4F50A

Y-family dna polymerase chimera dbh-dbh-dpo4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
342
structure length
337
Chain Sequence
MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQNKYSEPVENKSKIPHGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
molecule keywords DNA polymerase IV
total genus 103
structure length 337
sequence length 342
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f50A03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f50A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f50A01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f50A04
5IIKA 1T7PA 2KZMA 4XA5A 1IXRA 2ZTCA 1U4BA 4PUOA 4RQ5A 2EC0A 1J5OB 1Z00B 5KFFA 4IDKA 1HARA 3C1YA 1RT2A 4WZQA 4B9LA 3C6UA 4ECTA 3JPQA 5KFVA 3SV3A 1TL1B 4QZCA 1UWBB 4ZPAA 4H4MA 4IQWA 3PW7A 2BANB 4ECRA 3DMJB 3PNCA 1VRTA 4QWAA 3LAKA 4QW8A 4KB7A 4NRTA 5J2NA 4KLGA 4QZAA 1D0EA 1COOA 3N6LA 4G1QB 1FKOA 2R8KA 9ICUA 1S0VA 1HQEA 4TYBA 4TUQA 3V81B 4I27A 5J2HA 3UXOA 4YD1A 3RR8A 4O5EA 5L1JA 1LWCA 3ETLA 4YG2A 3SFUA 1ZQCA 4IOBA 4IH7A 2IC3B 1MSWD 3NBPB 3GIJA 1RT3B 5J0RA 2AGQA 4RW7A 3BR9A 2UUTA 5KFKA 3BDPA 2FVRA 1RT5A 2XCPA 4ECZA 4DF8A 1NJXA 7ICEA 4NCGB 5IILA 4IQTA 1HQUA 7ICFA 4QWBA 2ZJ5A 1ZETA 4YMOA 4YD2A 4K50A 4M9JA 3RJEA 1ZQLA 1C0UB 4U7CA 5BOMA 3I0SA 3ZDCA 2KFNA 2VG6A 5IIJA 3KTQA 5KFRA 1KLMA 3ZDEA 4B3OA 1RT3A 3PW2A 5KFWA 4BGDA 1U09A 2BCVA 4ICLB 4MK7A 1C1BB 3GILA 3TAMB 2FJWA 1LWCB 2FMSA 4ED3A 3LP1A 1B43A 4PHPA 5KFDA 1Z4UA 3KK2A 5J0TA 4K4VA 3QGIA 4EO6A 4WE1A 3H40A 1W25A 1ZQZA 5D3GA 3CO9A 5J2JA 1RYRA 2RF2B 4GLXA 1C2PA 4RNHA 3B0XA 3M9MB 3TFSA 1U48A 2ASLA 4UAZA 4EBDA 4RT2A 1EP4B 2R2TA 4JV0A 4R63A 4ZPBA 1HMVB 4ZVFA 4Y2AA 4DSKA 4QZEA 2R2UA 1VRTB 4O3OA 5HHHA 2XY6A 2B21A 3M8PA 5J0YA 4MFFA 9ICNA 2W7PA 3GV8B 1KHWA 4K4UA 2HHXA 5HROA 3OGUA 2YKMA 3UR0A 3BSCA 4JV2A 3NBPA 1RTHB 3VQSA 4IQVA 5DGBA 1ZTWA 4DWIA 4C8MA 5J0SA 5IIOA 1JLAA 2WCXA 3RBDA 1S1VA 4PH5A 1D1UA 1S1XB 3CJ2A 1SKSA 4DL7A 4QWEA 2PFOA 1WNEA 3LP0B 7ICNA 3KK3B 3TARA 3LALA 3ISCA 3RAQA 3DLEB 4F5PA 1FKOB 2OPSB 1HQEB 1XC9A 1BQMA 2FLLA 5F8LA 4P2HA 3HVTA 4EZ9A 1TVRB 1C1BA 4NLOA 3LANA 1IKWB 2JEJA 1DLOB 3LWMA 3OLBA 4J9LA 3OLAA 2V0NA 8ICRA 1GX6A 2FPMA 2W9MA 3GV7B 4ID5B 5KFHA 1V9PA 5DQHA 4DL5A 2R8HA 1R0AA 1S48A 4WXWA 4PHEA 7ICKA 3ISBA 4IH5A 5IINA 7ICIA 1BGXT 4PQUB 3UXNA 1D9DA 1ZTTA 4F93B 9ICIA 3GYNA 1XU4A 4PGXA 2IM2A 2JEFA 9ICXA 4IKAA 1KDHA 3UQSA 1C0TB 2VA3A 3IS9B 3C6UB 2HMIB 4I2QB 3T3FA 3MF5A 3PV8A 1Z00A 4RNFA 3IRXA 1IKYA 2YNIA 4EBCA 1JLBB 4X5VA 5L1LA 3AU6A 4R5PB 4EO8A 2UVRA 4YP3A 2F8EX 2XGQA 4ZVGA 3TVKA 1T8EA 5HNKA 4KLUA 4IRKA 2WOMB 4ZMMA 3UPQA 1RT6A 5J2BA 2HHTA 2C2RA 4J9QA 4DFPA 1XR6A 2IM1A 2YNGB 1N4LA 3C21A 4Z6EA 3JYTA 3E01A 3T1AA 1LW2B 3OJUA 9ICEA 8ICWA 5DBCA 2XGPA 3RR7A 2AWZA 1SH3A 1A77A 3QIDA 3PR4A 2YKNA 3KLFB 4UAYA 1VRUA 2MUTA 4F5NA 2BCRA 2WONA 5J2NB 1SKWA 4XUSA 3DRPA 3RJGA 1C7YA 2HVHA 3PW0A 4KE5A 3GIMA 4M47A 2ISOA 1B22A 4MH8A 5K14A 5KFSA 1RT2B 3V6HA 4C8NA 4IR1A 3OHAA 3HT3A 2MUTB 2W8KA 3JPNA 3G6XA 9ICSA 4O0IA 3DRSB 1S9EB 4R8UA 3KMQA 2MAXA 4F4WA 3AU2A 2BCQA 1T03A 2HWIA 4UBCA 1X9MA 2VANA 2IBKA 3RB3A 1BQNB 9ICKA 3I5AA 2ISPA 4M95A 1JLGB 1U45A 4ED1A 4NYZA 5KG4A 1T4GA 1ZQQA 4MIBA 4NLUA 3JPOA 4I2IA 1FKPB 4Q0BA 3JYTB 1D9FA 2PFQA 5C25B 4TY8B 1BPBA 5JUMA 4QWDA 4DO9A 1XSNA 2ILYA 1TAUA 8ICYA 7ICRA 5CJ7A 5DQIA 3D5MA 4YFKA 5KTQA 3KHRA 1HPZA 4RNMA 1ZQYA 5J2CA 3M8SA 3ZDDA 3PMNA 4I2BA 4RW8A 2JLEA 3I0RA 3H8JA 5J0UA 3Q8MA 5KG3A 5KFBA 4P4OA 1N56A 3HVAA 4BXOB 4YXMA 2E9RX 1S1WB 8ICMA 1ZJNA 4TURA 2J6SA 1S6PA 2NRWA 1UNNC 1S6QA 1TVRA 5DB6A 3OL9A 4PPXA 1HMVA 1JLFA 4K4YA 3QO9B 2OPRB 4Z6DA 4F2SA 3V6DA 1SL0A 4MEXA 4NLSA 5KT7A 5EWGA 3MR3A 3UDLA 8ICPA 1NHUA 1RTIA 3ICLA 4MF8A 3KK2B 1NK6A 1RA6A 1N5YA 3CJ5A 4DOAA 2GIQA 4O44A 5F8HA 1NJWA 3LP1B 3M8QB 1HUZA 3BSAA 3KHLA 4DOBA 3C1ZA 3G6YA 3Q8PB 3TAMA 3LDAA 1ZQHA 1X2IA 9ICAA 4PWDB 1LWEA 4I2JA 2FLNA 4YCXA 4YR3A 4R5PA 2YNFA 4WFXA 4G3IA 4M9GA 5KFAA 3SFGA 4DSJA 1IKYB 2HHSA 4NM2A 4I2PA 5HLFB 2FJVA 5J2GA 1TV6A 4I2QA 1RTHA 4RQ2A 3SYZA 1TFRA 3OL6A 2ZJAA 1RTJA 1S1UA 3KHHA 2JEGA 3MEDA 8ICEA 3H2LA 3H8SA 1RZTA 1U9LA 1ZQXA 3PHEA 3MEGA 5KG2A 1RT5B 3H5SA 5J2QA 2BE2B 5F8NA 4IG3A 5HHIA 2H5XA 1IM4A 1NOMA 1D8YA 5FDLB 4NRUA 2W9CA 4M9NA 3PX0A 2P6RA 3C5GA 4ED0A 4H4OA 2C28A 1CEZA 2GC8A 4K4WA 2IAJA 2VA8A 4QZIA 3GDXA 2B5JA 2R8JA 4LZDA 3DYAA 5KG5A 2ZJ8A 3QIPA 4TLRA 5EOZA 1IKVA 3ISND 1T3NA 4TQRA 2GWSA 4XRHA 1KFTA 1JIHA 5HP1B 4M6WA 5C5JA 4IG3B 1JLAB 8ICXA 1TP7A 4KLQA 5J2MB 1NJYA 4NZ0A 1MQ3A 2AGPA 3IG1A 7ICSA 5CYQB 3RH6A 1TKZB 2BE2A 2I1QA 1K1QA 3KLHA 2V4RA 4NCGA 1XR5A 1S0MA 5J2KA 4UBBA 5KFMA 2BPFA 1HQUB 3HP6A 4DSLA 4RPZA 3PZPA 1UA0A 1HPZB 1JMSA 2BR0A 4UB1A 4RQ4A 4DSFA 5J2MA 3N4MB 3DLGA 1SH0A 3BQ1A 2I5JA 5EWEA 2IHMA 2BPCA 5J2FA 4JK1A 5J1EA 5HP1A 3V6JA 2FJXA 2PFPA 4P4MA 3RH5A 2IA6A 8ICQA 5J2PA 4O4GA 1LW0B 3HWTA 1CSJA 1GX5A 3V7LA 3OJSA 4F92B 5F9NA 7ICHA 1IKXB 3EZUA 3FDSA 4KFBA 4IG0A 2WTFA 1A76A 4IQXA 2VA2A 4DQPA 5KFQA 1RT1A 3QO9A 3H4BA 2A1JB 4KLLA 3NAHA 4F91B 5F9LA 4QZ8A 2VG5B 2ATLA 1KRPA 4DQIA 1RA7A 4PUOB 1UWBA 3CJ0A 4WFZA 4QZFA 