 4FS2A 4NI2B 4BWJA 2XIGA 3VPDA 1HBMB 2GA7A 1GO3E 2J6UA 4B9UA 3G6ES 1KS2A 4PQAA 4F3OA 5AKQA 2C2NA 2F8HA 3TX0A 2JZBA 4DV5J 4ZLJA 3BV8A 4IRCA 1SJRA 2ISPA 1KLMA 1S03G 2M52A 5J2CA 2A6OA 3PYDA 1UT5A 3J80Y 2CA9A 1RT4A 3H2UB 2QARA 2KOBA 1RK6A 1X5TA 4OJ3A 3HFZB 2FVCA 2ZUCA 3OL7A 4USJC 4UBBA 2D6FC 4PGQA 5I42B 1J5OB 1BWVA 3TR5A 4DL5A 3UDEA 3EZOA 3VAIA 2DWCA 2AXTU 3BBFA 1H72C 4NXZA 1M0WA 2I5JA 4AYBF 4B02A 1U4BA 4C11B 4Y6IA 1O0PA 2XULA 2HIQA 3MCSA 1NDKA 4DR6F 1UFWA 4OHZA 2DO4A 3N4MB 2B56A 3EDRB 4I2PB 1N5QA 2BQ3A 3T9NA 1IIPA 3G2XA 2YNFB 4C8KA 3G82B 4W90B 3RIZA 2W54A 2AGQA 1R8BA 3JTOA 3MUMP 1S6QB 1NJYA 4B9TA 4I7FA 1SCJB 3K1RB 1WCLA 2G0CA 4ZKAA 4WPAA 4LF5H 1TVAA 4DR3H 4R66A 2HHTA 2RD5C 2DRDA 5IOLA 2KM8C 3L09A 2Q79A 3FFIA 5FD1A 2WSCC 1N36F 4EBEA 7ICIA 1IBLH 1Z2PX 4U9RA 1D9DA 4XRHA 2R4FA 4X4UA 4ALZA 4RBVA 1U48A 4B3MF 3NCPA 4WXOA 4QZFA 2CJBA 3N0VA 5CZVA 1SEIA 5GONF 1HQ2A 2ZKTA 1L3SA 5JQWA 4YB6A 3K57A 2QL9B 1FTCA 1C0UA 3OUUA 3GONA 4LF9J 3THVA 3ISND 3UN2A 2D3OR 5LSRA 5J2PA 4KE5A 2V4QA 3CQZA 4I0WA 1ZQFA 2MQNA 4NLXA 4ZMMA 4NWIA 2K4HA 5J0PA 1PYOB 2AQOA 3IHQB 3KKAC 1FXRA 4JI3H 2VUGA 3G86A 2V9WA 1RTDB 1GXUA 1S9EB 2HGMA 2D69A 2MQMA 1ZQEA 4EGJA 4RNHA 4YVZA 3VTIA 4OYBA 5L38A 4I2PA 3NVZA 1R8HA 4A3LG 4CO2A 5A6WA 3TWZA 1W26A 3RU0A 2A19A 1MW7A 3M05A 3US5A 2GH1A 4DN0A 1PVQA 3K5IA 4ZVGA 2DRAA 3D1HA 3PG9A 3L4PA 4Y65A 1TKZA 2ZOMA 4P74A 2ACYA 9ICMA 2F9JA 4X66F 1SIZA 2KRRA 2QFIA 4OYAA 1NLKL 1RQNA 1JNRB 5JUMA 4DOZA 4F26A 3AN1A 4M9HA 5AKEA 2ZJAA 4K0KF 1B33N 2YMPA 4DR3F 3HSZA 3L7UA 3PR4A 2VB6A 5DRKA 4LRBA 5F9LA 1FX2A 2VH7A 4DLEA 3VCDA 1LFPA 2CNKB 1NZ8A 2B9XA 3GMGA 2R7WA 2DJWA 4J03A 4GO5X 2ZIXB 4PEOA 3HKWA 2JEGA 2B7CB 3LVVA 2CPRA 8ATCB 1F5CA 1V5VA 3UXOA 3GYGA 2PAJA 1K0TA 4JWMA 4FO6A 4EBDA 1HUOA 2AX0A 1Y0HA 2VJUA 2H3IA 4PWWA 4ANCA 4X4OA 3CULA 4UZBA 3FNNA 3I96A 9ICPA 1FFVA 1BNPA 3OJUA 1E6VB 3L4KA 4GKKF 2ZTDA 5IILA 3N28A 3WNZA 2B5JB 3M6VA 3DLKA 1U6BA 2UVUA 4KYZA 2NR0A 3W60A 2KFYA 3DNCA 3IP0A 1RWWB 3E51A 4CLUA 4A3DG 3FGVA 4CLLA 8ICRA 8ICLA 2RF4A 3TUZC 4I2CA 2RQCA 2DGWA 9ICBA 1C1CA 2HCFA 1RZTA 1YJRA 2FJ6A 2UXDJ 4KHPF 5KFJA 2AYEA 4FF2A 3UQ0A 2VG6A 2DKZA 2GGPA 4DQRA 4F2SA 4C4SA 1HR0J 4PXBA 1AXQA 2H1YA 4NXMF 1Q8IA 3B9JA 3MTWA 4OYPA 2V58A 1LW2B 1SL2A 2WVCA 4I64A 1TV9A 4RUCA 3CJSA 5THWA 1R0AB 5I3QA 1KBRA 2A0FB 4FP9A 1UL3A 2NXEA 3GIDA 1VBYA 3TARA 3DLJA 4TYBA 2KFNA 1XERA 2FHJD 1RTJA 3HT3A 5GAGI 2W7PA 3I0SB 2YKMB 3KDOA 3KJVA 2XSJB 2WW4A 3MGHA 2WONB 2MQ8A 3B4MA 3NGKA 2BE2B 1JMTA 1SKUB 1VGYA 1RT1A 1O08A 2W1BA 3VQTA 3TEGA 3S6EA 3AH6A 4NX9A 4YY3J 1R27B 1NK5A 4DOAA 4JI0J 3ED5A 4NLOA 2XG8A 3WIVA 3JQJA 1Y00A 2V2KA 4P2SA 4DFPA 3NP5A 4A2AA 1MC8A 2ROPA 4MF8A 1D8YA 1GGOA 2YH0A 2KHQA 2H3QA 2AZ3A 4ZPWR 3R0DA 3I4PA 4J9RA 4J0MA 2R7SA 3PYEA 4ZVTB 3IG1A 1V51A 2R9LA 3KJQB 1DGSA 2DB1A 2JWNA 3K8WA 1K44A 2FI1A 3A3PB 5HVFA 4ZVRB 3CCVS 4FU0A 1A0PA 4FXWA 4P9SA 5DKWA 2HK2A 4GVBB 3F53A 3PSIA 3HX9A 1RQ0A 2GHPA 4DR7J 3QYYA 4EYIB 4UQGA 3HKZF 4F4AA 1FKAH 2PKEA 4FFDA 3QU2A 3NWRA 2YNHA 1DRZA 3UFCX 4ZLNA 2LP4A 2XCLA 1R8CA 1DHMA 3G4SS 5HI7A 2A1AA 1ZRNA 2JXJA 2F63A 1V3RA 7ICNA 3LUYA 4CDIA 2BKNA 3BO3A 2HJWA 3MM7A 3MAHA 3UM9A 2YU9A 1UVIA 9ICLA 1JNZB 5L9NA 1GTHA 3WU2U 3TA2A 3GR0A 5HLFB 3JYTA 3MM9B 1KDNA 3TQTA 