4F50A

Y-family dna polymerase chimera dbh-dbh-dpo4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
342
structure length
337
Chain Sequence
MIVIFVDFDYFFAQVEEVLNPQYKGKPLVVCVYSSGAVATANYEARKLGVKAGMPIIKAMQIAPSAIYVPMRKPIYEAFSNRIMNLLNKHADKIEVASIDEAYLDVTNKVEGNFENGIELARKIKQEILEKEKITVTVGVAPNKILAKIIADKSKPNGLGVIRPTEVQDFLNELDIDEIPGIGSVLARRLNELGIQKLRDILSKNYNELEKITGKAKALYLLKLAQNKYSEPVENKSKIPHGRIVTMKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGRTFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase IV
publication title Y-family polymerase conformation is a major determinant of fidelity and translesion specificity.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Transferase/dna
total genus 103
structure length 337
sequence length 342
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
A PF00817 IMS impB/mucB/samB family
A PF11798 IMS_HHH IMS family HHH motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f50A03
2.30.40.20 Mainly Beta Roll Urease, subunit C; domain 1 Urease, subunit C; domain 1 4f50A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4f50A01
3.30.1490.100 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 DNA polymerase, Y-family, little finger domain 4f50A04
3RJHA 5J2NB 3KLEA 2XWYA 3N6MA 4IKAA 3KTQA 5HLFA 2UUWA 1MSWD 4P4OA 8ICHA 4WE1A 3MFHA 2ZE2A 3GV8B 4B3OA 5KFOA 1L3UA 3HVAA 8ICVA 4X5VA 1XR5A 2E9ZA 2XY6A 5J0TA 3DOKA 3HVTB 2LYHA 3GV5B 4F4XA 5KFQA 2BKEA 1A77A 7ICNA 5C25A 3MEDA 5I42A 3CJ4A 1C1CB 3IG1B 4Z6CA 3PO4A 4QW8A 5IIKA 4DFPA 2FVPA 4K4YA 4LZGA 4QPXA 3IS9A 2HVHA 1S1WB 2YKNA 2HNYB 3KLIB 4PQUB 1MC8A 2ZD1A 4EZ9A 3GFKB 5BPCA 3HW8A 4LQ9A 3ZD8A 3C5FA 3V6DA 4KN7A 5DB6A 3MGIA 2ISOA 3KJVB 5KFVA 2B6AB 1HUOA 1C0UB 4RPXA 3C2LA 4KHRA 1JKHA 4KLJA 3DRPB 1U09A 3QEBZ 1N5YB 1RT4A 1QLNA 3LP1B 5KFBA 3BQ0A 4YR3A 2WHOA 4IFYB 2R8GA 3PR5B 4E0DA 4LSLA 1DTTB 1RTJA 3MECB 3OGUA 2IJFA 4RNOA 2CJQA 3KK2B 1KEJA 3H2LA 4DSIA 2FPKA 4F4WA 4TN2A 2I1QA 3DLEB 1X9SA 4U7CA 3M9MB 1RT1A 4K4WA 1JN3A 5KFIA 5L9XA 4M9JA 2R8JA 1JLAA 3MR3A 4YVZA 3BSAA 5I3UA 4DLGA 3Q8KA 3BSCA 3M8PA 1JLQB 3DRRB 4YD1A 4ELTA 3PVXA 1JLEA 4IH5A 5KFTA 1JLGA 2IA6A 2XC9A 2WB4A 3I5AA 1L3TA 1RYRA 3ISBA 2M9NA 4UB5A 4GXKA 4CCHA 3C6TA 1ZQEA 4Q8EA 3M8RA 3MDCA 1S77D 1ZETA 4KLMA 2WCXA 4ZPAA 4O44A 4F3OA 1ZQDA 3TFSA 3V6JA 1IKWB 1LB2B 8ICJA 1S76D 4ED0A 2IAJA 4KFBA 1ZYQA 4WZQA 3MR6A 3ORYA 4KN4A 2HNZA 3MABA 2GWSA 1JIHA 1N4LA 2VG7B 4KB7A 4O4RA 2VA2A 2E9TA 4ZH4A 1TQLA 1T05A 1UA0A 3DRSB 2HVIA 3FDSA 2BPGA 4DO9A 1EETB 5CYQA 5KFFA 9ICSA 2F1HA 2XI2A 3C2MA 1CSJA 3H5UA 5K14A 4RT2A 2HMIB 1NK8A 9ICAA 2FJXA 2A1JA 3CJ5A 2V0NA 1DOQA 4BWJA 4F93B 2XCPA 1XR6A 1FKOA 1U4BA 3T5LA 4QZFA 4NY8A 4MFFA 4I29A 2QE5A 4H4MA 2V4QA 1NHVA 4UB1A 1B43A 1X9MA 1T3NA 9ICXA 3UR0A 1NK9A 4K4IA 4B9UA 1REVB 1DTQB 3CO9A 1HMVA 4O4GB 2IC3B 1IKYB 1S1XA 4KLDA 2HHWA 4RQ7A 5D46A 2AU0A 1IKVA 1ZQNA 2BANA 3FQKA 5HROB 2ZD1B 1WCLA 1N6QA 3DYAA 1V9PA 2B5JB 2DFLA 2W8LA 5KFLA 3RH5A 4JK1A 5HMLA 3C6UA 3T19A 1RT5B 2J6TA 2F8EX 9ICJA 3HX0A 4KLQA 4B9TA 1T4GA 4WFXA 4RW8B 1JLCA 1J5OB 4PWDA 1JLBB 4LSLB 9ICOA 4O3PA 4M9GA 3BGRA 3TQ1A 3ZD9A 5KFPA 7ICOA 5KT6A 1TK5A 5KG3A 4EYHB 5J0OA 3ZDAA 5HHIA 2NRVA 8ICFA 3RH6A 8ICEA 4PGQA 1TKZB 3NKYA 1SH3A 1S0MA 2BPCA 3Q8RB 1EP4B 1BQNA 9ICMA 4KKOB 4NRUA 4PHEA 3LANA 3PW5A 1JLAB 4RW7A 5DGBA 2Y1IA 5J2AA 4RQ2A 3LP2A 1K1SA 3H7IA 2WONB 3PJXA 1SL2A 2C2RA 1RZTA 5EWGA 4ECYA 1X2IA 3V6KA 4R5PB 3EWAA 7ICPA 4TY8A 2BDPA 1HQUA 2UVVA 3BQ2A 8ICUA 3UDLA 4RW6B 1SV5A 1SKRA 2HHXA 3C6TB 3Q8PB 1S9EB 1Z00B 3OHAA 2I1RA 2ZJAA 3ZDCA 2FJWA 1RT7B 1PZNA 1IKXB 2VG5B 3RB4A 1MU2B 5KG0A 2HWHA 3KK1B 4KV8B 4M0AA 1D9DA 1TVRB 3H8WA 4IG3A 1LW2B 5KFEA 5KG4A 2J6SA 5C24A 3UQ2A 4KFBB 2OPSA 5DBCA 4C8LA 9ICCA 1RTIB 3OHBA 4B9SA 4HKQA 4MFAA 4NLOA 1UT5A 1FK9A 2NRZA 4MK8A 4C8KA 4R63A 1KHWA 4M6WB 3RJKA 3SZ2A 4UB3A 1HYSB 1RT2A 5KG7A 1S9FA 2JZBA 1TKTB 4BDPA 2XGQA 7ICHA 3RTVA 3I5CA 4YMNA 3E01A 3OL9A 3QIPB 3JYTA 4K4UA 4KBIA 2RKIB 3E2EA 3TAQA 4WYLA 2OH2A 4XUSA 1ZQKA 1ZQYA 1HPZA 1SL1A 4RNFA 5KFXA 2D7SA 1S0NA 1COOA 7ICRA 2C2EA 2AJQA 2BCRA 4ECRA 1KLNA 1FKOB 4PUOA 4QZGA 2WOMB 1NOMA 1QE1A 2BE2A 2HHQA 3QZ7A 8ICQA 3RR7A 4YCXA 2IM1A 5HBMB 2D41A 3JPNA 7ICVA 3KLGA 5HHHA 2KN7A 3B0YA 3IRXA 3RRGA 4JV1A 7ICKA 1RTHA 4WZMA 4O3QA 1S1XB 3TANA 4MFBB 4GLXA 3KHGA 4DQRA 1SZPA 4C8NA 4RQ4A 3V7KA 1S0VA 4R8UA 3BQ1A 1D0EA 1X9WA 3OSNA 1T03B 3I5BA 3MR5A 3NTUA 5J0UA 1XR7A 3JPTA 4NLNA 1S9GB 5J2KA 5J2BA 4FBUA 2W9CB 4FO6A 1OS5A 2Q0ZX 4J9RA 8ICKA 1LWFA 4F50A 3V81B 2P6RA 3RJGA 5F8LA 2AWZA 1RT3B 3M8QB 4ECQA 3UPFA 1T8EA 4Q45A 4RW4B 4ID5B 4ED7A 2BQRA 4TUPA 1IXRA 5J29A 2ASDA 2BR0A 4IH6A 2HHSA 1RT6A 5FDLA 4NCGB 4J9NA 3NMAA 1HNVB 4KLIA 3C1YA 4F8RA 2PXIA 1CUKA 4ED8A 2ILYA 4IRCA 2MAXA 3PO5A 3V72A 1C1BA 4RT3A 5F9NA 1BVSA 1XS9D 4URQU 3TFRA 1ZJMA 5F8GA 2WTFA 3RBEA 2I5JA 1HQUB 1ZQUA 4J9PA 4Q44A 4G3IA 2PI5A 1ZQFA 2V9WA 3NL0A 5IIMA 2FVCA 3OSPA 2YNHB 1JXEA 5IIJA 2OPQA 3B0XA 1NK7A 1JLFB 4DL5A 4ZHRB 4YMEA 4M2YA 8ICAA 4NLPA 4NLDA 4IRDA 4EEYA 3MEEA 2EC0A 2NRWA 3SYZA 3C23A 7ICLA 4KLGA 2YNGA 5C24B 1C2PA 3PNCA 4PHDA 2PFPA 3PW7A 2UUTA 4QZ8A 1FK9B 7ICJA 2RDJA 1VRUA 5J0SA 4K4ZA 5DG8A 4ED1A 5C42A 