1H38A 4NLQA 4ZHRB 8ICAA 8ICGA 2AX1A 2I1RA 4NXZA 4F3OA 2E9ZA 3MFIA 4NLNA 4Z6CA 5J2DA 3H8WA 3UXPA 5HLFA 4Q8EA 4RW8B 2V4QA 4DQQA 1QSYA 4LSLA 3MGIA 4NLZA 1QE1B 3SZ2A 4TY8A 2ALZA 3DM2B 1LW2A 4IH6A 3DRRB 4EZ6A 2OPPB 4I7FB 2BCUA 4MK9A 8ICLA 1TL3A 1RTDA 1KFDA 4M94A 1SL2A 1CUKA 5C42B 4DLGA 3EZ5A 3BGRA 4I29A 2HVIA 3DRRA 4IFVA 4O3RA 1BQNA 3JSMA 3DM2A 4FO6A 2QV6A 4GC7A 2W8LA 3BSOA 2JZBA 5C24A 3ITHA 4ED8A 4MK8A 1SUQB 2ZUBA 2BQUA 4KHMA 4DEZA 3JPSA 4UB2A 1HNVB 2HNDA 4RW6B 8ICSA 7ICLA 4MFBA 4GXKA 3TFRA 1C1CB 2B43A 4RPXA 3MDAA 4DFMA 1R0AB 3DRPB 1SUQA 3LP2A 2WONB 3BQ0A 5KFNA 4IDKB 3K4GA 4ID5A 3JPPA 2D3ZA 1ZQMA 3DOKA 2XCAA 3ITHB 3I0RB 1WCLA 2A1JA 4YVZA 2JZBB 3HPOA 2HNDB 4RW6A 1RT1B 4XO0A 2YKNB 4Z6FA 1KSPA 4IG0B 1IKXA 5J2EA 1VRUB 1K1SA 2AJQA 2WB4A 3MGHA 3KK1A 2ZD1B 2ZUDA 2P66A 4DSIA 1RT6B 3CVKA 4Q43A 2WOMA 2BRLA 3QGHA 1S1XA 2UVUA 4PGQA 2JC0A 4IRCA 5KFGA 4DF4A 1S1VB 4LSLB 5J0PA 1I6JA 3C2LA 4ZP9A 1LB2B 3Q8SB 3SV4A 4JV1A 4NLPA 4I2FA 2C22A 1HYSA 2Y1JA 1ZQEA 5DLFA 3RB6A 4F4YA 2HNZA 5HMMA 5F8IA 2BCSA 4KKOA 3MR2A 1XSPA 4LQ9A 2NRTA 1X9WA 5KFXA 1L3VA 4DG1A 2D3UA 2LYHA 4RQ1A 3D28A 3IS9A 4J9OA 5K14B 4TY9A 8ICTA 3FQLA 3M8PB 1DLOA 4KBIA 2FLPA 8ICBA 4OL8A 4O5CA 1T94A 1HNVA 2VG5A 1XO1A 4RQ8A 4C8OA 5I3UB 3EPIA 3SI8A 4M6WB 1MC8A 4M9HA 3RJKA 2YNHA 5KFZA 8ICHA 3NAIA 3KK3A 1XR7A 2HAIA 4WYWA 4KFBB 1AROP 3LP0A 2OH2A 2AX0A 3MECB 4WE1B 4Q44A 8ICFA 1JLEB 4F50A 8ICVA 3BQTA 3DYAB 9ICLA 5CP2A 3ZD8A 1UA1A 5L1IA 3DLGB 2RDJA 3DLKB 1D8LA 1REVA 4ELVA 1JLBA 1L5UA 3PW5A 2BGWA 4YR0A 3KNAA 1MU2B 2RKIB 3TI0A 5CR0A 5KG1A 2IJFA 5J2IA 1RXVA 4NLKA 4K4IA 3K75D 2D7SA 2D41A 4F5OA 3DI6B 4EBEA 1ZQIA 2BKEA 3IGNA 4RW4A 3MBYA 1L3SA 4ZVEA 1TKZA 3C2MA 4RQ6A 2DPIA 4ZP7A 2FPKA 5DG7A 1TKDA 2R8GA 4RT3A 4MFCA 8ICKA 4O5KA 4B9NA 1TV9A 4EYIB 1U49A 3DOLA 4UB4A 4JWNA 1XSLA 5DG8A 5JXSA 5CA7A 1N48A 1RT4B 3H98A 1S9GA 1BPYA 1T05A 3OL7A 1JLCA 3RJJA 4MFAA 3MFHA 4I2CA 4YMMA 5KG0A 4F4KA 1RT7B 4KLOA 2HNYA 2B5JB 1TK5A 3PO4A 2XO7A 2O5DA 2Q0ZX 3RJHA 1SH2A 3N6NA 4TYAA 1JLCB 5DBBA 1S9GB 3PJWA 1QLNA 2IJNA 2W9CB 4O3NA 4ZH4A 3V6DB 4HKQA 1LV5A 5HP4A 4B9SA 1ZQPA 4UB5A 3V4IB 3DOLB 3ISNC 1ZQVA 3EWAA 5J1EB 4F5RA 3QE9Y 2AQ4A 4C8LA 4YMNA 5I3UA 2IHNA 4H4OB 1T05B 4RW9A 3PMLA 5FDLA 2BQ3A 4LQ3A 4X2BA 2P6UA 4HYKA 3KLIB 4F5QA 3T5JA 2I9GA 3EW9A 1MMLA 1NK7A 5DKWA 1DGSA 1MQ2A 2Y1IA 3FSIA 1OS5A 5DDYA 4Q45A 1KTQA 2IMWP 4KLSA 2YNFB 2HNZB 5KG6A 3CJ4A 4J9KA 1ZJMA 3DLKA 9ICJA 1HYSB 7ICQA 4F2RA 2ZE2B 2RDIA 4Y2CA 4QZBA 5KFTA 3HKWA 5DG9A 1REVB 4KV8A 3V4IA 1TK8A 4KLJA 2BPGA 1RTIB 3OSPA 4EYHB 2HHWA 1KLNA 3V7KA 5D3GB 3M8QA 3E2EA 9ICMA 3C2KA 4O3SA 2C2DA 3RJFA 5CB1A 3G6VA 2OPRA 1S9FA 2J6UA 2IAJB 4J9SA 3JPTA 3CDEA 3NL0A 2V9WA 1Z3EB 4ZP6A 5CWRA 3CDUA 4YMEA 3OSNA 5KT4A 9ICGA 4H54A 4KLMA 3EYZA 4NM1A 5D49A 3MR5A 3RTVA 2WHOA 4RNOA 3NTUA 1NKCA 3C6TA 4URGA 1UT5A 4M04A 3MEGB 4KO0A 4NLYA 1C0UA 2NRXA 3KLVA 4DL2A 1NK0A 1ZQOA 1S1WA 5D46A 4NLTA 5KFOA 2W9BA 1TQLA 1RTJB 1TL1A 4F4ZA 4DL4A 4O3PA 4PGYA 3RB0A 1BPZA 3QZ7A 7ICOA 1TV6B 3HVWA 4NLXA 4TUSA 4Y34A 4NLRA 4LVSA 2BRKA 3RRHA 4R0EA 4IQUA 2PI4A 3MEEA 3H5XA 4NLVA 4Q0BB 1N6QB 3JSMB 4B9UA 3RAXA 1XS9D 5KT3A 5J0QA 4DS4A 4LSNA 1TVAA 3RRGA 1TKTA 1S77D 5EDWA 3V81A 3CIZA 1TL3B 1ZQWA 5KFIA 2E9TA 3MECA 3N97B 1ZQUA 5BOLA 1EXNA 4J9RA 1T03B 4TN2A 5CYMB 1RPLA 3KK1B 4KTQA 2ZTEA 3UPFA 2YNHB 1JLGA 1BVSA 1JLQB 4K4HA 1PZNA 3GV5B 1QSSA 4KLTA 1DTQA 1RYSA 1RAJA 2R2RA 4DLEA 2KZZA 4I2DA 1ZQTA 1C0TA 1SKRA 4ZVHA 4UQGA 1NNDA 1NKEA 3GQCA 5KFEA 2BANA 1YVFA 2DPJA 5IIIA 4I28A 5HMLA 4R66A 7ICUA 3RBEA 3LP2B 1UT8A 4I2HA 4B9MA 1ZQKA 4ECSA 2FVPA 1RXWA 4C8KA 3E51A 5BPCA 4BWJA 5F8GA 3CJ3A 3T5HA 1DTTB 4KLEA 3HX0A 4KSEB 3TANA 1S1TA 3BQ2A 5CYMA 2PI5A 3GFKB 4RUAA 1KHVA 2BQRA 3NKYA 4TUPA 2F1JA 4MEYA 8ICJA 1ZQSA 5CHGA 4QZDA 4ECXA 3PW4A 3KJVA 3GIKA 3M8RA 3Q8KA 9ICOA 1FK9B 1XWLA 1TKXB 5DB8A 4KHRA 5F8JA 1LW0A 4NY8A 3QEBZ 4O4GB 2DFLA 4XPCA 1L3UA 1ZQDA 5KFLA 3Q8QB 5EWFA 3KJVB 2ZE2A 4O9MA 9ICCA 5EUHA 5KFJA 2VG7B 4QW9A 2HMIA 5J0XA 3T5LA 1S1TB 1S9EA 4UAWA 3V6KA 4KITB 1U47A 4PQUA 2OPQB 2XWYA 3GIIA 3KLEA 1QSLA 1ZQNA 3IN5A 1NK4A 4NLDA 3NGDA 2CKWA 7ICJA 4PHAA 3BJYA 3QGGA 9ICQA 4KAIA 5TZVA 3V7JA 3UQ0A 4XQ8A 1ZQBA 2QE5A 1HUOA 4QZ9A 3TAPA 4KO0B 5KFYA 4RW9B 4J9MA 1BPXA 1X9SA 4GXJA 1NJZA 4FBUA 4P4PA 4IFYB 3I5CA 4J9NA 1JLQA 5DB7A 4TQSA 4JWMA 5I42B 4ZPDA 3HVTB 4R65A 3H59A 3TAQA 1KFSA 1IKVB 3DDKA 3OHBA 4YN4A 4KMUA 1BQMB 2ILZA 4ZP8A 2C2EA 5HBMB 5J2PB 1S76D 2KFZA 2I5JB 2BDPA 4LSNB 2CJQA 2JEIA 1RT4A 3ZD9A 2XI3A 1N6QA 5KFPA 4F8RA 2IM3A 3PX4A 2M9NA 4F4XA 4U6PA 4KV8B 1S97A 4B3OB 2YNIB 1JXEA 3QLHB 4FS1A 4R64A 2YKMB 4ED7A 4JUZA 5J29A 4ECYA 4GXIA 4NLWA 4B9VA 4DL3A 3T19A 3KLGB 3IGVA 2W9BB 4ECQA 4FBTA 7ICTA 3M9NB 4WFYA 7ICMA 1S1UB 8ICOA 3V72A 3KLIA 3KHGA 2B6AA 7ICVA 5CYQA 3IG1B 2FVQA 4O3QA 5J2AA 3IHQB 3H4DA 2KZ3A 2KN7A 4KLDA 4QWCA 1MU2A 3QLHA 4DS5A 4M0AA 1ZQJA 4Q8FA 1NK5A 3MR6A 1HNIA 4K4XA 7ICGA 5DGAA 1BPEA 5L9XA 3BREA 4PWDA 5DDMA 2HHUA 2AQ0A 2FPLA 4MIAA 3ZDAA 4O44B 1EP4A 4O4RA 1N5YB 4MKAA 1SV5A 3JPRA 2OPSA 1JN3A 1JLEA 2UUWA 3DLEA 1L3TA 3T5KA 1RDRA 4UB3A 2RF2A 4J9PA 2GIRA 3KMSA 4GC6A 2XC9A 