4F4XA

Y-family dna polymerase chimera dbh-dpo4-dpo4 #2
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
342
structure length
342
Chain Sequence
MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSGRTKTSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQDEYNEPIRTRVRKSIGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase IV
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
total genus 113
structure length 342
sequence length 342
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF11799 IMS_C impB/mucB/samB family C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f4xA03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f4xA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f4xA01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f4xA04
3TFRA 2FLLA 4YG2A 3BQ1A 2KFNA 2B43A 5IIJA 4ELTA 1IM4A 1U48A 1S0MA 2B6AB 5HHIA 4G1QA 4O3RA 2HHVA 4R8UA 5C42B 5CB1A 1S0NA 2FLNA 4WFYA 2W9CA 3M9NB 4LSNA 5KFKA 2ZKUA 9ICQA 2NRZA 1ZQCA 1Z00B 3BSNA 4J9QA 2ZD1A 4Q0BB 3THVA 2ZE2B 3EZUA 4MKBA 4P4OA 2P66A 2UVRA 5IIIA 1BQNB 3CWJA 1VRUA 3QGIA 2Q0ZX 4RNOA 4FBUA 4C8KA 4DQPA 3M8QA 4ZPBA 2ASJA 3LWMA 1NK7A 1N48A 1J5OA 2NRVA 3OL6A 3CJ2A 2ZUDA 4TURA 4KO0B 4TN2A 1HMVB 3DOLB 2ZJ5A 2VA2A 3C6UA 3ZDDA 3QLHA 4MK8A 3ORYA 4WZQA 1H38A 4ELUA 4KBIA 3B0XA 4UB5A 3C5GA 5J2KA 1HNVB 2PFPA 2DPJA 3C6TA 4KN4A 2VG7A 2OPRB 5HLFB 4DL5A 2WB4A 4WYWA 3RJHA 4IG3B 5KFCA 1TAQA 1KLMA 3M8SA 2JEJA 4QWAA 5CA7A 3GIIA 3G6YA 3KLGA 1IKWA 3BQTA 5IIKA 3BREA 2ZTDA 4M9GA 7ICIA 2ZUBA 2E9TA 8ICRA 9ICKA 3DLGA 2HMIB 3Q8QB 4RNHA 1NK5A 3MR6A 4RQ7A 3TAMB 4DWIA 3QO9A 1ZQWA 4MKAA 3DM2A 3RH6A 4WE1A 2OPQB 4Z6EA 4WYLA 1HJPA 5HROA 1SL1A 3GIMA 3V7JA 4DSIA 2R2RA 2I1RA 2HW3A 2B5JB 3I5BA 3PR5B 2AWZA 5KFJA 5J0QA 2IJFA 3N4MB 3Q8KA 1LWCB 3I5CA 2IHMA 2XY6A 4QZ9A 4RNMA 4F4YA 3RB3A 1RT5B 4M2YA 1DGSA 1CSJA 4M6WB 1XSLA 2W9MA 1S1VB 3BR9A 3RAQA 3T5LA 1RTJA 2FVCA 4ZH4A 5KFIA 3DLKB 2E9ZA 8ICKA 3IG1A 1ZQNA 1D0EA 2UVWA 4YN4A 4O3QA 4I2HA 1U4BA 3MEDA 3GQCA 4NLSA 4YQWA 4DL7A 1ZQBA 1ZQVA 3V4IA 1X9WA 4RQ6A 1U45A 2HHWA 2WRMA 9ICTA 1REVB 1ZQRA 1JLQB 2VG5B 8ICAA 2JC0A 4RQ4A 3MR2A 1HUOA 1TL3A 2YNGB 3CJ5A 5KFPA 2YNFB 3BDPA 1OS5A 2FJVA 4NLKA 2VA8A 3KJVA 4PH5A 4C8NA 4C8LA 3CJ4A 3JSMA 2GC8A 1XSPA 4I2CA 2W7OA 1EETA 2ISPA 2R8HA 2JC1A 5DG7A 2AJQA 4RW4A 3AUOA 3TFSA 9ICBA 2D3ZA 4DLEA 3C23A 4O5KA 5HMLA 4R66A 1TK8A 9ICHA 4R8UB 4E0DA 2BANA 4X2BA 3GV5B 4EO6A 4R65A 1ZQTA 2F1HA 1JLBA 2W9CB 1Z4UA 1S1XA 1Z3EB 4DLGA 4LSNB 5KFUA 4QWEA 5KG7A 2H5XA 5D46A 3H7IA 5KFRA 4RQ5A 2R8KA 4ECTA 2BPGA 8ICFA 4WXOA 3MEGA 1VRUB 2KZZA 1NJZA 1QSSA 3UR0A 3JYTA 3OLAA 3N6MA 1U09A 2R2TA 1NK8A 3M8QB 4YD1A 4NLNA 4MIAA 1J5OB 4O3OA 4IH6A 2XY7A 1QSYA 2FMSA 3ZDBA 4I2QA 4RQ1A 4F50A 4KLIA 4KLSA 3QLHB 1QAJA 4NLQA 2C2DA 4M04A 3I0RA 1D8LA 4KLFA 5TZVA 1ZQYA 3KK3A 4GC7A 4NLDA 2VA3A 2AQ4A 4ZVHA 3C6TB 2VG7B 4QZ8A 3V6DB 4MFFA 3MECA 3UXNA 4FO6A 4JV2A 3ZD9A 5T14A 4WFXA 2F1IA 1KLMB 4I7FA 4IQTA 2RDJA 4IKAA 4LZGA 3KLGB 9ICSA 5J2PA 1MC8A 3LP0A 3OHAA 3V6HA 1EP4A 9ICVA 3QO9B 1IKVA 4M9JA 4KSEB 1RTHA 2YNHA 4RT3A 4WE1B 4NLWA 4ED0A 5HROB 2FPLA 9ICJA 4I2BA 1SH3A 9ICPA 4NLVA 4QZBA 4ICLA 3V6KA 1NK0A 5K14B 1UWBA 4J9NA 1LW2A 1LW0A 4RW6A 4TLRA 4OL8A 4EZ9A 4Z6FA 3DRSB 3OL7A 5J2AA 2WOMA 4K4VA 4RPYA 5KG0A 4ECQA 5IINA 9ICUA 3K4GA 3BQ2A 3RRHA 1S9FA 1C0TA 3D5MA 5KFWA 2MUTA 1KFTA 2JZBA 1C0UA 3HVTA 9ICWA 3H2LA 3ISCA 3QIPA 4KFBA 3KLFA 5DBCA 3PW5A 4QWDA 5KG5A 2W9BA 1RTJB 4KMUA 4ECUA 3IG1B 3QEBZ 5CYMA 1JLAA 4F5NA 4Y2CA 4O4GA 1BQMA 3H4BA 2FPMA 3MEDB 4ED1A 4B3OB 1CUKA 2YKNB 1NHVA 4KLUA 4KE5A 3C2KA 1RT3B 2HHSA 5DQGA 2IBKA 2OWOA 4IFYA 1TL3B 3ZDEA 4QZAA 2HHUA 4F4ZA 2W9AA 2UUTA 3BSOA 5L1JA 4QZFA 3KJVB 3JSMB 5BOMA 1NOMA 1RZTA 2XC9A 4DOCA 2Y1JA 1QTMA 1KEJA 1EETB 3ETLA 4KLJA 3T19A 2XO7A 7ICOA 4RW4B 2WCXA 4I2DA 4EYIB 2ZTCA 4F5PA 4ED8A 2BCRA 2BANB 1KLNA 3IGVA 5EWGA 4F3OA 2V4RA 2IM1A 1JLBB 2I1QA 4ED6A 1SH0A 8ICYA 4WZMA 1LV5A 1XR7A 5C25A 3PR4A 8ICZA 3QYYA 1TVAA 1D8YA 2BHNA 4JK1A 4F4WA 1RTIA 4MIBA 1RPLA 2XGQA 3C5FA 3VQSA 4NLXA 3MEGB 3GYNA 4QZIA 1S1WB 2J6SA 1SV5A 2QE5A 5KFYA 4K4YA 1JXEA 1S48A 4IR9A 3GILA 4KV8A 4XPCA 3HHKA 2D7SA 3HT3A 4EZ6A 4F8RA 5F9NA 3ISBA 2BRKA 9ICIA 4KLQA 4I2EA 2KTQA 2BDPA 4O44A 3Q8MA 4I2QB 3RBDA 1L3SA 4TQSA 3MEEA 4IG0A 3OSPA 3I0RB 2EC0A 4HYKA 1TL1A 4MFBA 4O5CA 2AU0A 3UQ0A 2HHXA 3SZ2A 2ILYA 2ZTEA 3MECB 3KK2A 1RT7A 2OPSB 3TVKA 3NAIA 1KRPA 5KFSA 3H5SA 3IRXB 2BCUA 1RA7A 4I7FB 7ICVA 3AU2A 1GX5A 1K1SA 2W8LA 1C1BB 3LP0B 4F5RA 2AX1A 3FYHA 7ICJA 8ICNA 5J2CA 3PW7A 3OL9A 1EP4B 5KFEA 3KMSA 4MFCA 2RKIA 1IKVB 1RTHB 4JV1A 1FK9A 2YNHB 2M9NA 3ISNC 3SFUA 3MR3A 8ICMA 4M0AA 5KFMA 4M94A 3DI6A 4MEYA 4KLLA 2R8IA 3FSIA 4ICLB 2C22A 5J0RA 4IQUA 1LW2B 1MMLA 1BPDA 4JWMA 1LW0B 4RW6B 1HQUA 1KHVA 4YVZA 2C2RA 1T4GA 1RXWA 5KT2A 4PUOA 3H98A 1S1UA 2WOMB 1SKSA 1NKCA 1TQLA 1D1UA 3H5UA 2FVQA 5KFZA 4IFVA 2BE2A 1C0TB 3CJ0A 1COOA 1JXLA 2FVSA 2MUTB 1TVRA 3NAHA 2JZBB 4H4OB 1C0UB 1ZQFA 3HVTB 4NM2A 4O9MA 1DTTA 4ZP6A 3MFIA 1TFRA 4KFBB 5F8NA 1MSWD 4F4XA 3KLFB 4NLUA 2QV6A 1C7YA 5J0WA 2AGPA 2GIQA 1RT1B 4QZHA 1ZQQA 3ICLA 2W9BB 7ICQA 1NKEA 4C8OA 5J2QA 5CYMB 