5IYDG 5F3ZA 3TOQA 1NO8A 1RM6C 5JTIA 1UP1A 3GTJA 2I6XA 1LWEB 2LHTA 4F5OA 2VBXA 4I1TA 1P1LA 2SXLA 5KT3A 2VDIA 2MY7A 2RRAA 2QS8A 3BZQA 3HOZG 4ZN1A 2V4JB 3ISNC 2E5LF 4MTDA 2DNMA 5F3TA 5IIIA 4MV3A 4DU7A 4ZP7A 4YN3B 5M2RA 4P4OA 4DR1H 1CRXA 3SE7A 2KJ5A 3M6KA 3RN6A 1B70B 4ZK7M 1K0VA 3AJ2A 2GMHA 5ALHA 1KEKA 4YOEA 3DF7A 1FRJA 3RRHA 4HTIA 2XZTB 2W9AA 3J80U 1Q81T 1LWCB 1GKQA 4PWDB 2XZWA 4EZ9A 3IP4B 2KSOB 3AB2B 1YKWA 3FEZA 8ICKA 4WWSA 1WCNA 2BQUA 4DCPB 1SQFA 2FB0A 5DGAA 2O3DA 1N6QA 3CCSS 4RR5A 2NYIA 4NLRA 2ZBCA 4KPCA 2GAHC 4PXCA 2NU9B 1N63A 3LAKA 1KOOA 1N32H 2HOFA 5KFRA 1FFUA 3N9UC 3PW5A 4C7YA 3JPOA 1YNYA 4F92B 5D8HB 1DK3A 5KT5A 3H5UA 2BZ2A 1T03B 4URGA 4C5BA 2ALYB 4A93G 4MFAA 2Y3YA 2FMAA 2VQFH 1C0TA 3T1AA 3HBLA 4LBIA 2PFPA 1FDDA 2FJWA 3KLIA 5DDQC 1T9UA 1NDLA 2Y0BB 3HZGA 4CM2A 2A1JB 2HI0A 3DRSB 4DJBA 5IP7G 1IR2A 1IBKF 4AXJA 5IT9Y 1F3VA 3UVJA 4LFAJ 4B3TH 2R2SA 1W93A 2RDIA 5ALWA 4CO0A 1FO1A 4CWBA 4X4PA 3FSIA 5AXLA 1LV5A 5DB9A 3CDBA 3MDAA 3I4MG 3NAIA 1B04A 1SC3B 4AXIA 3Q22A 2W6PA 1WSCA 2QRRA 4UAVA 3OFFA 2OP5A 1ZQTA 2AEMA 3JTNA 2R87A 2EFQA 3DI6A 2W6OA 3KHHA 5J8YA 1VMBA 2MTLA 3R8YA 1N34J 3BN7A 3BH6B 4FYWB 3KD3A 4F5RA 1SJ3P 3DRPA 3MZIA 2KFZA 3AQEA 4KGZB 2G07A 3SYZA 2RP5A 1Q4RA 1TQLA 3NS1A 2AKWB 2OI2A 3MEGB 4DYKA 1T05A 2PFQA 1CQIB 2N3OA 2YX8A 4HNUA 2UUBF 1NJXA 9ICRA 3NS6A 2QC3A 2DUYA 4G1IA 2EXUA 3MWDA 4M47A 1IE7C 3RGZA 3DU5A 3FM9A 4RWWA 4M5DA 2R82A 3D66A 4QNLA 5ETQA 2ASJA 4NXNJ 2DKOB 1XMOH 5AK4A 3KDNA 3MTKA 1UCNA 1IV8A 2BPCA 2HHHH 1WG8A 1F60B 2E5JA 5CYMA 2IC3A 4OZLA 4HYKA 1Z2NX 3V5RA 2RGRA 1Y10A 5IT9U 1TKZB 2EPIA 4U7UK 2NVYA 3BR9A 3TJ8A 4ME6A 1TK0A 2I5HA 5HMLA 2HRUA 1AUXA 1D0EA 4YIWA 5DJBA 1ZA2B 4UBCA 3T5LA 3N6MA 3C14A 5C1OA 4A48A 7ICTA 8ICCA 4I2QB 4QYRA 4DZ6A 2YKAA 1SB6A 2RB7A 3EGJA 2AMCB 4N77A 1VQLS 3EXCX 1JLAB 3IRWP 3EGVA 3FYHA 1KTQA 4US8A 3N8DA 5A8RA 4GXIA 4RPZA 4GLXA 3H5YA 3HDSA 2B21A 4NCGA 4QZVB 4A8QA 1EHIA 1KONA 1RJQA 4U8VA 1ACMB 1AYEA 5JVLA 4OD0A 1UEVA 4ERDA 1U09A 2F4VH 3CGIA 3GTLA 2YB1A 5A0YA 5AM1A 5AXKA 3G87A 5A8KB 1BPDA 3ZNUA 2LMRA 2AGPA 1SQGA 3G77A 2JNJA 1F3FA 2PMZF 5CYQA 4WK1A 2ZVIA 3RF9A 1AT1B 1RXWA 1F5SA 4L75A 1XBWA 3ETMA 4DR3J 3W9JA 5IZHA 3HW8A 4JI1H 2LM1A 3Q83A 1N2XA 2PXIA 1FRXA 3BGLA 3FKIG 2ASYA 5IT4A 2F1IA 4RB1A 2AYBA 1T4GA 1RAIB 4RUAA 4LQ3A 1DY3A 2LDIA 2D41A 3M6ZA 1R8AA 1D8BA 4DSJA 1F0MA 1X31C 1GMUA 2CPHA 3X3UA 4UAYA 2AEJA 1CJTA 2JZBB 2BV3A 4UB9A 1IJFB 2LM4A 4ACOA 5LP6F 2ZIWB 1UHUA 1VISA 1N60A 3OUYA 2Z58B 1QCKA 5AM0A 2ZITA 2E7VA 3ZDBA 4LSLA 1DTTB 3EYYA 1W2BR 1XMOF 1NHVA 2YN4A 3AXMA 3QO9A 9ICJA 1YBAA 4J37A 4IG0B 4F71A 4KSEB 1S0MA 3BZCA 4O3QA 4MIBA 1NKEA 3M4XA 2KV2A 3RUBL 3LWLA 4UAZA 5AKZA 1RWOB 1B99A 4IHJF 2UXCF 5AKIA 3AOCA 4LF4H 2PA8D 1P9QC 2DGUA 1S9FA 4ZPDA 5GADI 3WKCA 2WBMA 3EUNA 1WELA 1H73A 4UY8T 4RJVA 1Z1VA 4KLDA 4ZCLA 2WB1D 3NL0A 2JEFA 1Z00A 2CQIA 4YD2A 3T5JA 3PJXA 1ZM2A 3OD2A 5M2UA 4B3SJ 2HRYA 2DR9A 2DHSA 3ONQA 2ALZA 1AFIA 2AGOA 3NS7B 4GKJH 1T9TA 4RKUC 4I2IA 5E0OA 4DL0C 1S77D 1TMMA 5IIMA 1VQPS 4NYPA 5J0XA 8ICWA 1G2EA 3H8WA 2IRXA 4B17A 4KMOB 1WDDA 3T79A 1DTQB 2RSQA 4LF6F 3NGSA 4I67A 4C65A 4NLGA 1UCVA 1ZZFA 3LTOA 2YWHA 7AT1B 4IO1A 3AD8C 2H5EA 4ZVQB 3CRXA 3ENWA 2HQIA 4LSLB 3J7AK 1SWVA 1TAUA 3AOAA 5AKYA 2R7MA 1KVKA 