9ICPA 3QIPB 4B9TA 1Y88A 3CWJA 1SV5B 2R8IA 2ZKUA 2WRMA 4DL6A 3MDCA 5L1KA 1BPDA 1S4FA 4KN7A 3QEAZ 2VG6B 2XI2A 4WYLA 4QZHA 4K4SA 3THVA 3C5FA 9ICRA 1S49A 2FMQA 1ZQFA 5KT6A 1HNIB 4ELUA 1ZQGA 5J2QB 4ECVA 4BXOA 2ASDA 3DI6A 1SL1A 2PFNA 4I2EA 3I0SB 5HROB 3EPGA 1QTMA 3KLEB 9ICBA 2BHNA 2B6AB 3KLHB 4I2PB 1SZPA 2RKIA 4RW4B 3QZ8A 3UQ2A 2ZUCA 1ZQRA 2KTQA 4KLHA 3KLGA 4K4TA 4IR9A 1WCNA 3HW8A 8ICIA 9ICFA 1NKBA 1NK8A 8ICCA 3QYYA 3BSNA 3RB4A 2NRVA 1TK0A 4RZRA 1NK9A 1JX4A 4XPEA 5IIMA 3PJXA 4DFJA 2IC3A 4DSEA 9ICWA 4DQRA 3PVXA 4FS2A 1QAIA 8ICUA 4QZGA 4ELTA 3LK9A 1RT7A 2HNYB 3OL8A 5T14A 4NLGA 3IM1A 1ZYQA 3M9OB 2NRZA 4ZPCA 1DOQA 3B0YA 4IRDA 3MTKA 4MKBA 3ORYA 3CDWA 5I42A 4ICLA 4URSA 4RUCA 2PXIA 2J6TA 7ICPA 1S0OA 3PR5B 1KLMB 4IFYA 5KT2A 1KEJA 4RNNA 3Q8LA 4RU9A 5DBAA 3AUOA 4DG1B 3DMJA 2OPQA 4RPYA 2F1HA 1S6PB 4H4MB 3FYHA 4MFBB 4KKOB 3MEDB 2W7OA 5KFUA 8ICNA 2JC1A 4CCHA 2R2SA 4WXOA 3LWLA 2ASJA 2VG7A 3NMAA 3LAMA 1J5OA 5DQGA 3PY8A 4RQ3A 5KG7A 4RW7B 2UVWA 3G86A 2HHVA 3TQ1A 1LWFA 1NHVA 5C25A 2FVSA 2XY5A 1EETA 1ZQAA 4BWMA 1S10A 1LWEB 4ECWA 4KLIA 9ICVA 4RQ0A 3BGRB 4K4ZA 1QUVA 1FK9A 2ZD1A 4YXJA 1RTDB 1TKTB 5HBMA 2AU0A 4I7FA 1FKPA 4YR2A 2OPPA 5KFCA 4DQSA 5DLGA 2WK4A 1EETB 4Y3CA 1JKHB 2UVVA 4G1QA 4TXSA 4R8UB 4KLFA 4E0DA 5F8MA 3I5BA 1QAJA 4KN4A 1JLFB 4DFKA 5J0OA 4YQWA 4M9LA 1S6QB 3Q8RB 4ZHRA 4I2GA 4RQ7A 1C1CA 3DRSA 2W9AA 1DTTA 3N6MA 2IM0A 3DOKB 1S0NA 4URQU 3RH4A 4ECUA 3C23A 5KT5A 4DOCA 8ICZA 3C6TB 4MF2A 1DTQB 3HHKA 3PO5A 2HW3A 1IKWA 3ISDA 3RJIA 4BDPA 4QPXA 2FVCA 1JKHA 3PX6A 5C24B 1TAQA 4ED6A 2XY7A 3FFIA 3E01B 3KLFA 3MABA 2HWHA 4LZGA 2YNGA 4PHDA 1HJPA 3ZDBA 3H5UA 5J0WA 3H5YA 4I2AA 2F1IA 2OWOA 2FMPA 4IFVB 1JXLA 3H7IA 3FQKA 5C42A 3MEEB 1TKXA 2HHQA 4WZMA 9ICTA 9ICHA 1QE1A 1LWFB 5D4BA 2AGOA 3FFIB 4K4GA 4ED2A 2ZTDA 3IRXB 3KOAA 3FRZA 5DB9A 4EEYA 4M2YA
chains in the Genus database with same CATH superfamily
3MD1A 1E9YB 1CJTB 2H54B 1U4BA 5KFFA 4LR8A 3MCOA 1YDLA 3WU2U 3JPQA 5KFVA 3SV3A 4A8WA 2P53A 1Q78A 1WF0A 2H3IA 2W2NP 4OX7A 4LFAF 3J7A1 2O67A 4KLGA 2OXOA 4QZAA 5K8MA 1N52B 3L5KA 3R97A 3RFAA 4I4BA 4ZLLA 5F3TA 2RUGA 5IT9U 3O7UA 1YBQA 1QTNB 2VJUA 1RISA 4YHHF 3UXOA 2RGVA 3UI3A 2UUBF 5D1OA 2UBPC 2DH8A 1UPHA 3CMAS 1JJ4A 1LWCA 2FJ6A 4HL9A 3SFUA 5IQQA 2VFUA 3GIJA 3P6YC 4K2XA 4E2FB 2UXDF 4M5MA 5J0RA 2JLGA 2AGQA 3BR9A 2DNLA 2J76E 4P0QA 3MOZA 2FVRA 1TA8A 2XCPA 1H2UX 5ALZA 4DF8A 4CZCA 3IG5A 5CZXA 3NUQA 3LF0A 3D2SA 1HQUA 2CADA 1BJTA 3N41B 4BBSG 3QGAC 1CC8A 3NS1A 1C0UB 2VF3A 3GWCA 5BOMA 1F0MA 3OFGA 2KFNA 1FWAC 1LFWA 3KTQA 5KFRA 1URRA 2XICA 2WBRA 4BGDA 1U09A 1C1BB 3GILA 1X4FA 3TAMB 2FJWA 3CD6S 2ZC4A 5ALHA 2BXJA 1MNEA 2CJBA 4IS7A 4DR4H 3KK2A 1IBLJ 4K4VA 2CZ4A 2XS5A 2XZTB 2XYGB 4DHVA 4LF4F 4NXMH 3EJMA 4RBUA 4RNHA 2V2KA 3BM7A 1T9WA 5CCLA 1N63A 1JMTA 2MQOA 1PBUA 2CW8A 3WBZA 4ZVFA 1PVRA 2R2UA 4O3OA 4MV8A 5J0YA 3IO1A 3HDSA 2BJEA 9ICNA 1X7VA 4K7QA 4PG4A 3R2DJ 3GV8B 5A0YA 4LMZA 1RJQA 5M2RA 3OGUA 1UCVA 1CRXA 2A1BA 3F0NA 4WFAQ 5A2QU 3GRIA 3S6JA 1RTHB 2DK2A 2LFVA 2RGRA 5DDRC 1ZTWA 2ZHAA 2E1PA 4C8MA 3QNWB 3DU6A 5J0SA 3HJVA 2WCXA 3RBDA 4OZJA 3VR1A 1WG5A 2UUCJ 2MSTA 1TE2A 1JI7A 2HVDA 4A8YA 4QWEA 3TW0A 1WNEA 3KKAC 3H2VE 3NCRA 1APSA 4U8VA 1DGJA 1Y5LB 3RAQA 1KJQA 3PKYA 2CQYA 3Q1KA 3UFCX 3CC7S 4EGQA 4PG5A 4QJVA 2GS8A 2PFDA 2HKEA 2ZG6A 4P2HA 2EBGA 2KXNB 2KT5A 1AA1B 2Y9HA 2E2HA 1I7LA 4HR7A 3OLBA 4ZLJA 1CBKA 3GV7B 1RKIA 1M0SA 3B6BA 3MM8A 1YJ7A 2WVBA 1R0AA 4DUTA 4WXWA 4PHEA 4MA5A 4IH5A 3BZKA 3UXNA 1D9DA 4F93B 1WHVA 1VK8A 2IM2A 3UCGA 5ALYA 1KDHA 3DV9A 2FJBB 4KPCA 4RAYA 2VA3A 2AQVA 2LEAA 4OIXA 2GNKA 2K4IA 4KR0B 4RNFA 3MPVA 3RG6A 1IKYA 3OT9A 2P9CA 1VLOA 3K2YA 4X5VA 2EG1A 1YGYA 1GKRA 4ZVGA 2FZGB 3GTPA 1T8EA 5HNKA 2YB1A 2JSXA 2K4HA 3CIMA 3H25A 4ZMMA 3K3VA 2CPEA 4DFPA 1XR6A 1WI8A 2YNGB 5G0RA 3HI9A 3C21A 4Z6EA 1XQIA 3BO4A 3E01A 2AZ3A 3VAMA 3OJUA 1JK9B 1YIJS 9ICEA 3RUPA 4MA0A 5DBCA 5FJ4A 3GR0A 4JI4F 1SH3A 3QWPA 4LF8J 2YKNA 3KLFB 5HMXA 2LQJA 2WONA 1UETA 3NGKA 1SKWA 1SB3C 1KBRA 2R3VA 2W3RA 4PPDA 4PL1A 1Z2PX 4M47A 3R9KA 2ISOA 1AXQA 4Y28C 1UVJA 3OPKA 3GTOA 4DPXA 4CIOA 3O2IA 2B8QA 1ZHSA 2JDJA 1GXUA 4M9UA 1HBUB 2K8CB 3DRSB 4YB6A 1S9EB 1N33H 2MAXA 4F4WA 2BCQA 5A2QW 1X9MA 2IBKA 4GFJA 4KRWA 1W96A 3TZYA 3RB3A 1DAXA 2AJ1A 2ISPA 3EGVA 2QLJB 3ICJA 1FO1A 4DV0J 1P7DA 1H6KX 3AFGA 1N2XA 5DDPC 2ZUAA 3U1NA 5KG4A 1K0TA 1FO4A 1R43A 2ERRA 1FTCA 4MIBA 4YFUA 3NMRA 3JPOA 3CCSS 4I2IA 1FKPB 4Q0BA 3A8JA 1D9FA 3DDNA 1OPIA 5CB4F 1SFOA 3GJRB 2LMRA 2ILYA 5DQIA 3D5MA 4YFKA 1IBLH 3KHRA 4RNMA 4FYVB 4NYPA 4MKYA 1IOWA 5KAKA 1R27B 3ZDDA 5LMNJ 3PMNA 4IC9A 4UW2A 1NPPA 1KWMA 2C3PA 2JX2A 1R9YA 3NOCA 5H2FU 5KG3A 4WKYA 4IYQA 5F3ZA 5LOVF 5AIBA 3HVAA 1UFLA 4YAKB 1B7YB 2HLTA 2QK4A 5C3EG 4TURA 1UNNC 1L7OA 4UY85 1A0PA 5DB6A 4K4YA 2OPRB 4C5YA 3NGSA 4C9DA 3V6DA 3R0DA 3J81W 4NL5A 4YIWA 3J7Z5 3JSBA 4MEXA 5SZTA 5HQLA 3H0PA 4B3MJ 2P9BA 3SE7A 3UDLA 5KX5F 2NUAB 8ICPA 1RTIA 3ICLA 3KK2B 1EJXC 2DIUA 1NK6A 1RA6A 2C2ZB 3CJ5A 2N82B 5F8HA 1NJWA 3LP1B 3BSAA 5D77A 2DR9A 3AY0A 3C1ZA 3Q8PB 1ZQHA 3NG8A 4LF6F 1GSAA 1VC5A 4YR3A 1RAKA 1FT8A 3I76A 4EPBC 4WFXA 4G3IA 5KFAA 3G8QA 1TWGA 4NM2A 