3RBDA 3G6XA 4KHMA 3E01B 3MR2A 1S1UA 3KHRA 1NJXA 1S1TB 3MEGB 4I2PA 2MUTA 2W8KA 1HPZB 2VG6B 5DDYA 5D3GB 2BQ3A 4BWMA 4RPYA 4TYBA 4NLSA 4IR9A 1QUVA 1TL3B 3UXPA 1TV6B 5C5JA 4URSA 5J2PA 4PHAA 5EUHA 3DI6A 4DS4A 2YKMB 4NLGA 2FVSA 1S10A 2XY7A 4KO0B 3IRXB 4UAZA 4JV0A 1TAQA 5J1EA 4UAYA 5J2QB 9ICIA 7ICUA 3LDAA 5KT3A 4BGDA 3SV3A 4DQPA 3TVKA 1DLOB 2KZMA 2XCAA 3OL8A 1ZQRA 1MMLA 3DLGA 3EPGA 1ZQLA 3RAXA 3Q8QB 1D1UA 1RA6A 3JPRA 3FFIB 3CJ2A 4O0IA 4YMOA 3IM1A 1FKPB 2XI3A 3QIDA 3TAMA 2W7PA 2XO7A 4NLTA 4F5QA 3PY8A 4KSEB 1LWCA 1JMSA 4I2CA 3QZ8A 2HHVA 1S6PA 4ICLB 1ZTTA 3H98A 4R64A 9ICEA 3QO9A 4UB4A 2ASJA 3JPSA 3KLHA 2D3UA 2R8KA 1IM4A 4RNHA 1HUZA 4K4GA 4IG0A 4P4PA 5DB8A 2HHUA 4F5RA 1BPXA 4B9NA 4M04A 4NYZA 4O9MA 4MK9A 1KFDA 3PMNA 4RUCA 3TAPA 4ECTA 4LSNA 1U48A 4RZRA 1VRTB 1KLMA 3MGHA 5J0PA 4TQRA 4B9LA 2PFNA 1XSNA 3GYNA 3RJJA 4I7FB 5J0WA 1UT8A 3H5YA 8ICNA 4R66A 1BQMA 2IM3A 2PI4A 8ICLA 3I0RA 1N56A 3ETLA 4G1QA 1DGSA 4QWAA 4ECUA 1TKXA 4I27A 3ISDA 2AX0A 2YNIA 4Z6DA 3C21A 5HP1B 1RDRA 3NGDA 1SUQA 4RQ5A 4DOCA 1R0AB 5KFWA 3Q8LA 3JPOA 9ICBA 4QZEA 4XQ8A 3DDKA 3DLKA 3VQSA 1S49A 3KLEB 5HLFB 4ECWA 2BRLA 3QGHA 4RUAA 2FLNA 2OPRA 2Y1JA 4DSJA 3SV4A 2GC8A 4WE1B 5L1IA 2BHNA 2ZE2B 4B3OB 3OLAA 1ZQMA 2GIRA 1ZQOA 1S1VA 3KLVA 1KSPA 1RA7A 4IDKA 3QGIA 3DOKB 4YFKA 4FBTA 4MF2A 3T5HA 5C25B 4I2IA 3MEDB 5I42B 1NKEA 3V4IA 1HJPA 4PHPA 2F1JA 1S6QA 3LP0A 5D4BA 2BGWA 1JXLA 5CJ7A 4ED2A 3FSIA 3PX6A 4O5KA 3IS9B 1QSYA 5CP2A 2YKNB 3H4BA 3Q8SB 5F8NA 2OPPA 1C0TA 4NLUA 2D3ZA 3V6DB 5KFCA 3ICLA 4PPXA 1JKHB 4IFVA 4XRHA 4RNMA 8ICIA 3T5KA 1RT4B 4QZCA 3JSMA 4C8MA 4UQGA 1RTDA 4WXWA 1BPYA 4EZ6A 4YXJA 5J2MA 9ICGA 3IN5A 1RTJB 1TAUA 1U9LA 2IBKA 3CDEA 5D49A 1QAJA 2BCSA 1QSSA 3PW2A 9ICQA 4RNNA 1ZQQA 4I2QA 4DG1A 4DQQA 1RT1B 2C22A 2P66A 2ZKUA 3DOLA 5DLFA 5KG6A 4ZVEA 3KOAA 4MKBA 4QWEA 2JC1A 3KK3A 2HNDA 3OJSA 4DL7A 5KFJA 1LW0A 5I3UB 1UNNC 3RH4A 3M8PB 4O5CA 1LWEA 7ICSA 3I0SA 1HQEA 2FJVA 3QO9B 4QZBA 1JLEB 1JLGB 5J2GA 3KLFA 2ASLA 4DQSA 1KRPA 2UVWA 4YR0A 2I9GA 2ZUDA 1XSPA 2PFOA 4PGXA 1SH2A 4K4XA 3PR4A 4Q43A 4O44B 5J2IA 4IQVA 4QZHA 4IR1A 1CEZA 2RF2A 2JEGA 4YMMA 4RQ3A 1KLMB 4TY9A 1RXWA 2IAJB 4IRKA 4ZPCA 5CYMA 3V7LA 4O3RA 2VA3A 1NJZA 2HNZB 2QV6A 3BSNA 4I2EA 4F2RA 4O3OA 3TI0A 4TQSA 5IILA 8ICWA 3LALA 4F4YA 3KHLA 5J2CA 8ICYA 4B9VA 2IMWP 2YNIB 1T05B 2R2RA 4ECVA 4Q0BA 4IQXA 5CYQB 1S0OA 3N97B 5J2NA 5J0QA 4RQ0A 3T3FA 1RPLA 1U45A 5K14B 3THVA 8ICCA 4O3NA 4DFKA 8ICMA 2A1JB 3GQCA 9ICFA 5KT2A 4MK7A 4KLTA 3IHQB 4RU9A 1C7YA 1ZQVA 1NK4A 4J9OA 4M9LA 3C2KA 4Y2AA 4I2JA 2ZJ8A 3JPQA 5DQGA 4IDKB 3GDXA 4HYKA 1HARA 4H4MB 5JXSA 1S48A 5J2EA 3IG1A 1ZQPA 2HAIA 3LAMA 1HMVB 1ZQSA 4Y2CA 1ZQCA 2HNYA 3HT3A 4RQ6A 2OWOA 3KLIA 4PQUA 9ICVA 2JLEA 1ZJNA 4F5PA 4M9NA 4DSLA 1IKVB 2BQUA 2ZTDA 4XPCA 1D8LA 3LWLA 4K4SA 5TZVA 2BANB 4J9QA 4DOBA 4ED3A 3KJVA 2B6AA 3FYHA 1C0UA 4TUQA 1N6QB 2YNFA 3DRPA 3DYAB 1N5YA 3LP1A 4M94A 5DGAA 2IJNA 3G86A 4DWIA 4IFYA 3C6UB 4KE5A 1DTTA 2R2TA 3MECA 5CR0A 1BPBA 3N6LA 4K4TA 3KK2A 2BCUA 1JLCB 4PWDB 1NNDA 2ZUBA 3BGRB 3DLEA 3ITHA 4YQWA 2AGQA 3V6HA 3SFGA 9ICUA 4P4MA 2RDIA 4TYAA 4DS5A 3ISCA 1SH0A 3H59A 3QLHA 5KFGA 4R0EA 3AU6A 3PMLA 5J0XA 1KHVA 1BPZA 1BQNB 4EBEA 4YG2A 1JLQA 3CJ0A 3D5MA 3DRRA 4RW7B 5DBAA 4QWBA 3LP2B 5KFZA 2JEJA 4I2DA 2ZTEA 1HNIA 4RW9A 1NKCA 4ZP8A 4TY8B 1RAJA 2BCVA 2VA8A 2C2DA 2BCQA 4DLEA 4EBCA 1TK8A 4RQ8A 4F92B 3D28A 1WNEA 1U49A 1KFSA 2FLPA 1TK0A 1SV5B 5F9LA 3JPPA 4ZPDA 4KLSA 3EYZA 7ICFA 8ICBA 1UA1A 2WK4A 1IKWA 1QTMA 4Y34A 5KFNA 2AQ0A 2RF2B 4NRTA 9ICWA 1ZQHA 2FVRA 2ZTCA 8ICTA 3N6NA 4KLLA 4IG3B 1ZQJA 3PW4A 1T94A 2OPSB 3K4GA 2HHTA 3UQSA 4NLKA 4DOAA 2VG7A 2HW3A 3DRSA 3MTKA 1EETA 2HWIA 4QZ9A 1RT2B 3OLBA 2FMQA 4EO6A 4MFCA 1A76A 4F4ZA 3SFUA 3C5GA 4ECSA 2JZBB 4F2SA 4Q0BB 3LAKA 2HMIA 4NLRA 4M47A 3JYTB 5KT7A 3AU2A 4ZVGA 3G6YA 3RJIA 1WCNA 1ZQXA 1AROP 7ICMA 5KFSA 4UB2A 1MQ2A 4PUOB 4FS1A 1QE1B 2BE2B 2B43A 4KAIA 3BSOA 5CHGA 1DTQA 1REVA 3H5XA 4O4GA 1EXNA 3NAIA 2IC3A 2ISPA 1IKYA 4TURA 3KLGB 4NM2A 4O5EA 1TVAA 5JUMA 4TLRA 1H38A 4KLHA 1RTHB 4XA5A 5BOMA 3HP6A 9ICLA 5HROA 3GIMA 4IQUA 3CVKA 4UBBA 1XU4A 2B5JA 4R8UB 3TARA 1L3VA 4DL6A 1NJWA 2YNFB 3LWMA 1YVFA 1RT5A 3OL6A 3RRHA 4BXOA 4RW8A 2GIQA 1ZQZA 1J5OA 1ZQWA 1LWFB 3IGNA 1JLBA 4PH5A 9ICHA 3C1ZA 2O5DA 4DQIA 5F8JA 2W9AA 3UXOA 3EZUA 2W9MA 3OJUA 4IOBA 3CDWA 3ITHB 2FMPA 1TKZA 5IINA 5L1KA 5CWRA 4J9KA 1EP4A 2FPMA 1RT6B 5FDLB 3NBPA 4KKOA 3QLHB 1UWBA 3DMJA 2IM0A 3ISNC 4I28A 5CB1A 2WONA 5CA7A 2R2SA 2XGPA 1XC9A 5DQHA 4F5OA 7ICGA 1C1BB 5EWEA 3HVWA 1XO1A 3V7JA 9ICKA 4R5PA 1S4FA 3QYYA 4ELUA 4YD2A 4O3SA 1HNIB 4RW9B 4RW6A 4X2BA 2I5JB 5J0YA 1S9EA 3RB6A 3NAHA 1Z00A 1NK0A 4JWMA 2AQ4A 4IH7A 3H4DA 2ALZA 1RT7A 3ZDBA 1IKXA 2VG5A 2BPFA 1MU2A 3KK1A 4M9HA 4KV8A 7ICQA 1L5UA 2NRTA 2OPQB 3DM2A 4H54A 1NHUA 4MH8A 1TVRA 1ZTWA 1LW2A 3QEAZ 1B22A 3PW0A 3MEEB 1RTIA 2AX1A 2ATLA 1S97A 3HHKA 4ZVFA 4URGA 2YNGB 3CIZA 2IHNA 4M6WA 4ZP7A 4Z6EA 3BJYA 1HYSA 4WFYA 5EWFA 4I2HA 3M9OB 1GX6A 5J2JA 3E51A 1TKTA 4KITB 5DDMA 3N4MB 7ICTA 2UVRA 3ZDDA 1VRUB 1GX5A 3QIPA 1K1QA 2RKIA 4F5NA 5C42B 4I2GA 1S1UB 1D8YA 1SKSA 3GV7B 8ICOA 2JC0A 2W7OA 2F1IA 1BGXT 1ZQIA 5J0RA 4JV2A 4I2PB 2MUTB 8ICSA 2R8HA 4ECZA 3CWJA 5KTQA 5BOLA 2WOMA 2ILZA 