4F57L

Fab structure of a neutralizing antibody l1 from an early subtype a hiv-1 infected patient
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYRQHPGEAPKAIIFDVTNRPSGISNRFSGSKFGNTASLTISGLQAEDEADYYCAAYTVASTLLFGGGTKVTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Viral Escape from Neutralizing Antibodies in Early Subtype A HIV-1 Infection Drives an Increase in Autologous Neutralization Breadth.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Light chain of Fab of a neutralizing antibody L1
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2012-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f57L01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f57L02
1WAAA 4R9HA 1KN4L 4GG6A 4J3SA 3DXAE 5DRWA 1QHOA 4Z95H 1K5NA 3B8YA 2DQDL 5MI0C 2X09A 1KN4H 3SEPA 1IC5H 5A2LH 2R0WL 1XR8B 2FD6H 1Q0YL 4JRYE 4GXVH 4ODXB 1BM3H 4OLYL 3VXRD 1EV2E 2HVKB 1IGCH 2WW8A 3UTSD 3KWWA 3V7AE 3IT8D 3VU2A 1HE7A 2XIDA 5IVXB 1O0VA 1F6LL 2QV2A 3BQUD 2X7LA 3L3KB 2E8ZA 3NAAH 5E1AB 1OD7A 3BO8A 4X98B 3DHMA 4LVHC 1DVFC 4ZSOA 4NWTH 2R69L 2P24B 5IMOB 3RGVC 4MA3B 4LAQH 3BZEB 4N0UB 1CS6A 1HXMA 3O0RL 4D9QE 5D5MF 5J3HC 5HYQB 5J11C 1X5JA 1E4XH 4BFEA 3B9EA 4N8PA 4NQXB 4FQ1H 3RGVA 4WCYL 4ZTPL 2RBLA 4YLQT 4UNVA 5J89A 1SBSL 2GJJA 1MRFH 4YHLL 5HJ3A 3GSWB 4IOIB 3ES6B 3KPRD 3LN4A 3DRQB 3EO1A 3G5ZA 4FNLL 4LASH 3IDXL 1QRKA 5ISZD 1MFAL 4WFFD 2VC2H 1N6QH 3D5OF 2CGRL 5KS9A 2NLJA 1SJEA 3C08L 2DQJH 1RULL 3QA3B 1JPSH 2Y4SA 1T2JA 1YPZB 2DWDB 1NH6A 4ZPTA 1W72B 3O4LE 5D7JD 1ZHLA 4IRSD 3RTQD 4YAQB 1M1SA 4RFNC 2IBZY 1T2QH 3BD5A 1K4CA 2VQTA 5E99H 1JN6B 2I9LA 2XN9B 3MRHA 4HG4J 3L7EA 3MO1A 4MS8C 1LD9A 4XCEA 3MLPA 1A6WH 2W92A 4NDMA 4O9HH 1HYRC 2NTFB 5B8CA 4F33B 3SGDI 5FO9A 4Z7VF 3FCTB 3DURA 5KVMC 1G6RB 1MI5B 3UC0H 3D3VA 5E8EA 2BZDA 3VXTA 3VXPB 1SJEB 1IKNC 1HCFX 4UT6H 3VGDA 1WT5C 4Y5YA 2GTZB 5H35B 5FO8A 3VWKB 4UU9A 3HCVB 5FDYA 4N9GB 3T4YA 2B39A 1GPOH 1MJJA 2F19L 4ONGH 5JHLH 3B2UD 4PY8J 2IPTL 1SVCP 4OFDA 4TULH 4PTUA 5HHMD 2J4WH 1MRDL 1CG9B 1FG9C 3GI8H 3HNTH 4UIKH 3EFFA 2VKWA 1FAIL 3QULB 3OKNB 5ALCL 2AKRB 2O61B 1T0NB 3CLFL 1EHLL 4ZQKB 4NUJA 1BEYL 3LMJH 4QOKE 3WV0A 5J6GA 4ZSOB 4DGIH 1HOCB 5ICYA 4WI6A 5GGRA 4DN3H 3H3PH 2Z31A 1YECL 5DEZA 2XZQH 2Q3AA 3WNOA 4RGMC 1X5FA 5E8DL 4QRPB 4HIIA 1ZHKB 2H32H 3GSVB 3RDTA 4PS4L 1JNNL 2H6PB 1QFOA 4PG9B 1A9EA 2PYED 1XGRA 4XC3L 5I66B 3BZ4B 5JOFB 2FH8A 5F9WB 3VE0A 5ELIA 5C1MB 3ZKMD 3VXMD 3W39A 3D0LA 4U2YA 2EDYA 5D2LE 3A6CL 3L1OL 4MDJA 2P4AB 4XMLH 4WFHD 2CLZB 2AK1L 3UZQA 2YD3A 2Y06L 5J12B 1BF2A 1CWVA 1NC2B 1TETH 1S9YA 4ERSH 4U6HB 3HE7C 4OCMC 1ZLVK 5E7BA 3WS3B 1D5BB 3QYCA 3OMZA 3SDDA 4RWHA 2EDOA 3NABH 4NHCH 2EKSB 4DGVL 4L4TD 1KIUA 3C6LC 1T83A 2DQUH 2KKQA 4KMQA 3C08H 4MAYD 2IGFL 4FXGB 3QHFL 5CIPH 4MQ7B 4F9PC 3CVHB 5GGRY 3QNYA 1I9JH 2EDTA 5BRZE 1C5CL 3QDJE 5I1CL 2IGFH 1XIWD 1E28A 2N4IA 3MA9H 1UYWL 5FYJL 5HGGS 3T77A 4OF8A 1A7PL 2GT9B 3CXHK 1P1ZA 4DGYH 1S7UB 2J4WL 3RWHB 4HEPG 2AABH 3B9KC 2DMCA 5A3IC 5CP7A 2PO6D 3P30H 2P48B 4XTRC 1H8SA 1GHFL 4PTTB 3JTTB 4RRPG 1H5BC 2NY3D 2GUOA 3TJHD 1H3PL 3MC0A 5ANME 5C0EA 1FVCB 5IJVB 4LOUC 2YZ1A 1JPST 3F7QA 3VXUA 4XMLL 1RHFA 4PJBB 5H37G 3O3AB 3QQ4A 3MRLB 3KJ4B 5C07B 2M2DA 5K59F 4WDIB 5EUOB 2UWEA 3O9WB 2PW2A 3OGOE 4HH9A 3RZWA 2CKBL 5DK0A 1LHZA 1SHMA 2VB5A 4GJTB 2A9NL 1J1OH 3SPVA 2ATKB 4PJ7B 2OK0L 4M6OL 4QT5B 3LRSB 2X4RB 4FFYL 5C08D 4JFXB 2DAVA 1KIRA 3D9AL 