4NRTA 2IMWP 1JLAB 4O4GB 3HKWA 1BQMB 2PXIA 3RH4A 1X2IA 4I2JA 3RJIA 3K75D 4NZ0A 2WONA 5CWRA 1ZQGA 4UB1A 4IFYB 3T5HA 3B0YA 2I9GA 4EBDA 1NJWA 1S10A 4XA5A 2OH2A 4B9NA 3MBYA 4RW7A 5D49A 1TK5A 1T05A 3DRPA 3MDCA 3RJGA 3PX6A 1WCLA 4RQ8A 4QW8A 1JX4A 9ICFA 1LB2B 4URGA 3E01A 1TV9A 3Q8PB 2D3UA 3FDSA 4DFJA 4O3SA 1QE1A 5J0PA 1JLGA 1ZQMA 4DS4A 4TUSA 3SYZA 4QZCA 1RTIB 4ECZA 3ZDAA 2WK4A 3PW4A 2VG6B 1NJXA 1SV5B 2GIRA 3LAKA 1SZPA 1NK4A 4EBEA 1D9FA 4B9UA 1EXNA 4YXMA 4I2PA 2YKMB 3QZ8A 4NXZA 4UB4A 2ZUCA 4UB3A 2FMQA 1JIHA 2FJWA 4KB7A 4DF4A 2F8EX 4O44B 4K4ZA 4ZMMA 2FLPA 5L1LA 3MEEB 4IG0B 3CO9A 1TL1B 4MFBB 4RUAA 4YMNA 3RJJA 2RF2A 4DL4A 4M95A 3KK2B 5IILA 1S9GA 3UPFA 1RT7B 1N6QA 5DB7A 4KLDA 2IA6A 2HNZB 2AQ0A 4DQIA 4TUQA 3H8SA 2Y1IA 2IAJA 5BOLA 4LVSA 4IQVA 4ZPDA 5KFGA 5J0SA 5I3UA 5DDYA 5BPCA 5IIMA 3CDUA 4ZPCA 1FK9B 3M8PA 4PWDA 3RR7A 4I28A 4MK7A 1YVFA 1TKZA 3DI6B 4G1QB 1S1TA 3G6VA 1NHUA 2R2UA 4XQ8A 5KG2A 3KLHA 4Q45A 4YR2A 4K4IA 3UXOA 1DTQA 3DRRA 4DQRA 1HQUB 9ICXA 5EDWA 4DG1A 2RDIA 3EWAA 1S6PA 4PUOB 1S1UB 4KHMA 2ZD1B 2IJNA 4Y3CA 4R5PA 1T94A 5J2DA 1SL2A 4IFVB 2BE2B 5DB6A 1RT4A 2BPFA 1DTTB 2OPPA 3HPOA 3EPGA 4K4HA 5I42A 1L3TA 4TQRA 1ZJNA 1UT5A 5KG6A 4K4SA 5HP4A 3NGDA 4DOBA 4NCGA 5J2QB 2HVHA 1DLOA 4M9NA 4BWJA 4BGDA 1ZQPA 4EO8A 3RAXA 3C6UB 4O3PA 1B43A 1JLFA 4ED3A 4DFKA 1S0OA 3OSNA 9ICGA 2WONB 3TANA 3OJSA 5DBAA 3MF5A 3DOKA 3N97B 5HP1A 4GXJA 2XCAA 5FDLA 3OLBA 1QSLA 3MTKA 5CJ7A 4RW7B 3JPTA 5HNKA 1RYRA 5J2NA 4DSKA 4KTQA 4DSFA 3DRPB 3LP2A 1IKWB 4XRHA 2FMPA 1QUVA 1X9SA 2J6UA 1XC9A 2BCQA 3DLGB 3KTQA 4DL3A 3ZDCA 1RTDA 3NKYA 3G86A 3DM2B 3N6NA 4ECWA 3GV7B 3AU6A 5DB9A 3E01B 8ICCA 1ZYQA 5KFQA 1CEZA 4RW9A 5KFHA 4GLXA 2PFOA 1ZTTA 3KLIA 1JLGB 4RZRA 1MU2A 3LANA 4R64A 4YMOA 3PW0A 2GWSA 5KFAA 4ZVGA 5KT7A 3T5JA 3PNCA 3M8RA 1FKPA 1BPZA 4KAIA 3NMAA 1WCNA 4RUCA 8ICGA 2IM0A 3NL0A 1XU4A 1UA1A 4I2PB 4NLOA 1HQEA 2XI2A 2DFLA 1ZQJA 2IM2A 1RT6A 2BQRA 2FVPA 5KFTA 5DQHA 3TAQA 4ZP8A 5KFLA 4Q43A 1U47A 4IRKA 1C2PA 1PZNA 5HMMA 4F92B 1RXVA 2IC3A 4IR1A 2JLEA 5KTQA 3UQ2A 3H59A 3T3FA 3CVKA 8ICEA 2RF2B 4ZP9A 3UQSA 1S9GB 4Y2AA 3V4IB 5JUMA 4I2AA 1T03A 3NTUA 5HBMA 8ICLA 3RJFA 3QZ7A 2ALZA 4DSEA 2IAJB 9ICAA 3T1AA 4ZVFA 4IQXA 4R63A 4KO0A 4YR0A 5KG1A 3TQ1A 8ICWA 4K4XA 5I3UB 4PGXA 4B9VA 3DDKA 4QPXA 3IGNA 3MR5A 3JPOA 3KK1A 4Q8EA 3H4DA 4MF2A 3ISND 4O5EA 1N4LA 4PHDA 1BPXA 4FBTA 3V72A 1TKZB 5J0UA 1S1TB 3MFHA 5CYQA 5KFBA 3KLHB 3PHEA 1A77A 4PPXA 8ICUA 1KTQA 2BR0A 1DTQB 1BVSA 5KFVA 1S1XB 3DRRB 1UT8A 1L5UA 4KITB 3BJYA 2MAXA 4DG1B 4KLEA 1S6PB 2FJXA 4XPEA 2JEFA 4R5PB 3HP6A 5L1KA 3PY8A 4KLMA 4IRDA 4H54A 2B21A 1RT4B 4M9LA 4F5QA 3RJEA 1KHWA 2E9RX 8ICPA 4LQ3A 4TYBA 1L3VA 2OPPB 2PFNA 7ICEA 4URQU 4RU9A 1ZQLA 5I42B 7ICTA 3KHLA 1LWEA 1UA0A 4YXJA 4IRCA 1RT2A 1S77D 3JYTB 8ICOA 3OJUA 7ICLA 4NCGB 7ICMA 3QIDA 4PGYA 1KSPA 4IH5A 1DLOB 3PW2A 1XR6A 4GXIA 1NJYA 1LWCA 2HVIA 2C28A 3C2LA 4ECVA 2V4QA 3HX0A 1KFDA 7ICUA 1RT5A 1D9DA 2NRWA 3KK3B 1K1QA 4QW9A 2ZJAA 4CCHA 2BRLA 3KHRA 3DOKB 1BGXT 1JLEA 2ISOA 4I29A 1HUZA 3JPPA 1TAUA 4NLZA 5EOZA 1S6QA 4XUSA 5FDLB 5J29A 2R2SA 4RQ3A 4MFAA 3GDXA 5J2NB 2ASLA 2BQ3A 3LP2B 2I5JA 8ICTA 5J2PB 2ATLA 1S9EA 3SV3A 4K4GA 4F5OA 4F91B 2AGQA 2V9WA 4I2FA 1MQ2A 2ILZA 1RTDB 5J0XA 9ICNA 5F8GA 1IKYA 4H4MA 2VG5A 4UBBA 3RRGA 8ICIA 3RB4A 5J0YA 1N5YA 3DLEA 2YNFA 7ICFA 2UVUA 4KLHA 2R8JA 2XY5A 5J2HA 3N6LA 4I2GA 3KLIB 1UWBB 3MDAA 9ICCA 4KLTA 3T5KA 1UNNC 2YNIA 1L3UA 4MK9A 2HAIA 3I0SA 1ZQDA 4J9OA 1FKPB 1ZQXA 4JUZA 5DGBA 4FS1A 5KT3A 3H5XA 3QGGA 1HQEB 1LWFA 5DLFA 1HNIA 9ICOA 4F2SA 3QIPB 4G3IA 1RT6B 3DYAA 3PO5A 1Y88A 3V7KA 2HWHA 3H5YA 4IDKA 4ZPAA 5C24A 5KFFA 3C21A 3KLEA 4ZP7A 2IC3B 4C8MA 2J6TA 5HHHA 4O0IA 4ID5A 1N56A 5DGAA 3OL8A 4PQUA 4RPZA 1C1CA 3MABA 4TY8A 2C2EA 1T03B 5HBMB 4YFKA 4J9MA 5DLGA 1TP7A 4K50A 4KKOA 5DKWA 4YMEA 1RDRA 1ZJMA 1ZQZA 3LWLA 5KFDA 4KLOA 2P6RA 4YCXA 3ZD8A 3PJXA 4NLGA 2HHTA 3I5AA 4RW8A 4R0EA 3KK1B 5KG4A 4MF8A 2HNYA 3M9OB 3V6DA 5L9XA 2NRTA 3Q8RB 4TUPA 2AGOA 4DS5A 5CYQB 4DFMA 4JWNA 1IKXA 4O3NA 3BGRA 4B9LA 2W8KA 4J9KA 2W7PA 4URSA 1RA6A 1R0AA 3V6JA 5DG9A 3DMJA 5C25B 4TYAA 5F9LA 3EZ5A 1MQ3A 4B9SA 5IIOA 5J2MA 4QZGA 3GIJA 9ICLA 3MGIA 5DDMA 5DBBA 5CR0A 5F8IA 4PHAA 1TKTA 1LWEB 1RT2B 5K14A 4I27A 2WHOA 4KV8B 4XO0A 3DRSA 8ICHA 3JPQA 5KT5A 5KFNA 5KFXA 1W25A 3FQLA 3ITHA 1DOQA 2LYHA 5CP2A 3SV4A 2KZ3A 1XS9D 1SUQA 4I2IA 5F8HA 3PVXA 1JLEB 3HW8A 3FRZA 4PGQA 2BCSA 1S6QB 4Z6DA 9ICRA 3BSCA 5J2BA 5EWFA 4ECXA 3PO4A 1S49A 3QGHA 3UDLA 1X9MA 4DEZA 3M9MB 2I5JB 4BWMA 3PV8A 1S9EB 1S0VA 3LAMA 4B3OA 4Z6CA 4DSLA 2YKNA 3RH5A 3Q8LA 5J1EA 2RKIB 2O5DA 4JV0A 4PHEA 1IKYB 4UB2A 4H4MB 4P2HA 1RT3A 4QWBA 4RPXA 2ASDA 4Q8FA 1N5YB 1T8EA 1JLCA 4F4KA 3KHHA 1HPZA 3DLEB 2XGPA 4WFZA 4O4RA 4ZHRA 1T7PA 4BXOA 2ZJ8A 1TK0A 1S76D 4YMMA 1S97A 2YNIB 5JXSA 3RJKA 4ED7A 3I0SB 1VRTA 3RTVA 5D3GA 4TY9A 4RNNA 1XR5A 1FKOA 1TVRB 2AX0A 1LWFB 1NK9A 1HNIB 2HNDA 1GX6A 3DYAB 4P4MA 1ZQIA 4IDKB 2A1JA 5C24B 2PI4A 3KLEB 4RT2A 4RNFA 3LDAA 2R8GA 4DFPA 4ID5B 1JMSA 3LALA 1S1WA 4TXSA 4PQUB 2KZMA 3FQKA 3C1ZA 4UBCA 1C1CB 1SH2A 4TY8B 3PMNA 5L1IA 4EBCA 3D28A 4MH8A 4KKOB 4UAWA 1QLNA 4RQ2A 5KG3A 3CIZA 4U7CA 5KT4A 4EEYA 