4K0KJ 1TV6A 4M5DA 4DR5H 2ZH4A 4MTEA 4OJGA 1TFRA 3OL6A 2ZJAA 3L4PA 3R3TA 1NUEA 2FHKA 3VPDA 1VQ4S 5ALDA 3BS9A 4AL7A 3KJNB 5HBRB 1U9LA 4UCVA 5LL6b 1ZQXA 3MEGA 4N47A 5J2QA 2ZOGA 3RUBL 4A48A 4DR1H 2CQ4A 5ETTA 4Z42C 2QT7A 1TWHA 1ZPWX 2W9CA 3MAAB 2P6RA 3IR6B 3NRWA 3C5GA 2C28A 2QIFA 1CEZA 2GC8A 3WKAA 3L3FX 4K4WA 5FJ8G 4RB3C 1FRXA 3E0LA 1GXLA 2ZWPA 4ZPWR 1U1PA 2ZJ8A 2V58A 2XWXA 4TQRA 3M2RB 2IA0A 4N8NA 4JI8F 1IVZA 2GWSA 1RLDA 2NCKL 3VCBA 1FWLA 5TISU 1KFTA 2OEMA 1JIHA 4K0KH 1DIKA 2WVCA 1WOSA 3W8PA 3R9LA 3R1LA 4KQNA 1UTAA 2AGPA 4EFAC 2KT2A 1PKUA 1HQ2A 3PG9A 3QJLA 3ET6B 3ENQA 2R7UA 1UMJA 2J9EA 4NWBA 2MPUA 1EIYB 1IUJA 7FDRA 3ZTOA 3KZXA 3R5HA 4USIA 1KN6A 1GFWB 4JMUA 3BBFA 2XMAA 3O0FA 5KFMA 2BPFA 2BKOA 3OVAA 5T41A 2DGZA 4DSLA 2ZIVB 1R3NA 1HPZB 5K2MA 1JMSA 2BR0A 5DZ7A 4RQ4A 1PK3A 5J2MA 3DLGA 3VVTA 2GLEA 1SH0A 2I5JA 4CLZA 2ZH6A 5J2FA 4L76A 5HP1A 2IA6A 8ICQA 4DDFA 3R2CJ 3VMMA 4X4NA 3HWTA 2W25A 4ANDA 3M2UB 3V7LA 3IRUA 3MWBA 3OJSA 2DIKA 1NZ8A 1R6VA 3PO2G 3PIOQ 3NVZA 3D3BJ 3CJKB 5IOLA 1A9XA 4IO9Q 3C14B 4IG0A 4WTOB 3CQZA 1A76A 4GKKF 4BUGA 4IQXA 3IM8A 4D3GA 2W6QA 5JVHQ 1L8LA 3MTJA 4NA1A 1RT1A 3PHTA 2DH9A 4LRAA 3M6ZA 4Z7CA 1M6VA 2ZJTA 2KVCA 5F9LA 2MSSA 5EHHA 1HD0A 1KRPA 1RAGB 4DQIA 3ADAC 1FIQA 4PUOB 4DV0H 2GJ2A 4NV0A 1VQPS 1HBMB 4QIFA 2X51A 4NA3A 4RR5A 4B6JA 5I4MA 2LCWA 3UNYA 1JXVA 5J2DA 2R7KA 2QSWA 3T1YJ 3K5MA 4NXMJ 1QE1B 3TQTA 4E4TA 2J0XA 4V19J 2ALZA 2VPZB 2G9OA 4EU0A 5B7WA 3VAFA 2R7OA 4I7FB 3CCMS 4K5RA 4CNUA 3N4WA 3TUZC 3RGXA 2BVZA 3PYEA 1SL2A 2A6MA 3EZ5A 3BGRA 2HVIA 3DRRA 1PSDA 4KQZA 1AUSL 3PFOA 2ZWOA 2VPQA 2MJNA 2YYAA 1DQ9A 2DGQA 2YH1A 2JZBA 4Y2MA 2LDYA 1Z2NX 3ITHA 4MK8A 1F9EB 3RF2A 3JQKA 3J7YU 2ZUBA 1WDDA 3UMBA 1TUWA 4HTJA 2PEHA 1HNVB 2Y0SD 3GTJA 2ZZMA 8ICSA 7ICLA 4CQCA 4GXKA 3TFRA 1C1CB 4RPXA 2HPUA 1WC1A 1BXNA 1IWAA 3MDAA 2ADBA 1SUQA 2WONB 2F9JA 4IDKB 3K4GA 4ID5A 5KAIU 2D3ZA 3QAEA 4X62H 2R7QA 3IWLA 2V8VA 2A1JA 4YVZA 1HWLA 4ATNA 4XO0A 2AJ2A 1Q8LA 2ZBPA 1S59A 3R6LB 1XNQH 3OTDA 4F71A 2HFUA 2Z30B 5J2EA 3OVSA 1TUGB 2LA4A 2OJ3A 2UUAH 1FWHC 2AJQA 4UT4A 2WF6A 2Y1LB 1RLCL 1F6TA 4I6AA 5M2UA 2QEXS 2DNQA 1IN0A 2ZUDA 5AI9A 5A6WA 2WOMA 2ZIXA 1YZ6A 3WO0A 1GMWA 2ACYA 1DARA 4OD0A 1S1XA 1BNCA 2UVUA 2EKNA 3X1LB 1ZOLA 1S1VB 2KG5A 4CM0A 2DR8A 3R5FA 3O6QA 4OZ0A 3Q8SB 1VBZA 2JA5G 1MA7A 1HYSA 3BS5A 3QRRA 2HNZA 4LFBF 5F8IA 4NE9C 1U0HA 4LQ9A 2R7LA 1X9WA 2JL9A 2N1RA 4DG1A 2BZ2A 2HQFA 3N44B 1Y5IB 4JV5H 4TY9A 1X4EA 3KXYT 1FXLA 4KBIA 4USTA 2FLPA 3QXGA 1T94A 1X8DA 4H4KC 3FKBA 1VQ8S 1ZM9A 1S99A 1BNOA 4HR2A 3VF0B 4ES2A 1TAEA 3EPIA 4M6WB 1QUPA 2YNHA 3UDCA 3F5EA 4M5KA 4TVAB 4WFBQ 3RZAA 2B3TB 1XR7A 2VONA 3C15A 5AXMA 2AX0A 2NSBA 3N5FA 1U2CA 4CNTA 1HR0F 1WSCA 2N3LA 2B0CA 9ICLA 4C80A 4I6YA 2XZDB 1SCJB 3WK4A 4PABA 1CJUA 1VQ6S 1NLKL 3K5NA 3DLKB 3L95X 1D8LA 1YRXA 4ELVA 1EJUC 1MU2B 2XYHB 2NU6B 1BHNA 1IBKF 2YKPA 2FIUA 3P49B 2PA8D 1R8BA 1YJUA 2VHGA 2VOOA 3EZOA 3K75D 2D7SA 3BBCA 1WC6A 1KBLA 2DRAA 2ZKTA 3M1VB 3IGNA 5IT0A 1TKZA 4R7RA 3F2BA 2RILA 2HLUA 1Y1VG 4JYAH 5DG7A 1H74A 4DV2J 4MFCA 4B9NA 3ZO7A 2VDHA 3IG0A 4AL6A 1Q1KA 3WIVA 1XSLA 3DGPB 5DG8A 3S01A 3A1YG 2OHDA 1BPYA 4P0PA 3OL7A 3OUYB 1JLCA 4CDGA 5DETA 2BV3A 2PO4A 2W43A 4MFAA 2C2KB 3OV7A 1HI1A 2R82A 2CPRA 4F4KA 4KLOA 4RLEA 4RL1A 1SH2A 3CMES 3N6NA 4DR3F 3H8YA 4ZH4A 5FSEC 3U1LA 4QIWC 4UB5A 3V4IB 1ZQVA 3EWAA 1DZ5A 4F5RA 3KFWX 4YMNA 4WGXA 1X4CA 3QUBA 4KT0C 2IHNA 3OTQA 3UNGC 5GAGI 4A8FA 1JUDA 2FD2A 3MAQA 4LF7J 2P6UA 2DVIA 4PYAA 4CLLA 3R23A 2UUCH 4LH7A 3EW9A 2DRDA 1NK7A 5DKWA 1RQLA 4JI5H 1NSKL 3OOQA 2AZ1A 2Y1IA 1VK3A 4RWXA 1KDNA 3F5AA 4QQBA 2NVYA 3TJAA 2YNFB 2DGVA 2HNZB 3KG1A 3CJ4A 4YY3F 2OD4A 9ICJA 1HYSB 2CJYB 7ICQA 3WZ0A 2X1AA 4OJ5A 4CQ1A 4QZBA 2LYBA 1REVB 2IYIA 1M0TA 1T9XA 4EYHB 2Q43A 1Y1VA 1KLNA 4RQNA 3UN3A 4C0BA 2YS7A 1RK5A 2HQIA 9ICMA 2F9DA 1S5ZA 3C2KA 1SV0A 3U26A 4LFCH 2ZDGA 2F40A 1WH2A 5LSOA 2V9WA 1YMYA 3C16B 4ZP6A 1FXRA 5CWRA 2NXEA 3L7OA 3OSNA 2Z0GA 2UP1A 5ALOA 2DHGA 2DNMA 3RTVA 2WHOA 3IXQA 2KAUC 2IBOA 2NUUG 2X1BA 2XD4A 2X7IA 3C28A 4QCLA 1SJ1A 1FNOA 3M6WA 3BGFA 3UN2A 2FHJA 2QB1A 5D4NA 1AYEA 4DL2A 1NDPA 4K8RA 5D46A 4NLTA 1CJTA 1PCAA 2W9BA 1RTJB 1TL1A 1DURA 4F4ZA 5J2UF 3QZ7A 4TUSA 1RQ0A 4IWXA 4R0EA 4C5CA 4CQDA 4IQUA 2W4CA 1V85A 2PI4A 1R9ZA 5KL1B 1ELOA 3ZNUA 1AZSB 2YW2A 4TU7A 2R7MA 4DUZH 2JMGA 4TKTA 5J0QA 1SBRA 2CQHA 2VFVA 2V9KA 1WG1A 4UCSA 5EDWA 1XMOF 2DGTA 5CAEB 5ETKA 4OX9J 4G7EB 2IOHA 3K5PA 4CE6A 4A46A 1BC6A 1C20A 1EXNA 1TUVA 3MXHP 1T03B 4TN2A 2HK2A 4EFBA 2OO4A 4EUVA 4Q0YA 3UPFA 3CJTA 1JLQB 4K4HA 1QSSA 4DUYJ 4LBHA 1HWUA 2WAQC 2OSRA 5E79U 1C0TA 2G2YA 1FVIA 3GQCA 4A8QA 2AXTU 1LK7A 3GZ7A 7ICUA 1UT8A 4I2HA 4B9MA 1ZQKA 4ECSA 2RHQB 1K44A 1SJ4P 1FWEC 2HBZB 2CPJA 3T5HA 1RM6C 4RBTA 4LVOP 4DCOB 3M1YA 3TANA 1S1TA 4L6V3 1KHVA 4RUAA 2BJ1A 3NKYA 2HYIB 3ILJA 1V6HA 4USWA 2MKJA 4V19X 2F1JA 8ICJA 2WAQE 1HBOB 2DXFA 4PXCA 1WHWA 3GIKA 2F1FA 3CB4A 3M8RA 3Q8KA 9ICOA 1FK9B 1OQ3A 3EXYA 3QU5A 2CAJA 3VGUA 2Y0SE 1YRTA 2DBBA 4NY8A 4O4GB 4DV3J 4KGKA 2CZGA 1WYGA 5AXNA 2E5HA 3CVZA 3FCVA 2FE9A 3OR1A 2YKAA 2ZE2A 4O9MA 2KL8A 2VBYA 2P8IA 3IA0A 3SCKE 1BUXA 2R4FA 2WW4A 