5KG2A 5IIOA 1QSLA 3CJ3A 4K4VA 2C28A 5DG9A 5HMMA 5HBMA 2V4RA 4ZMMA 4MIAA 3KMSA 3ISND 5J2PB 4U6PA 3BR9A 3DI6B 4J9LA 1Z4UA 2BRKA 2FLLA 4XPEA 4LZDA 4MFBA 5F8IA 3EPIA 4ZP9A 1LV5A 4H4OA 4J9SA 5EDWA 1TL1A 5J1EB 1ZQTA 1T03A 4KTQA 2KTQA 2WRMA 4DFMA 4QW9A 1BPDA 1TP7A 4XO0A 4OL8A 4NM1A 2NRXA 1S9GA 4NLVA 8ICXA 3DLGB 2DPJA 2W9CA 4TXSA 3H40A 3FQLA 2KZ3A 3PX4A 3QE9Y 3CDUA 5KFRA 3V81A 4BXOB 1ZQGA 3Q8MA 1RT3A 3M8QA 4LQ3A 3BDPA 4RW4A 3TAMB 2J6UA 4ID5A 3RR8A 3MFIA 2JEFA 5KFAA 2XY5A 5IIIA 2W9BA 1LWCB 4YN4A 4NCGA 1S6PB 3QGGA 1NK6A 4DL3A 4ZVHA 1NJYA 2DPIA 4MIBA 1HNVA 2ZJ5A 5KFKA 1NKBA 3RB3A 3KLHB 3NBPB 4I2AA 4MF8A 1BPEA 9ICRA 3H5SA 1UWBB 3DMJB 4DSEA 4IG0B 3UXNA 4MEYA 8ICZA 4J9MA 3K75D 4LSNB 1KTQA 4GC7A 1TV9A 3H8SA 4EYIB 2YNHA 4NXZA 5KFMA 3MBYA 4R65A 4KLEA 4UAWA 4KLOA 4ED6A 2P6UA 3M9NB 2E9RX 4DSFA 5DB7A 4QWCA 1BQMB 4MKAA 3KNAA 1JLFA 5F8MA 4ZHRA 3RJFA 3I0RB 1Y88A 5EOZA 4G1QB 5J2FA 4UBCA 3DM2B 1TKXB 4I2BA 2FVQA 4WXOA 4NLYA 4NLQA 4ELVA 3BREA 4IQWA 1I6JA 1SUQB 5DG7A 4JUZA 3RJEA 4KMUA 9ICPA 4ZPBA 2KFZA 4DL2A 3EZ5A 3DLKB 4PGYA 2B21A 2IM2A 3GIKA 1T7PA 4EBDA 4FS2A 3AUOA 1XSLA 1KFTA 2OPRB 5DKWA 8ICPA 3PV8A 4YP3A 5J2DA 2CKWA 3HVTA 3FRZA 2KFNA 1QAIA 3KHHA 2H5XA 5HNKA 1S1TA 3MEGA 1S1VB 2R2UA 4ZP6A 1C1CA 2VG6A 4C8OA 4Y3CA 3PZPA 1JX4A 4MEXA 5D3GA 2KZZA 4NLXA 4WYWA 3V4IB 3IGVA 1S1WA 1S6QB 3LP0B 5L1JA 3RB0A 1TL3A 1TV6A 3HWTA 4JWNA 7ICEA 4DF8A 3H8JA 1RYSA 3GIIA 4B9MA 2YKMA 3PJWA 4RQ1A 5KT4A 4TUSA 2OPPB 1C0TB 4KO0A 5KG1A 4RPZA 4DFJA 8ICRA 4WFZA 3PHEA 5J2QA 4DL4A 4H4OB 3T5JA 3OL7A 1L3SA 4IFVB 1MQ3A 1DLOA 1TL1B 3JSMB 1D9FA 5KFYA 5DB9A 1RTDB 3HPOA 8ICGA 2ZUCA 5J2MB 5KT5A 1W25A 4K50A 3GILA 1KDHA 4YR2A 9ICTA 1XWLA 5DLGA 3FFIA 4F4KA 3MF5A 4QZIA 1FKPA 1U47A 4Q8FA 4I2QB 4DG1B 4DSKA 4LVSA 5KFHA 3DOLB 4DEZA 4ICLA 1TFRA 3KK3B 2HNDB 5DBBA 3PX0A 2W9BB 1LW0B 4ECXA 5HP4A 2AGPA 5KG5A 4KLUA 4NLWA 1LWEB 4GXJA 3I0SB 1N48A 3UQ0A 1HQEB 3KMQA 4QZAA 4M95A 5DQIA 5T14A 2AGOA 5L1LA 3KLFB 5J2HA 3MDAA 2VANA 4Z6FA 4GC6A 4P2HA 3LK9A 4QZDA 5KFDA 1NK5A 4KLFA 2JEIA 2UVUA 1VRTA 1TKDA 3EW9A 4YXMA 3GIJA 4I2FA 3ZDEA 4I7FA 5F8HA 2FMSA 3SI8A 3HKWA 1Z3EB 1ZQBA 3UPQA 3BQTA 4DF4A 5CYMB 1ZQAA 3M8SA 3G6VA 2FPLA 7ICIA 3RAQA 1RXVA 5KFUA 4QWDA 4NZ0A 4F91B 5HP1A 4GXIA 3T1AA 1SKWA 2IHMA 1R0AA 9ICNA 4EO8A 1SL0A 2R8IA 4IQTA 2PFQA 4NLZA 4K4HA
chains in the Genus database with same CATH superfamily
3D0HE 3RJHA 3ILIA 5BYRA 2XWYA 3GWCA 2Q3PA 1IBMF 3A3OB 2I6WA 1A7GE 3MFHA 4WE1A 3GV8B 1VC6A 4B3OA 5KFOA 8ICVA 4X5VA 1XR5A 5J0TA 3DOKA 4RQNA 4EI2A 3MKVA 1SQFA 3N43B 1RWXB 4HQ6A 4IL6U 4DX8H 3GTPA 5LA6F 1NPPA 4AFFA 5I42A 2VFUA 4A3CG 2IHR1 2E1RA 3D68A 5A6PA 4K4YA 3QT5A 3U9TA 2HVHA 2YKNA 1Z1ZA 3F0NA 1JNZB 3KLIB 4ZLJA 4PQUB 1FDAA 4MV1A 2CNNB 2HCFA 2WAQF 3VR1A 1A5OC 3W2VB 3CD6S 4YDDB 2H5IB 3V6DA 1SFOA 2XSJB 5DB6A 1M1HA 3KJVB 3VF0B 3P8BB 4RPXA 1WKLA 4KHRA 5ETTA 1YMYA 2ZH5A 1NPRA 2K7JA 2MHEA 1L7NA 3D0IE 1N5YB 3LP1B 5B5EU 2CPJA 4QZVB 4YR3A 3HULA 2R8GA 2NXCA 5DETA 5HSPA 3OGUA 1OWXA 4RNOA 2CJQA 1R8BA 5EX0A 2YB4A 3LA0A 4F4WA 4TN2A 2P9CA 4U7CA 1RT1A 4MAKA 4K4WA 3B78A 1ZM9A 1JN3A 3CJTA 1S57A 1FD8A 3BSAA 3GJQB 2OODA 1M5KC 3DRRB 4YD1A 4ELTA 3PVXA 3QFFA 3SMZA 1JLGA 2ODGA 1BXNA 4M5DB 2WB4A 5IQQA 3MWMA 2YMPA 3RFCA 1L3TA 1RYRA 1VIXA 5B0EA 4YY3J 1NSKL 4GXKA 4CCHA 3UCUP 3IAM9 1NDKA 4DV0H 3C6TA 3HJFA 4LFBH 1HHQA 1ZETA 5FJ8G 3GB0A 2FZCB 3WKAA 2CPXA 4MT1A 4C5CA 4F3OA 4ZI7F 5ALSA 1L2ZA 3TFSA 4A2AA 3V6JA 4CO4A 2P9GA 1LB2B 8ICJA 4FZMA 4ED0A 4LF9J 4KFBA 2R87A 1Q86T 1TR0A 5HMDA 1N5TA 3NEKA 4KN4A 3MABA 4FZVA 1UPHA 1WHVA 1KJJA 3JTPA 4NXNF 5C1OA 1MN9A 3AQEA 2XYPB 2HQFA 1N5VA 1RG6A 4IO9Q 3R27A 2C2OB 4O4RA 1PC4A 2VA2A 2E9TA 2YRXA 1TQLA 1X5OA 4A8MP 2BPGA 4QU7A 1B64A 1W26A 2E1CA 2VHGA 9ICSA 3W64A 1J6PA 2CWKA 4JI7J 4D3HA 3A3NB 2ZBRA 5K14A 1N5SA 4JI8J 4C98A 2QS8A 3DHWC 1FRIA 1X4AA 3C19A 1WOSA 4NWIA 1NFGA 2YWFA 4F93B 3QAUA 2F65A 3WZ0A 4EX7A 1XR6A 3T5LA 4QZFA 2W24A 7FDRA 3HHLA 5IYCG 3LGHA 3OXFA 3J7YU 1Q8LA 3UO0A 4UB1A 1B43A 1X9MA 2NV3A 4R85A 1T9WA 5ALUA 2GX8A 3LWBA 3UR0A 3CO9A 3UM9A 3EDRB 2PKEA 3N7PD 2P6TA 1IKYB 5E5NA 1O51A 4KLDA 2HGSA 4DV6H 1ZQNA 3IG0A 2WB1C 2JFDA 1QH9A 3ZI4A 1MG7A 3RAMA 2KVSA 4P72A 5HBRB 4KGMA 2B5JB 3JAMY 2E8PA 1L7OA 5G0RB 1SWWA 5HMLA 2HQCA 3C6UA 3T19A 2F8EX 1SBRA 3FEYB 3X3UA 1GXUA 9ICJA 3HX0A 1L7PA 4B9TA 1YBQB 2YWHA 4RW8B 3OW2R 1IUJA 1FTCA 2G4BA 3H0GG 2PSZA 3ZD9A 1BWVA 1RWVB 2ZNYA 1NB7A 4U95A 3N7SC 2W70A 2FGCA 1TK5A 3DC2A 3FCVA 1UVMA 5J0OA 5HHIA 2NRVA 2ZH2A 1LOUA 3K57A 4Y28C 4L3KA 3FKIG 2R18A 1LXJA 2D3O1 2Y1IA 3N7RC 2K1RB 3LP2A 3S8SA 3H7IA 4ZVOB 2ZITA 3IMQJ 3LPEA 4M5JA 1RZTA 3HBLA 4AYBE 1RACB 1F0XA 3V6KA 1R8HA 1VYAA 2UVVA 1VC5A 3BQ2A 2B3TB 3IP0A 2Q66A 3BG5A 4KHPH 4HHUA 2EXUA 1VGYA 1SV5A 5ALMA 1DK3A 3C6TB 4TKTA 1PKUA 3OHAA 4BJQA 4DR2F 3IG8A 1RT7B 1IKXB 3RB4A 1MU2B 2PGCA 2XZDB 3KK1B 4QIWA 3BQ7A 3H8WA 1VMBA 4IG3A 1LW2B 3OUYB 4A8YA 4KFBB 2OPSA 1Y0HA 3K5PA 4NLCA 3HDSA 3WQPA 9ICCA 1FFGB 2MKSA 4Y6IA 4B9SA 4YHHJ 4HKQA 2WB1D 3SQIA 1F2GA 1FK9A 1GXTA 2P5VA 4C8KA 4O2BF 3KG0A 3RJKA 3CCQS 4GVBA 3KDNA 1HYSB 3PYEA 1WEYA 4C0OC 1RLDA 5IWAF 2H5EA 2EBGA 3RTVA 4C8YA 4YMNA 2CFXA 1HNXF 1V6HA 3OL9A 3JYTA 3IR7B 4DV4H 2RKIB 3AAWB 4XTTA 4RNFA 