1F0XA 2KG5A 3UDVA 2ZIXA 1KBUA 3QZ7A 6FD1A 4QIVA 3MMBB 2KMDA 3OXLA 3KK3B 4RW7B 2DR7A 1U1RA 2JLFA 1DXSA 5KT7A 3T41A 3FBFA 2OM6A 3JPNA 1KSPA 3CVZA 4NOHA 3C1YA 4ELVA 3O0FA 2E5HA 2YX7A 1S1TB 3ZO7A 1NK7A 1HQEA 4LMZA 3HO1A 5AM2A 3AA8A 2L9DA 1XNQH 3LOUA 3W2WA 5A8RB 5EHHA 1U0HB 1EJUC 2QSWA 3C16A 5B0CA 3VVUA 4YB7A 1I3OB 5AE3A 2RRDA 2XIDA 5I3UB 3WK5A 1JROA 1ZQSA 1BNOA 3CDAA 3CUNA 2GHWA 4OZ5A 4KGMA 4YDDB 3VAGA 4RU2A 2CQ3A 2QA4G 3ZD8A 5C0YA 3C15A 8ICSA 4OZ1A 4PDBA 2OIHA 3K5LA 2IA0A 4JYAJ 4KIAA 3BKFA 5FD5A 2LA6A 2ZJTA 1UJ4A 1AROP 3V4SA 3BAAA 4DPWA 2ZJ8A 4FYDA 4YQWA 2ASDA 2HBLA 2NRVA 3HK2A 1PILA 5GAEU 3G8QA 4ECQA 4QZCA 5FD6A 1KW4A 1EX8A 1HQUB 2AJQA 2JLEA 4DV7H 2H3EB 3CJ2A 1NH8A 3HP6A 3WKDA 2BR0A 2WE6A 2W6QA 1EJWC 5C3EG 4TUQA 4JI6J 4ES3A 2Y0SA 1NSAA 2O1PA 2HZVA 3DMJB 3CO9A 4ICLA 2ILZA 3U9SA 5IC6B 2R93A 2K4IA 1JLCB 1RAHB 4V19J 1EQ0A 2OH2A 1HI8A 1S1VA 4OL8A 1IBMH 2IVYA 5CYQB 3G9CA 4RB3C 4LRFA 4CT9A 2JA8G 2YNIA 2JC0A 4ZOHC 4JV1A 3QGKC 1F5BA 3JS9A 4EFAC 4A3BG 5AIBA 3AJDA 5HMFA 3WKAA 5K8NA 4A3CG 4UAUA 2M3DA 3KK1A 2H9ZA 5EX3A 8ICTA 2UUCJ 5AI9A 4GY7A 2SCUB 4K50A 3AQFA 3RJFA 1HNZH 4DR7H 3WHIA 4K5RA 3GIKA 3V6DA 1S7IA 1I94H 4C8NA 1ONWA 4LF7J 1R9ZA 3R7SB 4HI1A 2V67A 4G6VB 4BXOB 9ICEA 3OTBA 5F0WA 4WTYA 2LA4A 2R8GA 4IWXA 3C0FB 1ZRMA 3GILA 3KYLA 2MRLA 4DR1J 2Q09A 5A8KA 4JOUA 3K59A 5J1EB 4NL9C 4CRXA 3H98A 4BXOA 2XHWA 3PX0A 3C8YA 3GLKA 5HANA 3PEJA 3GIPA 5F9NA 1FVSA 1CJVB 2NXJA 5F0UA 2JLGA 2JV3A 1FNXH 3V7KA 2LQ8A 2IP4A 2E29A 3LP2B 3H2VE 2G5HB 4P7TA 2GMLA 1HNZJ 1HWKA 2LQBA 2QA4S 3J80W 3SAFA 4RU9A 2Q2TA 2M0GB 2DNPA 3M6XA 3BYRA 4X65J 2EFOA 2KHDA 3M8RA 3R5CA 4C4WA 2NXCA 3QJLA 3HOYG 1N5XA 2HHVA 1KKHA 2BJDA 1T7PA 2JJ4D 3K7RA 2WF8A 2UU9H 3OTOJ 2WSEC 3C2MA 2F65A 1KHWA 3H20A 1MZBA 5HHIA 4R88A 2DNKA 2JZ5A 2A1JA 3SEIA 1EJSC 2XSFA 3WX4A 4YMOA 1SV5B 1OMSA 3N43B 4Z6CA 2JA5A 2EANA 4QCLA 3KLEA 4TLRA 2BM0A 2BCSA 4I7FB 4HH0A 2MKHA 4O2AF 2IAJA 5A2QY 3CMES 1VS0A 1O03A 4JB3A 2XMWA 4ED7A 3RRGA 3H8YA 1BY9A 4KY3A 3P49B 5ALPA 4RZRA 5C42A 4CLFA 2L3MA 5G0RB 4OZ0A 1JKHB 2UU9F 3CMQA 3E0LA 1HPZB 4YCXA 1KQFB 2VFVA 4XPEA 1XMQH 2FJVA 2FE9A 3MPWA 4G1QB 2RU3A 2HMIA 4X62H 3C5GA 1R8PA 3R6LB 1UC9A 2P2CB 2CNNB 1UVLA 3HD1A 3CCQS 3MCNA 1V97A 4WTOB 1M5HA 2VKRA 2IDEA 2B0GA 5KFTA 3IS9A 2CPIA 2Z7JA 1C1BA 2KHVA 2P66A 1UKUA 5CYMB 1RTIB 4YR0A 1PSDA 4ZJOA 2UXCH 2YVSA 1SPBP 2ZM6J 4R7RA 1QAJA 2EK6A 3PW4A 4R0JA 2FPLA 1KJQA 2P5VA 1NKBA 4NCAA 4MV7A 1BC6A 1RWNB 3C2KA 1N48A 4O0NA 4V1Ak 4LR7A 4I68A 1URNA 2Y9UA 3S6JA 2K7JA 5ALTA 2B8PA 4QYZJ 2LU1A 3D0IE 1J2NA 4M6WA 2DD8S 1SBRA 3ENVA 1HNVA 2WSFC 3NMAA 4BCAA 4L72B 5JJBA 8RUCA 1JJHA 4QJVA 2OHFA 2QG9B 5H1SV 4K2JA 2VONA 1L8LA 4PPDA 2VDHA 5DBCA 5LMUF 4ID5B 4UCUA 4OYXA 2ZUBA 3QFHA 2N7CA 1KC7A 1X9MA 2GO7A 4KLMA 1EETA 2QSFA 4IFVA 1IKYB 1OSDA 1HD0A 2WAQD 2J6TA 3N7SC 1WF0A 4PKDB 1F2HA 4P4PA 1G4CA 4ZI7F 4RNMA 3HHNB 1WUUA 1KVJA 5LJ5Y 2W2OP 4B3RJ 1R9XA 4J9MA 4K59A 2XMKA 1J2MA 2OAUA 4HKQA 2A3VA 4MYUA 2GHVC 1HWJA 5KAKA 1LXJA 3CCJS 2L08A 1OWTA 1L3VA 3SBMA 1JI7A 4IH7A 3ZFVA 2ATCB 3MEEB 4KGVB 5AE1A 5L9XA 4U8YA 3D3CJ 1JRPA 3QAEA 1QE1B 2HHXA 3NGDA 2B4OA 1JLBA 1TVRA 4YHHH 1PC5A 3UFXB 1TKDA 1H7XA 4LSZB 4UT4A 1P6TA 5CAEB 2UVWA 4P7VA 4JV5H 4QOTA 4QWCA 1L3UA 1RWUA 4DQSA 5F8HA 1KQSR 2CPXA 