4TNOA 1S9EA 5DM7Q 4DR2H 3AQPA 3V6KA 1U47A 5BYQA 3KLEA 1QSLA 3IN5A 3ZTSA 2V63A 4C7ZA 3EGWB 2GA7A 2CKWA 2NU7B 2ZH2A 4C0OC 4PHAA 3RJ0A 2A3VA 1I3OB 1XTZA 2HZVA 3QSIA 1ZQBA 4QZ9A 4EGLA 5GVQA 5D6GA 1KP6A 4J9MA 4ZCKA 1X9SA 1NJZA 2W70A 4P4PA 4IFYB 5D78A 4A3MG 5DB7A 4DV1H 1XJWB 3CTRA 3I4PA 1J6PA 3UMGA 2I87A 2V68A 4P7TA 4Y8VB 4DPYA 5D8HB 3J80W 4R65A 3H59A 2ZDQA 3DCAA 1KFSA 4CQBA 2IDEA 5I3QA 5LT5A 2HSZA 1SC1B 4YN4A 1N54B 2UV8G 2I5JB 1GSOA 2EXUA 2BDPA 4LSNB 3SSRA 3VGTA 4ETSA 2CJQA 1ZS6A 4LBIA 2B4VA 2JEIA 1RT4A 2POKA 2YTUA 5KFPA 4F8RA 2M9NA 3K58A 2VM8A 2LQ9A 3AB2B 1KOOA 3AOAA 2GIFA 4R64A 1TFYA 4JUZA 4ECYA 1P1MA 4DLKA 5G4HC 4OI2A 1KJJA 4NLWA 4AFFA 1BXRA 4DL3A 3ET6A 3T19A 3KLGB 3IGVA 5CEHA 2G0IA 4KHPH 3US5A 1T0TV 3KBBA 3V72A 3ZI4A 7ICVA 4RZBA 2F77X 1IJEB 1X4HA 3HSZA 1GXTA 3RBXA 1X5OA 1NDKA 1Q82T 1NSQA 1FJGJ 1ZQJA 2GJFA 1NK5A 2C2OB 5IXUA 2R7RA 7ICGA 4EPDC 1BPEA 5KNIA 4NMLA 3RFCA 2M0NA 3MWEA 2HHUA 4MIAA 2EANA 4O44B 1PVQA 1JQGA 1NM2A 1EP4A 5D0HA 1NZBA 2CPFA 4MKAA 1SV5A 2OPSA 4Y2VA 4ZIVA 3T5KA 1HNZF 2GIRA 1QVFR 3U9SA 2VFTA 2ZIUB 2W24A 2E44A 5L1KA 4BWSC 1S4FA 4KN7A 3QEAZ 3WX4A 3OFEA 4B3RH 1B0PA 3THVA 2YRWA 3GIRA 2MQQA 5DDQC 3IGHX 2IFXA 1ZQGA 2YBVA 2WF9A 5BJRA 2BOPA 4BXOA 2ASDA 2C1EB 2NLWA 3FC4A 4NEZA 3MCNA 5D0RA 5IC4B 3FCWA 3L9ZA 3KLHB 3QNMA 4USUA 2B9XA 4LJXA 3QZ8A 3TUIC 2K3IA 2VOBA 3CYMA 1GMWD 2AIRB 2PN1A 3G8TA 8ICCA 4ZVUB 1O0PA 4XPEA 1ZZNA 3D6HB 2OLWA 1JRPA 4WIIA 4X66F 2G09A 2KM8C 4DQRA 3PVXA 1UJ6A 4FS2A 3WNZA 1QAIA 8ICUA 3OL8A 1ZD3A 3GYXB 4NLGA 3TRGA 2QB0A 2EKYA 3MM7A 2KFYA 1H7WA 1VBYA 5HK4A 3M32B 3HHLA 4IRDA 1FDBA 2R42A 2HQDA 1POJA 1RB0A 2J6TA 3HHLC 2CWKA 1QCKA 3PR5B 3I55S 1A0OB 3WKDA 1FRJA 5AXKA 3Q8LA 4LF5F 5DBAA 4DG1B 3TA1A 5K8NA 3DMJA 3BDEA 4RPYA 1EKSA 4MFBB 3TINA 2G08A 3MEDB 1IV8A 2EK1A 4FYYB 2JC1A 4W92B 4FNHA 3K89A 3LWLA 2ASJA 1UL3A 4HNVA 3PY8A 2WW8A 4RW7B 4JI0J 1Y11A 2HHVA 4ZVSB 2W11A 1Y3JA 4X4PA 4DL0C 1FCAA 1NDCA 3VAJA 2VD3A 3LPEA 4ECWA 4KLIA 1LXJA 3OXGA 1QUVA 3POTA 1FRMA 4WHBA 2RVJA 4LF1A 1FEEA 1RTDB 3N43B 1TKTB 1WOOA 2AU0A 4YR2A 3PRBA 5KFCA 2ZIXB 2E2IA 2P2CB 3C15B 1EETB 4JI7J 1PYTA 5D1PA 4L72B 4JI6H 3R7BB 3B9JA 2MB0B 1WORA 1JLFB 4TLQA 4X64H 4DFKA 3FVYA 4M9LA 3HKZE 4Y2SA 4M5LA 3QJJA 2KEYA 2L5YA 3HMJG 1U2RA 1C1CA 1MROB 2YKQA 4DR6H 4URQU 2MZSA 4DBQA 4BLGA 4KX5A 4X84A 4LF9J 4LF5J 3CRXA 1ULZA 2YMPA 2HW3A 3ISDA 3HHLD 1RU1A 3N8DA 3RJIA 5ETMA 4CWBA 1JKHA 1XMBA 3HHDA 3BABA 3M32A 5E33A 5HQ8A 3ETMA 1OYEA 2XY7A 1Q79A 3FFIA 3E01B 1T3OA 3TZXA 3TIGA 1U0SA 4LZGA 2YNGA 3OR1B 4PHDA 3LQVA 3H5UA 3H5YA 4I2AA 4PG6A 1X4BA 2KHCA 4IFVB 5LXXA 1B0XA 3WK9A 1JXLA 3BA8A 1KRBC 4O2BF 3QU2A 9ICTA 5IT9Y 4OZNA 1LWFB 4RB1A 4GY7A 5D4BA 1VQ9S 3MGJA 5IM0B 1E6YB 4ED2A 3NGUA 2VQEJ 3O1LA 2RS2A 4ME6A 3FEYB 1YJVA 4M2YA 2HVRA 2RQKA 5IIKA 2HAFA 4XA5A 2ZTCA 2MEWA 4PUOA 1Z00B 2GAGC 3M6VA 4JI5J 1IQTA 1HARA 2B56A 1W2BR 3C1YA 1F2GA 2DJWA 1XNRF 3C6UA 2AQOA 3CDBA 4Y6IA 4PCQA 4QZCA 1UWBB 4DR7H 4H4MA 2NYIA 2BANB 3TACB 2EH9A 3DKDA 4DN0A 5AXLA 3LAKA 4P72A 2RHFA 2O03A 4F0HA 4CF3A 3PSIA 4DN9A 3F2DA 1COOA 3BS7A 3N6LA 2RD5C 1A5OC 2YVSA 1CS4B 1UVIA 2R8KA 3JRXA 5GADU 3EDQB 4CO3A 2KHQA 3VTIA 9ICUA 4BCAA 1YX2A 4DV1F 4TYBA 4DX7A 3V81B 4I27A 2G13A 3KDOA 3DRYA 4JI4H 5J2HA 2OODA 4YD1A 1RAHB 5B0CA 4O5EA 4YG2A 2FHJD 2Q6CA 4IOBA 1AZSA 4I67A 3W2VA 4F3QA 3R7NB 4GO7X 4USMA 3BDPA 1RT5A 4ECZA 1NJXA 4JYAJ 1Q53A 3M6KA 4KIAA 1V5VA 4C8ZA 2R7TA 4DOZA 4ED5A 1SIWB 2A2CA 4K50A 3RJEA 2QLWA 1BGWA 3PYGA 2UZAA 2JA5A 3ZDCA 5IFMA 4PEOA 2VG6A 2B6GA 5IIJA 2JWNA 3QGPA 1RT3A 2WSFC 3D0GE 2GSEA 4ZJQA 2NO5A 3FBFA 4AQYF 4B3RF 4JI1J 1N0UA 4P6QA 1LWCB 2R18A 2BACA 1E4GT 2CNOB 4ED3A 1U24A 4N41A 4OV6A 4HHJA 2MLYA 1MN9A 1X66A 4I1TA 2BW2A 3I9V9 3QGIA 1SKUB 5LMNF 2DGUA 4GBDA 3H40A 3IV6A 1ZQZA 5J2JA 1RYRA 2RF2B 3M9MB 3TFSA 1Q3VA 2NZCA 4WD3A 3DXSX 4RT2A 1EP4B 1DV1A 3SQIA 4NXMF 4LF4H 2MA1A 1SWVA 1N5WA 1HL6A 3MM5B 4Y65A 4B3SJ 2VICA 4HAIA 2AW0A 2B21A 4MFFA 3G8SA 1RDFA 1UVKA 1GTEA 3KXDA 2HGMA 3N6XA 5L38A 1KHWA 2MZ1A 2M4MA 1OO0B 2HHXA 5HROA 4HVZA 1U6FA 3IBCB 3MPDA 4DI6A 2G3FA 3QX7A 3SCIE 4WJ3B 2AJ4A 4JV2A 2OAUA 3KJFB 2UUCF 4FKYA 3HOXG 4QJFB 2KE7A 3BKUA 3OTOJ 3SXLA 1M0WA 2LU1A 3IWNC 2P0AA 3HO1A 4DL7A 5HMZA 4TV9F 5GMEA 3VQTA 2MQNA 3LP0B 7ICNA 3KK3B 3TARA 4RO0A 3DLEB 4NEYA 1HQEB 2MZRA 3BH6B 4USAA 1BQMA 3QRPA 2KJVA 3MMJA 2JH1A 4AYBC 4TU8A 3LANA 5LYJF 3GG0A 3R27A 2DIVA 1DLOB 2R7XA 2QX0A 2KJWA 3E5NA 2W9MA 4X4SA 5KFHA 4ANEA 4C3MA 1KVJA 1TWFA 1S48A 1Y3KA 2E1CA 7ICKA 2DYAA 1EYZA 7ICIA 3AD9C 1ZTTA 9ICIA 5I3PA 3GYNA 1OW5A 4IKAA 2ZM6F 2AP6A 2F3NA 1C0TB 3C6UB 1GKPA 3T3FA 1PO6A 3PV8A 1G1XA 1Z00A 1IE7C 1EHWA 4OQJA 2GJIA 4EO8A 2ZJPQ 2BABA 2UVRA 1E6VB 2XGQA 2JVOA 2RUSA 4US9A 4IRKA 1HWJA 4G7EA 1WD6A 3UPQA 1RT6A 5CH7B 5J2BA 2YWFA 1QQ7A 5AKEA 2Y1RI 4J9QA 2IM1A 1KQFB 1OJ4A 4WP3A 3W1YC 3G4SS 5AI5A 4RWWA 2VIXA 2AWZA 1A77A 2QT3A 3GLJA 5ALLA 3M05A 3VAIA 2OIHA 3C66A 4UAYA 2QN6B 3T9ZA 1VRUA 1B70B 2W6ZA 2BJ8A 4DX8H 2BCRA 3D9BA 1JNZB 2CPDA 5J2NB 3P96A 1Q5YA 4FE3A 2CRXA 3LYSA 1HBMA 4CNQA 3AQOA 3S6EA 3N42B 3GIMA 4X64F 2DO0A 5KFSA 4DR1F 3BPDA 4OYXA 2ABYA 2BJ3A 2A1AA 4HHHA 