2B8QA 2H9ZA 4DR7J 2DF4B 3CQZA 7ICRA 2C2EA 2JA6A 1KLNA 1QE1A 2C00A 2L3MA 5B09A 2HZVA 2BM0A 3FSYA 8ICQA 3RR7A 2UXBH 4USKA 3MD1A 5HBMB 3Q23A 4UOHA 2OTLS 1PJ5A 4LF8H 4A8QA 2VFSA 4WBFA 3B0YA 3LSBA 4ZHQF 1SKUB 4GLXA 1XMQJ 1SZPA 4QR2A 4C8NA 4RQ4A 3RF9A 4R8UA 4DV1J 1IE7C 4NYOA 4B3TF 2N3LA 1EUCB 4ES1A 5J2BA 1CVJA 4FBUA 1QTNB 4CI0B 4FO6A 4KHPJ 2B9EA 1WUUA 2Q0ZX 8ICKA 4USIA 2CVEA 2P6RA 2NSBA 3MDUA 2DWQA 2AWZA 3M8ZA 4ECQA 4Q45A 4RW4B 2N1RA 2JH3A 4YB7A 2BQRA 4TUPA 2V50A 1IXRA 4QYZK 1BNPA 2LU1A 2HHSA 1RT6A 2GJ2A 2KNJA 4J9NA 1ZA1B 4JB8B 1AFJA 1AB8A 2PXIA 4WK3A 1CUKA 4XYMB 4IRCA 1IG6A 3HILA 5C1PA 1KRCC 2VUGA 4RT3A 1C4AA 2ZIVA 4OV1A 2V8VA 1KOOA 1JNRB 2KHVA 2WTFA 2W2PP 3BF4A 1XO0A 4J9PA 4Q44A 1F5BA 1ZQFA 2V9WA 3NL0A 2DEIA 2FVCA 1CC7A 2FB0A 1EB0A 4MV3A 4WK1A 4FYYB 1FD2A 1ZS6A 3M4XA 1O75A 3M1YA 1NK7A 3T1HH 4DL5A 3ORQA 4TV8F 4EEYA 1O5JA 3M2UB 2NRWA 4LF5J 1WORA 3I4NG 2K06A 2A10A 4F4AA 2YNGA 1VAJA 1C2PA 3AM9A 3PNCA 2AYBA 2IA0A 2B9YA 2QJ3A 2RDDA 1GSOA 4L3NA 2NQPA 1UMJA 3HHNB 1FK9B 1WHXA 1L3KA 3MR7A 5FD5A 2A19A 2AZ1A 5IC4B 2Z58B 1T11A 2AJ2A 3U1LA 2Z8QA 2QLJB 4XZ3B 1N36H 3M8WA 4Z7CA 3GG1A 4JYAH 3VGUA 1S1TB 4X4TA 4JI1J 4UB8U 2W8KA 2DXFA 3I6PA 3SENA 3DLBA 3L7PA 2EW9A 2UUBH 2BQ3A 2P9BA 3NCRA 5JVLA 2XZTB 4NLSA 3L95X 5AKEA 3UCZP 4DU8A 2A3JA 5C5JA 2DKOB 2W6PA 4WP8A 3W9IA 1PAEX 3DI6A 4NLGA 3NLCA 1GK8A 2AXTU 2LQ8A 2WF9A 4YB5A 2DEJA 2CJ9A 5J1EA 1U1PA 5FPRA 4ZJLA 1H2VZ 5J2QB 4LFAF 7ICUA 5KT3A 3SV3A 4C4RA 1NDCA 2MSSA 3TVKA 2JA5A 2JH1A 2R86A 2KZMA 4IOCQ 4F02A 2LLZA 3OL8A 1ZQRA 2HRUA 1SC6A 1RABB 4E2FB 3OUZA 2LXUA 1RA6A 1Q79A 3CJ2A 4E4TA 4YMOA 1AQ6A 2L41A 1YK9A 4F5QA 2W3SA 1PK1A 2E7XA 1A0PA 4F26A 4HT5A 4I2CA 2HHVA 4ICLB 2RJZA 1AUVA 4J03A 4UB4A 4OYZA 2ASJA 1DQ9A 2ZDGA 3KLHA 4DUYF 5LMUH 1FWLA 4CM2A 2CPFA 2P53A 1HUZA 2K4IA 2PMZF 4K4GA 1NDLA 1ZOTA 3MMAA 2HHUA 4O9MA 1I51B 3ISZA 4M9UA 3US5A 4OCZA 3HRDD 5LMNJ 1S6UA 4I0WA 4RZRA 4WIQA 1N36J 2QL5B 5J0PA 4A3JG 1JROA 2JRZA 1PG5B 3L7OA 4JYAJ 3GYNA 3OVSA 3H5YA 3M2VB 1V9OA 1RK8A 3DLJA 2XO6A 3VC8A 2HOQA 5FSEC 4ZN1A 3ETLA 3QWPA 4RWWA 2I8CA 2AX0A 1X66A 2YNIA 4Z6DA 2DGXA 1G4CA 5HP1B 4RB2C 3D2NA 1U2CA 3NGDA 4GKJJ 1SUQA 2R92G 2ZXIA 3JPOA 1S3TC 4QZEA 2HOFA 1S49A 4TNOA 5F3TA 3KYLA 3P4UB 3OVAA 2COLA 4WJBA 4P52A 1ZD4A 2OPRA 2Y1JA 1NXIA 3SV4A 2CQ3A 2G0AA 2VC1A 2GC8A 2XMTA 1SVDA 5L1IA 5LOQA 3OLAA 1ZQMA 4UTGA 4ZDNA 3D66A 1ZQOA 4IDKA 2YQ0A 1WCMA 5M2PA 2K4PA 4EX6A 2DK2A 4EMDA 2IPOB 3T5HA 5C25B 1NKEA 3V4IA 2BKPA 1M0WA 1HJPA 2CQ1A 4KR0B 2BGWA 4G7EA 1U8WA 3PX6A 3EGZA 3I56S 4MHVA 3L4KA 3I31A 3IS9B 2P35A 1PCAA 2EFVA 5H9FJ 2CQYA 2DUYA 4NLUA 1GT8A 3ONQA 1X0PA 4RU2A 3N44B 5KFCA 2QX0A 2ZM6F 5LMUJ 5D4OA 1B0XA 4PPXA 1K47A 3WKEA 4XRHA 1S59A 5C7PA 4ZITA 3WX8A 2CADA 5J2MA 3IN5A 1RTJB 2OFGX 4KRWA 1TAUA 3QT6A 3QU4A 5D49A 4B3MJ 2IDLA 1KL9A 1QSSA 4RNNA 4DG1A 3QT7A 4DQQA 4QR1A 2ZBIA 3KFUF 2RGRA 5KG6A 1CJKA 2GPWA 5A8RA 2FTYA 2DTJA 3KK3A 3UDCA 3N9UC 3OJSA 4M63A 1JKJB 4DL7A 5I3UB 3AOBA 3RH4A 1OXJA 1QDUB 4O5CA 5AXKA 3FZ2A 2FJVA 5J1NA 1LKYB 1Q82T 2MHNA 5J2GA 2VFTA 1KRPA 1FJGJ 1Y11A 2M7SA 3RYLA 1ZRMA 4YR0A 2I9GA 2ZUDA 2GCFA 3DRYA 3G6ES 2KL8A 4A3LG 2V4JA 2E8MA 2PFOA 2YTUA 5DDOC 1Q8KA 2KVQE 2W57A 4UB9A 1MWZA 3OTOH 2JWNA 1H0HB 3TZWA 2H3IA 2DCUB 4QZHA 4FE3A 4IR1A 4CLKA 5D0HA 2RF2A 1O0PA 4YMMA 2DRAA 2HHHH 4MTPA 3M6VA 1HIWA 1RXWA 3FBBA 3QGAC 3SBMA 2R9LA 2DGZA 4R0JA 3V7LA 2HNZB 2QV6A 3BSNA 4LF7F 1TE2A 4P73A 5ITHA 1AUDA 3LALA 5ETKA 3GP9A 2GVDA 3DN9A 5BR8F 2QFIA 2IMWP 2YNIB 2R2RA 4Q0BA 3K3PA 2J8AA 2ALYB 5J2NA 4ALZA 1U45A 2CIMA 1IBKF 5KX5F 8ICCA 1GLVA 1A5NC 4O3NA 4DFKA 3ED5A 2L9NA 3AXMA 3S6EA 4EK2A 4KLTA 4ZCIA 3E3XA 2R7XA 2VASA 4CH7A 2RVJA 1ZRNA 5ALWA 3C2KA 4Y2AA 2ZJ8A 4KPYA 5KOWA 4LR9A 2VR1A 1RWOB 2BX6A 4IDKB 3NWGA 1S48A 4JI0F 3IG1A 4OI3A 3GIQA 4I69A 2R84A 4OHWA 4QIFA 1ZQSA 1ZQCA 1IWAA 4G6VB 2VBXA 4LFCH 2NUHA 4BY1G 4K4SA 4EGJA 4J9QA 2NYIA 1WG1A 2FYXA 2K2PA 3FYHA 5DM7Q 4TUQA 3DRPA 1RUSA 1KEEA 3D6HB 3HFKA 4M94A 5J2UF 3OD2A 1U7LA 3WIVA 4IFYA 3D2QA 1G7CB 1P1LA 2RILA 2UV8A 4K8RA 1GMUA 3MECA 4C48A 1BPBA 3KK2A 2BCUA 1JLCB 4C97A 2MQQA 2BVZA 2ZUBA 3BGRB 4F67A 3GTYX 2AGQA 3V6HA 1I7NA 4A3MG 9ICUA 2RLTA 4PWUA 1SH0A 3H59A 1YTYA 5KFGA 4R0EA 3WK7A 3BZKA 5J0XA 1C20A 1KHVA 1BQNB 3ENAA 4EBEA 2FTRA 1JLQA 3CJ0A 3D5MA 3D0GE 1NU4A 1VQ5S 4GKKF 3PO3G 3ENWA 3F5EA 2ZIWA 1KJ9A 2ZTEA 2OHDA 4FNIA 1TL5A 4LIRA 2IDEA 5B0FA 4RB0A 1FXDA 4PWWA 3K8VA 1CJVA 4DLEA 2Z2ZA 1TK8A 1JI7A 2HOIA 1U49A 5DZ6A 2RNEA 1TK0A 2M0GB 2JA7G 5F9LA 4V1XA 1RAGB 3PNIA 4QJVA 4IO1A 1N8RT 2AQ0A 2RF2B 1N62A 1NO8A 9ICWA 1E9YB 4QPTA 1ZQHA 2FVRA 4DV3F 4KLLA 1QAYA 4RZBA 3AD8C 5GVQA 1SV0A 1BQXA 3KUEA 1F44A 3H25A 2MGZA 2E5JA 3RRKA 2FKLA 2LQBA 2RQ4A 2GVDB 5AXLA 2GPSA 1N34J 3DEEA 4ICAA 4MFCA 2XNRA 1YI2S 1NI3A 4Q0BB 3GR1A 3H0GA 4NLRA 4M47A 5C2CA 1RB0A 2XNQA 4KGZB 1XNRH 3TIIA 4ERDA 2KDOA 1WCNA 2DQNB 7ICMA 5A2QW 5KFSA 2XYGB 2EC2A 3AD7C 3T1YH 3PKMA 4PUOB 2ZUGA 4B3ZA 3AEVA 2AYGA 1A9NB 2CNLB 2B43A 4Y8VB 4WU2A 3QPIA 2J7UA 3CJSA 3KUGA 1DZ5A 4DLKA 4UASA 4O5EA 1RM6C 2QG9B 1RTHB 3HP6A 2Y0SF 3PKYA 2HZAA 3CO0P 4USTA 3EM1A 3GIMA 4UT4A 1YJRA 3IAS9 1HW9A 2PMZC 2L9WA 2Y1LB 1YJ7A 3MMBA 2CJXB 4N7TA 4P9SA 3MCOA 3TZXA 2KVCA 1RT5A 4LH6A 2YW2A 