1I3GH 2BMKA 3WNLA 3C60B 1CLOH 4HX1B 4P2CG 2VLME 3U4EB 3FAWA 1GC1L 1WFTA 4ETYA 1H5BB 3UEZA 3ARBD 2NY5L 4P5KB 1OARL 4UT9L 4QOKB 5FKAA 3OKKA 4JG0H 5CEXB 4YE4H 2Q7YA 5AAWA 1U58B 4BUHA 3QZWG 4PRHD 5LWYH 5FV2A 3BP4B 3SKJH 4U1JB 5H94B 2EDNA 2WP3T 5TQ2H 3V4VH 3JBG7 5HSFA 5E8PB 3UJTH 4FQHB 1NMBH 4RGND 4XP1L 4F57L 4W68A 4PJ8B 3A6BH 5FGCE 4X9GA 4OLWL 4PRPA 4QTHB 5I30H 3T2QA 3IDUA 5J1AB 1KFAH 4QRQA 5ICZB 3EO9H 5DQ9A 1E4WH 1WAAF 1KF9B 2XZAL 2H2SC 1ODAA 4X5LA 2ZJSL 4DKDC 2CLRB 1FZOB 4DW2H 4PRPB 3U83A 3FT3B 4HQQH 4P46D 2F15A 4PJEE 1FYHB 3U36A 4X8XA 5LGKA 3MV9D 4NQCD 5HHPA 1UB6B 4K71C 2VZUA 5FM4A 2ZCLL 4R8WH 1BVZA 2HLAB 4E9LA 1OP9A 4IRSA 1HKLH 5F89A 3PE9A 1FN4A 2IFFL 4NM4H 4O2EA 5JTWA 5HVGB 3DV6A 4NO3B 2LAAA 3KPSD 3U82B 3BEWA 3L3IA 1JE6A 3UTTB 3UTOA 4JGJA 2QSTA 4P2RE 1UB5B 4JDTL 3G04B 5T3XE 4JO3H 1MI5A 1CXIA 1AHWA 1FYTA 1A4JB 1G6RA 2OCFD 4Y2DB 3OAZH 2X4RA 1JWUB 3G5YA 4Z7WE 1FIEA 3NFSL 1NBYA 3EDFA 4JKKA 1LD9B 3C2AL 1K6QH 2C3VA 5E94B 1KTRL 5FYKD 2R2EB 1V8HA 5HHQA 1IFHH 4XPTH 5GJTL 2GK0A 4I0KA 5JW3L 2ZCKL 3AAZB 2EC9U 5KS9F 2DKMA 4XAWL 2DLHA 5FCUH 3PJSA 1EJ6A 3QPQC 3DVFA 2AJ3B 2KBGA 5ALBH 5CJQL 4H20L 1LMKA 5C09B 5A16A 5I1HH 3BGAA 5T1KD 2XPGA 4UT6L 1QHPA 2XWJA 4IS6A 4TSBH 1A3QA 3O6FA 1AJ7L 1RZIB 2B4CH 4HBCH 1I1AD 2O5XL 2DQGH 1ULVA 2WUCH 4XNZC 1CGYA 4P23A 1YYLH 2BK8A 3LEYH 4FFVC 4PY8I 1BM3L 4JRXB 4U1KB 2FX7L 3R0NA 1XIWC 2X89D 4GAYA 1QLFB 3T0EB 2GT9A 1ZT7B 2PR4H 3FO1B 1UZ6E 3MV11 1EFQA 4JJ5B 1RK0A 5D7IE 4D9RE 1I7TA 1BD2A 3VRJB 2Y07L 1R5VA 5IB4A 2FIRT 4XNXL 5BV7H 3SJVB 5JIPA 4Z7WB 3QNYB 5IBLC 2XI9A 4F2MA 1BLNB 5ID1B 3ZTNH 3LDBB 4PREA 1T5XA 2ZNXA 4LDLB 5E95B 4Z5RB 5C0AE 3W2DL 1QSED 2H3NB 5EPMB 4RMRA 1MIMH 2WAHA 1D5MA 3FB7B 3PWJB 3HMXL 3TT1H 4NNPH 3FMGL 43C9A 2HWZH 3HC3H 2J5LB 3RVTD 2ZKHL 6FABH 4I18A 3VI4F 3OAYK 4J3WA 1LGVA 3QZWB 3TV3H 5F8QC 2DQEL 3VGBA 2OTWB 1KNOA 4RFNB 1X5YA 5FM5O 5LXGL 2RB8A 5FYJE 2W9EH 1FSKC 1FL6A 4UQ2B 4WGVB 4PBXA 3EHBC 3EYFB 4DOHB 3L9RA 2UY6A 4GFTB 3TPKA 4H26A 4J8RA 2A6JA 1NC2A 3O6LH 5FCUL 3F7VA 1DSFL 4G8GE 1CFNB 3CFBB 5SWZB 5LXGH 1I7ZB 5EORH 5JW4M 1RFDL 2LU7A 3HE6A 5IROC 5C0RH 1GGCL 4C4KT 5D7IA 5EUKA 2Z92B 3TA3A 4P5TA 1AR1C 3ILQC 1KNOB 2FHCA 1J8HE 2ADJB 5EO9B 1U8QA 3T0XA 4XCCL 2Z93A 3KDMB 3WJJA 4P5MA 1IAIM 2E27H 4PJDA 2HFTA 3RDTD 5HYIA 2B2XH 3CPLA 5F9OH 1ZTXL 2EDHA 4XWGL 1MCBA 5IEHA 3D2UD 1FGVL 4ISVA 4F7PB 2X1QA 1J0IA 3ZDXE 1U3JA 2EYSB 5E9DA 2PUQT 5J6GB 5EZIL 5E9DE 4H1LH 1NSNL 3SDAD 4DN4H 4WV1C 1HWHB 2SEBA 2FJFB 4WJ5A 3FN3A 3Q5YA 3VH8B 1KB5A 3DSNA 4F8TA 2EXWD 1HHKB 3C60C 4PJDF 3ZDZF 3IAPA 1CLZH 2QJDA 1X5KA 1OSZB 3G6JF 3MYJB 4GXUN 3QWOA 5KVGL 3FFCB 3L6FA 2D2OA 5HY9B 2ICEA 1CK0L 3QG7H 1JP5A 3L3JB 3U30C 4Z9KB 2HKFH 4DW2L 4H8WL 4G6JH 1G9MH 3L3GB 2UUDK 4OCWL 1F4XH 3F7YA 2AQ3A 4KUCD 4Y19E 4D3CL 3U6RB 1U8KB 4Y0GA 4R3SA 4PD4J 3LKOB 3IDYB 1PG7H 5JLZA 2DYPB 2BRRH 2EDWA 5FO8B 4ODVL 1KFAL 3FQRB 3DOSA 3MLRL 1FVEA 3BIKA 2YOCA 1TJHL 1EEQA 5JQ6H 4ZUUB 5HYJD 4UDUB 5BJTA 1UXSA 2OBGA 1K2DA 3NIFF 2QL1A 2R1YB 5JIHA 4MJ6A 3IU4H 2CJUL 1DLHA 3MBXH 3HLAB 2GK2A 2IWGA 5E2UH 3MV8B 4AMKL 3PABA 4EI5B 3ULUL 5B8CB 1K8IA 3D25A 1RIUL 3LHPH 4WFEE 2GHWB 4YIQA 3AXLB 3J7HA 4HHAB 4M93B 3EJYC 1EO8H 3U46A 4IRSC 1CLOL 1QPXA 1ZT1A 5EC1A 5SWSA 4OFKA 5C2BL 2CMRH 4U1IB 1NAMB 2H8PA 5SWSE 3WSQL 1CE1L 4QRRD 1FL5A 1XAUA 4V1DD 4P4KD 3TBYA 5DMGD 1ACZA 1UB5A 3W0WE 1N5YH 1UH3A 1T6WA 2Z8WC 1J1OL 3F58L 2AEIT 3CC5B 4LPTA 