3KXYT 4ZVUB 1RT2A 4C8ZA 1ULZA 1WR2A 3QQCD 1VOMA 2FLLA 2V68A 2FK2A 3GG0A 5CD4H 5D4NA 1FJGF 2JA6A 5LA6F 3EUB2 3VAFA 4P2XA 1FKOA 5F8JA 3J7A1 3GTPA 4EEKA 3G6VA 5T41A 2CNLB 3MR7A 2CN1A 4JMUA 3GIQA 4I2QA 2AJ4A 5J0TA 2VFRA 4KV8A 2DEIA 4DUYF 1S1WA 3MAQA 3ISZA 1R89A 1XSPA 2DPIA 3BGUA 3CJQA 3QMQA 1NNLA 3VAHA 4IQMA 2WVDA 3ETOA 4PPZA 3IGNA 4JI8J 3IM8A 1SIWB 1HPZA 1L8OA 2NPFA 4RNFA 2X1BA 4WBFA 3AMZA 2D3UA 3OW2R 2YKMA 4MKVA 2HBKA 4F0KA 2EK1A 1KHVA 4DUTA 1Y7PA 2YKNA 3TA1A 2H3ZA 3LA4A 5CZXA 4CI0B 4FM9A 1L7MA 2F4VJ 3BO2A 3ZDCA 3KG4A 2HNZB 3PSTA 1VAJA 3TUJC 5KT6A 1WEZA 2HVSA 4Y2KA 5JU5A 4B9MA 2XC9A 2IHNA 4CF5A 2ZBIA 3DUGA 3DXSX 4DR5J 2BJ7A 2ZDOA 4Z37A 1A6LA 1ZQKA 3GTYX 1RWVB 1JMSA 3W5YA 1E4GT 2VOOA 4LUBA 3ZTRA 3UQSA 1B64A 1HL6A 3V7PA 4UQTA 1PZNA 3B82A 4ED0A 4M04A 3HHLA 3TAMB 5U47A 1TL1B 2ZKUA 2IM2A 1J5EF 2PMZA 4OHWA 3I6PA 3KUEA 4DU8A 3GV7B 3D2QA 3IRUA 2BCRA 3VAKA 3MM6A 2J8AA 3OTCA 4C48A 2OEMA 1T11A 1PAEX 3EDQB 3KAKA 3ZZYA 2IAJB 4KO0B 3RBXA 2DCLA 4NM2A 1XQIA 3BA9A 1M1HA 2VPQA 5HAOA 4C6AA 3ZC4A 2YKNB 1CJVA 3HJEA 4R5PA 1Q5VA 3MKVA 2XTJP 4P2FA 5E3CA 4BBSG 4O3NA 1FD8A 3N5BA 5A2QW 4P0PA 3VMMA 1LFWA 1C20A 2OPQB 4HLBA 2A18A 1UPMB 2AT1B 3CMAS 3E0FA 3TQEA 4CC6A 1HARA 3KTMA 1SYXB 2E1PA 4QU6A 1FJ7A 2POKA 5HO4A 3C28A 3WBZA 5E5NA 4ED2A 2P9EA 2Y8WA 3RW7A 3EYZA 1PYTA 3TZZA 1HIYA 2ZH8A 2YW2A 2AZ1A 2HWIA 3IGVA 1RB0A 3EICA 1U2RA 3V4MA 2YWGA 5ETNA 3A12A 1QVFR 1N36J 1SKSA 1N34H 4RQNA 3PV8A 4FPIA 1VBXA 4PHDA 2QT7A 4L3NA 5DM6Q 4XUSA 2RUSA 2N4DA 1HMVB 3MM6B 3E58A 4DPXA 4LIRA 4B9SA 4Q8FA 7ICUA 1U9LA 1PVRA 5DO2A 7ICKA 2GOLA 2PFNA 2G09A 1SH2A 3QNWB 5LL6d 1HNXH 2E8OA 4I2JA 1X9SA 4Y00A 4PG8A 2B6GA 5J2JA 1GXTA 3C46A 1CS0A 4URQU 2RQ5A 1ZOTA 1EETB 4DWIA 2VC0A 2CAJA 2QZ8A 4BUGA 3M32A 2E2HA 5H9FJ 2UUBJ 2RGVA 2DWQA 3DXBA 4JI7J 4M63A 2FE3A 4ZP8A 2YZGA 5CD4A 4JI7H 2Z00A 4F04B 1FFGB 4PABA 4N5SA 2ZNYA 9ICIA 1ZAVA 4OYWA 4DR2F 5AXNA 4YHHJ 5J2MA 1RSCA 2VU5A 2Z57B 2BMBA 3MGIA 5J0WA 2GWNA 5ALMA 4F25A 5ETMA 3CT9A 4NLWA 4IO9Q 2VG6B 3CJRA 2HNYB 4O44A 1JDEA 5BJRA 2ZZTA 4FZNA 4KQNA 1CQMA 5HMMA 3CC4S 1MQ3A 1HIWA 5EDWA 3DOMA 3WK8A 1X4HA 1TP7A 1S0VA 4JI0F 5K14A 2DNGA 1ZH5A 2FMPA 5KFZA 4IQWA 4MFBB 1NB7A 3M6WA 2KJVA 1WI8A 3CE8A 1N32J 2DNLA 3KNGA 4JUZA 2H54B 1WWVA 1NZBA 5EX0A 2NRTA 2B8QA 2HBZB 5LMNH 1S48A 1X9XA 3SI8A 3LP8A 1ZQZA 5CYJA 5HHHA 3OFGA 2I87A 4DV1J 1J2VA 4J9NA 2ES6A 5ALQA 1FWKA 2NO5A 3SENA 4ID8A 3A13A 3CDEA 2HHUA 1M5KC 4M5NA 5A2QU 4QWAA 2M2BA 1K5OA 4M5KA 1EF2A 3P96A 4Y2UA 1Y3KA 3LP2A 5GMEA 4F2RA 1KFSA 3N4WA 2BX6A 3POTA 2JOQA 1WC3A 4CM0A 4MJKA 3GDXA 2W7AA 3LSBA 3M8QB 3FZBA 4DR6H 5B0EA 4ZJLA 1T02A 3MHYA 4IZOA 1WTFA 2BE2A 2I0XA 3IR6B 2YH1A 3JAMY 1KLMB 2DR6A 3R1HA 1GAOA 7ICPA 2CPZA 1O5JA 3HWTA 3M9MB 1X0FA 1FWCC 3AUOA 2JRSA 1VC5A 4F0SA 2H5JB 5FP0A 5J29A 4DUZF 5ETRA 3MR5A 4NI2A 4QWDA 1CC7A 1X0PA 2KIVA 1ZQJA 5AI5A 1SFOA 2YQ1A 4DSKA 3KLEB 2GLTA 4P4MA 3CC7S 3DHXA 4LBPA 1UNNC 2X51A 1CC8A 2GLEA 3V4IA 2PMHA 2WZ1A 5B0FA 5AK5A 5LXRA 1N5TA 1LWFA 3KZIU 4CE6A 1ZQHA 4PZVA 5GMKa 3FRYA 3GSIA 2LYAA 4YMEA 3N6XA 1MA7A 3WC0A 1IXRA 3WO1A 4R7WA 2G0IA 1H2TZ 3I0SA 3KFUF 1RTHA 4K0KJ 4QIWA 1DK2A 1S6UA 3M2VA 4DV3J 2CNOB 2E9RX 2LXIA 4O4RA 2HQDA 1FK9B 1SJQA 3MR6A 1AN7A 3ET6B 2M4MA 1FT8A 4Z7CA 1P1TA 3T6BA 3Q8SB 