2GMLA 3RRHA 2KXNB 1LWFB 3IGNA 1AUXA 5HQMA 3C1ZA 3Q8YA 4ZIWA 2VBWA 5F8JA 4M5HA 2HBLA 3MJFA 2W9MA 3OJUA 4A3GG 3J7Z5 4BUGA 4L6V3 5IINA 4G1PA 4CRJA 4KKOA 3TA1A 3WK5A 3N4WA 5GAHU 4HACA 2Q79A 4RPFA 1UWBA 4FKYA 3KFWX 5EE0A 4DV7J 1XC9A 4L72B 4WWSA 4KMOB 4LJXA 1QY7A 1C1BB 1FNXH 4KYZA 3V7JA 9ICKA 4R5PA 1A6LA 2D69A 1S4FA 3QYYA 3MUVP 2HSEB 3VAMA 4AP9A 2IY5B 1FJCA 1XNRJ 2GHPA 4ID8A 1I7LA 3ZZZA 1CJVB 1B7FA 4F0LA 1Z00A 2KD1A 1KEKA 5HATA 1U1RA 4IH7A 2DNQA 5CCLA 4AXIA 4KX5A 4YB1P 2BPFA 7ICQA 1L5UA 2F44A 3HXLA 1NHUA 3GMGA 3KZXA 3C15A 3QEAZ 4NA3A 1B22A 1GKRA 3PW0A 1X4FA 2AX1A 3WK6A 2KJWA 3HHKA 2EZZA 4URGA 8AT1B 3DDNA 4AYBC 3BBCA 4M6WA 4OO1J 2W55A 3U1MA 5EWFA 4I2HA 4LVOP 2PMZD 1U1NA 3E51A 1VRUB 3PO2G 3QIPA 3N2CA 2D3OR 3RTXA 3SAFA 3H0LB 2YPZA 1M1GA 3MPDA 1SKSA 3WK9A 5AXMA 1GAOA 4J5OA 4LF6H 4IUFA 4JV2A 8ICSA 2I80A 2GVZB 3CWJA 1HNWH 2RHFA 2QLBB 5BOLA 1DY3A 5F0WA 2LEAA 3CJ3A 3D9BA 5DG9A 1WTBA 1TMJA 4B3SJ 3UFXB 3HD2A 4U6PA 3CXCR 1DQAA 1Q0NA 1Z4UA 3GSIA 4LRAA 3SXLA 4M5MA 3FNNA 1FWIC 4MFBA 1VJ5A 4ZP9A 1KJ8A 2OFHX 2VC0A 3FUYA 1J5EH 2Z2YB 4JI6H 4P0PA 2MLXA 5CD4A 2O03A 1T03A 2FY1A 3THTA 4GRSA 8ICXA 2P0AA 3GR0A 4UW9A 2UXCF 2RUSA 3PXGa 3A8EA 2V8DA 2Q1LA 5KFRA 3FK4A 5K8PA 5F3ZA 2E5LJ 3Q8MA 2J6UA 4TU8A 1I94H 3D1HA 4LMYA 3MFIA 1T9TA 2XHWA 2JEFA 1FWDC 1NJIT 5B0CA 2PFDA 3GRIA 1T3OA 3GTQA 1VLYA 3NUQA 3RJMB 1S6PB 5HR6A 1U8SA 3POTB 4AYBD 4MIBA 4UUWA 3VZHA 2NUAB 1HNVA 3N5BA 2CPRA 3I28A 4G1IA 3VQTA 5CD4H 1HR0F 3BS7A 2YZNA 4MF8A 1BPEA 9ICRA 4O23A 1UWBB 5A0YB 4ZJOA 3KKAC 1F5SA 1WKJA 3NNAA 4QJFB 4FXDA 2N4DA 8ICZA 2D8CA 2PBZA 3TINA 2G5HB 3TJ8A 1Q8IA 4IS7A 4F04B 2YVSA 5G4HC 4UCRA 5AM4A 2YNHA 3KOOA 2ATCB 3MBYA 4R65A 4UAWA 1RAFB 4LH7A 3M9NB 1BQMB 1G3OA 4MKAA 3KNAA 2V59A 2E1EA 4ZPTR 1Q46A 1U24A 4DOZA 3W2WB 5KAFU 4G1QB 1VISA 3C15B 4WXOA 3GZFA 4FYWB 5TISU 2XHCA 3HKZE 3BH6B 3GFZA 1I6JA 1FWCC 1R89A 2BE9B 2R3VA 4KJIA 3PFEA 4O4HF 4KMUA 3J7AN 3C16B 4X4QA 4C0HA 2IRXA 3EZ5A 3DLKB 2WBRA 3R5CA 1J5EJ 1T7PA 4YEAA 2K3IA 4APMA 1XSLA 2RQMA 3UNGC 3SFWA 5J2DA 3HVTA 4WFAQ 2KFNA 4EU0A 4NI2A 1HI1A 1OY6A 1PYTA 3KHHA 1Z4NA 3HK2A 2V9KA 3LP8A 1JX4A 1IBMJ 1JMTA 2HSZA 5D15A 3IGVA 1S6OA 1S6QB 5L1JA 3M2RA 1OWTA 3HWTA 3D6MB 4PZOA 4NPOA 4DF8A 3H8JA 2QRRA 1ZHQA 5KNIA 3PRDA 3O8WA 1TAMA 3UFCX 5KT4A 1Y10A 1LFPA 4DMZA 1N5WA 4DFJA 2D9OA 2LA4A 2HEKA 2GQ2A 4WFZA 4DV0F 4LFBF 2BJ8A 2AQOA 1GQEA 2Y0BB 3H0PA 2VUMA 1J2MA 1DLOA 2AD9A 2VQEH 1MN7A 3C29A 4OX7A 3KWMA 3SDEA 3M32A 5KT5A 3CGIA 4OLPA 9ICTA 5FLMG 2DT9A 3EYYA 4USUA 4PXCA 4AC7C 2GWNA 3WU2U 1Q7YT 4LUBA 3TVZA 4A47A 1SJ3P 4ZCLA 4AD6A 1KBUA 2XLKA 2R85A 4GXJA 4ED5A 2ZZTA 1HQEB 3A0HU 1CPZA 5DQIA 4C3LA 2AGOA 3G71S 4YOEA 1FRMA 1BXRA 1N54B 2MA1A 5CHCB 4F36A 4GC6A 1SV4A 1Y5IB 2VPXB 1Y5LB 2CQBA 5KFDA 3A8JA 2ZWOA 2V63A 1VRTA 1TKDA 3MPWA 5AJ3F 1PYOB 1VKZA 4HNUA 3GYGA 3OPXA 1N33F 4CC5A 3IG5A 5I3PA 5CYMB 2NZ4A 3M8SA 1PVRA 3VALA 3G6VA 2QKQA 4F0SA 2W6OA 1FWJC 5KFUA 2EG2A 4DV6F 2BOPA 3ET6B 1UHUA 2VKRA 2KYZA 1EUDB 3F2BA 3GGMA 9ICNA 4DDFA 1YHQS 1SL0A 3MM7A 4KITB 2B7CB 4NXNJ 3ZXWA 4IKAA 3KTQA 1PVQA 5HLFA 1BC6A 2G1DA 3K5NA 8ICHA 4JI4H 1L3UA 2DGWA 4X4UA 2E9ZA 2J0SD 4UARA 3M6XA 3HVTB 3MGJA 4UUXA 4NI2B 2HBYB 3GV5B 4O4LF 4LMZA 4OJ1A 2BKEA 2RS2A 3E0LA 2FZKB 3MEDA 3N8DA 5GTIU 3PO4A 1VBGA 4DFPA 2FVPA 5H80A 5GMEA 2JSXA 2MY8A 4HNVA 2DVIA 2DHAA 3D67A 3EVMA 2NU8B 3CD7A 2HNYB 1WWUA 1CJTA 3SCLE 2OAUA 2ZDPA 2ZD1A 4EZ9A 4WFNQ 1GNKA 3C5FA 1HD1A 4KN7A 2VPQA 2ISOA 2IVYA 5KFVA 2B6AB 1HUOA 3C2LA 5DM6Q 1UVIA 3D3CJ 1S99A 1RT4A 5KFBA 3TP2A 4V19X 3MTWA 4PZVA 5HMYA 2CXYA 3PR5B 1A5LC 4LSLA 1DTTB 3B54A 4MMOA 2IJFA 4EELA 2LM4A 2FPKA 2YZMA 4RDWA 1VQPS 4CNSA 1BHNA 3CT9A 2UU9H 3JSRA 5D0EA 1ACMB 5KFIA 1H2UX 5L9XA 2FPGB 3FMAA 2VM8A 2R8JA 5GADU 3MR3A 3KXYT 2GSEA 2VFVA 2QTWA 3O2IA 4C6AA 3PFOA 1M1KT 3BSCA 3M8PA 1HKAA 2GGPA 1FRLA 3ELHA 1JLEA 1KKHA 1X31C 2IA6A 2F8MA 2NXUA 4NZ6A 1H72C 2DD8S 1E6VA 3BM7A 2W6QA 2M9NA 2RSQA 1TUGB 4DV4F 2CG8A 1K6WA 1TWGA 3HHDA 4QIWF 1ZQEA 2E7VA 4ZVPB 1NBEB 2YS7A 3NVVA 4EGQA 3TYTA 2AYEA 3UNYA 2MZRA 2UZAA 4A3DG 5D6GA 1UVLA 2PN1A 4P0QA 2IAJA 4A3IG 1SIWB 1U1LA 5HN0A 4X66H 2UXBF 3R6GB 1Z2PX 3MR6A 1VCTA 3ORYA 3BGLA 2WHEA 2E29A 4LF8F 2QB1A 4DCJB 2DR6A 2ACMA 3AD9C 4DR2J 2VG7B 4ZH4A 2KG0A 4OZLA 3V4SA 3TOQA 1T05A 2MKHA 3AY0A 3TNVA 5D4PA 1EETB 5CYQA 1FEZA 3Q22A 2LXIA 1K1DA 1KC7A 4O2AF 2HMIB 9ICAA 1FDBA 2HVZA 2FJXA 2A1JA 3AH6A 4K0KF 2HFVA 3PIPQ 4BWJA 2LFVA 3H0RB 1FKOA 5IWAJ 3GTLA 5IYDG 3K1ZA 4MFFA 3MPGA 5ETVA 1HNXJ 1RYUA 3AJ1A 5FPOA 3BAAA 1M5SA 1T3NA 9ICXA 1VOMA 3OVBA 2Z56B 4CNUA 2MLZA 4B9UA 1DTQB 2GMJA 1REVB 1HMVA 4O4GB 2N7CA 1ZAVA 2PMWA 1WHWA 1S1XA 2HHWA 2ZIXA 4RQ7A 3SSSA 4BC9A 4ANCA 1KNZA 3ZTRA 2AV5A 2BANA 1NH7A 3FQKA 4KT0C 2ZD1B 3EUB2 1NCLA 5HANA 3UVJB 2NCKL 2DFLA 4HR2A 4DR3F 1Z19A 1RBAA 2G08A 2YX4A 2KJ5A 4KLQA 4C0ZA 3QJPA 2ZDQA 1J5OB 2VHLA 1JLBB 4LSLB 4O3PA 4B3TJ 3T1HF 1OPIA 3DU6A 5KT6A 5KG3A 1POJA 3GCWP 1NZAA 3RH6A 2ZZNA 1O03A 2BPCA 3GU0A 4V1Ak 3WK4A 1W2BR 5F3XB 1VQSA 5LL6d 4RW7A 2J9DA 4FYXB 4NCBA 3PJXA 2WONB 3HOVG 2DNZA 2F40A 5C4XG 4W98A 3H0MB 2GGPB 4ZVUB 2FLOA 3OR2A 4HLBA 4CO2A 5EWGA 4A2BA 4ECYA 2KJ8A 1X2IA 1B99A 1S5ZA 2M3DA 4ZVTB 3UWTA 1RISA 3IC1A 1SKRA 2AJ4A 3V4ZA 3Q8PB 