3TAPA 3FFIA 2JEIA 3OGUA 1HYSA 4DF8A 5J2GA 1XWLA 5DG8A 5J2EA 3PX4A 4FS2A 4RW8B 1T05B 4NY8A 1ZTWA 3NBPA 4J9PA 5J2FA 2HNYB 3LP1A 2D41A 8ICJA 2V0NA 2OPSA 7ICKA 4KN7A 5J0OA 3BQ0A 1IXRA 4QZEA 4KHRA 2IM3A 4RQ0A 3IRXA 3TARA 3ISDA 3V81A 1BPBA 1ZQKA 1B22A 1IKXB 4DL6A 3IS9A 4PHPA 3QEAZ 5J2IA 1ZQOA 3BGRB 3IM1A 1RAJA 2JEGA 1C1BA 1JKHA 2IHNA 4UAYA 1R0AB 1ZQAA 3DMJB 1TV6A 4LSLA 8ICVA 1QE1B 2BKEA 4EYHB 5J2MB 3QE9Y 1BPYA 2UVVA 4QZDA 1TKXA 4IH7A 3E2EA 4J9RA 2NRXA 3PJWA 2B6AA 7ICHA 2XWYA 5C5JA 3CDWA 1TKTB 4NRUA 2WTFA 8ICQA 2BQUA 3BSAA 5C42A 3CDEA 3EW9A 2KFZA 3PMLA 4KLGA 4NLPA 2BGWA 4YD2A 4GXKA 4NM1A 3H8WA 3EPIA 4IQWA 4DL2A 2FPKA 4Y34A 4J9SA 1Z00A 4YP3A 3SI8A 4K4WA 4Q0BA 2ZE2A 5DQIA 3ITHB 1SKWA 3GV8B 3RB0A 4H4OA 4M9HA 1SKRA 1BQNA 5J0TA 3KNAA 1SUQB 5D4BA 4P4PA 4LZDA 4ECRA 4MEXA 4U6PA 1N6QB 1RT1A 2BPCA 2F1JA 7ICNA 1XSNA 4NLRA 4F93B 1HMVA 7ICSA 3DOLA 4DSJA 3UXPA 1WNEA 4UQGA 3KHGA 5CHGA 4DQQA 1HARA 2VANA 1NK6A 3PZPA 5J1EB 1AROP 5EWEA 3M8PB 1HNVA 1I6JA 3RBEA 3MGHA 4ECSA 8ICSA 8ICBA 4PWDB 1V9PA 3RR8A 3HVWA 4ELVA 2OPRA 1JLCB 1HPZB 3SFGA 2BCVA 5HLFA 4GC6A 5KT6A 4ZHRB 4ED2A 3HVAA 2FVRA 1ZQHA 4Q44A 4BXOB 3EYZA 4IG3A 3H8JA 2P6UA 1KFSA 3V7LA 3KLVA 1ZQUA 3IHQB 3JPSA 2KN7A 4DQSA 3Q8SB 1TKDA 2HMIA 4LQ9A 3TAMA 4WXWA 2PI5A 1VRTB 5D3GB 1FKOB 4ZVEA 2OPQA 5EUHA 2CKWA 9ICMA 3LK9A 4IOBA 5J2JA 2HNDB 9ICEA 4HKQA 1T3NA 4M47A 8ICXA 5F8MA 2B5JA 2A1JB 1S4FA 3IN5A 4K4UA 4F2RA 1XO1A 3UPQA 3HWTA 2VG6A 4QWCA 3G6XA 1QAIA 1NNDA 1JLFB 4K4TA 3C2MA 2XCPA 1KDHA 4B9TA 4NLTA 4BDPA 2YKMA 3C1YA 3RB6A 4M6WA 4NLYA 5F8LA 5HP1B 1S1VA 4ECYA 7ICRA 3FFIB 1HYSB 1ZQEA 3H40A 3GFKB 3KOAA 7ICPA 1ZETA 5KFOA 3JPNA 3DLKA 1ZQSA 4NYZA 2DPIA 5F8JA 1JN3A 3OHBA 2CJQA 3NBPB 3E51A 1BPEA 7ICGA 2PFQA 1A76A 3CJ3A 1U49A 1SL0A 1NKBA 3LP1B 4B9MA 4DO9A 2HHQA 2XI3A 4X5VA 5DB8A 1REVA 1U9LA 2HNZA 1JLQA 2HWIA 3V81B 3GIKA 3IS9B 2YNGA 3JPRA 1JKHB 4RW9B 3KMQA 1RYSA 1TV6B 4LSLB 4YR3A 3PX0A 4J9LA 4DOAA 1MU2B 2UUWA 3TI0A 1TKXB 4UAZA
chains in the Genus database with same CATH superfamily
3TFRA 2YPYA 2P9GA 3IA0A 3HJVA 2FPIB 5I3QA 2JA5A 1O51A 2B43A 5IIJA 1HBOA 3G6ES 2P2CB 2J5AA 1S0MA 2B6AB 5HHIA 2PUZA 3KNGA 1PJ5A 1EJVC 3AH6A 5C42B 1TWGA 5CB1A 4LFBJ 1S0NA 3KJFB 4O23A 2WAQD 4BS2A 3G87A 1HWLA 2ZKUA 3SR6A 9ICQA 1Y3JA 2NRZA 4L3KA 5AE2A 2YX4A 2ZD1A 2EAPA 3EZUA 4DV1J 4NE9C 4P4OA 2P66A 3J80U 5IIIA 2WSFC 3T1YJ 1VRUA 1ZAWA 4DR5J 5K9FA 4FBUA 4QJFA 5AJ3F 2UU9J 4MV7A 4HACA 3M8QA 4LFBH 4DPYA 3OL6A 2B6GA 3UNYA 4KO0B 2E8NA 3W2WA 4A93G 3CCRS 2M70A 3DOLB 3SQGA 3NGKA 4OLOA 2NU8B 2F9DA 3C6UA 3DV9A 3QLHA 4MK8A 5IC4B 4XTTA 2JA5G 4P2XA 3B0XA 2X7IA 4DV1H 4DMZA 3C5GA 5J2KA 3PYDA 4ZN3A 4W4MA 3T1YH 2OPRB 2PE8A 5HK4A 2R86A 4DR5H 3GRIA 2P53A 1N34J 2K8GA 5CCLA 4XYLB 5KFCA 2UU9H 3HOZG 1KLMA 1N63A 1SIZA 4OJOA 2FIUA 3WK7A 4M9GA 2MKKA 2PFFB 2LLZA 8ICRA 2KK0A 3ETRA 2HMIB 3SENA 4RNHA 1NK5A 1GXUA 1F9FA 3WDOA 2XLJA 1JI7A 2V4JB 2Z00A 3T1HJ 2H3QA 4C11A 4YS2A 2OPQB 2W11A 3NNHA 3W63A 2RD5C 3CXCR 4WYLA 1HJPA 4BJQA 5HROA 2R2RA 3Q1KA 2Q79A 1AXQA 3SD7A 3FBCA 2M2BA 2FHMA 3I5BA 4AYBD 2IJFA 4UCOA 2VFVA 4UCTA 3JSBA 3N4MB 1N5TA 5TISU 3TRGA 1VFJA 3QGKC 1G4CA 2HBQB 2XY6A 4UW9A 4RNMA 3T1HH 4M2YA 4M6WB 4UBPC 4EG0A 1XSLA 2Y9UA 3ZNJ1 4NXMJ 1AYEA 3T5LA 2EPIA 3Q22A 3AA9A 3L4BC 3MM8B 2XTJP 3BR8A 4MAMA 1D8BA 1W26A 2DRDA 3DLKB 1ZQNA 2CZ4A 3NMRA 4I2HA 1OXJA 1IJFB 4K0KJ 2R7WA 1AUSL 2JWNA 3QRQA 3IO1A 1WSVA 4DV2F 4YQWA 1HNZJ 4RQ6A 4NWBA 1ZQRA 1JLQB 5AK4A 3M2VB 1IBKJ 2ES6A 3N43B 3MR2A 4FYXB 4F02A 5GADI 4MV3A 3CW2C 4USKA 4WHBA 4NXMH 3BDPA 3LA0A 3HSDA 2QC3A 4NLKA 2IOHA 3KJVA 4PH5A 3CJ4A 2GC8A 4I2CA 2G2YA 2W7OA 1EETA 2ISPA 4F4AA 1I7LA 2JC1A 4UCVA 2AJQA 5A8KB 1RBOB 4K0KH 3ZZZA 4CEUC 3TFSA 2ZVIA 5I47A 2D3ZA 1HNZH 3BKTA 9RUBA 2DD8S 9ICHA 4X2BA 1UC8A 3VCDA 1NM2A 3OFEA 4LF7J 1IBKH 3OVBA 2F1HA 1JLBA 1Z4UA 1Z3EB 2IVFB 4JI2J 1F3FA 1FXRA 4Y28C 5GAGI 1H98A 2WB1A 1RTZA 3M8YA 5LMNF 5D46A 1VIOA 2X3GA 5J1PA 2YMPA 2OAUA 2R8KA 4J9VA 8ICFA 3AEVA 1TL7A 3D0IE 2KZZA 5C8YF 1X6IA 2KVQE 4PXEA 2VHGA 4EGJA 3CRXA 3R0DA 2R2TA 2MQPA 3DLJA 4YD1A 4LF7H 2A10A 4MIAA 2VUNA 3CQZA 4O3OA 1W96A 9ATCB 2XY7A 4ETSA 4JI2H 2B7CB 1L7MA 2EAMA 4UQTA 2FMSA 4I2QA 3VVUA 2H48B 4KLIA 1QAJA 1IOVA 2YS6A 3I0RA 5GTHU 5C4XG 4J37A 2EBEA 2AQ4A 4Y6IA 2MKSA 4HVZA 4ZVHA 2VG7B 4X62J 1AQ6A 4QZ8A 3AJ2A 3UXNA 4FO6A 1QUPA 3JAMU 3GTGA 2BACA 5T14A 1FO1A 4IQTA 3TR5A 4OI3A 4LZGA 3KLGB 5C3EG 3OTBA 1U02A 5HN0A 1M6VA 3E58A 4CLWA 5D78A 1PG5B 4BWSC 1F60B 4YY3J 1IKVA 2KJWA 4M9JA 1RTHA 4DR3J 1Q78A 3DDIA 4X62H 9ICJA 2XM3A 3CJRA 4I2BA 2YKOA 1SH3A 9ICPA 1FRIA 2FTYA 5CQGA 1QQ7A 4OI0A 2X1FA 5L9NA 4OJ6A 4OL8A 2K8AA 1E6YB 4EZ9A 4LF6F 2DH9A 3ZZUA 1QCKA 4YY3H 4N7TA 4ECQA 2DNRA 2WW4A 4P75A 3RRHA 3SFWA 4DR3H 2J9CA 1XTZA 4Y00A 2O03A 1UFLA 1C0UA 1ZAVA 9ICWA 3H90A 3JQKA 1YSJA 4CI0B 3UCUP 2W9BA 4Q2MA 4O4LF 1RTJB 2GPSA 4DBQA 2YWWA 3IG1B 1NSQA 3BGOP 5EGYA 4F04B 1L8LA 3H4BA 3KDNA 3MEDB 4ED1A 1U25A 4B3OB 1CUKA 2YKNB 3CJKA 3AD7C 5K20B 2VDIA 1VBZA 4KE5A 2OSQA 4OMFG 2OWOA 4IFYA 3CJ8A 2GAGC 2FHOB 3CDBA 4QZAA 1WF1A 3F5EA 5L1JA 4QZFA 5KL1B 1Q86T 3JSMB 5HMXA 5BOMA 3VAFA 2XC9A 1QTMA 4CH1A 3AHPA 4KLJA 3T19A 5ALPA 