4ZHRB 4LFAF 1EKSA 3DMJA 3IFEA 3RFCA 1GK8A 1VLOA 5DBBA 1S76D 4ECSA 3FSYA 4DHVA 1ZQGA 2X1GA 4ES2A 3TJAA 2WVBA 4ED4A 3I32A 2FD2A 1K1SA 3CPWR 1UT8A 5D1PA 3M2RB 4G1QA 2PFOA 2QKQA 1OJ4A 1GNKA 3UI3A 2BPFA 2MGZA 3QT5A 4HHHA 3VAMA 1WNEA 2F2AB 1RT5B 1U7LA 2YNFA 1MLAA 4B3RH 3R2DJ 1FVQA 3FUYA 4O4GB 2PFFB 2B63G 4P10A 2DHAA 1TAEA 2CJXB 4WHBA 4MFBA 2ZUGA 2DIUA 1X6IA 3EZUA 1S1XA 2GQQA 4G1PA 5M2PA 3VAJA 2A10A 2D3DA 5K9FA 1E9YB 3HULA 3S1TA 3WK7A 4LSNA 7ICOA 1FEHA 4LFCF 5EWEA 4DFKA 4NRUA 3UWTA 2IHR1 3FCHA 4DPTA 4KHPJ 3BKUA 1X66A 2JVRA 3T1HJ 5J1EA 2HAIA 4NY8A 2C2MB 3BG5A 3BR8A 4Y2RA 2R7OA 3LWBA 5FDLB 1RAOA 4GRSA 3Q8VA 3QE9Y 2A2CA 2COLA 2O5DA 4RQ1A 3F2BA 5D46A 3LPEA 3DLKB 5ALXA 5TZVA 4YAJB 2W03A 1TKTA 1Q3UA 4DI6A 1VQOS 2RS2A 3DOMB 3M1VA 1ZTTA 4YHHF 1RGVA 1JLEB 3A4TA 2ZFHA 2NRXA 3E01B 1U1KA 2XGQA 2FPPB 3DKDA 4JI7F 2U2FA 4F91B 2VFSA 1MN7A 2J0WA 4V19X 1D8LA 5J2TF 3BYPA 1B6RA 3LALA 3QYPA 2PT0A 4DSFA 4YB8B 4RAZA 3RF2A 1FDAA 1X4CA 3M32B 1KN5A 9ICTA 1GMWA 2XS2A 2G1DA 2JHEA 1OYEA 5LJ3Y 4A8MP 1KFTA 1UPHA 3NGUA 4C0ZA 4P0PB 2OPRA 3GRIA 3RTVA 3PZPA 2VQEF 4RPXA 4A3EG 2X1AA 3CXCR 5EUHA 1NK9A 2K89A 1AA1B 3ZXWA 1ZQOA 2LECA 3V7LA 4P72A 1ICEB 3H0MB 3OR1B 3KG1A 3GV8B 3B8HA 1YJNS 3BA8A 3OTEA 1G1XA 3RH5A 1ZQ7A 1EAYC 2HVRA 3ADAC 3MI7X 3IMQJ 4FYVB 3UDLA 2KT5A 2BABA 2K8GA 2QL7B 5J2GA 2CZGA 3DLEB 5FDLA 3HKZD 2RIJA 3GIJA 4N47A 4PG5A 2HS4A 2IA6A 2MU2A 4RW4B 3DGPA 1XNQF 4IKAA 1Y11A 2IBOA 1T95A 3GZFA 2I5JB 2KXHA 1WI6A 4WBNF 4EPDC 2IBKA 5FJ4A 2FDRA 2MZJA 4KIRA 4ZS6A 2N4CA 1K1DA 5FIIA 4MA5A 3FFIB 3DM2A 4OZNA 3MMCA 5K14B 1GSAA 2GS8A 4KBIA 4WFBQ 3QUBA 3KHLA 2GQ2A 4DBQA 1N5YA 4IH6A 1TTHB 4RW6A 4DX5A 2HAFA 2J76E 4KLQA 4EG0A 2ZDGA 2VPYB 2APOA 2CPEA 4TXSA 1Z4UA 2NO4A 2O6KA 4M1KA 3QZ8A 1F1BB 2Q66A 5FSEC 3FCVA 4PG7A 2VG7B 4C0BA 1BGWA 1N5WA 3D28A 2YCHA 1BPZA 5KFLA 3RH4A 1YRXA 4MV6A 1QM9A 1S5LU 2NYVA 1B3TA 2MHEA 1Z2LA 4E4TA 2B6AA 1I6JA 3MEGA 1HWUA 1HBNA 1XU4A 7ICVA 3BBBA 2KSOA 4WZQA 4C5YA 1F9EB 4DDFA 3FKIA 5IIKA 1WHWA 2WOMA 5AHXA 4HDGA 4MH8A 5IYBG 5C4XG 2GJIA 2MPUA 3P6YC 2MEWA 2VFTA 4DOBA 4DV3F 8ICGA 4HI2A 2ASLA 4MV4A 5J2DA 2KH9A 3SFGA 3CCWA 1Q3VA 2FTRA 1I3QA 5G4HC 1FTRA 4R63A 2OJ3A 3D6FB 4WD3A 4FF3A 2V4JA 1JK9B 4YMNA 1CPZA 4GC6A 4YP3A 1WKLA 1N6QB 1YSJA 2OEKA 3PO5A 9ICKA 1H74A 2V0NA 3FBBA 1JN3A 2UXBF 9ICXA 1HW9A 3HSJA 4QWEA 1QUPA 2HHSA 1YQHA 3O3LA 3RAMA 4OX9F 3QT8A 4RT3A 1HR0H 2K8BB 2JA6G 1IBMJ 3BO4A 4FVCA 1WF1A 2R7TA 4V1YA 2C3MA 1AB8A 1D9FA 2FYXA 3WIUA 5AK6A 1EKRA 1WG1A 1FCAA 3T1HH 1PO9A 3OT9A 1S10A 3L3FX 4UB2A 1MWYA 2BJ9A 3BS7A 4DLGA 2A2DA 3ETRA 1ZQDA 1CJUA 2R7UA 1W25A 3MXHP 2DZDA 2C2DA 3BH7B 2IJRA 4MMOA 4ICAA 1YLXA 4F0MA 3H25A 4DV1F 4TY8B 3TAMA 4BWSC 4J91A 2DGTA 5GTHU 5HNKA 4DV0F 3M9OB 2R92G 4PUOB 5EE9A 1UJ5A 1XSLA 1WC4A 3EGNA 3D7SB 1N33F 2E1FA 4DV6H 2QB0B 2OELA 4O0IA 2MB0B 2AJ2A 2JA7A 3D68A 3PW0A 1HBOA 4DS5A 1U47A 2NPIA 3I87A 4I7HA 1I94F 3U26A 2XZDB 2ZZMA 3SSQA 2O67A 1C3OA 4PGXA 1EJRC 3H90A 3ORQA 2YBVA 2W8LA 4DSIA 4ZVOB 5K4LA 5J0QA 2BRLA 2GOKA 1HA1A 4I56A 5HMZA 3BQ2A 1IJEB 2BACA 3D6MB 3IO1A 2NRWA 2FY8A 4R65A 2OSQA 1WTBA 1ULRA 1S79A 3HVTB 3ALRA 4KJIA 2QB1A 2X3GA 3MM8B 4FZLA 4Y2QA 5J2NA 2D9OA 1NJWA 4EX7A 4M9LA 4IOCQ 3NVYA 5DB8A 3OGUA 1PVPA 2FVQA 3QLHB 2D3O1 8ICFA 1LK5A 2BW7A 