3M8YA 3V5RA 3HB9A 4J7CA 1PZNA 2UUBF 2HWHA 5KG0A 3UCGA 2OXOA 3MDFA 1MMNA 3CEDA 5IQ6A 1TVRB 2RRAA 1FE4A 2RMLA 3IRUA 3K7RA 3KALA 1Z4OA 2E5IA 4BWSC 2J6SA 2C1EB 3UQ2A 4DV5F 2FHJD 3RZAA 2Q6CA 1RTIB 2N7YA 2G09A 3OTQA 1UT5A 1CS4A 4JB3A 3HI9A 2CUYA 1WC4A 2LYBA 4MYTA 4R63A 1DRGA 3SZ2A 2KV2A 1RT2A 4LF4H 4USHA 3RBXA 2FY8A 2WF8A 1S9FA 1ZM3A 1RHUB 1FX4A 1TKTB 5HVHA 4BDPA 7ICHA 5E3AA 3I5CA 4DUYH 3E01A 3IDWA 4C5BA 5LSLA 3C14A 1B0PA 2WB1E 3SIPB 4OYXA 4KBIA 2XULA 2CZ9A 4WYLA 1SQEA 4AL6A 2AW0A 3ALRA 4XUSA 4YN3B 1HPZA 2C3YA 2KI2A 3QU7A 3IM9A 2R7LA 4M8LA 2BCRA 2N82B 5BMVF 4ECRA 1FKOB 1FFUA 2BE2A 3GJSB 2B0GA 3NGSA 3NNHA 3RN6A 4XX0B 3QRQA 3JQMA 1WD6A 4Y2VA 3LNPA 2Q2UA 4ZPWR 1WG4A 1NZ8A 1VQMS 4HTIA 3RRGA 4DX5A 3PYFA 1GO3E 1N2XA 4OYOA 2RS8A 4O3QA 1ULRA 1S1XB 2ZIXB 2H3QA 1XERA 7AT1B 1S0VA 3FVYA 5IFMA 4NZ7A 1D0EA 3I5BA 2EFQA 5J0UA 1XR7A 4NLNA 1F6TA 4HH1A 3W8GA 2H54B 4OI4A 3DLHA 4FFDA 3QSIA 3CNQP 4LFAJ 2QYCA 3V81B 5HMFA 3GE9A 3M8QB 2XD4A 2QSFA 2RE1A 1T8EA 3IWLA 4P2FA 5GAEI 5EZYF 1S68A 5J29A 1SJ4P 2B4OA 2BR0A 4IH6A 5D78A 3D2WA 2LQJA 3H42A 2OHFA 3C1YA 2VPWB 4IHJF 3RUPA 2P8IA 2MAXA 3PO5A 2QIFA 2MPUA 2ZH4A 4NASA 1NH8A 4I6YA 3VV2B 5FLXW 1XS9D 4DR4F 3AT1B 2YCHA 4JV5J 1ZJMA 3NWRA 1PK8A 3HHLC 3RBEA 3MHYA 2IYIA 4K5RA 3VPDA 3C2PA 2FE9A 2PI5A 1S7IA 5IIMA 4JOUA 4XDDA 2C35B 3QNMA 1HBOB 4FKXA 1R6YA 1JXEA 1NRKA 2X1AA 3DXSX 1JLFB 3LGMA 4CLWA 4ZHRB 2M52A 4DR5J 4IRDA 1FWHC 2R4FA 3SYZA 4W92B 2G2OA 3C23A 1CS0A 3R6LB 2OM6A 1RU1A 3RGIA 4KLGA 4KQZA 1FNOA 1CC8A 2V69A 5T7LB 5THWA 2M5YA 3ZZYA 3JSNA 2IIHA 2YH0A 2GO7A 3UE2A 7ICJA 2RDJA 2LXFA 4M5KA 3G4SS 1KQQA 2XVTA 2OKQA 5J0SA 3AN1A 5L1MA 2K8CB 3I82A 5AM3A 1IJFB 4KHMA 3E01B 4RL1A 4F0HA 3MR2A 3G82A 1S1UA 1A0OB 3OUUA 3KHRA 2P9EA 5DS7A 4ZKAA 2WSEC 5CXTA 2KJ9A 1HLWA 3MEGB 4I2PA 2MUTA 1BJTA 2JH7A 5CB4F 2OD4A 3K5LA 1HPZB 5DDYA 2W43A 5D3GB 4BWMA 4RPYA 3UR3C 1EQ0A 2W71A 1XK8A 3BGOP 2BW2A 1K70A 1TL3B 3UXPA 1TV6B 1T9VA 3I87A 5D1PA 3AJDA 2ZOFA 2DNLA 1EJXC 3T9NA 2O67A 2CQDA 4EPBC 2YQEA 2XY7A 1HNZH 2R42A 4OYBA 3TJ9A 4CT9A 4UAZA 1RI7A 1TAQA 4AQLA 3ETMA 2DWCA 3QUTA 3M4IA 3HHLD 3ZFVA 2EKNA 1JQGA 1E6YB 4DQPA 3OTOF 1XQIA 4A46A 2XCAA 1MMLA 4Y2MA 3DLGA 4OX9H 1X8DA 1IBKH 2E2HA 5B66U 5E41A 2ZM6J 2DKZA 2HHHF 4MA5A 3E0FA 3Q8QB 4HHJA 2XSFA 3LF0A 2F77X 2BBEA 1YKWA 4O0IA 1GTEA 2XI3A 3MMJA 2P2CB 5KAIU 3TAMA 3QRPA 1R9TA 1HIYA 2XO7A 3GONA 1XDNA 4KSEB 1JMSA 2H48B 2MSTA 4R64A 2ZH6A 3ULHA 4JI0H 5ALGA 3MM9B 1KN6A 3IBWA 1HBMA 2LDYA 2D3UA 2JA6G 4TLQA 2FP4B 1UTAA 1MW7A 2P6SA 3LO3A 1SGGA 4IG0A 1VBYA 4P4PA 1N52B 3L4JA 4M04A 4GIBA 1IJEB 3MM8B 2JR5A 5KL1B 2R7VA 4MK9A 3PMNA 4NL9A 3D54A 4LSNA 2WAQE 2KG1A 3PN1A 1RJPA 2PD1A 1KLMA 4L74A 1X6IA 3MGHA 4TQRA 2PFNA 4HDGA 2CPYA 1WKKA 3L09A 1ZOLA 5J0WA 2CQCA 1WG5A 8ICLA 3I0RA 2VQDA 5G5HA 1F3VA 5D4LA 4ECUA 1TKXA 2MZJA 3UW1A 4LFCF 1E4FT 2QA1A 2J9GA 5AM1A 4UCVA 1DXSA 3O44A 1YG0A 3QU2A 3RBZA 3AJ2A 5KFWA 4OD0A 3Q8LA 1VQNS 1CRXA 4X4OA 4LF7J 3VQSA 3KLEB 4GKKH 4C0BA 4ECWA 5BR8J 2Y8WA 2FLNA 4FZLA 2R7NA 3CJKA 4EUVA 2C2KB 1S4EA 4P6QA 3MZIA 2BHNA 2PA3A 2ZE2B 2GIRA 3G82B 3QGIA 5ALFA 4YFKA 1PYSB 4FBTA 3BYPA 1Q1KA 3N5FA 2KXFA 1OMSA 4QIVA 3LP0A 1JXLA 4C4TA 1O08A 1WC3A 4ED2A 1SJFA 2DNKA 3MCNA 2V6AA 5EE1A 2PEBA 1XMOF 2GIFA 3H4BA 1G6BA 2JX2A 4UZCA 1ZZNA 2H3FA 4JI0J 5K4LA 2OPPA 2LA6A 2K7KA 2KH9A 4UY8T 3WK8A 2KHDA 2DH8A 2OYYA 1JKHB 3RFAA 3T5KA 4QZCA 1E4EA 4UQGA 2JNJA 4Z37A 4K2XA 1FO1A 4CP5A 3Q83A 4NXMH 1RTDA 3PDNA 4WF9Q 4LVNP 9ICGA 2A1AA 3WNZA 2Y0SA 1V85A 4C7QA 2BJ9A 2BCSA 4ZLNA 1WH2A 2V58A 1ZQQA 4I2QA 3QBCA 2C22A 2X1FA 1FFSB 3DOLA 5DLFA 2ZIUA 4MKBA 1AUSL 4CLTA 5KFJA 1LW0A 2PDAA 1UNNC 7ICSA 2R7RA 4QZBA 1QJHA 4DQSA 3VAGA 3UMCA 2GLEA 2HBKA 3GIRA 3MM6B 3W5XA 4C7ZA 1ITPA 2QT3A 3NXZA 4GKKJ 3CW2C 1TL7A 4PGXA 1SH2A 2FHOB 1URJA 4O44B 5J2IA 1W2IA 1WWVA 2LEBA 3T1YF 4CLUA 1PSDA 3EXYA 4U67Q 4NMXA 4RQ3A 1KLMB 1FXLA 4HL9A 3WHIA 2OD6A 4ZPCA 4JBCA 3J81W 2VA3A 2CQHA 2JA5G 4CNTA 2FHMA 2F1FA 4JI8F 4F2RA 2SXLA 3TI0A 3D4JA 5IILA 1YZ6A 2I87A 1M6YA 4F4YA 5HVFA 5J2CA 8ICYA 1VDHA 4DV3J 2CVIA 4ACOA 4ECVA 4IQXA 3N97B 3PG9A 3T3FA 1YJWS 1X40A 4N47A 3THVA 3AA8A 5A8WB 1CQIB 1VK8A 5ETPA 1FCAA 3GQCA 9ICFA 5KT2A 4DUZF 5AKYA 4F0RA 2GLTA 3IHQB 4ETSA 4LBPA 2CNOB 2CG4A 4OI2A 2HVSA 4JMUA 3MTJA 1Q3UA 5IS2A 2V2VA 2KIVA 2H4YB 2B4UA 2JHDA 2HAFA 2MKCA 4PZNA 1UFWA 3GDXA 4H4MB 5JXSA 4RX6A 2YQ1A 9ATCB 5D8HB 4RBTA 2OSRA 4WBNF 1IBLH 2QGFB 1PC5A 4RQ6A 2OWOA 1OJ4A 3EX7B 4RR5A 3KLIA 3P5BP 4PQUA 9ICVA 2JLEA 1ZJNA 2VJUA 3B4MA 4M9NA 4DSLA 1IKVB 3W2VA 2ZTDA 4XPCA 2WVFA 2XSJA 5TZVA 3G96A 4ED3A 3KJVA 4CF3A 5H9EJ 5E79U 1N6QB 3DYAB 5LJ5Y 1YWXA 1N5YA 3LP1A 4RZQA 2YX7A 1WWHA 5DGAA 2W4CA 2ZNZA 1F3FA 4KE5A 1QQ7A 5H9EK 5HAOA 5MLCV 1M5OC 5CR0A 5HL7Q 2O01C 2OSQA 4PWDB 2I9SA 1UEVA 2QL7B 1K0TA 3ITHA 1KVJA 2EKYA 2EAMA 3H3VH 1FHTA 1KQGB 3VPCA 4TYAA 4DS5A 2K8BB 3ISCA 3NRZA 3J81j 4CYUB 3AU6A 3PMLA 1ZA2B 2VOPA 4G65A 1TTHB 2H4WB 3GU3A 4EGLA 3BEGB 4N77A 3DRRA 5DBAA 3CD5A 3DU5A 1QM9A 1JJ2R 4M5DA 3GG0A 2JEJA 2IRUA 5J1PA 2WBMA 1HNIA 4RW9A 1NKCA 4ZP8A 4TY8B 1NMEB 4MV8A 2OELA 1U1QA 5JVGQ 4RQ8A 3D28A 2FLPA 1YJUA 1U2RA 4CLZA 3EYZA 1HNWF 1A6SA 2EZXA 2F5GA 5KFNA 2V8GA 4NRTA 8ICTA 4BBRG 3B9JA 1ZQJA 1H98A 