2Q76B 5DJ6B 2D03L 1FQ9C 4Z76A 1F11A 2IALA 4FZ8L 1EEYA 5I75B 2YRZA 4NN6B 3TO2B 5J13B 5EU6A 3CU7A 4MQXC 1J7VR 1VGKA 3P9LB 1PLGL 2G2RB 1PEWA 3UX9B 3UTQA 3MYJA 3QWOB 4KKBD 1NEZB 3ME0A 5D7LE 2WQRA 4B5EA 5KSBB 5C0IB 1ND0A 3QUYB 5D7LA 3M17B 3GBLA 2AAVA 4PJ7E 3ZKNC 5KG9B 1MJ8L 4FFVD 5B4MD 1QFUL 5CMAA 1HHIB 4XNQA 5M95B 4XP1H 3MGOA 3QAZC 4F57H 5FK9A 5HGAA 4P3CL 3LB6C 1NGWB 1AE6H 4AEHH 5EU3B 1A3LL 4GAGL 2Q6WB 3V5DA 5B4MC 3SE9L 3BN3B 4C83A 1I3UA 4X5XA 4N8VG 1HXYB 4HLJA 4U1JA 5H94A 1L7IH 2EYTA 4MVBD 4Z78B 1GOHA 1F4AA 4NNPL 4NQDE 5CD3B 1T83C 3C5ZA 2CDEB 1F2XK 2ZOLB 1PZUB 1KG0B 2AJVH 3UAJC 3JUZA 1RUMH 5TJWK 4KGJA 2GFBA 4NQEE 4XCYA 5DWUH 5KAQF 3TF7C 2KZ1B 1AR2A 1BD2D 3G9AB 4PJ7A 2ED7A 2RCSH 3N85L 3QNZA 1FV1A 2ED8A 4IOSD 1R24B 5HYSG 5FECB 3CZFA 4PJHE 1KLUA 5AD0B 4OIIH 3MUJA 5DWUL 1XFPA 3RVVD 3EZJB 1MF2L 5D7SH 1QFWH 43C9B 2EDDA 5MENB 2W38A 1O7VA 5GSRA 1TCRB 1K3IA 1DBKL 5KVDL 2F58H 1T7YA 1BREA 2X4PB 4DKFL 1NL0L 5EBMB 4O58H 1IAII 1G9MC 4LQFL 4L9LA 1XR9A 1YN6A 1A21A 4CGTA 4FABH 5JA9A 4XMKH 4F2MB 5AWNL 3TT3L 3AS2A 4XC3H 1CL7I 2H45A 1S7WA 4UBDD 2R1XA 5J06A 2VXUH 4EDWL 4ZUTB 3HRZB 1MCOH 5JW5B 5DRNB 1TXKA 2Z4QB 2DLEA 3OKMA 1XCTB 3NCJL 1IQDA 1KJVA 3OXSA 1EO8L 3GSQA 5D1XA 2J8UA 1MJ8H 2F8XC 3E3QE 3GNML 3GMNB 4ZOCA 1QLEL 4D8PB 1J05A 4RGNC 4ONFL 4CNIB 3VFSA 4NO5B 3MLTB 3GNMH 1L9MA 1IEAB 4KGLA 2XTJC 2EDQA 3GSRB 1BOYA 4YR6B 4DTGH 5DVOA 2IH1A 4OF5A 4GRMA 1SQ2N 1A7OL 1FG2B 1YN6B 3NCJH 4JFQA 3P9MA 4RMQA 4LGPB 3N1QC 3IS1X 5F1IA 1AGCA 3PGDA 5JHLL 4RMSA 2DICA 3STLB 1IKFH 3TEUA 1XF2A 5ANMA 3BQUA 5HDLA 4RMTA 1FCCA 4OD2A 4MNQD 2LQRA 4KI5F 1FAKT 3U7WH 4Y4FD 2YD2A 1I7RA 2ZZUT 1WCBA 3FKUS 3K4ZA 3K8LA 1JHLH 1CU4L 5T1MB 5F9JB 2ATPB 5F96H 1UQSB 3QQ3B 4KK6C 3FB5A 5IVXE 5T3ZH 2PKDA 1AQKH 4HT1H 3WFEH 2XRAH 3ARVA 2IC2A 1J0ZA 4KKLD 5I30L 3C6LD 4OAWA 2OR9L 4JAMA 5HDOA 3MOBH 1QSVA 4KQ4L 1MHEB 4ZO8A 2OJZH 1U93A 3EIFA 4I4WB 2P46B 3OAUH 4JFHD 3PWPA 2HT4C 3PNWB 3WXVL 5L0QC 1FRGL 2D31B 2YZ8A 1YEGH 3FT4B 4M1GH 4HKBB 5IBUB 1QBLH 3ALPA 3P73B 4APQC 1IGYB 1QLEH 3I6KA 4WHTA 2CLRA 1DDHA 5IEKA 1DVFD 1JZ3A 5SWQA 2FO4A 1WZLA 4NZRL 3DXAA 4E42A 2AJYL 1CDJA 5FUCE 3GB7A 1G9NL 1X4ZA 3LPGA 1HEZB 5T5FL 4AEEA 32C2B 4HMCA 1DBAH 1FFPA 2VDQL 3FB8A 3PHSA 3P40A 3I6KB 1IKNA 1NCAL 5IW3A 1FCGA 3QXAB 2V7HA 3H9HB 4FQIH 4U1SA 3BPNC 1Z9MA 1GPOL 2C9AA 3ZT6A 5ITFA 4ODUA 4FQQB 1OTSC 1WCQA 3LZFL 4J3VA 5FA4A 4M7JH 5HYSA 1RK1A 5C0FB 2W60A 4EN3B 4K2UL 1CTOA 1RJYB 3UZEA 2BNUA 3L3DA 1MCFA 2D3VA 2DIJA 1UKQA 2VUYA 4JFYB 3VXMA 1MFBH 5DJAB 4F15C 3HNSL 2GITB 4CJ0A 4XT1C 2DJUA 1FYTD 1ADQH 5D6DA 2V2WA 1CBVH 4TVPH 4L29B 4JKLA 1FFRA 4H0GA 3AREB 3MV8D 3LRSA 4FZEL 1RUPH 3C5ZD 4EQ3A 1MCSA 5T1LD 1WF5A 4WWID 1RJLA 2NCMA 3L5XH 2NYYD 3FZUC 3LKQB 1ZLSH 1RJCA 2NY3C 1OP5H 2HT4D 2VKXA 4RAUB 4QHLB 5GQBA 3QDHA 4ODTL 3JUYA 4HS6A 3HI5L 4UUJA 5AZEH 4WV1A 4YJZL 4JLRB 1XF2B 2VWEC 3F12A 3WLWC 2VZSA 3KXFB 5CHNA 5C07A 1PZ5A 12E8L 3B6SB 3HLAA 4Z6AT 5JMRA 1YEHH 4X0KA 5EG6C 1RZKL 1S7SB 4R97B 2H9GB 3MJ8A 2EDKA 2BNQE 3SE8H 3IJSA 1ZVYA 4FN0A 5L2JB 1MCWM 2XZCL 3PL6A 4ODSH 4OZGE 5ACZA 3QG6A 5ABDE 4P4RA 1FBIL 5I15H 3MXWL 1H8NA 5LAXA 1MCCA 4R4BB 3Q5TA 4R3SB 3OKDA 3H9SB 5DJZA 4OLVH 3NTCH 4JPIB 3EOTL 3FQUB 2ADFH 4NJ9L 2A77L 1D9KB 2I5YH 5CEZE 3PHQA 3T77B 4FS0A 3ULVD 1MQKH 5I1AA 4EBQH 5IIEB 2OSLB 2BRRL 1MCRA 5HVHB 4N0UA 4HF5H 4YHYB 3MPCA 3WFBL 1CBVL 4OQ1A 3LEYL 1T7WA 5CJXC 25C8H 1LO0L 4MXQC 5FF6A 2HJFA 