4USHA 3ULHA 2XO7A 2WCXA 3BF4A 1M5HA 2K1RB 2HHPA 2APOA 1XIQA 4ED8A 2BANB 4E98A 5J8YA 1KLNA 1HEKA 1FDDA 2B3TB 4F3OA 2L5YA 4HHHA 1FKAF 1ZOLA 3VPBA 4DPTA 1JRPA 3OPKA 2FHJD 4N5SA 1FDNA 2VOPA 4WZMA 3BPDA 4DCJB 2CNNB 1D8YA 2ZUAA 5B0GA 1YT3A 2ROGA 2R6FA 1RTIA 3WKDA 2XGQA 4C0ZA 3MEGB 5EZYF 3LNPA 4TU9A 1KJQA 2JA7A 3GIPA 1S1WB 4EELA 1VYAA 2QO3A 1TWCA 1S48A 4X84A 3ZTOA 3HZEA 4CH0S 1IQTA 4XPCA 4TKTA 4OHYA 1Y5IB 2LM4A 4I2EA 2WVFA 3AJDA 3TZXA 4IHJF 3Q8MA 3ZFVA 3MEEA 4IG0A 2ZJQQ 1D9AA 3IR7B 1RAGB 4KGMA 4LFAF 3C29A 4Y65A 3OFHA 1H2UX 2OMLA 2UXDF 1EUCB 2W25A 2ZNZA 2ZZNA 3MECB 3KK2A 1R8HA 1RT7A 4PZNA 4CLLA 1KRPA 3H5SA 3IRXB 1U2CA 2KRBA 2QARA 1K1SA 4OZNA 1UVJA 2W8LA 3UDEA 3LP0B 1WHYA 3H2UB 1QY7A 2IRXA 1R43A 1WSRA 1VBKA 1YJNS 3OL9A 4R7WA 5FSDC 1N52B 1FK9A 2YNHB 2DNOA 3D9BA 2M9NA 2JA7G 3SFUA 5ALYA 3W2VB 4CYUB 4NPOA 4BX9C 1RLCL 3UBPC 2WYOA 3N42B 3C16B 2HSZA 3FSIA 3Q2TC 4RAZA 5IQQA 2LU2A 1M1HA 2F40A 2H3VA 1BXNA 2RNEA 2FC9A 1MMLA 4RW6B 4OZ5A 3C8YA 4UAUA 1IWAA 3VAJA 5D15A 4PUOA 2O01C 2WOMB 1SKSA 1NKCA 1TQLA 3QAEA 3MM7A 2YQ3A 5AXNA 1ED1A 4NI2B 3GWCA 4IFVA 1TU0B 1C0TB 4QZVB 1COOA 4PAAA 2MUTB 2QMWA 1VQLS 5CABA 2XNRA 4B3MF 1ZQFA 2E1AA 1E9YB 3J7Z5 1TFRA 1U7LA 2KV2A 2HJWA 1B04A 3GU0A 1N8RT 3M7DA 4NLUA 4KMOB 2GIQA 4XIUA 2NXUA 3L95X 2QSWA 5FLMG 3CO0P 3WIUA 2GCFA 3JTNA 4C5YA 5D4PA 4B17A 2CPXA 3RH4A 3VHQA 1WEYA 1V5VA 3QSIA 1NLKL 4I2JA 1VBHA 1E4EA 2XSFA 3AXKA 2AKWB 1RDFA 3VQTA 5ALUA 4NZ0A 4LF8J 3R6LB 2F3NA 1E6VA 4DR4F 4JI6F 4O4HF 2HLUA 2G1DA 4EBDA 1Z2ZA 3DEEA 2A6MA 1CLFA 1FCAA 3UDCA 4JI8F 5ETSA 3R7NB 3RYLA 2QKQA 3WHIA 3GONA 2XWXA 1J5EF 4M1KA 4MA0A 5FLXW 2CQIA 1FE4A 3DRPA 4K8RA 3MDCA 3QU2A 5D6GA 1T9UA 2UP1A 1A0OB 3CC7S 3GCWP 1VS0A 2HGMA 3PYEA 3UFXB 4UY85 3DLHA 9ICFA 4P2FA 1HWJA 1APSA 1Q8BA 3HBLA 4LF8H 3M1YA 2F8MA 1ICEB 4ZJOA 2FJZA 3FDSA 5F3ZA 5ETTA 3SSQA 4KRWA 1QE1A 4IZOA 1ZQMA 5AKJA 1RA5A 4B3SF 3ZDAA 3EUB2 2WK4A 3PW4A 2VG6B 1SV5B 1RQLA 4UAVA 2R7NA 3D2NA 4I2PA 1U2FA 4LJXA 4FNIA 3OVSA 1XRTA 4NXZA 4UB3A 5M2UA 2FJWA 4KB7A 3BEGB 2F8HA 2KT2A 3FC4A 2F8EX 1K5OA 4LFCJ 5IT9Y 5L1LA 3H0RB 2XB2D 3CO9A 4CNYA 5FPRA 2MSTA 5A6WA 4MT1A 3RV4A 4MFBB 1WHVA 2VUGA 3QUBA 3RJJA 2XLIA 4WCEQ 2WZ1A 2N1RA 1KRAC 2V8VA 4OHZA 4MMOA 3F53A 3ET6B 3D0GE 2RSQA 3UPFA 5CZVA 2MQLA 2FE3A 2HBKA 2P0AA 2Y1IA 4ZJQA 4LVSA 2YRWA 5KFGA 3TJ9A 1B33N 4LFCH 5BPCA 2ZZTA 4WBNF 1GMWA 2BM1A 4CO5A 1VQ5S 4V1YA 4PWDA 2RGRA 4AUKA 4I28A 3I4HX 3U02A 3D6JA 1UW9A 1T9XA 5IYCG 2DR6A 1S1TA 1S5ZA 2R2UA 4XQ8A 3S7RA 3NGTA 1PO6A 1BLUA 2KSOB 3DRXA 2FKLA 1T9YA 5IP7G 1N36J 3FMAA 4DG1A 4NJ8A 3EWAA 1S6PA 1S1UB 2DNQA 4KHMA 3UW1A 4M63A 4R5PA 5J2DA 4LJMA 2LM1A 1RT4A 3SIPB 1DHMA 2OPPA 3HPOA 3EPGA 4D3GA 3CGIA 5C2GA 3N5BA 3L4PA 4TQRA 2XS7A 3K3VA 2GV1A 4NA2A 4DOBA 1TWFA 3JZIA 3R5XA 3L09A 2W2OP 4BGDA 3F0NA 4EO8A 1N36H 3RAXA 3GB0A 4R7RA 2OFGX 1WF0A 9ICGA 4ER8A 2XLKA 3HT0A 4Y2IA 4ZPTR 4NXNJ 4ICAA 2YY6A 2I8EA 2XCAA 4NYPA 1QSLA 4RW7B 5G0RA 5HNKA 2C2OB 2CWKA 3MGJA 5J2NA 4AC7C 1CJUB 2H5JB 1IKWB 5L8RC 3K57A 1VCTA 2GMJA 2R7RA 1Z4NA 4IWXA 1RTDA 1UHUA 3G86A 1LVHA 1F5BA 4ECWA 3KKAC 2CJKA 4R0JA 4USVA 2ICSA 5DB9A 1G2EA 1NDLA 2H3ZA 3OTQA 4RR5A 4NXNH 1RZMA 3GIDA 5ALVA 1FD8A 1CEZA 4WJBA 2HMXA 2DHHA 3HCXA 5AKXA 2PFOA 1UJ6A 3UN2A 2GOLA 1JLGB 4RZRA 2A18A 3LANA 4EPDC 4YMOA 2GWSA 3QUTA 1MW7A 1B0PA 4ZVGA 5JVLA 3OBIA 1U2RA 1VQ4S 3I31A 1KOOA 4XX0B 1F0XA 4OX9J 4FVMA 4XZ3B 2DXEA 8ICGA 4RUCA 3NL0A 3O5TB 2G0JA 2YZNA 3RU0A 1MN9A 1RT6A 2H65B 1VBGA 1VQPS 5KFLA 1U47A 4IRKA 1ZQ7A 2RF2B 1GSHA 2W04A 3V4IB 5JUMA 1Y0HA 1T03A 4OX9H 3F2BA 5HBMA 1CJVB 4CRJA 4RLEA 1XMBA 3RJFA 3QZ7A 3GFXA 2MXYA 1AUDA 9ICAA 1OSDA 4LF4J 4KO0A 4YR0A 4DZHA 8ICWA 4K4XA 5I3UB 3IP4B 4A3CG 3MR5A 5ALSA 4MTDA 4XK8C 3G71S 1WKJA 4J7CA 1SQFA 2W1BA 2QEXS 4FBTA 4JI3J 1PX2A 1DQ9A 1TKZB 2E7VA 4ETZA 5ALFA 2HBYB 5CYQA 2MYFA 5KFBA 3CCZA 2FVKA 3KLHB 1RSCA 2CQ2A 5KFVA 4LF4H 3OTCA 3SAGA 1JB0C 1EAYC 3RJ0A 2VZ9A 4KLEA 2FJXA 4CLSA 3W5XA 3R9KA 2V4JA 3K8WA 4U8VA 5L1KA 3PY8A 2WAQA 3A8KA 4KYZA 4TYBA 2DGZA 4JI3H 2MZTA 3KHLA 1LWEA 1H2TZ 1UA0A 3QT7A 3JYTB 1SWWA 2C3UA 4P71A 3OJUA 4NCGB 1F2HA 3HO1A 1KSPA 2G07A 1FWIC 4DV6F 1DLOB 3PW2A 1NJYA 3F8NA 2CJ9A 2KP7A 2B7BB 4ECVA 1KFDA 2ZC3A 3KXDA 2V67A 2MLXA 3KK3B 4I29A 1NI3A 1PJ7A 1HUZA 3JPPA 3BS9A 4C0OC 3AD9C 1ROFA 5ETRA 5J29A 2V2ZA 2VPSA 1IN0A 1S8OA 5IP9G 3WO0A 2I5JA 2LYVA 1XMOJ 8ICTA 1PBAA 2BYCA 3HF5A 4MV9A 1I7NA 1WTFA 3HHDA 1BNCA 2EKNA 5J0XA 1N5QA 2EDUA 1KVJA 1ZD2P 1IKYA 1H3DA 1RADB 4U9RA 3RRGA 4ZJLA 1KEEA 3RB4A 5J0YA 3HD2A 3U1MA 2YZGA 2E2IA 3IR5B 4NA3A 4DOZA 2HHHF 4RDWA 4KLHA 2XY5A 3LS9A 3TYTA 3HOUG 5C7PA 4PL1A 1KP6A 2CXEA 4I2GA 3KLIB 1UWBB 3FZ2A 3AOCA 5IWAF 1XMOH 1QAYA 1SZHA 3I82A 1UNNC 2XMTA 3BZCA 2B9WA 2ZH6A 2I8CA 1A6SA 2HAIA 1ZQDA 2HRYA 4J9OA 1FKPB 2R7VA 1P8GA 2I6XA 1X4DA 2MCTA 4AYBA 3V7PA 4NA1A 1R8CA 2G0IA 2XMAA 2MHEA 2XEXA 1LWFA 1KJ9A 2KE7A 4UB6U 1NXIA 2QYCA 3CCUS 2PEHA 1OUQA 1HBNB 3ENAA 5KFFA 3C21A 2AEJA 3KLEA 4ZP7A 2IC3B 4C8MA 2VICA 2ZHOA 5HHHA 4O0IA 3NNCA 4ID5A 5DGAA 4PQUA 3G82B 3OUYB 3MABA 2K4IA 3NVVA 4KKOA 4EX6A 1U1PA 3MWEA 1ZJMA 3WZ0A 4KLOA 4UT4A 2L48A 2BZFA 2ZVSA 4NLGA 4Q7AA 1DJ0A 1EJWC 4J91A 