5JJBA 1RP5A 1FKAH 1TUWA 1T94A 2HHTA 3UQSA 4NLKA 2CA9A 5D77A 1RBOB 5I4MA 3MTKA 2B4PA 4PPZA 2RF4A 2CZ4A 2OEJA 1K83A 4EO6A 4NV0A 2FUG9 4F4ZA 4ECSA 1FWBC 2JZBB 1YZ7A 4F2SA 3S7RA 1SC4B 2U1AA 3R0DA 1MA7A 3DKDA 4LR7A 4BBYA 2R7WA 2NU6B 3KTMA 3RJIA 4PG6A 2HZCA 2VOBA 1CQNA 1ZQXA 3V7PA 5IOLA 2FDRA 4KGKA 4BJHA 2HWTA 1I94F 5HI7A 1YNYA 5IYZF 3FC9A 4XYLB 2FC9A 1Q81T 5BPHA 5CHGA 5SUHA 4HAIA 4JI2J 1EXNA 2ZKTA 4JI5H 3BN4A 1FNMA 3A12A 2ISPA 1IKYA 4TURA 3KLGB 4C11B 5KKNB 4P7VA 4NM2A 2RRNA 3P5TL 3TJAA 1PBAA 5M2UA 4H9MA 9ICLA 2Q6BA 5GAGI 4V1YA 3QUQA 1HEKA 2VD3A 1OSCA 4NEZA 4Y2QA 5AICA 4LSAA 2B5JA 3ORRA 1ZPVA 1HBNB 3U02A 5BXIA 3VPBA 2QZ8A 5G0RA 1BLUA 4O0NA 1DK2A 1YVFA 1LK5A 1VQYA 3HXMA 1YBQA 3OTDA 2GIQA 4RW8A 2LKZA 3RGXA 1VS3A 5JQWA 4FM9A 2N3OA 3R9KA 1Y1WA 2OP5A 2KT2A 3ITHB 5L1KA 2UXCJ 1R9XA 4J9KA 5ETQA 5FDLB 3AB2B 1FRJA 2LKYA 4C3KA 2E8NA 2K1RA 3ISNC 5CB1A 5CA7A 1XNQH 3N40P 5DDPC 4C7YA 1N32F 3HVWA 1XO1A 1MMDA 3KXDA 5GMKa 4DZ6A 2FJZA 4HI1A 3FMWA 4PYDA 1HR0J 3D3BJ 1UEUA 3KD3A 3B8HA 1HNIB 1RE1B 4RW9B 4X2BA 2I5JB 4WTYA 2VZ9A 5J0YA 4K7QA 2OI2A 3K89A 1KJQA 5IYBG 2BKNA 4FYVB 3RB6A 2RHQB 2FJBB 1EJRC 2MQLA 3GLJA 1FWKA 1RT7A 1IKXA 1MU2A 3KK1A 8ATCB 1EZZB 2NRTA 1GXLA 2EFPA 2OPQB 2E8OA 4MH8A 3UDEA 1LW2A 3OUYA 5ALEA 4DJBA 2WF5A 3MEEB 2EQYA 2WFAA 2VL1A 1JDEA 2UV8G 1B33N 4ZVFA 1X6JA 3F73A 2IHNA 4ANEA 5LP6F 2AIRB 1HYSA 4WFYA 1GX6A 4A3BG 3AL0B 3WC0A 2KT3A 1D8BA 4MKYA 5AXNA 3VAKA 4DR1H 2VQEF 2UVRA 3MAQA 5GTHU 4R25A 2RAQA 2RKIA 5AE1A 5C42B 3VCBA 4I2GA 1FIQA 2UXDH 5HQLA 4J90A 1FWPA 1GMWA 1JDBB 2AF6A 2PMZE 3L4PA 4PXDA 1ZQIA 2XMMA 2HVDA 1ED1A 2VQFF 1H6KX 5KG2A 5IIOA 5EX3A 1FTRA 1A0IA 2VU5A 2ZDOA 5HBMA 2V4RA 3FRYA 4CIOA 3BH7B 4ZMMA 4MIAA 1N33H 4I4BA 3KMSA 3ISND 4CRXA 5J2PB 1KRAC 4OJGA 1S03G 3M7VA 3SD7A 4L9XA 2BRKA 3CCVS 2VH7A 5F8IA 4RBUA 3BE7A 1TL1A 3QUBA 3AODA 3UBPC 1YBTA 4N76A 2FJEB 2WRMA 4DFMA 2W2NP 1TFWA 4KH1B 5CCMA 1TP7A 3RW6A 4OL8A 2W2QP 2NRXA 4CLYA 5JVHQ 1TFYA 3ZC4A 4TXSA 3AA9A 2KZ3A 3QE9Y 4GVLA 1RAAB 4DV0J 4LFBJ 2SCUB 1SV0C 2W7AA 4Q2MA 4LQ3A 3O5TB 4RW4A 3W7BA 1JLLB 2XY5A 4ETXA 5IIIA 1LWCB 1FO4A 3JSYA 5E2QA 4FVMA 1RJQA 3QGGA 5E3PA 1LNQA 5AKKA 5ALHA 4LRBA 4N5SA 5KFKA 3D1OA 3PYGA 4NOHA 3OR1B 2G3FA 3W60A 1AZSB 2DXEA 2ZHOA 4EEQA 1SC3B 3H90A 3UXNA 2OTJS 4MEYA 1SWVA 3P96A 4JI4F 1WC1A 5LXXA 4I64A 4PQAA 3NOGA 3RU0A 3A0BU 4GC7A 1KR4A 5L39A 1TV9A 4NXZA 2XS2A 4KLEA 4OI6A 4KLOA 4ED6A 3BBFA 2H1YA 3GYXB 3IM8A 2KFYA 5DB7A 2B0CA 5A8KB 2QA2A 3CCMS 2DNNA 5J2FA 4UBCA 4A3EG 2D9PA 3M2UA 2C3MA 1RCOB 3RG6A 2C3UA 1L6NA 3BREA 1N33J 4IQWA 2F9JA 1APSA 4A8SA 4AQYH 4P7TA 5DG7A 1RQNA 3RJEA 3HM7A 1RSCA 9ICPA 1F9HA 1MWYA 3TX8A 4DL2A 3QU5A 2B21A 1DV1A 4DV6J 3N41B 3DFEA 3AUOA 4CNZA 2QK4A 2LU2A 3C8YA 8ICPA 4MKVA 3PV8A 3HVRA 4YP3A 5GMDA 2IOFA 3FRZA 1RAHB 3R5GA 2H5XA 3D1QA 1S1TA 1S1VB 4DHVA 2E1FA 2GQCA 2XLIA 2UU9F 3F41A 1RHRB 3WO1A 1C1CA 4C8OA 4Y3CA 1GMVA 3ETHA 3AYHB 1URNA 4WYWA 1S1WA 1S72S 2KB2A 5DDQC 4JWNA 1U1MA 7ICEA 3MCMA 2RT3A 1RYSA 3GIIA 1X7VA 3MCSA 3PJWA 1R3NA 1C0TB 5KG1A 2MQPA 4AYBA 1R27B 4RPZA 2LYVA 4YB6A 3PHEA 5J2QA 2IVFB 4WTOB 2WW8A 4DL4A 4TU9A 4B3RF 3T5JA 3OL7A 3R5FA 4IFVB 2RU3A 1TL1B 3JSMB 1YSJA 2G9OA 1YIJS 1YGYA 2D1CA 3TRGA 4K50A 4K0KH 2WDTA 2DGSA 3BV8A 4F4KA 3NMRA 2NZCA 2V8HA 2AZ3A 4A8KA 4X66F 1T02A 1YRXA 3ZTQA 5GONF 4Q8FA 3R8YA 4DSKA 5KFHA 3R5HA 2BZFA 1JXVA 4ICLA 2UZ9A 1RDFA 1XIQA 3J7ZT 2HNDB 3PX0A 4K59A 1RQ0A 1AXQA 2AGPA 2BJ1A 4OZNA 3MURP 1LWEB 3I0SB 3UQ0A 3GFXA 4M1KA 4CQCA 5T14A 3KLFB 3MUMP 3ZZOA 3MDAA 4DUTA 4F3QA 2AHOB 2HLUA 4C5YA 4HTJA 2HVEA 4KLFA 1MROB 4CT8A 1ZQ7A 4PPDA 3JRXA 2UVUA 4ZN3A 4DR3H 5F0UA 3QQCD 4I2FA 3UD3P 1R0BG 4DV4J 1B4FA 5FJ4A 2UUCH 4QOTA 3M2VA 3U26A 3HKWA 5A6WA 2I5HA 1ZQBA 4DF4A 3BQTA 4B08A 3EICA 3W3SA 5AKLA 2IYGA 7ICIA 3RAQA 4QWDA 2B56A 4F91B 4CQBA 5HP1A 1TELA 2YKPA 4GXIA 4X64F 1R7IA 2DRDA 1NZPA 3QNWB 1SKWA 3BKFA 2IHMA 2UXBJ 1ELOA 4IQTA 4K4HA 4LF8J 1EJTC 3JTOA 2BE7D 2WAQC 3KKAA 4CLPA 5ETNA 3R1LA 2FPPB 2DIVA 4USAA 4X65F 4E8UA 5B08A 2HGNA 1SB3C 4HI2A 3HVAA 1YRTA 2MQNA 2LHTA 4USVA 2J76E 2RRDA 2PIIA 1FRHA 4CLLA 2LYHA 5KFQA 4HEA9 4EWTA 4FU0A 3R5XA 3BR8A 1A77A 7ICNA 4PXBA 4Q7AA 5C25A 2ZC3A 2VIHA 1C1CB 1UJ4A 3T81A 4QW8A 2DO4A 2XEXA 2U2FA 4LZGA 3IS9A 1S1WB 4CO3A 1HBUB 1MC8A 4DV5H 5BPCA 2PLMA 2CKZB 4IWYA 2LMRA 3HW8A 4LQ9A 4J0MA 3ZD8A 3HSGA 2B9WA 2NXJA 4OHYA 4D3GA 1C0UB 4KLJA 4UCSA 4X84A 4I67A 1U09A 3LSCA 2W1BA 4X62F 2BXJA 2DR7A 3QEBZ 3ETRA 2NUUG 3BQ0A 2ZVSA 4OLOA 2R7TA 1W93A 1YBUA 4P2SA 3QFWA 1RTJA 1RBLA 4USJC 1IWGA 3M30B 3AB4B 3H2LA 1YT3A 4JI3H 4DSIA 1XN9A 2VODA 2KVIA 2AEFA 3WKDA 4DR3J 2I1QA 3DLEB 2MKYA 4UOGA 3M9MB 2APOA 4PG5A 3N79A 3AHPA 2YY3A 2QARB 4M9JA 5IT9W 1KTVA 4PJ0U 2GV1A 2R7MA 4YVZA 1W7WA 5E33A 5I3UA 4DLGA 3G8TA 3NGKA 4FN5A 3Q8KA 3T1HJ 4YS2A 4LF4F 4AXJA 3C0FB 5KFTA 1Y1VA 1LKYA 2OJ3A 1FWEC 2V5AA 2WAQD 3ISBA 2FK1A 1T0TV 4C60A 1ZAWA 1SJ1A 4Q8EA 3MDCA 1S77D 3BS9A 2R7QA 2WCXA 3FSXA 3NRBA 1ZQDA 2XB2D 5H2FU 1IKWB 3HJVA 2JVRA 3E5NA 2VB6A 2H3ZA 1ZYQA 4WZQA 2H5JB 4TUYF 2VUMG 2HNZA 3SAHA 1ZXIA 1WDDA 5AKHA 1JK9B 2UUBJ 1N4LA 4KB7A 5AM2A 2JXJA 4NCAA 4CTAB 3DRSB 5J8YA 1EYZA 2M0NA 3HM9A 1NPKA 4Y00A 5KFFA 4ZK7M 4DV5J 1GFWB 3S1TA 3SCIE 2ADBA 2DIKA 1CSJA 