3PX4A 1RWMB 4R0EA 4ILRA 2YMQA 1RYRA 4RW9B 1T9WA 1PO6A 2K8CB 3UMBA 3EWGA 1HI1A 5KNIA 2AQ0A 1VBHA 4JI4H 1CJTB 3ETJA 1VS3A 3RV4A 2HURA 3T19A 4JI6F 1RT2B 4CNSA 4Y2XA 4A8OA 2MZ1A 2RRNA 3PYGA 4XTTA 2K8AA 1HUZA 3VGSA 3HKZC 3KLIB 4X4RA 3EMTA 1XNRH 2ZVSA 4NLSA 2BCQA 1I51B 2FHMA 5D0RA 4J9PA 2V8GA 1S9GB 3V6JA 3ENAA 2KTQA 3GP9A 4LREA 3U7JA 3POTB 1P7DA 4RQ7A 3GTQA 2D1CA 4DR5H 4KTQA 2EZZA 2WAQF 1CULA 1FRHA 1NSPA 2BJEA 3EVMA 2ZXIA 2FGOA 3FMWA 5IM0A 4TQSA 3R2CJ 1VJQA 2KT2A 4HAIA 4OLPA 1JXLA 4F3MA 3RJEA 5ETKA 4LQ9A 2AH5A 3EVOA 3TUPA 3IAM9 1V3ZA 2V8DA 2C2KB 3O7UA 1UBPC 5I47A 4ZCIA 4LF7F 4GXKA 4EEYA 3H7HB 4A8XA 2AIRB 4ENOA 2MSNA 1U2CA 2FVSA 2GNKA 3CP8A 3CD6S 2IC3B 4NLBA 4X65F 1NMEB 1SCUB 3LQVA 3AQPA 5AKJA 1C0TB 2ZDPA 5BYRA 2XBPA 2CJQA 1JB0C 4KHRA 1RAAB 1S5ZA 1K1QA 3FBEA 4OJ5A 5K8OA 2PUZA 3E74A 1R6YA 2ZUDA 2FHKA 5HN0A 2V69A 4PR6A 2V4RA 2K1RA 1VQKS 2OPPA 4J9OA 1BXRA 1KFDA 3O8WA 2G08A 2KZZA 4XAKA 2UUAH 2FLNA 3FEXB 2WF6A 4QR0A 3CDWA 4IR9A 4OHXA 4V1XA 3WC2A 2KVCA 4AL7A 3NBPB 4ZHQF 1Y14B 2V8VA 5IC4B 2YKPA 4U7UD 1S4FA 2FMSA 2ZH6A 1UJ6A 2YQEA 1FKPA 4ZVFA 4FN5A 3DCAA 2KHCA 2UXBJ 4DUZJ 2ESEA 2CKZB 3N01A 3KFWX 3ZTSA 2Z56B 2FC8A 3QXGA 2Y0SD 2Y0SE 2J8SA 1QSYA 1BQMB 1RAEB 1Y1WA 1JLLB 1SJ4P 3IG5A 4B6JA 3RJIA 4CIOA 3ILLA 3MGJA 1VYAA 5AKKA 3HOVG 1LW2A 4M2YA 3CC2S 9ICWA 3IBWA 1AUVA 2IRUA 5CRXA 3I5AA 5FLXU 4X64H 2E1CA 3R97A 5HBMA 4KB7A 1TKXB 1MWQA 1N5SA 2QMWA 4NYZA 2M0NA 5KG0A 2Z2LA 3BJYA 1S1WB 3TP2A 2XSJA 3SXLA 3NTUA 4URSA 2M9NA 2XNRA 2RLTA 2EZYA 3KTQA 2DPJA 5KOXA 2R6FA 2VOPA 1SKWA 1TL7A 3WKEA 2NV3A 4A2BA 1UVNA 1D9AA 4X66H 4GBDA 5KKNB 5CQGA 3J81W 4BS2A 1KCXA 4OMFG 2HHHJ 1H2VZ 4DQIA 3VPCA 2YKOA 4WGXA 4I2HA 1S0NA 3NXZA 3IV6A 2CPJA 1C4AA 2EWHA 3I31A 3M2UA 5JRTA 2KN7A 3L2PA 3KJNB 2PGCA 3HHLB 1FERA 2JFDA 3PFEA 4A4JA 3PW7A 7ICSA 3CYMA 3HSDA 2VQEJ 2ZC4A 2RHFA 1OS5A 4WFYA 4ITSA 5L46A 1WHXA 3HKZA 4HNVA 4OJ6A 2DYAA 1S49A 4YUDA 4C11A 2W01A 4GOAA 3UD5A 1XDNA 1GXLA 4DO9A 1UC8A 3A8EA 2FGCA 2Q43A 5KG6A 3AEVA 5CA5A 3KK2A 4MKAA 4C5CA 5KFHA 3SCJE 3V81B 4M51A 3QJJA 1FD2A 1VQ9S 2I8CA 3F8NA 2OMOA 1NJZA 2C1EB 1NK6A 1M5PC 4UCRA 2YMLA 1Y4ZB 2EAMA 2W6MA 4RNOA 3IV8A 1X8DA 4K4HA 3WK4A 2VBYA 3KJFB 4DCJB 1FJEB 2YNIB 2F8LA 1G7CB 3OUZA 4AQYH 4LVSA 4H4MA 2FKLA 5KFBA 1RKJA 5J0UA 5IT0A 3MM7B 2E1EA 3GV5B 1GEHA 2F3NA 2W6NA 5IV3A 2E8NA 4C7ZA 2MJNA 2P35A 1EJTC 5DZ7A 3F56A 3C6UA 1XK8A 2OUGA 1FWEC 5CP2A 3V6DB 3TKAA 2OEJA 4IDKB 6FDRA 4M6WB 3JSMB 2XCPA 1E4EB 4K4WA 4FVMA 1RHMB 1H38A 2FVRA 2JH3A 1ZETA 1HWIA 5J2QB 3KKFA 4UBPC 3FAHA 1FK9A 2BANB 1FRIA 1MQ2A 1IKWB 4I6WA 1VK3A 2KVSA 3Q89A 2JGAA 2BPGA 1FWJC 1U1NA 2GFFA 3IBFB 3FCWA 2DHGA 4IFVB 2E44A 4CNZA 5AI4A 3SV3A 7ICHA 1RE1B 2PEBA 4Y2SA 2EC0A 2C3UA 1GSHA 2Q2UA 2VICA 5JVGQ 2ZH5A 3O44A 5LSLA 1AQ6A 3BQTA 2GX8A 2C35B 4I2FA 4KC5A 3MMCB 3MR2A 3FQKA 4EPEC 3I4HX 2XI3A 5BR8H 2I1RA 4YMMA 1FJCA 3PX6A 2BB0A 4M9GA 1WCMA 1RG6A 1IOWA 4F36A 3PM9A 4JWNA 4DS4A 2CXYA 4Q8EA 1EP4B 2PMZE 1X4FA 2IFXA 1CLFA 2M88A 3KK3A 2VG7A 2ZH4A 2DGXA 2WCXA 2ZHBA 4L73A 4YY3H 3I76A 4Y0FA 1HBMA 3ZNJ1 4CQ1A 4Y8VB 2CQ1A 1NBEB 1DLOA 2QYZA 1M0TA 1IM6A 2IY5B 4CT8A 5T14A 3ICXA 4F5QA 2YY6A 4I4BA 5EZYF 2MMYA 5CJ7A 1WD6A 3VGVA 2HHPA 4K4TA 4EELA 2KG0A 2AQ4A 1U6FA 5B08A 3OVAA 3MAAA 5JVDF 2DY9A 4L76A 