4OYBA 4RW8A 3BZKA 2HFUA 2HNYA 3MM5B 2NRTA 2O66A 3B54A 3LTOA 3M2RA 3NS6A 1N0UA 3RGZA 3GZ7A 4JWNA 1IKXA 1U6ZA 4H4KA 5L46A 1LFPA 1MG7A 4Z7CA 3BGRA 4B9LA 2W8KA 2W7PA 2V2VA 1FRLA 2ACYA 1RA6A 1R0AA 4EGQA 1FNMA 5DG9A 1SIWB 4GO7X 3DMJA 5AICA 2A3JA 2G0CA 2KM8C 5F9LA 2C35B 1EQMA 4B9SA 4EK2A 1HFEL 2EZZA 3FK4A 2EVZA 4C4WA 9ICLA 3TJ8A 4RDVA 2GO9A 3J80Y 2FE9A 4HHUA 3CUNA 4PHAA 3DU5A 3QGPA 3T79A 4I1TA 4MTPA 4ATNA 5B0FA 3HHEA 2MGZA 4I27A 3FC9A 2WHOA 3M6UA 2RJZA 4I67A 2YU9A 3GLKA 3D3CJ 3K5LA 2DHXA 2OLWA 2QYZA 2PMZC 1NU4A 4RB3C 3NS1A 2MJUA 3A3NB 3ITHA 4LRBA 1DOQA 3SDEA 1M5PC 1VJWA 2LDIA 3O8WA 5F8HA 1JLEB 4RZQA 1F9HA 4QU6A 3FRZA 4UB9A 3SBMA 2QLTA 3DFEA 1WCMA 9ICRA 5EWFA 2Y3YA 1UFWA 4BCAA 1SXDA 3W7BA 5AJ3J 4DN0A 4W90B 3PO3G 1S9EB 3EVOA 2KVSA 2Z56B 4B3OA 4DSLA 2YKNA 3L3CA 3N6XA 3Q8LA 2ZOGA 2XBPA 2N7YA 4NLBA 3QT5A 1SEIA 4ZCKA 5IYZF 1RBAA 1ZXIA 1X5OA 5ALLA 2DNKA 1EUDB 2IVMA 2ASDA 1T8EA 1JLCA 3KHHA 4DUZJ 1HHTP 4QU7A 1PYSB 4ZHRA 1FF2A 1EX8A 2A0FB 4BXOA 2VPZB 3MMBB 2OJ3A 3A12A 2BB0A 5FJ4A 3J7YU 4A3BG 2OOFA 4YMMA 3NRWA 5DDPC 2E7XA 4OX7A 4C5BA 3H0PA 2JX2A 1FFWB 5AKKA 1WWUA 3I0SB 2RE1A 1Q8LA 4A2BA 2HVRA 2DNHA 2VFSA 3BYRA 4RNNA 2FVMA 1WCMG 4B3TF 2HFOA 5F41A 2RUSA 4DUZH 1HNXF 2CZ9A 3TO8A 4HEA9 1FWHC 1EJTC 1UVKA 2E5HA 3H42A 3ENWA 2ZBCA 2YWFA 3W64A 2GMLA 5H9FJ 4JI0F 1LXJA 4FM9A 4UCSA 1JMSA 2DXFA 1S1WA 4TXSA 1HD0A 4KIRA 3EE3A 2CJXB 3KUHA 1C1CB 2RRAA 4TY8B 2E5LJ 4MH8A 3E5NA 3BA8A 1GSAA 2CPZA 2DUYA 4OI6A 4QBUA 2UUBF 3OD2A 4F0RA 5DG8A 2VQEF 3OW2R 4OZ0A 1Q8IA 2MQMA 4EFEA 2XYPB 4RBTA 1ZTWA 3NBPA 2BZ2A 5J2FA 2EWHA 2FGOA 4JYAJ 1NDCA 3WIVA 2W01A 4DV2J 1XJWB 1IXRA 1IIPA 3C15B 3CCSS 3IRXA 2QMUB 3TARA 2E5LH 1M5SA 3CJTA 3FSYA 4DL6A 4AL6A 1QQ5A 3I4MG 5J2IA 1ZQOA 1JKHA 1Q5VA 1RK8A 1A5MC 4HNVA 3M7VA 1S3TC 8ICVA 3VWSA 4GVLA 4N56A 1JUDA 3GR0A 5J2MB 3QE9Y 4QIFA 4QZDA 2Y8WA 2GGPB 1YJRA 3E2EA 2AV5A 2DYAA 1YRXA 2H3FA 2FHJA 4HTIA 2NRXA 3PJWA 4JYAH 3W2VA 4C3MA 2XWYA 5C5JA 1RJPA 1YJTA 4DV2H 1PVRA 4NRUA 2WTFA 2KRRA 3NCPA 8ICQA 2BQUA 3CDEA 3PMLA 1PSDA 2AEMA 3A3PB 3QSYB 4GXKA 4NM1A 4DL2A 1WJ9A 3D7SB 1R9TA 1NSKL 4Y34A 4J9SA 2RIJA 1O8BA 2ZE2A 3WO1A 3HKZC 3RAMA 3RB0A 4M9HA 5J0TA 1SUQB 4JI1J 4P4PA 4MEXA 2MSNA 4P7TA 5F0WA 3K5OA 3KTMA 2ZXIA 3GTQA 4OZ2A 3JAMY 3MWMA 4CNZA 4PR6A 4DSJA 3UXPA 2EFNA 3D1OA 1SC3B 1AROP 2GQCA 5IXUA 3R2CJ 4A8MP 2HQGA 4LT6A 1HNVA 2GWNA 3MGHA 8ICSA 8ICBA 2VBWA 3HVWA 2W2PP 3MM9A 4JI1H 4EWTA 3IR6B 5HVHA 2V68A 2DHGA 1R8PA 4GBDA 3R7BB 1YJ9S 2F76X 4Q44A 4IG3A 3H8JA 3EVMA 1CC7A 1VC0A 2OGUA 2E5JA 3JPSA 2KN7A 4MIWA 1EHWA 3Q8SB 1TUVA 4NZ7A 2OSRA 1U6BA 3TAMA 4WXWA 1RWWB 4C8ZA 2PI5A 2HURA 1VRTB 2CPHA 4LFBF 2FD2A 5HMEA 4UOFA 2MQOA 4HH0A 2CKWA 4UCUA 4P0PA 5ALTA 4U95A 5ALDA 2B56A 2B5JA 2UUCJ 2A1JB 2BE9B 3T1YF 1S4FA 2UXBJ 1XO1A 2VKQA 2AP6A 2VG6A 3BS5B 2OEHA 2BXJA 2UU9F 3FNNA 1IOWA 3W5ZA 4CQBA 1NNDA 2MZRA 2HKEA 2XCPA 1UFKA 4B9TA 1VC5A 4CEXC 3RB6A 4NLYA 2IIHA 4N8OA 2G06A 5MLCV 3GTMA 2DGTA 2KH9A 4FPRA 4LIRA 1HYSB 2MRLA 4N47A 2CDRB 2UUCH 5KFOA 1RA0A 2R3VA 5F8JA 1JN3A 3BAAA 2UXBH 7ICGA 1COKA 1RWMB 1GGOA 1SL0A 3MGVA 2JH1A 1N34F 2CPDA 2BABA 4DO9A 4X5VA 1DBDA 1LQ9A 2HWIA 3I4PA 1X4BA 3V81B 3IS9B 1CJTB 1SCUB 2AMCB 2YKQA 1TV6B 3T1HF 2J0SD 3WKEA 1A5OC 2EZXA 2VC1A 3TI0A 5CRXA 4A8QA 3D0HE 4A3JG 2KFNA 1FJEB 1B7YB 1RAAB 2AJ1A 4RJVA 2ZKTA 2OTLS 4O3RA 3FKBA 4Y2RA 1P8LA 4UZCA 2W9CA 4CNUA 4LSNA 3K17A 1ULZA 4L9XA 1FVIA 5A2QU 3BSNA 4J9QA 4Q0BB 2JR5A 1S6OA 2PMZD 1U0SA 3MPVA 4MKBA 2UVRA 4C0HA 1QD1A 2QB1A 4M5NA 2Q0ZX 2V63A 4RNOA 3QX7A 3N7PD 4YBZB 4ERDA 1X31C 3I87A 4ZPBA 5E7OB 3N9UC 4FPIA 1J5OA 1XN9A 3VGVA 1DGJA 3W9IA 1HNZF 2ZUDA 5FP0A 1ZOTA 3TINA 3VAHA 4PKDB 1O12A 1HMVB 2ZJ5A 2VA2A 4QCLA 1KR4A 3ORYA 1H38A 3AA8A 4UB5A 1GKRA 3AJ1A 3D6MB 2W4CA 1CRXA 4DL5A 2WB4A 1H74A 2FZKB 2KM8B 3PSTA 1UEUA 1TAQA 4E8UA 1DV2A 3M8SA 1DQAA 2DNGA 3G6YA 2XIGA 1IKWA 5IIKA 3QFHA 3BREA 7ICIA 2YWGA 2ZUBA 5EE1A 2Z2LA 4S0MA 1X0FA 3P6YC 3Q8QB 1KC8T 3MR6A 4RQ7A 3L5KA 3RH6A 1YZ6A 4RQNA 5LJ5Y 4JI2F 2A6OA 2GJ2A 4Z6EA 4A3FG 3W66A 4DSIA 5ALNA 2I1RA 2M9KA 5B5EU 2HW3A 1WEZA 1M6YA 5GTIU 1X4EA 3Q8KA 1HLWA 1U8SA 3I5CA 2WHEA 2LA4A 3T9NA 1GH8A 7AT1B 3N41B 3MMAB 4F4YA 3RB3A 3VAIA 1L7NA 4UUXA 5CA5A 4LF9J 3GTLA 3N4WA 3DGPB 2ATCB 3BM7A 4Q0YA 4GMKA 3ICXA 1CSJA 2EK1A 4N76A 3M6VA 1XMQJ 2W71A 2F4FA 3RAQA 4CLKA 1EARA 4TLQA 2CQGA 5KFIA 2CQ0A 5HATA 8ICKA 4KGKA 2UVWA 4X62F 3TADC 2E5SA 3EXCX 1VDVA 1U4BA 4NLSA 2NSCA 2VF3A 4DL7A 4ZVOB 2DNMA 1ZQBA 1NDKA 3V4IA 1X9WA 2HHWA 2WRMA 1R89A 1WC3A 5A0YB 4LF9H 1S79A 8ICAA 2JC0A 2XYHB 2YNGB 3HHLC 2LMRA 2YNFB 1OS5A 1S7IA 4YY3F 4C2MA 4DR3F 4JI8J 4C8LA 4A8SA 1KNZA 1FO4A 3Q8YA 3TQEA 1Q7LB 5FD6A 4AQYJ 1A5LC 1ZZNA 3TJAA 9ICBA 1HBOB 2ZHAA 4DLEA 5HMLA 1TK8A 4E0DA 4EO6A 2QG9B 3F2DA 2XHCA 3S01A 2ZJTA 2JMGA 2RHFA 4BY7G 1TWHA 4YAJB 4M8LA 4A3MG 2DQNB 4QWEA 4JI8H 4CLFA 2CFXA 2LCWA 5H9FK 2Z0GA 3HKZD 1IE7C 5HI7A 4AQYH 4ECTA 2JA6A 1BQXA 1VRUB 4ANCA 3CIMA 2YXLA 2IRUA 4YN3B 2OEKA 3UR0A 4FZLA 3JYTA 5GAEI 2BJ9A 3N6MA 4L73A 1NK8A 4HACB 3M8QB 4C4RA 3N5FA 2X1AA 2GVZB 5CAEB 3MCSA 4F0LA 3W2WB 2AIRB 3SQGB 1DK2A 4YB8B 4PQAA 2CJBA 4DZDA 4KLSA 3WK6A 3QLHB 4NLQA 1CS4A 3QJJA 4NX9A 