3V6HA 3WK8A 4IR1A 2W8KA 2DRBA 1RE1B 3JPNA 4WIQA 3N01A 1HNWJ 5GONF 1T03A 4QU7A 4UBCA 4RB0A 3ISZA 1GNKA 2E8PA 1L3KA 1BQNB 3N7RC 3LOUA 1R8AA 2LXIA 4LSZB 1W2IA 4A47A 4F0LA 1FFUA 4OHXA 3UVJB 2J5AA 4DR3J 2WYOA 1T4GA 3NASA 3CCWA 1ZQQA 2PVPA 3JYTB 1DHMA 2PFQA 3KTMA 4TY8B 3M8WA 4RX6A 1BPBA 1F9FA 1PK1B 1SB6A 1XSNA 3N7SC 8ICYA 2EAPA 5AKIA 2XS2A 2QC3A 1XNSA 1HPZA 5L39A 3QMQA 3SMVA 2PAJA 3QQCD 4J9UE 3ENAA 5G5HA 1N36H 2BBEA 4I2BA 4RW8A 2JLEA 3GPAA 3H8JA 3KUGA 3V4MA 1YI2S 4F3MA 4C97A 4P4OA 1OPZA 4YXMA 3JAMW 2C3MA 1S1WB 2XYPB 2OLSA 4HH1A 8ICMA 2HI0A 1P9YA 2J6SA 3MM6B 1S6QA 1SC4B 1U1KA 3OL9A 3I56S 4UOFA 4Q5VA 1HMVA 3V4SA 1I94F 5CCMA 2X3GA 5B0FA 2BW7A 4LF7F 4IHJF 3MC1A 4Z6DA 2W6MA 3G2XA 3N40P 2OFHX 4GVLA 2M70A 2V2QA 3D3CJ 5AKZA 4PZNA 3TJ9A 2QL7B 2EDUA 4MF8A 4ED4A 2MKYA 2Z8QA 4DOAA 5ETSA 3JB9k 3KHLA 3BR8A 3MPWA 4I2JA 2G2ZA 4AQYJ 2SCUB 1RWKB 2FLNA 3KWMA 2J0WA 3QUTA 2WVFA 1RACB 1IKYB 2Z2MA 2L9DA 2HIQA 3CJ8A 2VIHA 2EFPA 5CD4H 1H2TZ 3SYZA 3T6BA 4AP9A 3BGLA 3KZIU 5ALJA 1VOMA 3K59A 2WDTA 4OYBA 3KOOA 3JQMA 3DLJA 4OZ1A 2SXLA 4J7CA 2MZQA 1WEZA 6FD1A 2VASA 1JJHA 1N32F 1P1TA 3OTCA 3PHEA 5KG2A 1RT5B 2O01C 4P2XA 3EWGA 1VQYA 2D69A 4IL6U 2BE2B 4CLKA 4IG3A 1NOMA 1B0VA 5FDLB 3VGSA 2XQCA 3TADA 1O75A 1WEYA 1K8AT 4ED0A 2ZH1A 2VA8A 3GDXA 4R25A 2QB0B 3V5RA 3RF9A 2R8JA 4LZDA 2KT3A 3DYAA 1KQQA 4LF6J 4TLRA 3ISND 1T3NA 4B3MH 4KH0B 2ROPA 4XRHA 3KUHA 1ZZFA 3CNQP 3GGMA 4ZKAA 5HMEA 2UXBF 3MDFA 4M6WA 2CQ1A 4IG3B 4ACOA 2R9LA 1UW9A 2XEXA 4KLQA 4NZ0A 1FNMA 1XMQF 3W64A 1VJWA 7ICSA 3IP4B 2HOQA 3RH6A 4FPIA 2C42A 4KGZB 4DR2F 3KLHA 5BYSA 2CZVC 2G0CA 2QMUB 1VR6A 4C0HA 1WJ9A 2AYGA 3SAHA 4FNIA 1HNXF 3HP6A 4CEXC 2RIJA 3T1HH 3PZPA 1UA0A 4PXEA 1SXEA 4DSFA 3EVOA 2K4PA 4GKKH 3QBCA 1RAEB 2E1EA 2BPCA 4NJ8A 4FZLA 4P4MA 3RH5A 3VPBA 2CXEA 3ZZ0A 2A3JA 4YUDA 4DR2J 4F92B 4I56A 3HHNB 2R7NA 2K06A 2H3FA 2R92G 2WTFA 5JMNA 5CA5A 2ES6A 3H4BA 3TA0A 3FBEA 2VPWB 4P2FA 3JZIA 4F91B 2FGCA 4ILRA 1GAOA 3OD2A 4WFZA 1ZD2P 8ICAA 3CJQA 2AX1A 5G5GA 2VB6A 2I1RA 2E9ZA 2FHOB 1UVLA 4Z6CA 3H8WA 1YG0A 3UXPA 3W5XA 4RW8B 3CPWR 2V4QA 4DQQA 3A8KA 1P1LA 2CKZB 2DWCA 2G0JA 4JI7F 4DV1J 4IH6A 4YJ3F 3DRRB 4EZ6A 3R5JB 4JI3F 5L9NA 1TL3A 5D0EA 1RTDA 2I2YA 2ZXIA 2VBXA 2WBMA 1VQMS 4M94A 3EGJA 5LXYA 3H90A 3I96A 1Y5NB 4I29A 1BQNA 2LYVA 2QV6A 3OTBA 2W8LA 5B0AA 2FJAB 1CULA 2DXEA 2VKQA 4MYUA 4JI3H 4CO5A 4G9BA 1WOPA 5JH7F 2CPIA 2FJZA 2JRZA 1SUQB 4QIGA 1P8LA 2BQUA 4KHMA 3GFHA 3JPSA 2XO6A 4UB2A 1XNRH 4NASA 5C4XG 4EELA 2KB2A 2I8CA 3M4IA 2B43A 5E3QA 3F53A 5HR6A 1URJA 1GQEA 4L9XA 5AM4A 3DRPB 1VLBA 3BQ0A 4WFNQ 3JPPA 3OVBA 1ZQMA 2XCAA 3ITHB 3QFWA 5B0GA 1R31A 2JZBB 2HNDB 1RT1B 3CEDA 2R84A 2G06A 5FLMG 2NV3A 3TP2A 2BM1A 4IG0B 4CP5A 2ADCA 2VQEF 1FJ7A 5LM7E 1BLUA 3NGRA 4ZA1A 1KQSR 2E5LF 3BF4A 5DZ6A 3PSFA 2P66A 1T36A 4NI2B 2CQIA 3K5HA 2JC0A 1XN9A 2CWXA 4A8EA 2LKYA 2W2QP 1Y1WG 1D8BA 2JHDA 4UZCA 3C2LA 2RF4A 3SV4A 2NYVA 4DV4F 2Y1JA 2CJXB 5DLFA 4F4YA 5HMMA 5C0YA 9ATCB 1IWGA 1UVMA 2NRTA 2D3O1 2NQPA 2JOQA 1NB7A 3MMCB 4RQ1A 4XDCA 5AJ3J 3CCUS 2WB1F 4N76A 3IS9A 4J9OA 1WTFA 3A3PB 5K14B 1UJ5A 3D6JA 3FQLA 3AYHB 3M8PB 1BMQB 3D6MB 3MCSA 4OL8A 1COKA 2RLTA 4PR6A 4MTPA 4GKKJ 5FPOA 5AKLA 1SJQA 5KAFU 4X4RA 5B0DA 5HN0A 1XO1A 4RQ8A 4C8OA 1G4CA 3TJ8A 2PMZC 1OWTA 2DISA 1L6NA 5KFZA 3K17A 3NAIA 3KG0A 5A8KB 4WYWA 2KU7A 2OH2A 2W4PA 5IC6B 4UCOA 1TMJA 2K1RA 4Q44A 4F50A 4B3SH 3BQTA 3KALA 4DR4F 2BKPA 5CP2A 2WAQD 1KTVA 3ZD8A 1YHQS 5L1IA 4I50F 4ERDA 4F36A 1J2VA 1FWIC 4YN3B 2RDJA 1QQ5A 2H4WB 3LGMA 2GZOA 1PO9A 1REVA 5FIIA 3DF7A 1JLBA 2BGWA 4YR0A 5ALWA 1A5MC 1RP5A 3FZ2A 1X31C 3TI0A 3VAKA 2IJFA 4C65A 5IWAF 3C46A 4NLKA 3A13A 4K4IA 3QATA 2QGFB 2D41A 3DI6B 1N36F 4EBEA 1ZQIA 2Z7JA 2M5YA 4LFAH 1IBKH 1FA0A 4RW4A 1L3SA 2B4UA 4ZVEA 3WO1A 3C2MA 4RQ6A 2DPIA 4OZ3A 3DUGA 3J80Y 1HW8A 3MM8B 1TV9A 2CDRB 3EE3A 1L7PA 4EYIB 1OY9A 2F4VH 1U49A 1MMDA 5JXSA 3MUTP 2BB0A 1RT4B 3WQPA 4FU0A 3JAMU 4UCRA 3GTLA 4I2CA 4YMMA 4NXNF 2DY9A 5HMWA 1NSAA 2YN4A 3F8NA 2PSZA 4WPAA 2B5JB 3PO4A 1RI7A 3RJHA 2EFQA 4TYAA 1MG7A 4LRDA 5DBBA 3PJWA 1EUDB 2VUNA 4EWTA 1A7GE 4O3NA 2OOFA 3V6DB 4O4LF 1LV5A 1JWWA 3DOLB 4DX5A 5J1EB 2CXYA 2AQ4A 1ECWA 4LRBA 3ZTRA 2GO7A 3HXMA 4IUFA 4H4OB 1UPPA 1S57A 4RW9A 2J0QD 2MYFA 3EMTA 3Q22A 2BQ3A 5AK3A 4X2BA 5A8RA 4HYKA 1QVGR 2DR7A 3SENA 2I9GA 3GJSB 1B0TA 3J7AN 3BO2A 1DGSA 2CJKA 3TUPA 2MHNA 5LMUH 1X5PA 4Q45A 2KICA 4C4RA 4KLSA 3BV8A 1AQ6A 5KG6A 1ZJMA 3K5OA 3CCZA 2UU9H 2NUHA 2VBWA 4ZQIA 4JI6F 2ZE2B 1TU0B 1XBWA 3RTXA 2B9EA 3HKWA 5DG9A 2MGZB 3BYRA 4MV3A 3GONA 1QAYA 4KV8A 3V4IA 3ZNJ1 1RTIB 3GLKA 3OSPA 3JAMY 4ES1A 2HHWA 3V7KA 4HHUA 3IAS9 5D3GB 1VQNS 3RRKA 3M8QA 2JA8G 1OUQA 2H65B 2PMZE 2HGLA 3GFYA 2C2DA 2H1YA 3G6VA 2OPRA 5EZYF 4DR4J 1PVPA 1S9FA 3U1MA 1N8RT 2ZVIA 2J6UA 2U2FA 2KJ5A 5GAHU 2ZJQQ 2G1HA 4NXNH 3NL0A 3I6PA 1HI0P 1Z3EB 2FUG9 4X62F 3OUYA 2DNRA 3AAWB 3CDUA 2KRRA 4ZOLF 1MN8A 4NL9A 5JRTA 3OFHA 3ETRA 4ZJLA 3ZXWA 4RNOA 2W6NA 2HBLA 2MTLA 3C6TA 4URGA 1UT5A 4KO0A 2KXFA 3O44A 3BBBA 3F2CA 4KMOB 1C0UA 3QT8A 1UJ4A 3D54A 3KLVA 3PSPA 1NK0A 1U6BA 3BN4A 1ZQOA 4C11B 2MZTA 2CG8A 1OY6A 4DL4A 1JDBB 3U9TA 5K5MA 2HWTA 4EG0A 2VQFJ 