1NSPA 2ICSA 3H5UA 5CYJA 2JVOA 1NK8A 3VAIA 1U6ZA 4I1TA 3LA4A 2O66A 4DR4H 2RUGA 1U4BA 5LSRA 2DHXA 3H2VE 4NY8A 5JH7F 3GTOA 2CNKB 3L7UA 3ZNJ1 3R1HA 2I2YA 4LF1A 2V4QA 1MWQA 1KP6A 1NHVA 2E66A 1NNLA 1T3QA 1SC1B 5E7OB 2ZOMA 1VS0A 3EGJA 1FRKA 1NK9A 4K4IA 2LI6A 2KG5A 2IC3B 3X1LB 1IV8A 5D46A 2AU0A 1UCNA 2NXNA 4EFEA 3WC2A 4X4VA 3MC1A 1BE4A 5HROB 3BA9A 1WCLA 2DISA 5AI6A 2UUAH 3R2DJ 1V9PA 4ZOHC 3QX7A 2W8LA 5KFLA 3RH5A 1UBPC 3Q1KA 4DV2F 2HS3A 1VQ9S 5H9FK 1C30A 2QLFB 3I12A 1ZD5A 3CPWR 1VQKS 2R82A 1RCXB 1JLCA 2IMOA 3Q24A 3KAKA 3TUPA 3B6BA 1H7XA 3BGRA 5DO2A 4I68A 3G8CA 3QJLA 4EYHB 3ZDAA 8ICFA 2KJVA 4FXWA 1TKZB 3NKYA 1S0MA 1KD1T 3Q8RB 1EP4B 2R93A 1BQNA 1VI7A 9ICMA 4A8OA 2LBOA 2KE7A 2V5HG 1X4BA 3PW5A 5K8NA 1K1SA 2V2KA 1SL2A 4M5GA 4DR6H 3G9CA 2HBZB 1LQ9A 2YWGA 7ICPA 1EAYC 2BDPA 1HQUA 1YJVA 8ICUA 4F25A 2YMQA 4BX9C 2HFSA 2XI9A 3UDLA 4RW6B 2B51A 2DRBA 2HHXA 1S9EB 2E44A 2I1RA 5DZ7A 1GH8A 2FJWA 3C66A 2VG5B 1E4GT 1EJVC 1N88A 4KV8B 1JWWA 1D9DA 4NX9A 3GZ7A 4DN0A 3QMQA 4E98A 3CDAA 5KFEA 1K8AT 1Z2LA 1CJUB 5DBCA 3ICXA 2ZG6A 1GKPA 2HMXA 4CO0A 4MFAA 1DQ8A 3ZZRA 4MK8A 2NRZA 1HNZF 3PJ9A 4UB6U 1X0FA 4KPCA 5KG7A 2CRLA 1FWFC 1IR0A 1VHIA 2NVYA 2WSCC 4N56A 4KY3A 2I8EA 1ROFA 2RRBA 4OX9F 3CCUS 4K4UA 5CAEB 5ALTA 3TAQA 1KW4A 1GSAA 2F4VH 1IBCB 1KS2A 1R8AA 2OH2A 1ZQKA 3W62A 4DN9A 5KFXA 4LBHA 1S0NA 1Q5YA 1XRFA 2MU2A 4PUOA 3BS5A 3CB4A 4CLSA 2WOMB 1NOMA 3JSLA 3QZ7A 2RP5A 3NVZA 2HQDA 4GO7X 2M8DB 2Z57B 3EDQB 2FIUA 1FDDA 3IRXA 2DGTA 4N8NA 3L2PA 7ICKA 2BV3A 4O3MA 2DH7A 2E2IA 1RTHA 1PUZA 1GSHA 3THPA 2G0IA 1K44A 3PHTA 3ZO7A 3BQ1A 3MR5A 2J0WA 1RWKB 4NEYA 1S9GB 5J2KA 2H51B 4C5AA 2W9CB 1EJ7L 1TAEA 3OFFA 1LWFA 2FVMA 2HKEA 3RJGA 3D6FB 5F8LA 2B63A 1RT3B 3OTOJ 1CULA 2AT1B 3U1NA 4HR7A 4ID5B 4C8ZA 2Q4TA 3P49B 4ED7A 1Y9OA 3MMCB 2HHHJ 2J8SA 2DY1A 1VQOS 4NCGB 1S7HA 1B0TA 3NMAA 4KLIA 4RUBA 3BPSP 4XIUA 2EDUA 3R5DA 1Z1VA 1XMOH 4NA2A 2GS8A 1A5KC 1C1BA 5IXUA 3CCWA 3UD5A 1BVSA 3JB9k 4URQU 5HMZA 3TFRA 5F8GA 5ALXA 1HQUB 1RHQB 4U96A 2A2CA 2D3DA 4DXLA 4NMLA 1P7DA 1WHYA 4DX6A 3FEQA 1HD0A 1PVPA 3B0XA 2KN4A 4CGZA 3Q2SC 3CE8A 2KSOB 4NLPA 4NLDA 2MSNA 5JTIA 7ICLA 1YRUA 2DCLA 4YY3H 4DPOA 2PFPA 1FWAC 3PW7A 2PA8D 4YAJB 4QZ8A 5A2QY 4C2MA 3DGPB 3SR6A 2X1BA 3EGWB 4LFCJ 4PKDB 3MAAB 3PCOB 1VRUA 2XIGA 5DG8A 4NXMF 3RJ0A 4ED1A 2F63A 3RBDA 3G6XA 4ZOSA 2QB0B 2KKPA 2NREA 4LF9H 2J9EA 2ROEA 1UQVA 1Q7LB 2M4MA 2YL2A 1RAOA 4XDCA 2GVZA 2ASYA 3JZIA 4OJ5A 4RUHA 1DV2A 2VG6B 2JDJA 1T9YA 3MWEA 5B0DA 4F7VA 4PL1A 1QQ5A 1SXLA 4TYBA 4AE5A 4U8YA 3BS5B 2K60A 1QUVA 5ALOA 2QLWA 2KIWA 5BJRA 1I6UA 3Q2OA 4PHAA 4JI7H 1VBXA 3W9HA 5EUHA 1R8PA 1WI6A 2RQKA 2YKMB 4DPXA 4JI8H 5C3EG 2FVSA 5LM7E 1S10A 4US8A 3KG1A 4KO0B 3IRXB 2CQ0A 1GTHA 4JV0A 2B7BB 3W66A 4UAYA 1XMOJ 9ICIA 3MOJB 2FD2A 5MAOA 2X3DA 5I47A 3DOMA 3AFGA 3K1RB 3VGTA 3G8SA 1I50A 4TVAB 3J7AK 3QSYB 3HCXA 2VV5A 2H3EB 3QT8A 1ZQLA 3RAXA 1X4EA 4L73A 1HWKA 1R0CB 5IT4A 1D1UA 2ZFHA 3FFIB 4J37A 4OI0A 4DUZH 5ALNA 1FKPB 3IM1A 1U0HB 3TEGA 3QIDA 1J2NA 4ZOLF 4ES2A 3I9V9 3LMLA 1X4HA 1O12A 5IM0B 3QYPA 3PY8A 1CULB 4P71A 4PG8A 1RK6A 1S6PA 3POTA 4OFZA 2HIQA 2LM1A 3MXHP 4YIWA 3QO9A 3HFVA 4QYRA 3JPSA 3M05A 2R8KA 1IM4A 1J2VA 5A0YA 1Q3VA 4IWXA 1LKZA 2R7KA 2ZJRQ 4QJFA 2E1AA 5DB8A 4C5ZA 4YBZB 4F71A 3NGRA 4NYZA 1SQGA 3FCWA 5FD1A 1FXRA 4RUCA 2DYAA 3FEZA 1NHKL 4A93G 5K8MA 3BZCA 1KRBC 6FD1A 1NAQA 2W01A 4I7FB 8ICNA 4R66A 1BQMA 1RADB 2IM3A 4ZS6A 1F60B 5DJBA 1N56A 2LVWA 3I4HX 3W2WA 1IBLF 4G1QA 3GSDA 3IRWP 1DGSA 3A8KA 4FF4A 1LXNA 3T1YJ 1JALA 2FZGB 4BLGA 2DGVA 1VR6A 3C21A 1B04A 1FVQA 2WSFC 4US9A 1RDRA 1R0AB 4EPEC 3JTNA 3C16A 9ICBA 1N60A 2CXEA 3DDKA 3DLKA 1UWAA 2W4DA 1UC9A 2WVEA 1YDLA 2BRLA 3QGHA 2EANA 4LRDA 1VQLS 2FVKA 4Y2IA 1DFDA 2EI5A 4WE1B 4OYWA 3HHEA 2VKZG 4OIXA 4B3OB 3SSQA 4X4PA 2FK3A 2G06A 2A18A 5BYSA 1KSPA 3DOKB 1X5PA 4FVCA 4H4KA 2FJDB 2ABYA 4YHHH 3HSDA 3MAHA 4I2IA 5I42B 4DUZJ 4QIWE 2EH9A 2RH3A 4PHPA 2F1JA 1S6QA 1RTZA 2C3OA 4IZOA 3FSIA 4L75A 1B4SA 4WCEQ 4EEKA 2MB0B 5CP2A 2YKNB 2C2ZB 4UZBA 5BYQA 3PYDA 4DFDA 3KDOA 2X51A 1XNSA 2OIHA 3V6DB 3ZZPA 3TKAA 3HLUA 1UFLA 3A1YG 2HGLA 4MTDA 4UBPC 4RB3C 8ICIA 4DR7H 4ETZA 3FBFA 3IGHX 1I1GA 2ADCA 4WXWA 4EZ6A 3DOMB 4YXJA 3ZZUA 4RB1A 1VBKA 3VTIA 1U9LA 4QCLA 1D9AA 2FPHX 3SEIA 3PW2A 9ICQA 1SJRA 1RT1B 2Y3YA 1FKAF 3JAMW 1OSDA 2P66A 2LEPA 2ZKUA 1WSCA 4ZVEA 2L48A 4C3MA 1B70B 2JC1A 5CH7B 3K5OA 3A3PB 1XMQH 2M8HA 4PR6A 1KQKA 4ME6A 5ALZA 1AA1B 1HQEA 1DRZA 4DV1H 3QO9B 1WF2A 4CNQA 1WF1A 2VJVA 1JLGB 2CJYB 3CJRA 3NCPA 4OZ1A 2W2MP 4I6WA 2UVWA 4EENA 4WFBQ 1XSPA 2FQQB 4N8OA 2HVRA 1KQSR 4Y2TA 1P8GA 1ZQ1C 3J7YI 2KAUC 4K4XA 3PR4A 4Q43A 2RB7A 1CEZA 2LYAA 3HOXG 5AKQA 2Q2TA 3K5IA 1RZMA 4B6JA 4TY9A 1H74A 3NY0A 4IRKA 5G5GA 1UKUA 5CYMA 1FERA 1F2HA 4UCTA 4O3RA 4LF6J 2DR8A 1ZZFA 4GY7A 4JI5F 4UOFA 2IFXA 2EBEA 3OQ2A 2PC6A 4I2EA 2PEHA 2MXYA 2QA4G 2GOKA 1HNWJ 2GNKA 4TV9F 4TQSA 5LL6b 1BNCA 3ET6A 3IWNC 2QLXA 2CWXA 5C8YF 4B9VA 6AT1B 1JJHA 3OFHA 4MAMA 1JB0C 2Z2MA 4Y2YA 2GO9A 1KVIA 2GZOA 5J0QA 1RPLA 1TL4A 1K9MT 2MMYA 4Y2XA 5K14B 1SXDA 1RQLA 8ICMA 1N32H 4WU3A 4RU9A 4JI6J 3VGVA 1C7YA 1EARA 2YY6A 2AKWB 1ZQVA 1NK4A 1R8CA 2NPFA 1U26A 2NU7B 1YBAA 4I2JA 4S0MA 3JPQA 3HHLB 4LSZB 2DGQA 4OYPA 4LF5H 5DQGA 2JLGA