3LEVH 2D0FA 4BKLA 4NRXA 4EBQL 4K23H 4RISL 5E2WH 2UZXB 1BJ1H 5T1LA 1KIQB 1JNHB 1H3VA 2DBJA 4LEXH 4PJGF 3PDOA 1M6OA 5F6IB 1FC1A 1MCJA 2I60L 4IIQA 3WD5H 2RQ8A 1M7DB 3DMMD 5JW3H 2W9DL 4OTXH 2HJKA 4NRYA 1JWSA 2A73B 3W81A 4PP2B 1JPSL 1U3ZA 3HS0A 4U3XA 4WW1A 4L8SB 4PP1C 3ULSA 1QO3A 1D5ZA 4JPVH 1A14H 3MLUH 1SY6A 1C8PA 2ZCHL 3LEXB 5D1ZB 5ICXA 4X6EA 2BVPB 4XNUH 4YHPA 4HPOL 1S7VA 4OKVB 4G8FB 3EHBD 3R1GL 5DS8B 3KLAB 2DDQH 1WFUA 2AV7B 1VFBB 2FHFA 2XKNA 3PL6D 3IXTA 5DURB 5BXFA 3V5HB 2GIYA 1LVEA 3GSVA 4LHJB 1RU9L 3G6JA 4NRXB 3MNVB 4NFCA 4I0CC 4AL8L 3PV6B 4ONGL 1A1OB 3HN3A 2M1KA 5EO1A 3QUXD 1WBXB 5DJXA 3UJTL 2PNDA 2VH5H 1TZGH 3RIAF 2NY2B 2PR4L 5E5MB 3KYNB 2HT3C 1A0QL 3CU1A 2ZPKL 1SEQH 4W6XB 3VRJA 2F5BL 2P8MA 3NMEA 2WLYA 4KI5E 1RK0B 4Y19A 4UIMB 4JJ5A 4M9OA 1KCRL 1G7JA 1CFTA 5EH1A 2FGWH 4MAUH 4Z8FH 4RFOH 4HIEA 1A6WL 4Y4KB 5IVZB 3BP6B 3V0VA 4A6YA 1G0DA 1MJ7L 3H9SA 3CK0H 4GLRH 1TPXC 4JY6B 5ALBL 2VDNH 3D39E 5H2BA 4KTEL 2E8YA 4BK4A 4U1GB 2OTUA 4RFEA 5JXED 5K9KB 2EIBA 2Y5EA 1F3JA 3VXTB 1OGAA 3K2UL 1BGXL 5T5FH 3V8CA 3BEVA 1UG9A 1XF3A 3B6SA 2X4UA 1EEZA 3ARRA 2BFVH 3VMOA 3VXNB 4U0QB 4HKJA 5T3ZE 1TNNA 3CH1A 4U05A 4OCXH 1FORL 5DHVH 1NLDH 4R4FH 4TOYL 3D2UA 2P8PB 4FXKB 1RJLB 1U41A 3MV8A 4JM2A 2E9WA 4X9FA 1G7HA 3FL7A 4MMZC 3LH2L 5HHXL 5IJKC 4MXWL 4HLZH 1FNFA 3V6OC 2WV3A 3BESR 3E6FB 1JGDB 3H42H 1YPZA 1UM6L 2BJMH 2P5EE 3G08A 2GITA 3EBAA 1QG3A 3VXMB 1HHJA 2OTUB 4PRID 5J7CC 2CDGA 1B6UA 1BFTA 4JFOA 2VAAA 3FQXA 2C1PA 3HMXH 1JI1A 1NGQH 2Y1VA 3BH9B 5C0BD 4I3SL 4AM0A 2NW3A 1P5UA 2LVEA 4MJ5B 4WENB 3NPSC 4HWBL 1A3RL 1GL4B 3FZUD 3GI9L 3O45B 4ZTOL 1MF2H 1D6EA 5D7SL 2B20A 5BV7L 3TVMA 4U1SB 3U7AA 2AV1B 1UGNA 3OG4B 2R0KL 4HW6A 2CKNA 5D6DC 3RGVB 2F9BT 1KPVB 32C2A 4K9EC 3QDGD 2ZSWB 3O2WL 1A7RH 2IG2L 4WUKL 3SOBL 2NY0C 1Q9OA 4JFPB 5ENWB 4YBQC 1P4LA 4E42B 4XRCA 4J3UA 4LHQB 5JXAL 2JJTA 3S36L 4FMKA 5SX4H 2D0HA 5E1AA 3WFDH 1HHGA 3C5JA 4QY8A 5GRJL 1DQDH 5I8CA 2XY1A 1UYWH 4KHTL 5FYJH 4BFBD 3DJ9A 4L4VE 1BQHG 5TDPA 3PWPD 2AJYH 4LF3A 4LKCA 5BXFB 4O5LL 4BH7A 5DI8B 1NDMA 5DT1H 1HSBA 4JRWA 3GSXA 2BVPA 4YHPB 1BQHA 3QWRD 3N1GC 3GMOB 1N0LA 4LSTL 4AEIL 1VDGA 1YQ2A 4HFUH 5MEOB 5DK2B 2UZYB 4QRRE 4B41A 4PLNC 3A6BL 2W65A 3NFPB 5FGRA 1JF6A 3MTRA 4X6CB 4ZSOE 4N5UA 3EYQC 4J8RB 3P0YL 1R3LA 2JTDA 1QR1B 1A6ZB 5I1EH 1RUKL 6CGTA 5DZOA 4LNRB 4AIOA 5DMIH 5D93C 3CDYA 1IMHC 1QOKA 2ERJC 1Q94A 4PJ9B 1DBKH 3F6LA 5FEBA 4QKXB 1KN2L 2GQHA 5INCB 3VFPA 1T3FA 4MS8D 4WW2F 4TULL 1NEZG 4RBPH 3OBAA 3RU8L 3S7GA 3CXHJ 1KLGB 4K9EL 5HYJE 1VFAA 5HYJA 1HNFA 2Y7QB 4QGYA 2MKLC 2VXUL 4Z7WA 4PJHA 5DD3H 1LEGA 3T3PE 4YPGB 1OGTA 1F3DH 2R2CA 5IFHL 3RKPA 5KZCB 4G9FE 3INUL 1RJZA 2BDNL 3EOYG 1OVZA 4M7ZB 4PTTA 3C09B 4Y5YC 3CMOL 4NKIL 3RWDA 5AAMA 1ZAGA 2DF3A 2OMNA 4UOW0 5I76A 3RBGA 3WXWL 3AC0A 1V3KA 4HCRA 2BC4B 5JDJA 2F74A 4V1DA 3ETBF 3FHAA 4XCFH 1AD9A 2X44D 3NABL 3VRIB 3O2DH 5CCKL 3TBWB 3LQAC 1NCBH 1Z6JT 2RGSA 1VB9A 1KJ3H 4GLRI 4NQCB 5M94B 1TCRA 2IBGA 1U95B 4Q0XH 2DQJL 1ZWIB 1FZMB 2W07A 3CSYB 3H9YA 3KYOA 4QWWD 3RVWC 1NCTA 4MXQD 5JHDD 4E0RA 4UNUA 4WU5A 3SGJA 3PF2A 5FECA 3NCYS 1IJ9A 2IPKB 3QEHB 4LCWD 1ZT4B 3NCCB 3U1SH 1I3GL 1NL0H 3VG0L 3VFOB 2AS5M 4MA7L 1QEWB 4Y1AB 3TJHC 4LSPL 5BVJA 1RURH 2E7LA 2EE9A 5TDNA 2EKJA 4JFED 3IDJA 3IDNA 4PJ5A 1JMXA 1J8HB 3QNXA 4HIHA 3HI1B 3S98A 3KPTA 1R3JB 3C6SB 1FO0H 2VMFA 1LEIA 5C8JB 3QHZH 5DD1H 1V7NH 2IPUG 4MJ5A 2QQNH 2BX5A 2HLFC 1D5IH 4YDLC 1SM3H 