1NFGA 1U0HB 3RRHA 2KVQE 2JLFA 1TELA 4QYZJ 1S03G 1WSVA 4PWUA 2QA2A 4X62J 3H5XA 1C3OA 4Q0BB 5LMNH 2GVDA 2WFAA 3P5BP 4JI0H 3RAMA 1V38A 2RB7A 2RQ5A 4JI4J 3CIZA 1YKWA 2ZH8A 2E9TA 4CM2A 1AFIA 2FHMA 1FERA 3BGOP 4JB8B 3FMAA 1FFSB 5BOLA 1BNPA 2N4DA 5CYMB 2EQYA 4KTQA 1F3VA 2YNHB 4QIVA 4JI0F 4ANCA 4CTAA 2EAOA 3CNHA 1BVSA 4FF2A 2DBYA 3PM9A 3CCJS 1RQNA 2I0XA 2Q3PA 1RAJA 2MQLA 2R2RA 1U26A 3QFHA 2KZZA 4I2DA 4ZVHA 3HKZC 1HBUA 2DPJA 4Q2MA 4I28A 5HMLA 1R0BG 4QIEA 2O6KA 1R8PA 5L46A 1HIYA 3LVVA 1FDAA 5H9EK 1EAYC 3E51A 2LQ8A 3FEXB 3HM7A 4ALZA 2MJUA 4KLEA 3HX0A 5AKGA 2XM3A 4LF8H 2PI5A 2IRXA 3GFKB 2BQRA 1HD1A 2J9GA 2RP5A 1H7XA 1QD1A 1RWNB 1AUXA 5IYBG 3SCLE 4ECXA 3I82A 2VQDA 5C7PA 3RIZA 2NXNA 1TKXB 1RWVB 2AKWB 5DB8A 4KHRA 3OR2A 1BD6A 1LW0A 4AE5A 3KG4A 2DFLA 1DRZA 4XPCA 2XIDA 2ZXHA 4YBZB 3F56A 1KJ9A 6FDRA 3BB5A 3H0LB 1X0FA 3HHEA 4OO1J 3I28A 5ALNA 4CO4A 2VG7B 2HDOA 2NXCA 4MYTA 1NEEA 1WC5A 2E5GA 4Y2UA 4JI6J 4UAWA 4P10A 4K5SA 3NNCA 5HR7A 4KITB 2HHHF 3LA0A 2XWYA 2F3JA 3GIIA 1QDUB 3UR3C 1NK4A 1PG5B 1F3FA 4EMDA 1TTHB 2WB1C 1WI6A 3NWGA 3EUNA 3H0RB 3QGGA 3PIPQ 4OMFG 3V7JA 2CNKB 4RUBA 2RDDA 3TAPA 1JNRB 5KFYA 4M51A 3ZZPA 1BPXA 4FBUA 2A19A 4D3HA 2F8KA 3TYTA 3LVWA 3VHQA 2GVZB 3LGHA 2KKVA 1ZAVA 2DNGA 2P6SA 3B4DA 4DU8A 3HVTB 4F25A 4CLTA 4M5HA 1NRKA 4KMUA 2ILZA 5HBMB 4QU6A 2C00A 4LUBA 1S76D 2Y9TA 1BWVA 2CQBA 2EFVA 2B4OA 2QA4G 1VYAA 4B02A 2MQPA 1ICEB 2XI3A 4OJ6A 2XLKA 1RWPB 2GVDB 3VCDA 4JI2F 1VHIA 4KV8B 5DRKA 2FQQB 1JXEA 2FC9A 5J29A 1B3TA 1PK8A 4GXIA 3NNAA 4DR6F 4ES3A 1O03A 4B9VA 5AKJA 1CQJB 1WHYA 1T9UA 4I4TF 2EAMA 4FBTA 4WFYA 4DMZA 3D6TB 2KNJA 1V5IB 3K5LA 2MSNA 1IG6A 2KZ3A 4IOAQ 3M6UA 3UMCA 1MU2A 3QLHA 1JALA 4M0AA 5BXIA 3C29A 4Q8FA 2M05A 5FPRA 3PO3G 2CUYA 2VPYB 1VS0A 1S68A 3HFKA 1YJTA 2QLFB 5L9XA 3BREA 1CQIB 5T7LA 2XMMA 3ONNA 1G6BA 2ZH9A 4DV5H 3PJ9A 3W9HA 3ZDAA 1FEHA 4O4RA 1FE0A 2WB1D 1N5YB 4C7YA 1U02A 2F8LA 4FXVA 2QS8A 2GO9A 3DLEA 1JLEA 3MM9A 2VC0A 4USVA 1RDRA 4GC6A 2HZCA 4GKJF 2GO8A 9ICPA 3QIPB 2RQMA 3W9IA 3MMBB 2ZKUA 3PKMA 2M52A 1IXKA 4YDXA 1HNZH 4OYZA 2JA6A 4F72A 2XI2A 4WYLA 5HVHA 3MEKA 4QZHA 3IR5B 9ICRA 5E0OA 1ZQFA 5KT6A 1NB2A 1VJ5A 4AQLA 2OYYA 3DI6A 2HBMA 1SL1A 3CJRA 5HROB 2WVDA 3EPGA 2B6AB 3TO8A 4I2PB 4E98A 3T41A 5ALUA 2RKIA 2XG8A 4RW4B 3SDEB 4P2MA 2ZUCA 2IVFB 2KTQA 3AD8C 2DR6A 3KLGA 4IR9A 1ONWA 5A8RB 4MV7A 9ICFA 3AHPA 3MM5A 2RRAA 5LSLA 1MWYA 4B08A 2R93G 3QYYA 1X6IA 4UW9A 1WUDA 3BSNA 3RB4A 1UBPC 4FDFA 1F2HA 3SQOP 3Q0AA 4MJKA 5IIMA 3JSNA 3NP5A 3PJXA 4DFJA 2LKZA 1QQ6A 1UEVA 4DSEA 9ICWA 3OTOH 5RUBA 1OMSA 2XULA 3I32A 4N8OA 4ELTA 1SYXB 4O23A 3SMZA 3LK9A 2HNYB 4LF6H 3VZHA 1W26A 4F67A 4WKRA 3DEEA 1ZYQA 3M9OB 2AYBA 1VLYA 2Z56B 3HOVG 2Y9UA 1AN7A 2XBPA 2YZNA 3DDIA 3CDWA 4URSA 4RUCA 2PXIA 3MI7X 4DZHA 2PMWA 3LWBA 2PT0A 3NVVA 2KV2A 4IFYA 1MZBA 4P52A 5AE2A 1N60A 4YB5A 3J80U 2V8GA 3AUOA 1ZA1B 1NZAA 2BKNA 3WK7A 2WB1A 5LP6F 2F1HA 4LBPA 4X4UA 1YJNS 5SUHA 2XSJB 8ICNA 2V94A 1YITS 4Z7YA 2CQ2A 4WXOA 2GLTA 2Z2LA 4OX9H 3W62A 3HBLA 1J5OA 5DQGA 4RQ3A 2UVWA 4IAJA 2DNKA 4GRSA 3TQ1A 1NHVA 1YJWS 4I7HA 5C25A 1F1BB 5IYDG 4YB7A 2FVSA 2PGCA 2KSWA 4XTTA 1ZQAA 3A0HU 3D1QA 3M7VA 4RQ0A 5ADZA 3GP9A 5D4OA 3ZZOA 3DC2A 1GO3F 1SPBP 3GU3A 3UVJA 1FK9A 3PSTA 1GK8A 1KQKA 2AEJA 3K57A 5HBMA 3KKFA 3TOQA 3AH6A 1FKPA 1A5KC 2OPPA 2ZH7A 4NI2A 2D3DA 1YT3A 2OSQA 1X5TA 2UVVA 4A3IG 2R7ZA 4TXSA 4R8UB 5BR8J 3HZEA 3PRDA 4KN4A 2F76X 2O3DA 4XYMB 1L2ZA 1I94H 4AL5A 1XNQJ 1O51A 3BG5A 4HLBA 3TEHB 1IBMJ 2F7VA 4ZHRA 4I2GA 5L8RC 3DRSA 3DFEA 2XNQA 2OKQA 1K73T 3AT1B 1S0NA 2QG9B 3L3CA 3C23A 2BM0A 1F5BA 5H9FJ 3SAFA 4UOCA 8ICZA 2E7WA 2FVMA 1FHTA 4DV0F 4AUKA 4A3KG 3CP8A 2H3VA 2Q2UA 2K89A 2Z2ZA 3PO5A 4LSAA 2BMBA 1RWOB 1QH9A 4AYBF 4TUYF 4A3JG 2CQDA 4L3NA 1O6XA 5CZVA 4O4IF 3PX6A 1ZRNA 4C5BA 3B54A 2NZ4A 2JH7A 1K70A 1L7MA 5EN1A 2FB0A 1YBAA 1HA1A 3M2UA 5IYCG 4JI3J 2F1IA 3D2NA 2FMPA 3E74A 4BBRG 3FQKA 3MEEB 1UP1A 4FZVA 1A6SA 2R93A 4RAZA 5CA0F 5K8OA 4P73A 2AGOA 3FFIB 1WWVA 3FRZA 2OEJA 2N4CA 4E8UA 2RH3A 4C5AA 1T7PA 4RQ5A 2EC0A 1J5OB 2KDOA 2HFVA 4WZQA 4ECTA 4DV7J 2I8EA 2XS7A 1TL1B 4NYOA 4ZPAA 5AKKA 4N56A 1VRTA 3CO0P 3D66A 4YDDB 4C48A 2NYHA 4DJBA 3UQ8A 3MHYA 3S1TA 4UCTA 4DU7A 3AM9A 2HS0A 3DOMB 2PE8A 4NL9C 1D0EA 1BWEA 1KRAC 4G1QB 1FKOA 2CQPA 2HBQB 3CMQA 2B51A 1FFVA 2DKOB 4HT5A 4ZVTB 4J03A 1W7WA 4I55F 1S0VA 5CABA 1OY8A 4TUQA 2RRDA 4UZBA 1K83A 3RR8A 3POTB 5L1JA 4CH7A 3B78A 4P71A 3ETLA 4NLBA 4EEKA 4IH7A 2DH7A 1MSWD 3NBPB 2EC2A 1TR0A 4J5OA 1RT3B 1A5NC 4CF5A 4RW7A 2UUTA 5KFKA 2PKEA 1J5EJ 3NCPA 1N62A 3AODA 4M63A 4NCGB 1N32J 2BA9A 2HS4A 5IILA 4IQTA 1OSCA 7AT1B 1PILA 1CJKA 3R1HA 4QWBA 1ZETA 4YMOA 4YD2A 4M9JA 1YBUA 1ZQLA 1PBAA 4JV5F 4RPFA 5K9FA 2XMKA 2C3UA 4JI1H 5IP9G 1XEZA 3K8WA 3VV2B 1KKXA 1H72C 1KLMA 3ZDEA 2PMZD 4B3OA 3D2WA 5KFWA 3LGNA 2HVQA 3I4MG 4OJLA 5AI6A 1N34H 4ICLB 3CT9A 3MPGA 4DPUA 1FFWB 4QR0A 1NHKL 4LFAJ 3LP1A 2EZZA 1ZM4A 4IQMA 1WWHA 4DV2F 4PHPA 4CNSA 3MM9B 5ETNA 1VMBA 1Z4UA 2Q09A 2FMAA 1PAEX 4EO6A 4F0SA 2K1RB 1KD1T 1W25A 4LH8A 5D3GA 3CO9A 2BEFA 1WCMG 2YWWA 3Q23A 2V59A 3BE7A 5T7LB 3GB0A 4GLXA 1YJRA 1U48A 3J81Y 4UAZA 4EBDA 4PXBA 4DPOA 5AKQA 