5TZVA 1ZQYA 3KK3A 4GC7A 1AZSB 5B7WA 3D6FB 2JZ5A 2RRDA 3K2YA 1T3QA 4MFFA 3B82A 4ZHQF 3W5YA 1B99A 2HYIB 2X1BA 4JV2A 2CPFA 3ZD9A 3MTJA 1CI4A 3ADAC 3HI9A 4WFXA 1KLMB 4I7FA 4F0KA 1R3NA 5IZHA 1N5VA 1HBMA 4RAYA 2MLYA 5AXLA 1G7CB 1Z2LA 2RRNA 1EP4A 3TWZA 2I87A 4CLPA 2JA6G 4X4PA 4P52A 4C11B 3KBBA 1LOUA 2DKXA 1CQJB 4F72A 5LOVF 5HROB 6AT1B 5D8HB 3IGHX 2ZWPA 1V6HA 4LREA 4NLVA 5F0UA 3V6KA 1NK0A 3KG4A 1UWBA 1FWPA 2Q4TA 4UOGA 2H5IB 2CVEA 1IR1A 3DRSB 4CLZA 5D0GA 5IINA 9ICUA 4YAKB 4P10A 1Y4ZB 3J80W 1S9FA 1KFTA 2ABYA 3OXFA 3HVTA 1M0SA 5ALKA 3ISCA 4RX6A 3KLFA 5DBCA 1IBCB 3PW5A 5KG5A 4MJKA 1HNWF 2BM0A 2VH7A 1HBNA 1MWZA 5CYMA 1JLAA 4F5NA 1BQMA 3K5MA 2FPMA 3MCOA 2DVIA 4CLUA 4CNQA 2KFYA 1PO9A 2LA6A 3G82A 2M88A 4HDHA 3EGWB 1DFDA 1C4CA 4O2BF 5DQGA 5AHXA 1VR6A 5DS7A 4CQDA 2HHUA 2CN1A 2Q3PA 5ETOA 4F4ZA 2BJ3A 2UUTA 3BSOA 5JH7F 4DCPB 3KJVB 4ZN1A 1HA1A 1TUWA 4JI4J 4NL9C 4DOCA 4ZQIA 1M0TA 1EETB 5GADU 4ANDA 3HK2A 3OTEA 3AN1A 2A19A 1WUDA 1KC7A 4I2DA 1FDAA 2J9EA 5EWGA 1JLBB 2GPWA 4LH8A 2K89A 4V19J 2M0GB 1LV5A 2ZH5A 3RJMB 1R0CB 3CC4S 2F3JA 4FYVB 4JI4H 8ICZA 3QYYA 1U6FA 1GMUA 1TVAA 2BHNA 3PYFA 2D1CA 4F4WA 1RPLA 4GKKJ 1K73T 2P6TA 3GYNA 1TL7B 5CEHA 3CCMS 4QZIA 3MR7A 2QE5A 5KFYA 3K5PA 1YJ7A 4LSXA 3UCZP 2YTCA 3L3FX 2VQFJ 2W6NA 2HVEA 1M5OC 2EQYA 1FXDA 4AE5A 4ED5A 2BRKA 4KLQA 2VU5A 2V69A 2QTWA 3AQFA 4I2QB 2WB1E 2P9EA 4LF8F 4USAA 4MAKA 3OSPA 1JWWA 3I0RB 2EC0A 1TL1A 2CQHA 3BS7A 4GKKH 3NP5A 1CVJA 4CDIA 3SZ2A 4X4NA 2ILYA 3M2UA 4ZOLF 2QL5B 3P5BP 2OPSB 3TVKA 4TV9F 4K59A 2GNKA 1S57A 2CW7A 2DK2A 4UASA 3HJEA 3W3SA 1RA7A 4B3RJ 2WF5A 3I9ZA 2C2KB 2VQFH 3U26A 1C1BB 4F5RA 2B8QA 3DLBA 3FYHA 1SCJB 3PW7A 2G13A 3EUNA 1Q1KA 5KFEA 1OWXA 4OX6A 1ZQ1C 3LGMA 4MFCA 1IKVB 1EF2A 4JI5J 1RTHB 1TTHB 3M8ZA 3ISNC 1HD1A 1RAOA 2MZ1A 3GFHA 2JSXA 4EX7A 2NYVA 5HSPA 4KX3A 5KFMA 2FGCA 5B66U 1TFWA 2R8IA 2UZAA 5D4LA 2WAQF 3FBBA 4B3RH 4IQUA 1RK6A 3LH2S 4JWMA 1B4SA 5HAOA 1HQUA 2IYGA 3R1LA 1YBAA 1KHVA 2C2RA 5DO2A 2PT0A 5KT2A 2AEFA 1D1UA 1OSCA 5AKQA 4JI5H 1B0TA 5KFZA 1RJQA 1JXLA 2FVSA 2KO1A 4CO1A 1C0UB 1T95A 2YWKA 1DTTA 4FZMA 3MFIA 2H51B 4OYZA 2DR8A 2VUMA 4F4XA 4LFCF 4KHPJ 1NRKA 1PIEA 2BE7D 2QV6A 1YNYA 1VLOA 2BBEA 4YDXA 1RT1B 4QZHA 4WU3A 2W9BB 1L2ZA 7ICQA 3RBZA 5J2QA 2CQ3A 2R7XA 3H0LB 4NRTA 4CH7A 2CQDA 4APMA 2YRXA 2RHQB 1UPPA 3CJKB 4ES1A 5AKZA 2O3DA 3NG8A 3JRXA 3CCVS 3PTWA 2I6WA 2WONA 4L6V3 1ZQGA 2RGVA 4IFYB 3T5HA 3PYGA 4L1KA 1NJWA 4OYXA 4KHPH 2NXCA 3JS9A 2AYBA 2PA8D 3HHLD 4B9NA 3MBYA 1UPHA 4B6JA 4FVCA 2OO4A 3KKAA 4FP9A 2V50A 4NV0A 4GOAA 4RQ8A 2QL9B 3FRYA 1JX4A 3QBCA 2OD6A 2KU7A 3C15A 2VUMG 3AMZA 2DTJA 1C4AA 1N36F 3UD5A 1WG4A 1KBLA 1P1LA 4QNLA 2OTJS 4ME6A 4DFJA 3VAMA 3ZZOA 1PILA 2EFVA 2VJ4A 4DS4A 4DV3F 2CWXA 3SYZA 3TACB 2GGPA 1RTIB 1DXSA 2H3EB 3HSZA 5IWAJ 2NPFA 2J9DA 4DR2F 1NJXA 5A0LA 2F65A 5THWA 1HHSA 2CRLA 3P96A 4AT1B 1AFJA 2ZITA 5ITHA 1D9FA 1EXNA 1ONXA 4J5OA 4F25A 5GMDA 2HHHH 2N7CA 2XYGB 2KXHA 3FJ2A 4A3EG 3MEEB 4IG0B 2DO4A 4OYAA 5L39A 4L75A 5IWAH 2CNLB 4RUAA 1JROA 3KK2B 2CUYA 1S9GA 5HBRB 3HVRA 1RT7B 4KLDA 1F5SA 1WOSA 4WK1A 2W6OA 1B6RA 1V38A 2AQ0A 3H8SA 1VHIA 1WYGA 2QARB 2IAJA 1UW4A 4IQVA 5B0DA 1HWIA 3IP0A 4LMYA 2NREA 5J0SA 1K9MT 3LVVA 1LKZA 5DDYA 2FZGB 2FI1A 5IIMA 1RAKA 2HS3A 1FWFC 1FK9B 3PO2G 2HG4A 2IJRA 2FZCB 1FD2A 1NH8A 4MK7A 4ES3A 2HVQA 4RBUA 4ENOA 2C42A 1TL5A 3G6VA 5E5NA 5HQ8A 5KG2A 3C19A 3KUGA 4Q45A 3UXOA 3DRRA 4DQRA 9ICXA 3FEYB 5J1NA 5EDWA 4EGLA 5B0BA 1FWKA 4PUOB 1VS3A 4IWYA 3DOMA 3MM7B 1T94A 1WOOA 4IFVB 3O3LA 1RHUB 5KAFU 2P8IA 2EFQA 3DC2A 2BPFA 1CBKA 4DYKA 5I42A 4C5CA 1UT5A 1NFGA 5FD1A 2VHLA 1HW8A 2C3PA 3G2XA 4K4SA 5HP4A 2GIFA 3TUIC 5K5MA 2HVHA 4FXDA 7FD1A 1P1MA 4P72A 2QL7B 2YKAA 2A2DA 4M9NA 2MQNA 4ZS6A 4KPYA 3BS5A 4G9BA 4GVBA 1RU2A 4DPXA 1E4EB 2A1AA 2DXDA 2E8PA 2HOQA 2BJDA 4NCAA 1S0OA 2OXOA 3OSNA 1R7IA 3TANA 1E6VB 2FHKA 4LF4F 4YDDB 5EE0A 2R92A 1DRZA 2V9KA 5FDLA 2GJFA 3VZHA 1NBEB 1RYRA 4ZIWA 4CE6A 4RBVA 3DRPB 5FLXU 3LP2A 4XRHA 1QUVA 1N5WA 2J6UA 1XC9A 3WQPA 3KTQA 4C7YA 2DITA 1T36A 3DM2B 3AU6A 5J2TF 3L2PA 1URJA 1JKJB 1R8BA 4U7UD 4OI1A 3NLCA 4GLXA 2NCKL 2FB0A 1MROA 1T9VA 3TKAA 4FZVA 2YL2A 4OYOA 3W62A 1CULA 4R64A 4B08A 3VAGA 1HWUA 1A9NB 1HI0P 1FXLA 3MPYA 3H0MB 4QYZJ 3QT8A 1NCLA 2HPUA 4CWBA 3NMAA 4U67Q 2R92G 1UA1A 1RP5A 2K8CB 4I2PB 3FBFA 4NLOA 2P50A 2XI2A 4LF2A 2IM2A 4DR7F 2BQRA 3ZNUA 3WBZA 1C2PA 3CEDA 2Z30B 3OUZA 3D1QA 1PZNA 5ETKA 3NGSA 1WWVA 4F92B 1RXVA 2M52A 3D2QA 1O0PA 4USIA 2JLEA 5KTQA 3UQ2A 2KG5A 4C3LA 3MPGA 3U1LA 4CT9A 2E1FA 4KT0C 1GO3F 3W61A 2FB9A 2N82B 1CG2A 4I6YA 4CZCA 4ZVFA 4K7QA 1SV0C 2DZDA 3E3XA 4WIIA 3TQ1A 3KG0A 4I69A 2XZDB 4OZJA 4PGXA 4B9VA 2NO5A 3DDKA 4FFDA 4YIWA 3PNIA 5A8RA 4A2AA 3JPOA 4M5LA 4TNOA 3KK1A 3H4DA 3W8GA 3ISND 5G4DA 1VRQC 3QRRA 1N4LA 1T9WA 3RW7A 3CMQA 4CM0A 2XZWA 3V72A 1N60A 4C6AA 3LPYA 1S1TB 3MFHA 3NWGA 4PDBA 3BDEA 1A77A 5H1SV 1BVSA 1S1XB 1Q53A 1L5UA 3BE7A 4KITB 4KGXB 2V8GA 3GG0A 4DG1B 4X65J 1S6PB 1Y7PA 4XPEA 4L76A 2JEFA 2UUBH 4R5PB 3HP6A 2NUAB 4IRDA 4KLMA 4BJHA 2FDRA 2IRYA 1RT4B 2PFDA 1I94F 3RJEA 1KHWA 1SPBP 1F1BB 2OPPB 1AN7A 7ICEA 4RU9A 1BY9A 4LVOP 4CF5A 1RB0A 2PMZA 2RAQA 7ICLA 1WG5A 2VR1A 