4GRWE 4ONHA 4HKXA 1QSEE 5I1GH 4NJAL 5C0AD 3MUHL 4LLMA 3PQYD 1L6XA 2DD8L 4U1NB 2DLTA 5JPMB 3A0OA 1R3IH 2Z31B 1IEHA 4X6FB 5GGRB 3FB8B 1KSRA 3OKYA 3QUYD 1P84K 3IJHB 4ZUSB 1EX0A 1G7HB 4KKAC 1JJUA 1J18A 4OBSA 4UI2A 3SDDC 3TCLA 3M17A 3EFFB 3EO0B 3EDDA 4LPWA 5D7LB 2VN7A 4P9MH 4M62L 1INEL 4X6FA 4MJ4A 3OX8A 4A2LA 2VXSH 1N3NB 4DJMA 3NIDE 4UBDC 1PY9A 4PRNB 4NO2A 3DV4B 1B88A 1ZS8B 1JZ2A 2ZG1A 5FFLA 2VE6A 4OIBA 5FUOH 1F6FB 4DZ8B 3QPQD 2FR4B 5E6IB 1NPUA 2GJZB 5H35A 2PYFB 5DK3A 5K9OB 15C8L 2IBZX 3GGWB 3V6OE 4I77L 1Z0NA 4JRXD 5JR1H 1T4KB 3KPQB 5I2IB 3MRDA 1Z9SA 2ORBL 4HH8A 1LNUA 1NFDE 4RCAA 1G6RH 1A6AA 2ESVE 1JPTL 2FECL 2R4SL 3UYRL 1NKRA 2R29L 5E2TH 4DZ8A 4U1IA 4AQOA 4DKEH 2JK5A 1T2QL 1U8LB 4WVRA 1GGIL 4MQXD 1OM3H 4XI5D 3V4PH 4JZJA 5FDWA 1TETL 1A3RH 5HPMA 4HKJB 5SV3A 3CSYA 4KPHH 3LCYA 1P53A 4P48A 2VDLL 4WI3A 4H8WH 2VLJA 3PQYB 4TN9A 5K59E 3MRCB 1FO0B 1BX2A 4F7CA 5FA3B 2B4CL 1F3JB 5FHAH 1AD9B 2A74B 1S9KC 2FATH 4QYOA 3QCTH 5I18L 4LPCA 5I6XC 2A6DA 4NKQB 5A1AA 1P6AB 1JZ7A 2RR3A 1IZKA 3MGAA 1UVQA 2PF6A 4LVOB 2EDEA 4LCCB 3S35H 1JYWA 4JO1L 4G3YH 2RIKA 3WFHB 4LPXA 5GHWH 3W9DA 3BHBB 3SDAB 3C2AH 1QLRB 5TH2A 2J12B 5IFJA 3DUSA 1M7IA 3U0TB 1DE4B 5FYLE 4MB3A 4JO1H 4MQ7A 3QUMH 4HUUB 3L3OB 3CXDL 3PG2A 1DQJA 4PYHA 5DJCB 3C8HA 3N0PB 1NFDF 2VXQH 3QQ9C 1KTDA 1MFCH 4PUBL 4NZTH 2X4QA 1YNTA 1VADA 4OF0A 1ZE3C 5DVKA 2AJXL 2IAMA 2ZUTA 1JNJA 3MRQA 3MBEC 2YSSA 3RVUC 5DDHA 3CFJA 1JRHI 3L3OA 4UILH 3OJVC 3D85B 3WHXA 1JGEA 5DD6B 4WHCA 4XBEH 2V17L 3MGTA 4FQXA 4X7TA 4AIZA 2I07A 2VDLH 2BC4A 1UJ3B 1RIUH 2R9HC 5DMKB 2Q3ZA 1Z3GL 2W65B 5I1KH 5E03A 3AMKA 3D69A 1UXWA 3EYFA 4Z0BL 1D9KA 1JGEB 5DD6A 4WWKC 1KXQE 1QBBA 1J1PH 4ELMB 4O51A 4EUPA 2BNQA 4JO2L 3KPMB 5T33H 4JJHA 1A7QL 4LLDB 1Q9WB 2BP3A 4ZFOA 3MOAH 4MXVF 5KAQG 2AXGA 3I75B 4ODVH 5KSUA 3RZCA 1NGZB 3STZA 5IB5A 2O5YH 1X5XA 4GKNA 4UV4L 3UO1L 5JR1L 1P7HL 2YD9A 1N6QL 3QI9B 5FV1L 4OD1L 4NRZA 2A0LC 4X4ME 4IIQC 5DEFA 2Q86B 5FUOL 2AKRA 3U0PB 3EYVB 5T5NG 2W9DH 3FO1A 3B3IB 2AP2A 2JELH 5I1JL 1KJ2H 1TQBB 2ILLA 5AG9A 1INEH 3D39A 3NGBC 3LKQA 5GRUL 2DRUA 3BXNB 3S3PA 4ONOA 2P45B 4N68A 4S0TD 1OAQL 3GMRA 1N7ML 5DHXB 5ADPL 1RIHH 1NCWL 3PL6B 2VLLA 4QXGH 2ICCA 3NFSH 1U3HB 1Q1JH 2XNAB 1F90L 1S7SA 3W11D 1YEKH 1LE9B 3SN6N 1A2YA 4JHZA 4H8WC 3GKZA 4N8CH 5F7HA 5HGDA 1RIHL 1FL3B 3NIDF 4L4TE 5C09D 3KNBA 4LPYA 2DQCL 1KCUL 1YPZF 2MPAL 3UJJL 1N7MH 4G7YL 1HYSC 2HP4A 3G5VB 1LE5A 4NJ9H 2I5YL 3B9VA 2I24N 3HG1A 2A6KA 4IBLT 5I17B 4K7PY 1RZFL 4KJPD 4D0BB 1KV3A 4YHMH 2B0SL 1Q9OB 2DOCA 4HUKB 3A6OA 2CSPA 3MQIA 4AK1A 1NGYB 4GQ9L 5ETUA 4IEFB 5SWQB 1DQML 4G8IA 1EBPA 2ZUVA 4NCC2 3NACL 5I2IA 2FEEL 3KLHD 3P4NB 5B3JE 3BE1L 3QO1A 2OQJB 3JV0A 3U2SB 3QT2A 5IMMB 2F5AL 2QSQA 5CD5D 1CXFA 5CD5C 1SJHB 1HI6B 1QBLL 2HT3D 4I5BA 1HH9A 4LPVA 2JCCA 2OXHA 4FQQA 3VDBA 1T20A 1C16B 1WEJL 5IVXF 2Q7NA 5ESAB 4L5FL 3HI1A 3BT2L 4MVBC 3VXQA 1LK2A 1G7JB 5I71C 1YNKH 1QFUH 1OQXA 2PYEA 1U42A 1HQRB 3FTGA 2A6IA 1DUYA 2R8SL 3X11A 3PDGA 5CJ8A 3WXWH 5HXMA 5IQ7L 1QBMH 4LGSB 5F7FA 2A0LD 1VHPA 4NJAH 4GMSL 5HTSA 4TTDD 5HHME 5GGQH 5I8EA 3WUWA 3DUUA 1WC7A 4EI5D 3UZVB 1MCEA 1KPUB 2MQ0A 2WK2A 2X4UB 5I8KH 3BDXA 4U6XA 1F8TH 1I1YA 3LOWA 4KKBC 5CSZA 1D3CA 4XPHH 2D03H 1EO5A 5HGDB 2FB4L 2XA8L 2DI9A 1BOGA 1SYSB 4KRPD 3T8XA 4P5TB 4PY7B 1BBDH 2DM3A 3QJHB 3NOIA 3QNXB 2CRZA 3DX7B 4CNIA 2DM7A 2D4FA 1DZBA 4QLRA 3U4BL 1S7TA 4N5ED 5ADOH 5LWYL 3I2CL 3J8F7 4H26B 3DX6A 3V6BR 