4CLZA 3HVAA 4QZ8A 4DZDA 4RQ5A 1IR1A 2E5IA 3TJ9A 3EJMA 1Z00B 1N33J 8ICVA 1XR5A 1H7WA 2RHSB 4ZLLA 4O5CA 2RF2B 4Q45A 1ZXIA 4XK8C 2F8KA 2M05A 2VZ9A 1R9TA 2AW0A 3UE2A 4PH5A 5CEHA 4MK7A 4JI4F 3QEAZ 4HTJA 1WOPA 2I6WA 5AICA 1Z4NA 1ZQWA 3KK2B 1GQEA 1C0UB 2RUGA 5EN1A 4LF7H 1KR4A 5BR8F 5G4DA 1PBUA 3L5KA 5DS7A 3L7OA 3C2PA 1DV2A 2M9KA 5ALRA 3MF5A 1U02A 3BQ0A 1FIQA 5E33A 4WKRA 4DCCA 1L7NA 2G06A 4NXMJ 2UU9J 8ICMA 1YVFA 1H6KX 3GIMA 2HVIA 2WFAA 3ITHB 4KLSA 4OX6A 1QLNA 5CB1A 5B0AA 2ZD1A 1CEZA 3C6TA 3I4NG 2P0AA 1N4LA 5I3UA 3H0LB 3M2UB 2B0CA 2V94A 3NRBA 1G6BA 1RT3A 2E1AA 2DXDA 3RB0A 7ICMA 2DFLA 1NB2A 2W4PA 5FLXY 3IM1A 1DFDA 1JALA 3QUQA 1C2PA 4C5ZA 3VF0B 1XS9D 4JI3J 2PI5A 1HNWF 3NS5A 3TAQA 2BA9A 1TK8A 2YNGA 5L1KA 1COOA 1IQZA 2WAQC 4AYBD 4JI6H 3HF5A 4GFJA 1VBKA 4M5DB 2AHOB 4MAKA 5ETTA 4M5LA 2ZD1B 4KKOA 4USHA 1ZQ1C 5J0YA 2ZDHA 3U9TA 1A5MC 3P3DA 3ZDDA 3D1OA 2MKYA 1V38A 4ZQIA 3D0GE 2PD1A 3DYAB 4TNOA 5DDOC 4KFBA 1BNCA 1N33H 4O2BF 3IG0A 3BREA 3CJKA 4BXXG 8ICEA 1Q0NA 1RTDA 1HI0P 4RLEA 1CJKB 3J81U 2DH7A 3HCXA 3MFHA 4PRFA 4YD1A 1DLOB 1I94J 3R6GB 1UW4A 3CD5A 2YX1A 2HVEA 2ZBPA 3R23A 2JEJA 1RT3B 2ISOA 3GU3A 4OZJA 1OO0B 3D1QA 2BEFA 4X64J 1MWZA 2ZBQA 2B9WA 2I2YA 4LSXA 1PJ6A 2V50A 1XTZA 4ECXA 2HSZA 4MTPA 2CJ9A 2JHDA 3T5KA 1L5UA 3I1YA 3I55S 3BGRB 5I42A 4HH1A 2BKOA 3QO9B 1Y88A 4NLQA 5KG4A 4DV7F 3CW2C 1E9ZB 2QLXA 4W98A 2F7VA 2OGUA 4CTAA 2BYCA 2IMRA 4OI1A 4ED1A 4XA5A 2OLWA 1XJWB 2QMXA 1RXOB 4GO7X 4P73A 1TV6A 3CD0A 5IP9G 5E3AA 3I0RB 1YJ9S 5HROB 3KZXA 1LOUA 2DEJA 5HP1A 3T1YH 2YTUA 4OI4A 2Q4TA 4GKJJ 3OR2A 2P53A 1ZQBA 3CCMS 4PHAA 5BPFA 2BBEA 4ECUA 4USIA 3R7BB 1KLNA 3EXYA 1PGZA 1FWHC 2XYGB 2FJZA 1SL1A 2Q1LA 3MCMA 4Q0BB 4A8YA 1P8GA 3AY0A 2JDJA 4NZ0A 4AYBC 2DLNA 1IKXA 3JQKA 1FWFC 2XGPA 5J1PA 4LF8H 2KKVA 3J81j 5BPHA 1YRUA 2V63A 4I29A 2HNZA 4DG1A 3IAS9 3GFKB 3OFHA 4C2MA 4FBUA 3VALA 5HMWA 2V34A 4ZCKA 2XEXA 1DQAA 2JH7A 2CQHA 5DB7A 2QA1A 1YITS 3PSFA 3VR1A 1ZAWA 2HQCA 2CQDA 4DSEA 3HKZE 1M90T 2GWSA 1SWWA 3ORYA 4GKKJ 1VRTB 5F8GA 5IQQA 4DL6A 4F02A 1VBZA 4Y2YA 4AQYJ 5KFQA 4DV3H 1TL3A 1TFRA 1HNXJ 4BC7A 2XI9A 2LKYA 3F2DA 4P0QB 1RK5A 4ANDA 5LOVF 4UCTA 5KOWA 2GVDA 5EE1A 2W2NP 1FWGC 1NRKA 4EBCA 4JYAH 3AT1B 2GAGC 5F8LA 4WU3A 3SCLE 2MHNA 3O5TB 1IBLJ 3MABA 1OY8A 1RCOB 2FPHX 3IRXB 3GSDA 4DQQA 3SCKE 4O5EA 2WB4A 1FKOB 3PXGa 2VC1A 1RT4B 4FE3A 2DBYA 5ALLA 4K4XA 1JLFB 3W64A 3IBCB 1U1LA 4YBZB 4KLFA 3N7PD 3JZIA 5LXTF 2ZHOA 3PO2G 3BSAA 5C24A 4IRKA 2LI6A 1FXDA 1HNWH 2YWKA 2MQOA 2R8KA 2UUTA 2VQEH 5KL8B 2J7UA 2IM0A 1AUSL 3D2WA 2DIVA 1E4EA 3HHKA 3QRQA 2GVZA 5DBAA 5HR6A 4FYXB 3KLFA 3IG1B 3PSPA 4OX9J 4XDCA 3R5XA 5IT9W 1UPPA 1TE2A 4AFFA 3F73A 3QGHA 2DY1A 2R7QA 3AJ1A 2QTWA 2KIWA 4DL7A 1KKXA 1DTTA 4DL2A 2A3JA 2YS7A 2P9BA 4DUZH 2KNJA 3CJ8A 2KSWA 2IM1A 1UWBA 1ZD3A 1RPLA 1FKAF 2CWXA 2LU2A 2GVZB 9ICUA 1R43A 3Q24A 1W2IA 2RAQA 1SXEA 4F67A 4KR0B 4M5GA 1Z4OA 1LWEA 4IQUA 1HHSA 1FJGH 1SQEA 2EFNA 3RJJA 3RG6A 1LW0B 3ULHA 4DZHA 1IKYA 3SDEB 3JB9k 5CHCB 1JJ4A 1YWXA 1SH0A 3GE9A 5AT1B 2MCTA 3MBYA 3LO3A 1BHNA 3MWBA 4MK9A 2FJBB 4USMA 1ZYQA 4A3MG 3J7AN 5IIJA 4YJ2F 4RQ4A 3HD2A 4AC7C 4CQDA 3IC1A 3MPDA 5HL7Q 4KH1B 4F4WA 2CRLA 4DFMA 3AODA 1WF2A 1VJWA 3HOWG 4I2DA 4I2BA 3M6UA 2W71A 4TUYF 2K3IA 8ICAA 1HR0F 4X64F 1A0IA 4OYOA 4NLDA 