4GXIA 4MV6A 1GNKA 3NRZA 2BJ7A 3ENVA 3C2LA 4X65H 2V4QA 3HX0A 2DGOA 3VCBA 2GW8A 7ICUA 3DGPA 1D9DA 2VL1A 4QOTA 1FJ7A 4JV5J 2BRLA 1MN7A 2QB0A 5EOYA 3K7RA 1S6QA 1ITPA 3AOAA 4XUSA 3PACA 5ALJA 3KOOA 4ED4A 5G0RB 4XDDA 3GDXA 2J0XA 5E41A 5J2NB 2BQ3A 2KJ8A 5CAAA 5J2PB 2ATLA 2IPOB 4JB3A 3SV3A 2F5GA 4AQLA 4R88A 2V9WA 4I2FA 4L3NA 1PBUA 1RTDB 2JHEA 3IWNC 2ODGA 1RACB 4XYMB 2B8PA 8ICIA 3R2DJ 4JV5H 1N5YA 3DLEA 2YNFA 2J0WA 3EICA 3NEKA 1SJ1A 2DY1A 5J2HA 5CA0F 3PSPA 3BV8A 1AFIA 2QIFA 1VQMS 2U1AA 1SB6A 3JQMA 3MDAA 9ICCA 4KLTA 3T8LA 3T5KA 2P6SA 4I6AA 1YBTA 4OO1J 3CULA 2KICA 3JSYA 5DGBA 2AF6A 1W2IA 2ZDPA 1EKSA 3R9LA 1JK9B 3H5XA 2X3DA 1HNIA 3QIPB 3CPWR 4G3IA 2KG1A 2UZ9A 2WF7A 1RT6B 4C7QA 3PO5A 1RHQB 1EQ0A 5C24A 2OYYA 3NNAA 3TW0A 2J6TA 3W9HA 4C9DA 2DWCA 3MAHA 1UZDA 1DV1A 3KD3A 4RPZA 3TIIA 1NJIT 1T03B 1R31A 5HBMB 3MTWA 5HMZA 1TP7A 5DKWA 2DHSA 4UARA 2GVZA 2Y8YA 2QZ8A 4GIBA 5KFDA 4HTJA 5G5HA 5KNIA 3PJXA 2HBMA 4Y2YA 4B3ZA 2HHTA 1X5SA 1POJA 3ETHA 4UB8U 4R0EA 4DCOB 2AYGA 2CNOB 2H1YA 1X0PA 1AZSA 4DUZF 1U0HB 5KG4A 4OYIA 3CE8A 4M5MA 5AK6A 2E2HA 4DS5A 3P4UB 4FXVA 2XZTB 5CYQB 8ATCB 2BW2A 4PG6A 3NUQA 3WK4A 1B6SA 4HR2A 3V6JA 4ITSA 3I55S 4OZ1A 2HQ3A 5C25B 2G4BA 1M1GA 3CD6S 3TZYA 2B51A 1B4FA 1GAOA 2RT3A 5LL6d 5A2QY 3HOXG 3MGIA 4ZI7F 1TFYA 5T7LA 1YJUA 5DDMA 2IFXA 2GH1A 1H7WA 5CR0A 2CPRA 5H9EK 5F8IA 2F7VA 3NY0A 5ETVA 1LWEB 1N34H 3HKZA 1WH2A 5D4NA 1TA8A 3EZOA 3UVJA 3VGUA 1EJRC 2COLA 3HSGA 2WDTA 3DRSA 8ICHA 3JPQA 5KT5A 5KFNA 2MZSA 4ZVPB 5KFXA 2W2NP 2E5LF 1JJHA 2W3RA 3WKCA 2DGQA 2LYHA 3WX8A 1SBRA 2WAQE 1YRUA 4NEYA 3PVXA 3D54A 4HI1A 1BXRA 4Z6DA 2NS1B 5J2BA 5IT0A 3PO4A 3A1YG 1QDUB 3DKDA 4JYAF 2I5JB 3AAWB 2GQ2A 2Z2YB 5BYRA 2FY1A 4Z6CA 1O6XA 3RH5A 3HZGA 4YHHF 5ETMA 2RKIB 4G7EB 2YH1A 2L41A 2FP4B 1IKYB 1A5NC 2H4YB 2WVDA 1SJFA 4Y2QA 1HPZA 4F4KA 2GQQA 1WDTA 4WFZA 2D3OR 2BOPA 4O4RA 2DF4B 4Y2VA 1UETA 1FWEC 1VI7A 4KR0B 2ZJ8A 2AZ3A 1TK0A 5A8WA 4V1Ak 5JXSA 4KX5A 1K47A 4WFNQ 3DF7A 2IOFA 4BHQA 5KOWA 1X8DA 3ALRA 2YCHA 4TY9A 1XR5A 2J8SA 2MY8A 2OEJA 5AM1A 1LWFB 2HNDA 4M5GA 2M8HA 4ZDNA 2G2ZA 4CNTA 1GX6A 3D2WA 5DZ7A 3QFWA 4PG8A 1IR0A 3OV7A 3KLEB 1JJ2R 4JI1F 1U1NA 3IRWP 1SC1B 4ID5B 1WC0A 3THTA 3ENQA 4PQUB 1EKRA 1ZD5A 3C1ZA 2K4PA 2V5AA 1SH2A 2AYEA 1NSPA 5L1IA 3MXHP 4AYBE 5CD4A 4TV8F 4NASA 4KKOB 1QLNA 4BY1G 3QUCA 2ZJRQ 2XSJA 5GAHU 5KT4A 3GJTB 3TAPA 1SJRA 2DO0A 2JEIA 3GTJA 2GLEA 5J2GA 5IV3A 1XWLA 4DU8A 5J2EA 3PX4A 2LFVA 2MB0B 4FS2A 4RW8B 1T05B 5JJBA 4V1XA 2BUNA 2HNYB 3R7SB 1FWAC 3M6ZA 1PC4A 3LP1A 2D41A 2DHAA 8ICJA 2PMHA 2M0NA 1V4YA 1EJXC 2OPSA 7ICKA 2JV3A 3M2RB 4PPDA 4RQ0A 3ISDA 3OT9A 3T6BA 1IKXB 5K8OA 3KFWX 3BGRB 1O75A 3MURP 4YJ2F 2NYHA 1C1BA 3MMCA 2IHNA 4UAYA 1R0AB 3LA4A 2A1BA 3DMJB 4LSLA 1WTBA 3QU7A 3CD0A 2Q66A 1TKXA 3SE7A 4QYZK 2BKOA 4QR2A 7ICHA 2BOAA 2UUCF 4KGZB 1GXLA 2UV8A 2UXBF 2MGZB 5AM5A 4HH1A 4KLGA 4NLPA 2Y0BB 4Y8VB 4YD2A 1OQ6A 3NCQA 2FPKA 1Z00A 4X4SA 4PPZA 3PJ9A 3SI8A 4WPAA 3WKBA 2E5GA 2C3MA 1VLYA 2Y0SC 2AW0A 1D3WA 3ITHB 3GV8B 4Y2UA 3CVZA 3SDEB 1SKRA 1BQNA 2CJAA 3C66A 3MCNA 4ECRA 3M05A 1N6QB 3RZAA 1RT1A 2EW9A 4AL5A 2F1JA 5ALGA 3L4JA 3T41A 1WUUA 2J0QD 1EJUC 5CH7B 5BYQA 2K8BB 1PYOB 4OI4A 4BBRG 1P7DA 1XSNA 2Y1LB 3BA9A 2ESEA 1FNOA 3CTRA 1DZ5A 4F93B 4ETXA 7ICSA 2NXEA 1FFVA 3X3UA 3NVWA 4E4TA 1GEHA 1WNEA 1SC4B 2QLBB 2OD4A 4UQGA 3KHGA 5CHGA 4US9A 3PZPA 1KRCC 3SCKE 5EWEA 3FEQA 4DPOA 1I6JA 3VC8A 3ZTRA 2R87A 5U47A 2OP5A 2CJYB 3BBBA 4ELVA 1JLCB 2WSCC 3SFGA 5KX5F 2UV8G 3K58A 4X64J 2MKCA 5HLFA 3GTKA 3ZI4A 4ZHRB 4ED2A 3HVAA 2ZIXB 4BXOB 3EYZA 1FHTA 4DFDA 1MNEA 1I51B 4CRXA 3IHQB 4LR7A 3FUYA 1CQNA 1TKDA 1YRRA 2VKRA 2YX1A 2IOFK 4LQ9A 2RVJA 2K3KA 5BYSA 3KUEA 3NGUA 1VBYA 5LYJF 1Q79A 1S03G 1V51A 3CCWA 2G5IB 3O2IA 3LK9A 5J2JA 4Q5VA 3D1HA 3QPIA 4X64H 1T3NA 3GTPA 4M47A 8ICXA 4QIWC 4J90A 4P0QA 2V6AA 1JMTA 4K4UA 3O44A 4A8FA 1UL3A 1S12A 3HWTA 1XNSA 3MM6A 2J7WA 4QWCA 5AK3A 3W9JA 1DAXA 2D3DA 2L9DA 1QAIA 3DCAA 1FRXA 3S8SA 2WVBA 3LWBA 4HAIA 1KDHA 1FEHA 4F0HA 2Q09A 2H9ZA 2L3MA 3TADA 1S1VA 4ECYA 4USUA 1N32J 2LDYA 2DJWA 1ZQEA 3V4ZA 3GFKB 5HANA 2W6PA 5DZ6A 5JQWA 1IXKA 3JPNA 4NYZA 1ZQSA 1RWKB 1HNWJ 2DPIA 2CJQA 3NBPB 3EX7B 4ZLNA 1K6WA 1U49A 1TMMA 2BVZA 3HHLA 4BC7A 1ZA1B 3HJFA 4B9MA 3QYPA 5LA6F 4IUFA 2K4HA 3BO2A 1REVA 2M8DB 3BBCA 1S7HA 3BO4A 3CCES 1SV4A 3J7YI 3VALA 3SCLE 2XIDA 3K5NA 1AUXA 1JKHB 4RW9B 3QXGA 1N32H 1YK9A 1RYSA 3KMQA 2GS8A 2V8PA 4YR3A 3PX0A 2Y9TA 1RJJA 4DOAA 1HNWH 1MU2B 1GO3E 4NWIA 3K5IA 4M5DA 4UAZA 3N2CA 3EGNA 2FLLA 3JRWA 4YG2A 4EU0A 5AI0A 1SYXB 2XMWA 4ELTA 4HT5A 4QR1A 3QGAC 3J81j 3R1HA 2E29A 3TEHB 3HSJA 3J7A1 4R8UA 2J7KA 2E1PA 3EDRB 2ROEA 2FLNA 1WORA 3X1LB 3TA1A 5AI9A 1FDBA 5KFKA 2A2CA 2JJ4D 1ZQCA 4LF9F 2KJVA 2ZE2B 5AM3A 5AIBA 2GFFA 3AD8C 2OUGA 1XMQF 2YX8A 4RWXA 1WR2A 2MZJA 3CWJA 3CCJS 4IC9A 5IFMA 4DQPA 1Q5YA 2W4PA 1LEOA 1F2GA 3LGNA 1NK7A 1LKYA 1Q46A 3GTYX 2YB4A 3CJ2A 4TURA 4TN2A 1QM9A 2E1CA 3ZDDA 4QIVA 4V19X 1R6VA 4Y2PA 4ELUA 4KBIA 4A4JA 1HNVB 1BNOA 1NSAA 3C6TA 4KN4A 3F44A 1T0TV 5LXRA 3MM9B 1UAWA 2KEYA 2FJAB 2B9EA 4WYWA 3Q2SC 2UBPC 3RJHA 2R7OA 1RK5A 3CNQP 3BG5A 2KIWA 3JSLA 3MDFA 4IG3B 1ZM9A 4AQYF 2XI9A 2J7UA 2JEJA 2PDAA 