2V2TA 3BP6A 1FNAA 3BI9X 1FZJA 1LWRA 2R15A 2DQUL 3CSGA 1CFTB 2XOTA 4HH9B 3S35L 5EUOA 4YEEA 2OJZL 2FWOA 2D0GA 3OAUL 4RX4D 1Q0XL 3IJYA 4NUGH 2H2PC 5F7EL 3SDXE 1NCDL 3GIZH 3SDCD 1TDQA 4DFHA 4JFEE 3E3QC 5EO1B 2J8HA 3OB8A 4U3CA 3EOBB 3LKNA 2OSLA 3DYPA 1DQLH 2VLRB 4I0PB 4ZAKC 3JTTA 3GO1H 4R4ND 3GSQB 3O4LB 5AD0A 1R5WB 4LCWE 4HFWB 2NY2D 4PRPE 4E41B 4XWOC 4XAKE 1Q9KB 2G5BA 4G5ZL 1HN1A 1QNZL 1VGEH 4EIZC 4LRIC 1C1EL 5ISZA 5KTEL 4Q2ZA 1X6LA 1UJ3A 5JOEA 2EC9T 5DO2D 3DRTA 1ZLVH 3NCYP 3VW3H 3CUPB 2J88L 1MEXH 2Z8VC 3GMOA 4G7YH 4XX1E 2H9GA 1IC7H 5CAYB 2A9ML 4AZ8A 4ZUVB 4PJGA 4Q58C 4PJAB 2B5IC 3I6LE 2VISB 5E00B 4LBEB 2IAMB 5MI0B 1E4XI 4HZLB 1HXYA 4JRYD 1MPAL 1YEJL 2F53E 4ENED 4KK5D 5F1SA 4H5SA 3VXOB 1MJUL 4HIXH 4Y2OA 3DWTA 1WITA 2GJ6D 4QY8B 5GS1B 4TSCL 3S4SB 4YBQD 2BJML 5I8OL 4KK9D 3SO3B 4K7PL 4OZFB 4X6CE 1FYTB 5KANG 3RWGB 4NBYB 4YFDB 5F7WC 1IC1A 1KPVA 1S7XA 2LV4A 4HUWA 5TDOA 3PP3H 5GZND 5DTFA 3EYSL 4LMQE 4OZ4A 3WUZA 2CKBB 4GRWF 4IMLB 2XT1B 1CXEA 1MVUB 5HI4C 3BPOB 2QQKH 3V0WL 1LP9F 2QQLL 1AC6A 3TN0B 35C8L 2AJSH 2YKLL 4WI8A 1NFDB 3FN9A 1YNLL 2YEZA 5EZJB 3UO1H 2GY5A 3M45A 2R4RL 2EH8H 2BY0A 3QUZA 3GRWL 5CSGA 1KELL 3GRWA 5HI5D 3GJEA 2J6EH 4PRBB 1U8JB 1DFBL 2G60H 3QEQD 4J3TA 3GJFA 2V5TA 4ZS7L 5KSVB 1JNLL 4GW5A 2C7UA 2VQ1B 2PO6C 2E6QA 3EGSB 2DN7A 3UTZA 3OR6B 5I8KL 4CRPA 2VDKL 2FDBP 5L6YH 4GRLC 4JKMA 1EPFA 4RAUA 3TVMC 1U2HA 2GJ6E 4M8VA 3SO3C 3ZDXF 2OL3L 4FQHA 1FNEA 4LCWA 1U8PB 1J5OH 5J6HA 2E5EA 3IDXH 4JCLA 4O9HL 4FFZL 4L4VD 1EFXB 2Q1EA 4X6DF 1NBZB 4HAGA 5FM5M 5HGBA 1DL7H 3ARGC 1F11B 2IALB 5FYLH 3MV9A 4UB0L 4Z76B 4ZFZA 4CU7A 1SYVA 2MQ3A 5D7JB 4HULB 1IAIH 1VPOL 5CJQH 2IF7A 2QR0A 2APWA 3ARTA 2P47B 3EYOA 4O2CA 5DJ8B 1X6NA 2AXFA 4KY1H 5C0FA 1BFOA 3BMVA 1EFXA 2R0LH 1QSFE 3DURB 3MLSH 1RZ7L 2YRPA 3FCTA 2B4CC 2ICWB 1WLHA 3RZCC 1WCBB 1CDIA 5EOTB 4ODUB 2ATKA 2XXMB 1BWWA 4PRPD 1QA9B 2XN9A 1UA6L 2FLBT 3VGAB 4H1LA 3WNMA 1FHGA 1UWGH 1F90H 4QHUB 3T09A 4QRPE 1FFPB 3O6MH 2EIEA 1PX3A 3JWDH 1YN7B 1C7TA 4EI5A 1XGQB 1U8MA 1CK0H 1OLZA 3QG7L 4I2XE 4QWWC 2P5WA 3RVWD 3LKRB 2W0FB 1BBDL 4XMPH 4NRZB 4ZPVA 4ZAKB 3GUTB 1FNSH 1ZLUH 3BN9D 2K1MA 1H9VA 2DKSA 4ACPA 3OXRA 1CFBA 3MRJA 2N1KA 3QEQA 5EZIH 4WU7B 4LPUA 4P9HL 1KCVH 2PXYA 1YECH 2GUOB 5FCSH 1QKZH 2COQA 5CS7A 2HAZA 3RVXC 3HA0A 3KLAA 5EO9A 1JZ5A 3S5LG 5CILL 1VKXB 2V7NA 4M3KB 2F5BH 2ICEB 3GHEL 5DRZB 3HE6C 5DRNA 3WFBH 4JRYB 4G42A 3WIHL 4HJGA 2ZSVA 3PGCB 1U91A 1T1ZB 1I9RL 5IHUL 3CDGB 1KB5B 4OCYL 5K9JH 2EDXA 4C56E 4XNMA 2ARWA 1T1YA 4YHOL 5IMOA 4RX4A 3SHSA 3S4SA 4NGHL 4KUCF 1XR9B 4FXGA 1LP9B 4NCDA 5BZWB 3MUGA 3MXVL 5JQ6L 1JNHA 3QP3A 1MFDH 5T1LB 4H1LG 4TNVF 1JTOA 1KEGL 4MNQB 1RZGA 3IDGB 2H32B 3FB7A 2YXMA 5DQJA 3FOLB 4LBEA 3CX2A 4QRTA 4K3DL 3NAAL 4M6NL 2QEJA 1D5BA 2YD6A 1KJMB 4DQOH 2APFA 1T1WA 2ESVB 5IW6A 3SJVA 4L8SA 1KENL 1UZ8A 3ARUA 4CDHA 4D9LL 5DJDB 4LKXB 5ISZB 4M6OH 1DN2A 2VR5A 4IDLA 5JHDB 2FHBA 1T1ZA 2P7TA 2OYPA 1M05B 5IB1B 4LSSL 3HZMB 4M62H 3ZE0E 2CR6A 3MOAL 5F70A 4ZYKB 4PJ5D 3HHRB 3DARA 1KTLA 3L5HA 4JN2A 3MRPA 1IEBB 4G8GA 2J6EL 1OWRM 5GZNC 1GGBL 4GO6B 4WTZG 4NKDB 1F3DJ 1TITA 1W8NA 5LCVL 1J12A 3VXUD 4EUPH 5EN2A 2BSRA 3ET9F 1ITCA 1I9IL 3KPRA 3KYMA 3MREA 4QXGL 3AMLA 4HPYH 5BMFL 5D96C 1OGAE 2FIKA 5D70H 3IRZA 4X8JB 4W4OC 2X4PA 5IB4B 3LQMA 4M8QA 5F44A 1G7MB 2DQIL 1VFUA 2PO6A 3Q48A 1PSKL 4MD0A 1ZT7A 5L2KA 2HFEA 1MFCL 1X5IA 1A6VL 1FFOA 2C3VB 3CLEH 5HPOA 2E7MA 5AZ2H 1UENA 