1TWCA 3GYNA 3M30B 1Q7YT 3BSCA 4F5PA 4HHJA 4OIXA 3TVYA 3LDAA 1VC6A 2PMZC 2FZCB 3PRVA 4OJLA 2FJEB 3PACA 4RX6A 2OPSA 4TU9A 2OPPB 4B3RF 2DXEA 5DDPC 4YJ3F 2HW3A 2HOIA 3FK4A 3MMAA 4NZ7A 1NUEA 1BQMA 5D0EA 2QMUB 1SH3A 4IL6U 1B43A 2E9ZA 1TU0B 1PK1A 3S7RA 3TW0A 5KL1B 3PJ9A 3KHGA 4BLGA 2HDOA 4JK1A 1RABB 4XDDA 2G2ZA 3K2YA 3UD4P 1ZQYA 5IQ6A 3DGVA 1AZSB 1FA0A 3PVXA 1FXLA 1RTZA 4PXEA 7ICQA 5J8YC 4NMXA 1JIHA 1KRBC 2ZH3A 5IYCG 1WHVA 2HMIB 4LF5F 3BS5B 3TZWA 4MF2A 4JYAF 4NA1A 3EW9A 2HZCA 4UCOA 1Y1WG 1TWGA 2BM1A 1DAXA 3PO3G 4K4YA 2CIMA 4M5MA 4J90A 4UB8U 1XNSA 4EWTA 2Z2YB 4EO6A 3CB4A 3K5PA 2NS1B 1WC6A 5E79U 1WWUA 3LH2S 1MG7A 1NK0A 5ALEA 3TO8A 2DR8A 4OZ3A 2PE8A 1GKRA 1W96A 3KXDA 4WJBA 4XX0B 2IPOB 2RDJA 4HT7A 2RS8A 4CF3A 4CLSA 4LF8F 1EZZB 4EGQA 1N52B 3M30A 3W1YC 5L1MA 2ZWOA 7FD1A 1U8WA 2G13A 1Q5YA 4JI8F 4JI8H 2YWWA 4ZPAA 4ECRA 1BPEA 1RWXB 3BZKA 1ZPVA 2CQ4A 2LPEA 3UN5A 2F5GA 2ABYA 4QZAA 1R31A 4KLEA 1S72S 2J9CA 2DF4B 5DG9A 2WDTA 1S3TC 2R7RA 3OPXA 4OHYA 2GPSA 3S8SA 4FKXA 4AQYF 3Q2TC 1VDHA 3TZYA 1QD1A 3RB3A 2Y8YA 2NU6B 3T6JA 2QGFB 4J9QA 3D5MA 1IVZA 3QJPA 2V8HA 4TVAB 2WOMB 1UFLA 2ZH9A 1F6TA 5ALSA 3QT7A 2D74B 1DRGA 5H9EJ 2PMZD 5IWAF 4WZMA 4F5NA 1IBKH 3C6TB 1MNEA 1H98A 3S01A 4PWDA 4EFBA 1ZM3A 1VQMS 5AM4A 4B3TJ 1K6WA 3JRWA 2K7KA 3KMSA 4CYUA 2RU9A 5HP1B 2G5IB 5KT2A 4DX8H 2QO3A 1QVGR 4CQBA 1JLCA 2UP1A 2R7NA 4JI3F 4RDWA 4Y2JA 4UW2A 1FEZA 5J1NA 5B7WA 4BJHA 1UA0A 1H3DA 2MKSA 1EUCB 1HNVB 3W9IA 3BPDA 3MR3A 2BUNA 2C3OA 3HB9A 3IDWA 3CJ3A 2EZXA 4O5KA 2HFSA 2RHQB 1SI9A 4LF4F 1RYSA 1POJA 1L2ZA 5LXXA 5KFGA 1NHKL 2I9UA 1JLQB 3P5TL 1X6JA 4TY8A 1WC0A 1BWEA 2OPRB 4CH1A 2V2VA 2P6SA 3HILA 2NU7B 1YJVA 3CJ5A 3BE7A 1Y5NB 1KTVA 2B9YA 4ZP6A 3W66A 4X62J 4LH6A 1TWAA 3LP1A 2W24A 2L9WA 1ZHQA 2MY8A 3MUVP 2H51B 2LDYA 1RT7A 2W4CA 2CW8A 3NRZA 2G2YA 1J5OA 2FP4B 4ECVA 3C23A 4PHEA 2XMAA 5J2PB 5ALKA 3J7YU 3SAGA 2KB2A 5KFNA 7ICLA 5ALZA 3QRRA 2F9DA 1N34F 4QJFB 1URRA 2FHOB 2NYHA 3H0GG 1IBCB 1NCLA 4HQ6A 4KLUA 3P8BB 4IRDA 5C42B 3A1YG 4J9KA 1JQGA 2OYYA 2JA7G 3OJSA 1LWCA 3GGMA 3FMBA 2I1QA 3PNIA 5D6GA 1KJ9A 4OYIA 4MIWA 2R2RA 1NSQA 4QZDA 1PJ5A 1P9YA 2WK4A 2WW8A 4BY1G 2XMUA 3U1MA 4PL1A 3VCBA 4FNIA 8ICZA 1YRRA 3G6XA 2UXCJ 3QUCA 3CCTA 2NUHA 2EH9A 3GFZA 5J2BA 1NK8A 3TZXA 3NLCA 3HFVA 1IKVB 4RBTA 4ZN3A 2GGPB 3MWMA 3D67A 5FLMG 1N8RT 4OV6A 1A0OB 4DV6F 4LH7A 1M7JA 1Y1VA 2EC2A 5TISU 2FUG9 3SSRA 5AIAA 3ZZOA 4B08A 1R0CB 4NWBA 4YAKB 2WB1E 1PJ7A 3RH6A 1SV4A 4AP9A 4UCSA 2CQYA 2VPWB 4ZOSA 2NZCA 3QATA 2GJFA 2EBGA 4DR4J 4OLOA 5JMNA 4LZDA 3JPPA 3M2RA 3QGIA 2MZRA 2CZVC 3GR1A 4KHPH 4QIWC 1T8EA 2DGOA 3K5MA 4ZDNA 4M9UA 4Y2TA 4KITB 2MLZA 2KJWA 3ZD9A 3W62A 2XS7A 2I38A 5DLGA 1FHTA 3GPAA 2HBJA 3PIOQ 2NCKL 5T7LB 1K8AT 3BEGB 4NA3A 4DPUA 3J81Y 2ZIUA 3E3XA 2B4UA 3C3LA 4RWXA 4PUOA 5CA7A 3OTOH 3AQOA 3UDCA 3RJHA 3DRRA 3H8JA 2RF2A 1FE0A 4ETSA 1FWBC 3T81A 2JSXA 3VC8A 2QV6A 5E2QA 2I9GA 3KLGA 1VC0A 5HROA 1H0HB 3RBDA 4A47A 1N54B 4Z7YA 2EAOA 3SQIA 4R25A 4IC9A 3SFUA 2E7XA 1SGGA 1ZD2P 3LGMA 3I12A 3NG8A 2R18A 1CJKA 2R7VA 2XNQA 1GKPA 1WEXA 1FWIC 3Q8LA 2KM8B 4X2BA 4L6V3 5IS2A 1U1PA 2B4PA 5FLXW 4BKNA 3O1LA 1N61A 1T9YA 2CZ9A 3RJMB 3TX8A 3E5NA 3R5DA 1NPPA 1KOHA 2BCVA 9ICQA 2IOFK 3QU4A 1X5PA 2XWXA 2DCUB 1TR0A 4IOBA 2NUAB 1HYSB 3HLUA 3SD7A