3Q8VA 4R63A 4I0WA 1DY3A 3HM9A 4Y2AA 4DSKA 2LEBA 3A8EA 3RW7A 4IZOA 3V7PA 2XY6A 3M8PA 2GPWA 3ETJA 1FDDA 2VUMA 5IYZF 2W7PA 2QL5B 2PD1A 1TAMA 4K4UA 3G8CA 3QU4A 2KVSA 2YKMA 2DB1A 3MKVA 1LK5A 4PQAA 3VQSA 1LFPA 1KBUA 4IQVA 2DHHA 5DGBA 2HRTA 5A2QY 4DWIA 4OLOA 3PYDA 3H2UB 1D1UA 3KYLA 1SKSA 3H7HB 2YQ3A 2OTJS 2CFXA 4C4TA 2YMQA 3ISCA 5D15A 2G4BA 1N36J 2OPSB 4AXJA 3RW6A 3R8YA 2FLLA 4A3CG 3HVTA 4EZ9A 2HQ3A 1SQEA 3Q2OA 5ALSA 3IMQJ 1C1BA 4NLOA 3JS9A 2PMZA 2HFNA 2YY6A 2GVZA 2IRYA 2FK1A 4NA2A 2K8AA 4J9LA 2DZDA 2V0NA 8ICRA 2FPMA 3ONQA 5AM0A 4U9RA 3QSYB 5DQHA 3A0BU 4OHYA 4OJHA 1EF2A 2KJ8A 2VV5A 4JP8A 3ISBA 3HK2A 4A8SA 4MMOA 1BGXT 2UUAJ 1MROA 2NXJA 1RWUA 2FPIB 1RAIB 1XU4A 9ICXA 4FM9A 3UQSA 1T9YA 4A8XA 4FYDA 2V4JA 3MF5A 1Q0NA 3IRXA 2OUGA 4EENA 3EVWA 1RTZA 1UKUA 2YNIA 3D7SB 1JLBB 3AU6A 2YX8A 4YP3A 5EE9A 2HQCA 3TVKA 1VC0A 4LIRA 4KLUA 4L73A 2AJ0A 2MKHA 2H3EB 2WOMB 3U02A 1JJ2R 3OR2B 2W6PA 2HHTA 4ZS6A 4F26A 4DR3H 3MWMA 2E1FA 2JRSA 1N5TA 3JRWA 3CCES 4DV4H 3JYTA 2BUNA 4A3GG 2JR5A 2FE3A 1LW2B 2HK3A 8ICWA 2LHTA 1VC6A 3DLBA 2VFRA 2XGPA 1Z1BA 2VKZG 3PR4A 4WCEQ 2KHVA 4X65H 1VIOA 1AT1B 3E8OA 1VS3A 3P4UB 5IWAJ 2MUTA 1HW9A 3VGVA 2QFIA 1VKZA 3RJGA 4EP8C 2R87A 3SFWA 5A76A 4C11A 3PW0A 2Y3YA 1TL5A 3HVRA 4KE5A 1WG8A 1B22A 5K14A 3NQBA 2G07A 2DD8S 3FSYA 1UWAA 2LU2A 4XDDA 3HFZB 4C8NA 4OZ2A 4DFDA 3HT3A 3NOGA 1FI4A 9ICSA 4W98A 1E4EA 4O0IA 2ZHBA 5HQMA 3AU2A 1FF2A 2HWIA 3HKZD 2DF4B 1EQ0A 9ICKA 5FLXU 4M95A 4NLCA 4WK1A 1FESA 1DV2A 1M5SA 2W6OA 1XERA 1U45A 3K1ZA 3D2QA 4NYZA 2BE7D 2ZDHA 2QA4S 3KUEA 2HBKA 1X9XA 4DO9A 4CLSA 1KW4A 3UO0A 1FX2A 5IP7G 5B5EU 1TAUA 7ICRA 5KTQA 4DUYF 1UZHA 3CE8A 3WC2A 2GW8A 3PCOB 1ZQYA 3M8SA 2Y0SC 5ITHA 1N34J 5J0UA 3Q8MA 8AT1B 3OPXA 5KFBA 1N56A 2CQ0A 3H0MB 4BXOB 5A8WB 2E9RX 4BXXG 1ZJNA 2DLNA 1S6PA 3EYYA 2NRWA 3PACA 3SD7A 2BJ9A 2MQMA 3BKFA 3Q86A 1TVRA 4K0KF 1RKJA 3C19A 2GOLA 4PPXA 3L4JA 3WK5A 4O0NA 2ZNYA 3P5TL 4KGVB 3I12A 2DR5A 5HMFA 2A0FB 3SQGB 4Y00A 4LFCF 4R88A 1SL0A 3DRXA 1UFWA 3N2CA 3Q8UA 5KT7A 5EWGA 3MR3A 4ZPTR 2GX8A 5ALMA 2RMLA 2GIQA 5E2QA 4O44A 3M8QB 1HUZA 1L8OA 2AHOB 1B4SA 4DOBA 1NO8A 1UC8A 2QARA 3TAMA 3LDAA 9ICAA 1X2IA 2FVKA 4PWDB 1LWEA 4YCXA 2NU8B 4R5PA 4M9GA 4CDIA 1VI7A 2XMVA 2ZOFA 4I2QA 2DKXA 4OX9F 1RTJA 2YX1A 3ZZTA 3MDUA 4ZLPA 4KHPF 2D3OR 2Q1LA 1RZTA 4JYAF 1IR2A 5FSDC 1DXSA 4BS2A 3GJTB 4A4JA 2BOAA 4KJIA 1IM4A 1J2NA 1D8YA 3D1HA 4OJOA 3I87A 3FKIG 4M9NA 2VODA 2WSEC 4H4OA 4PPZA 3UE2A 2E8MA 5F3XB 3S7RA 4U67Q 4QZIA 2QL9B 2B5JA 1IBCB 2X3DA 1RJRA 5KG5A 4P75A 3QIPA 2DUYA 5HMYA 1GH8A 5EOZA 2BZFA 1IKVA 1GGOA 1P8GA 3FK4A 2QMXA 3B4MA 1HIWA 1RBOB 2LI6A 2OELA 1F60B 4UBPC 5C5JA 2VFSA 2QFJA 1JLAB 1S12A 1TP7A 1XK8A 2C35B 3ELHA 2HBRB 2A10A 3IG1A 1CS0A 5CYQB 4KGXB 2GQ2A 1VISA 2LQ5A 2OTLS 2E1MC 3EDRB 1EJTC 3IP0A 4FF4A 3HILA 5J8YC 4EFEA 1S0MA 3MDWA 5J2KA 1BE4A 2D1CA 4Y0FA 1SJ3P 3R5XA 3BQ7A 3G77A 2GV1A 1WUUA 1FJEB 1R8CA 2W57A 2DKZA 2QLTA 3HB9A 2V2VA 4UB1A 2Z00A 3BH7B 2KG0A 3G71S 3N4MB 2QMWA 3BQ1A 2UXDH 5EWEA 2IHMA 2E66A 3CSKA 3KAJA 2PFPA 3ZFVA 5J2PA 4O4GA 1CSJA 3MMAB 4DV2H 2VJ4A 5IS2A 1PJ6A 4CNYA 4CYUB 2DCLA 3A12A 4LVNP 1KOHA 3CUNA 4CLFA 3HPAA 3QT5A 5J1PA 2W54A 5DS7A 7ICHA 2ZZTA 3IBFB 3FDSA 3LS9A 2LP4A 3QYPA 3PN1A 2VA2A 1NCLA 4LT6A 2V69A 1Q8KA 5HL7Q 1FJGH 5CA1F 1FNXH 2VG5B 4IOCQ 2ATLA 4LF7H 2HS3A 1NSPA 2Y0BB 1UWBA 2BDUA 1KCXA 4QZFA 1KONA 4NLQA 4KHPJ 4ZHRB 4X65F 2YWHA 8ICGA 2PFFB 2KI2A 4Y2KA 1YBTA 4DX6A 5IZHA 3WC0A 3IBWA 2YB4A 5HLFA 1Z2ZA 3J7AK 1BQXA 3ZZZA 1KR4A 3LW5C 3NS6A 4LSLA 3FSXA 4GIBA 2EPIA 5EE0A 3BO3A 2OPPB 4ER8A 4V1XA 4MK9A 2ZVSA 1Y14B 3M30B 5IM0A 4GKJH 1FX4A 4U96A 2P9EA 2KYXA 2D74B 1SXLA 2EG2A 5C42B 3W66A 1YZ7A 1VBGA 4IFVA 2YX4A 3JSMA 3AXMA 3DM2A 2ZEJA 3U27A 2CJAA 4GC7A 2G0AA 4CNZA 3TUJC 2E5LJ 1VAJA 2CRLA 1CG2A 1UAWA 5J1NA 2GQCA 2B4PA 5EGYA 4JI7H 4ED8A 1J97A 2CPZA 1E9ZB 2XB2D 1LKYA 1H98A 2HNDA 2NO4A 1E4EB 3HXLA 3W3SA 3ULHA 1VDVA 2KIVA 4LRCA 1X4GA 2HJWA 5KFNA 3CF5Q 3DOKA 1O8BA 3I0RB 1WCLA 4RW6A 3GJQB 2YKNB 4ILLA 3HJEA 2E7VA 2E3TA 1WWUA 2LXFA 2YRXA 4U7UK 1KC8T 1Z1VA 3GZFA 1KSPA 2JNJA 3TVZA 1IKXA 2AJFE 3PEJA 5BYRA 2HRYA 3H0GA 4QOTA 4DUZF 4J9VA 1K1SA 4OJ3A 3GIQA 1N33J 1CULB 1PK1A 1V9OA 4BX9C 2AD9A 3LUYA 5AKXA 1WC4A 5D4LA 4X66J 5HV6A 4C5ZA 4DF4A 1B33N 2B63A 5J0PA 2YMMA 3W60A 1YRUA 3AXKA 1LB2B 5GMDA 2MCTA 4XAKA 1ZQEA 3SEIA 3JTOA 3RB6A 2J9CA 3BZQA 1Y0HA 3LNPA 4LMYA 5BPFA 2BCSA 4KKOA 3MR2A 2GGPB 2PA3A 1XSPA 5H9FK 2AF6A 2W3SA 5KFXA 3JSYA 1L3VA 2LYHA 1H2VZ 2R7VA 3EGZA 4PKDB 3RJMB 1GTHA 2MU2A 2R6FA 2FY8A 1FEZA 1HNVA 1M5OC 3C0FB 1VQOS 1O12A 5I3UB 2B0GA 3D6NA 1FRKA 4AYBA 2FPHX 4CO1A 4QIWF 3HF5A 2KVIA 8ICHA 3IM9A 1HWIA 2AH5A 4MIWA 1FWDC 1W93A 1SZHA 1EJSC 2HAIA 2DNPA 4KFBB 3BYPA 4JB3A 2KK0A 3MECB 4WE1B 1JLEB 1U6ZA 3E58A 2KG1A 5KOXA 3DYAB 3EUB2 3THTA 2GHPA 1MW7A 4UFZA 3RBZA 4LF4J 4DV6J 2KN4A 4P0PB 4QYZK 2HZAA 2A18A 5C2GA 4PAAA 2JFKA 3H0GG 2F4VF 3PW5A 1QM9A 1WSRA 1EJ7L 4A3DG 5KG1A 4GOAA 3KNGA 1RXVA 2PLMA 5B66U 1RA5A 2DTJA 5CYJA 2YX7A 2LPEA 2RT3A 2H9ZA 3HOWG 3AJ1A 4F0KA 2PIIA 3MBYA 3OTEA 2BJ7A 3SEOA 1BY9A 2FC8A 2R8GA 2P50A 4HDHA 1JDEA 2V50A 4Y2RA 1Y9OA 1S7IA 2F4FA 8ICKA </