3IDIA 5FYLL 4TOYH 5J3HD 4CN1A 3VDCA 5EOTA 2Y5TB 4JM2D 2VQUA 2DKUA 4OM0H 4GG6E 4YDIH 3DBXB 2HWZL 2QADC 3UJIH 4OI8A 3FQNB 1IZJA 1OAXH 5C09E 3UDWC 5J9PA 3U79A 1LO2L 5CWSA 3PGFL 4P2YA 1Q9LA 4FTVA 3TBVB 5FUZL 2KZWA 4S1SH 5DHYA 3QSKB 4UTBL 4Q9RL 4P4KA 3SCMD 3CFCL 1U92A 4XCNB 1U3HC 2EC8A 2OLDA 3KPOA 4PRAA 1FZKB 4LF3B 3MV7B 2VABB 1CE6B 3C87A 4EI6A 4PRHE 1B0GB 5JO5B 3FFDB 4WUUD 1MLBA 2VR4A 1YJDH 4NDMB 2DI7A 2FX7H 2V7HB 4M7LL 4C58B 3GHEH 3JSSA 2WIIA 3T3PF 4FFZH 4MHHI 4NO0D 4YDKH 3ZKXC 1IAKA 1IGJB 5J1SC 5BOZG 1DLHB 1JHLL 5KSVA 1WK0A 4K8RH 3IJHA 5C08E 5DZLA 1ORSB 4ZUSA 1K2DB 4D0CB 3ZL4H 4LHUA 2DMKA 1MNUL 5DC0A 2IADA 4DUWA 1FP5A 1A4KB 5EU6B 1I9EA 1C16A 1YEIL 1RJYA 1JWMB 4ONHB 5IG7A 1YEDB 4N5EC 3EDEA 3DVNA 5F9DC 2FJGB 3EDJA 4YXKH 2K7QA 2JJSC 4HS8H 3ZKND 4NSKB 3RWIB 3H9HA 3T4AA 1FZOA 1T80A 4YFEA 5L88H 1FL5B 1V3LA 5I73C 2AJSL 1YYMH 1DBBL 2PXYC 2NXYB 3ARQA 3BZEA 4TUJA 4XZUA 2AI0L 2FO4B 1NUGA 4S11A 1HHHA 2BSED 4WI2A 3S5LA 1RZKC 4KV5F 2EYSA 2A6KB 2FEDD 3HG1B 1T2XA 5GS0H 4WU5B 1K8IB 2IANA 4H5SB 4FRWA 2UWEE 2IANE 5BRZA 3PABB 3CPLB 3VWJC 4OFPA 1DL7L 4GKSA 3PGDB 3QDJD 4NP4H 2X70A 3E0GA 3GSOB 5C0JA 2F8VA 4NT6B 3RUGE 5CEXA 1FG2A 4FABL 5GRWA 3TA3B 3NIFE 3VWJD 5IKCA 1MELA 3ALWA 5EUKB 5K9KA 4I0PD 2AJUH 1TZHB 2FGZA 3SDCB 3DRTB 3HMWL 4YC2C 3BJLA 5C0EB 4BYHA 5IFHH 5T1MA 2HT2C 4QHNB 2NY4B 3X3GH 2R0ZL 1BVLB 4L3ED 4M7LH 5KW9L 4X7EC 1KJ3L 4N8VA 3VXRB 1N5AB 4P0DA 1TJGH 5EU6D 1J0HA 4Z7VE 5TE7H 5HDQH 1W0VA 3BQUB 4WDIA 1RZJH 3V4VL 1EH9A 3U7YH 1UACL 4MZ2A 1OTUD 5DVLA 2FJFA 4KRMB 1CFSB 3TIEA 1YNLH 2FBJL 4WEBL 1P4BH 3VWKD 1KJ2A 4QGTA 3LS5L 5GGTA 3L95A 5ERWB 2G9HA 4P2OC 1I1AB 5L88L 4L9LB 3TNMA 1WBXA 4IRJC 1K85A 1CDHA 2PYEE 5MP6H 1CFSA 3TIEB 1T3FB 2FECI 1BQLL 1AQDB 4YDIL 4N0FA 5D96B 3VGGA 12E8H 4GQPH 4WGWB 1P4IL 1F5WA 3MLZH 4WEBH 1TVHA 4IRJA 2GAZB 3P9WB 4ELMA 2ICES 3MRPB 5ICXB 1INQA 1RZFH 1UZ6F 1XEDA 4XTRD 3HE7A 4P23B 1D5ZB 3SE4A 3DPBA 3QDMB 4TUOB 1N64L 3MJ9L 1XF1A 1R0AH 4PB9L 2H26A 4GKOA 3JV6B 3LY6A 3S8WA 5EIVA 3TC9A 1OAKH 3WHXB 2EEDA 3LPWA 4HIJA 4K07A 4YDKL 1CD8A 2FO1A 1QFWL 3ULUD 3VI4E 3MJ9H 1K4DA 5TE4L 3REVA 4F7EB 1X5AA 3O3DB 1NKOA 3UMTA 5FF6B 4L3EA 4HJ0D 4B53A 5CEYB 4AH2A 3C5JB 4L4TB 4K3EL 5IR1B 4LLWB 2FL5A 5CP3A 4GAJH 1E6JH 3RUGA 4TVPE 4OV6F 2YR3A 3CH8A 3MLYL 1N0XH 4ZNCD 5IFJB 3PGFH 5MERA 2YMXL 5JZ7C 4NKOA 1DUYB 2CPCA 1P7KA 3GKWH 1BBJA 3PIQA 5B39B 1E0OB 3T4AB 1PEZA 1MSPA 2Y9RT 1U8NB 5I0DA 3NA4A 4HBQA 3SO5A 1CN4A 4LCCA 3VE0B 1VKXA 4JFEA 4RRPA 1X7QA 3H42L 3VXSA 2CUHA 4OGYL 2V5MA 1YNKL 2NW3B 4LVNC 1EZVX 1NCBL 4DGVH 1UH4A 4Z0XA 1CR9L 3VA6A 3K7UA 4CUCA 3FQXB 2VAAB 2XFXB 4WUKH 5DJ6A 5GS0C 1CT8B 3UTSA 1ETZA 4O02H 3TP4A 1NGWA 2NXZC 3OR7B 1BD2E 3D0VA 5DUPL 5SX5K 2X42A 4ZAKA 4JM4H 2DDQL 4OCYH 5K9JL 4M3JA 5JXEC 4NQED 4QHMA 4XVJH 5SWSB 2ITCA 4Z7UF 1YQVH 2JF1A 1U8IA 2WBJA 4BSWA 1A8JH 2P8PA 5E08H 1G9ML 1ZHNA 3PUCA 1NEZA 4OF6A 4X6DE 3DETC 3MRHB 1IILE 1XGUA 4YZFE 3ARSA 4GXUM 5E8PA 5EIQA 5L9DL 4I18C 3E1F1 1FZKA 5FYJU 4IDJH 2XN9E 2CRMA 1NCDH 3GIZL 2AXFB 1A6AB 3T1FA 3KXFD 2XNAA 3QXWA 4JZNB 4NZTL 5FOBA 2AEPL 4MAUL 4Z8FL 3HFMH 1A7OH 3U4EA 1OP3K 3CX5J 1F3RB 1QSZA 2PW1A 4C56B 3UTSE 3FQNA 3VXRE 1ZT1B 1AKJD 3I84A 3U46B 4F33A 2ZPKH 4PJCF 3ARGB 2W0KA 4KK8C 4ZXBA 3ZYJA 1KCSL 2VH5L 5GHWL 1EBAA 3LV3B 3CFDA 3MMEA 3MBED 4QRRB 1HHKA 4U6YB 3EGSA 4G9FD 3TH3T 1A7QH 2C3HA 4KXZI 4KAQL 4KJYB 1DEDA 1BMGA 2E7BA 5DEFB 5CIPB 2OZ4H 1I8IA 4GKNB 