4QWAA 3PKYA 3BQTA 5HQMA 3J81W 2ZTDA 2SXLA 1X7VA 1C30A 2LQJA 3IBFB 2XQCA 1H0HB 5A6PA 4L72B 2HFSA 1DY3A 5B0EA 2KYZA 3SEIA 3QO9A 3TAMB 2DIKA 2NU9B 1ZHQA 3DM2A 4WE1A 3K1RB 1RM6C 2EC2A 4M5HA 3Q8UA 3MJFA 4TU8A 4P0PB 1SL1A 3GIMA 3KDOA 5HMFA 1UZHA 3UN5A 2B5JB 3UM9A 4OJPA 3UCGA 3BGUA 3PR5B 5AM2A 2K4EA 3IG5A 4WP8A 4R85A 5FJ8G 1LWCB 3GU3A 2VC0A 1UJ4A 1Y1WA 3UO0A 2R7KA 3ZZTA 4K5SA 4OV6A 3V5RA 4UOCA 4K2JA 1IBLJ 5DDQC 2W9MA 4DCCA 1Y14B 3BR9A 4USJC 2BEFA 4AXJA 2ZDHA 4ZH4A 3HDSA 3IC1A 1W93A 2JFKA 2GOKA 1VQ6S 1D0EA 4YN4A 4O3QA 4NYOA 3UD3P 5B09A 4N41A 1GKPA 3OUUA 1WC4A 5HJXA 4M9UA 2OODA 2DNYA 1AT1B 1EYZA 3NVZA 2PA3A 3W1YC 4KPCA 4NL9A 1TL3A 3CJ5A 1IBLH 5KFPA 4EENA 2FJDB 4J9UE 1K8AT 3R8YA 1XSPA 2DEJA 2LYBA 5G4HC 1Y1WG 1SGGA 4LSZB 5DG7A 2FPPB 4LMZA 4RW4A 2IHR1 3AUOA 4CT8A 4CM2A 5LP6F 2KG0A 4BUGA 5H80A 3C23A 3V4MA 5EX0A 5LSLA 2ZOFA 3GV5B 1H72C 2ERRA 4R65A 1ZQTA 4GO5X 1V9OA 2HGNA 3QUQA 2B4UA 3EYYA 4OYPA 2W9CB 1S1XA 4LSNB 5KFUA 1IR2A 2VFUA 5KG7A 1IQZA 3EGZA 2DR9A 1GYFA 5KFRA 5DM6Q 1RWOB 1RAIB 3L4KA 2BPGA 2Y0SD 3CMES 3D2SA 1NMEB 4DV3J 3TIGA 3C46A 1NJZA 1QSSA 3BGFA 5KAKA 3AT1B 2AJ2A 4C97A 4DR2J 3MC1A 4FDFA 3Q0AA 4OZLA 1VQSA 2KKPA 1J5OB 1XQIA 2FMAA 4IH6A 2DIVA 1SQGA 4WD3A 2N4CA 4W92B 2F63A 4RQ1A 5AKHA 4M04A 5JVGQ 4KY3A 3KG1A 4NLDA 3SSSA 4DV3H 2UUAF 2AJFE 5K8PA 2KHVA 8RUCA 4JI4F 1N54B 5E3RA 4DR2H 5HVFA 3OOQA 2F1IA 5DM7Q 3P5TL 3A0BU 2RDJA 4O2AF 4QYRA 2ZUGA 5BJRA 5J2PA 3T9ZA 5HV6A 1YMYA 1KQGB 2EXUA 3AOBA 2KL8A 2R4FA 1A9XA 4RT3A 1UJ5A 1EJSC 2QA2A 2FY8A 4NLWA 3ZTSA 4WP9A 1C20A 2FK2A 3FM9A 4M7EA 1Y5LB 2YMLA 3EDQB 1FE0A 3UWTA 3RFAA 5HO4A 4MKYA 2W6QA 2YWEA 4ICLA 1BC6A 4QIWD 2FLOA 4ACOA 3BKFA 3HFVA 4GKKF 2SCUB 1LW2A 2W24A 2EH9A 3NRBA 1LW0A 2PIIA 4UCRA 1XDNA 1JNZB 5J2AA 1E9ZB 4C4SA 1VQKS 4DX6A 3LYSA 5KFWA 2VQFF 4F36A 4P2SA 2JZBA 2R7LA 3R5DA 4DUYJ 3H2LA 1A0PA 3R6GB 3QATA 3QIPA 1Y5NB 4KFBA 3MPWA 3ILOA 3QU4A 4HDGA 3TNVA 2V59A 1RLDA 3PRVA 3H0GA 4ECUA 1RI7A 2ZIVA 3JSNA 2VPYB 1N33J 1KJJA 3QEBZ 4O4GA 1RYUA 1RXOB 1HIYA 3IAM9 1RQ0A 3IG0A 5FLXY 2XHWA 2MDAA 4GKJF 1RHRB 1OY9A 5SZTA 1NHVA 4B3RF 2LHTA 1U1OA 2HWTA 1MA7A 3C2KA 1RT3B 2RHSB 2HHSA 3P45B 2IBKA 3BH7B 3DXSX 3MUVP 3HFZB 4DUYH 3H8YA 1SKUB 3PFEA 2F4VF 4JI5F 2V2KA 2NVXA 3KXYT 2ZH4A 3D6NA 1RZTA 4P6QA 1KEJA 1KQFB 1N33H 4U7UK 3ETLA 4O4IF 1U0HA 7ICOA 2C3OA 2R7UA 3LSBA 5AKLA 2AJ0A 1FX4A 3QWUA 2DGSA 3HULA 3JTPA 2ZH1A 1ZM3A 1BD6A 2V4RA 2K7JA 3H0GG 2NYIA 8ICYA 1XR7A 2G09A 3VVTA 5C25A 2DWQA 3A8JA 3PR4A 1CS0A 2D3O1 2DR7A 3E0FA 3FCVA 1Q8KA 4A8OA 4KHPF 4PXCA 3R5JB 1FFUA 2J6SA 4K4YA 3R5HA 1JXEA 1TAMA 2VASA 4NZ6A 1OYEA 4BKNA 3SMZA 1B3TA 1VHFA 1RJRA 4DX8H 2IMOA 2RF4A 3HHKA 2D7SA 4DL0C 3HT3A 4EZ6A 5AI5A 1RKIA 2KTQA 2BDPA 4DR7J 4O44A 4Y2XA 3RBDA 4TQSA 4A46A 1CS4B 3PIPQ 5LT5A 4HYKA 2HRUA 1Q81T 2FTRA 4O5CA 4PWWA 2AU0A 1PC5A 2FPHX 2HK3A 1JDEA 3UMGA 3MPUB 2KHQA 3EGJA 4M5IA 3G8QA 2BCUA 4I7FB 7ICVA 3AU2A 1R8AA 2QFJA 2PD1A 1HBMB 3MD1A 2AX1A 4C7ZA 2H54B 8ICNA 1EP4B 3KMSA 3HM9A 4DR7H 4I6WA 4A8EA 4LF1A 2RKIA 4G7EA 1BHNA 1RG6A 3CD5A 1PVQA 1UEVA 2YMMA 1VAJA 4A3GG 4WP3A 1REGX 4M0AA 1X60A 4M94A 3DI6A 4MEYA 2LQ5A 5D1PA 2QT7A 2OGJA 1JJ4A 1Y11A 3PM9A 4Y2SA 2MU2A 2PEBA 4PG7A 4F3QA 4AFFA 1VQ8S 4YVZA 1T4GA 5LL6b 1RXWA 2O1PA 4IOCQ 2GZOA 3R97A 2PMZF 1P9QC 1HR0J 3PRBA 3TUZC 2BE2A 3CJ0A 1BWEA 4H4OB 1N2XA 3VGSA 3HVTB 2J8AA 2ZM6F 1I94J 3DDHA 2ZBPA 5F8NA 3KLFB 4ZIVA 1I5OB 1NB7A 5J0WA 4C60A 5ETPA 1O03A 1CJKA 1ZQQA 1NKEA 4C8OA 2MLZA 4DPWA 5CYMB 1JLAB 1Z1BA 2FUG9 3HKWA 1BQMB 3CSKA 1HBUA 3RFCA 5DDRC 4ZCLA 4UZBA 4C5AA 3CD7A 3TX8A 3GJSB 3GE9A 1MMNA 4HLBA 1HR0H 2W3SA 5CWRA 2N3OA 4UB1A 1DRGA 3GLJA 3A8EA 3B0YA 2I9GA 1I94H 2F1FA 4XA5A 1KJ8A 4LVNP 1X4HA 2KI2A 3MHYA 1TK5A 2LEAA 2ZIWA 1T05A 3HXMA 3H7HB 4NMXA 1A5KC 4BC9A 3RJGA 4YOEA 1WCLA 4EUVA 5EHHA 3KAJA 1IVZA 1T11A 1KBUA 1F44A 5ALIA 3B8HA 3E01A 1YITS 1ZPVA 1OMSA 4CC5A 2OHDA 3LOUA 5DETA 3Q8PB 2YTUA 4A3LG 4DUTA 4O3SA 4LSAA 1PJ6A 4TUSA 5AI4A 3HOWG 4ECZA 3NASA 1VDHA 3IFEA 4QIGA 5CXTA 1N61A 4X4QA 3PFOA 2YW2A 2GIRA 3LAKA 5GONF 3MOJB 3LW5C 2IDLA 2HAFA 3MD3A 4ZKAA 2RQ5A 2YKMB 1GMVA 1RISA 4HNTA 3AODA 4ILMA 3PCOB 4A8YA 4EFAC 3FMBA 1KW4A 2FMQA 1XNQJ 2RILA 4DF4A 4K4ZA 4ZMMA 2FLPA 5E3PA 1UWAA 1I1GA 1TL1B 4US8A 2CG8A 3TUJC 3IRUA 4A8KA 3IV8A 1NB2A 2OCEA 1K70A 1SV0A 5A6TC 3NGRA 4DL4A 4M95A 3M2UB 1VK8A 1UKUA 1N6QA 3G8CA 2EFGA 2IA6A 1SWVA 1V97A 3C14B 2HNZB 4DQIA 4TUQA 1CPZA 5BOLA 5AT1B 4ZPDA 2VDHA 4FF2A 5KKNB 2QT3A 3GP9A 1XNQH 1GTEA 3CDUA 2YVSA 4ZPCA 5ALEA 4ILRA 2NVYA 5CZXA 1VQNS 1UCNA 3ZXWA 2ZIXA 1TL4A 4G1QB 2HI0A 4QR0A 2Y9HA 2V8HA 2EEYA 4LBHA 4C65A 3N40P 4YR2A 4K4IA 5AE1A 1DTQA 1HQUB 2HVZA 1Q3VA 5AI6A 5IM0B 2PO4A 5IS2A 3ED5A 3HKZF 2IJNA 1UVLA 1XNRJ 4Y3CA 1WC5A 3RUBL 4OJHA 4IO1A 3H25A 2XULA 4YB6A 1DTTB 4K4HA 2P5VA 2NU7B 2G2OA 3M8WA 3Q8VA 1L3TA 3EM1A 4PWUA 4A3IG 2ALYB 2NSBA 2DT9A 1V3SA 5AKIA 5J2QB 2NU6B 2XMMA 4WFBQ 2E5IA 1YRTA 1LXNA 2XMVA 2MZQA 4BWJA 2PBZA 3A0HU 1FWBC 1B43A 1XNRH 4JMUA 1OWTA 4DFKA 4FXWA 2WONB 4LRDA 3OJSA 3BABA 1NZ8A 5FSEC 3DOKA 3N97B 1N88A 1M90T 2WFAA 4OJ5A 3MTKA 1N5SA 3JPTA 2HFNA 2L08A 4C80A 4YUDA 4KTQA 1NZAA 4DSFA 2HQDA 2FMPA 2BCQA 3DHWC 3DLGB