4PJCA 3R8QA 2VDML 3RTQB 4XPFH 1DP0A 4KJWD 2ENYA 3FT4A 4K8RL 1I1FB 3BN9C 3KPNB 1KACB 3Q1SH 4PB0H 4M6AA 4I2XA 3TWCL 1T7ZA 3LN5A 3RWFB 3KPMA 1G0XA 1DBMH 1MAML 1SJXA 1N8ZA 1R3JA 3C6SA 2HA1A 4JFDB 5D4QA 2QKIA 4PRIB 3I02B 4LEXL 1W2KT 1BAFL 2CK0L 4OZ4B 5DTFB 4LLUB 4CMMA 5GGSA 2ZWLT 3C60A 4PBWD 1L4IA 4OLXH 4ZMAT 1JWSB 4ODTH 4MJID 4RQQA 1FGNH 4OZFA 3P0VL 2OL3B 1PYWB 5HI3D 3PWNA 4LLYA 2ARJA 5B22A 4PLOB 4LLWA 4JQXC 5CGTA 5IR1A 4C57C 5SV4A 2YSSB 1TTUA 3NPZB 4XCCH 3VD5A 4HC1H 4XBPA 2DMBA 5EC2B 4GG6F 4RSVA 5B38A 4KKAD 4BKLB 3BW9B 4WIQA 3M8OH 3MUGB 1E4KA 4M4RA 4YHLH 3VXUB 3ULUC 4UT7H 3EYSH 3MRGA 3WS3A 4GBXD 4JQIL 3GIVA 2VXQL 4PUBH 1SEBA 2N56A 4NM8H 1BD2B 3V9FA 4JQIH 2OMBA 2DQIH 4FP8H 5GGSB 1ITBB 1TMCB 5EUOF 4RWYL 3KPPA 3DX8B 4PPTA 5E9DD 4YHZL 3HC3L 5KJRH 2YA2A 3VI3E 2V2XB 1NGPL 1PLGH 3P11H 5BZDA 2A2QT 4UV4H 4YQXL 1R3IL 3WE6B 4I18B 4LGRB 4PR5A 4XX1G 4OQTL 5BS0E 5HI5C 4OFYA 1KPRA 5C0BE 1G9EA 4PJFB 4CMHC 4DEPB 5ADPH 4ZFOL 3HE7D 3NPSB 1PQZB 2FNBA 1G1YA 4MQSB 3NN8A 1PAMA 4XGZB 4JANB 2WUBH 4HSQA 4MAYA 5C09A 3VJ6A 1QRND 5EBMA 5E6ID 1ZVSA 2XACC 1WFOA 2DIBA 1XGTB 1KXTB 2LABA 2W0FA 3MV7E 4IDJL 2IQAA 1DEEB 3QULA 2BVEA 2YK1H 1QSEB 3RHWK 4JQVC 5ESVA 4I9WD 3O8XB 5EBWA 4EVNB 1N5AA 5DJ0A 3O6ML 3T2PA 4ELKA 3VFNB 2VITB 3Q3GA 1GCFA 4WEUD 2NQCA 4YWGL 3U9UB 5JORB 3EW3B 4U6VL 2OI9B 4ZFFB 1M71A 1RD6A 2X4TA 1UH2A 1OTTD 5I74B 4HKZA 5IMKA 1E6OL 4PJIA 1Q0XH 3BZ4A 5T5NF 4G6KL 1A02N 3MFGB 4DVRL 3MLXH 1PG7W 5C0JB 1RK1B 1NQBA 3Q6FA 4LKCB 3B5HA 1I1YB 1RMFH 3OGCB 3H0TA 2XQBH 1MCHA 4JGUA 1UCBL 5HHQB 3JXAA 2OTPA 4X6CF 5C0BB 4WRLA 2Q6WA 3V5DB 1TENA 1CLCA 1TPXB 1XGUB 4QCIB 5GIRA 1C5BL 2GTWB 1CGSH 4QF1A 4J3OC 2WLZA 5IB3B 1YEGL 4YH6A 4KI5D 4LAJH 4XNYH 3VG9C 2WANA 3G04A 4PJGE 4LSQH 1CXHA 2R1WA 2VZTA 1MCOL 3QA3A 1SY6H 2V6HA 4F9PA 4GRLA 5D5MB 1T20B 2YBRA 3AS0A 3HPJA 2BNRE 4I4WA 1EEYB 3DGCR 3VXSB 2OP4L 2AK4D 5KVEH 2JB6B 4GT7A 4JAMB 1ZGLP 2X4OA 2OQJA 2L4OA 2X4SA 4S10A 3FT3A 4PV9A 3SJVD 2W59A 4J2XA 1LP9E 3O6FC 3WN5C 4Y1AA 5MERB 2CXKA 4J4PA 2LTQB 3AB0C 4M1CD 1GHFH 4N1EA 5C0AB 1AGEB 3BUYB 3HPLA 4LIQL 4P2RD 4P2OD 1N26A 1EDQA 4FTVE 1JGLH 4EIGB 3IFLH 4WFGD 2APVA 3CH1B 4KROC 1U2CA 4L3EB 3MLZL 3BWUC 2D4DA 3MA9L 5IESH 4NQCA 1CDUA 1U92B 1UKTA 2BCKB 4NHUA 2MCPH 3DX9B 1LE9A 2WWMD 3IVKB 5EU5B 4RAVB 1YEHL 1TVDA 5DRWB 4M02A 5IV2A 3OTTA 1A6PA 4OCRL 1FVEB 2NLJB 4TUKH 4V1DB 3FQRA 1XF4A 1FVCA 2NX5D 5T1DL 1E6JL 2YD8A 4QXTA 5IWLA 5DD3L 1EAPB 4GW1A 3KS0H 3BOVA 5DD0L 3JVGA 1HILA 1RY7B 3BGFC 5HVHC 3BWAB 3L3HA 3VFRB 1S78D 5IVZA 4S1RL 4QXUH 5HJ3B 3VRLE 1ZHBA 5ITBL 4YX2H 4G6AC 1KCKA 1X44A 1AQKL 2VNCA 1ZGLA 3WHE0 4N0YL 4F58L 1LEGB 3LD8C 4Y7MA 2XWTB 4MA3A 4NQSB 3CFKB 4N1CA 1TFHA 2BNQD 2YPVL 3VH8G 1VFMA 1IGTB 2J8UF 3P4MA 1KLGA 2NXYC 3FRPA 5DURD 3UCRA 3KYMB 5IW1B 1JF1A 1PQZA 1NGZA 3QUMA 2BSRB 4PG2C 1J87A 1QYGL 3GMQA 3I6GA 3QI9C 3FRUB 1Y18A 3QIBD 4X80H 4XHJD 2EDLA 2R23A 4L8DA 1RUML 4PJ9A 3VFMB 1II4E 4AT6B 3G5XB 2XZQL 3JVGC 5IHBA 4TSCH 4KRLB 5D1ZA 2P5WE 1OQOA 3EYQD 3U1SL 2P5EB 3V6ZB 2MOVA 3DX6B 2G75B 2V2TB 4FQCH 4PRDA 3V5KA 4WW1B 1BZ7A 2UWEF 4R2GB 1XH3A 1OT1A 1KB5H 3BPLC 3O4OB 5IHZB 1NANI 1UZ8B 5I9QB 2MHAB 1R6VA 5F3HA 4A6YH 2KUTA 5IFAH 3U7YL 5C3LD 5E6YA 3LD8B 1D6VH 1H3GA 2CIKB 2NX5B 5IHLB 4N90E 4NNYA 4BH7B 4WNQB 1C08B 3ZKXB 4R2GC 1TJGL 3BPOC 1J0KA 1ORQB 1BVKB 1KCUH 2MPAH 4KTYA 2M26A 4OFIA 3WFCL 1F4WH 1JRHL 3WUWB 3ZYZA 3AGVA 1AO7B 1U8OB 4TUKL 2X5PA 2C1OA 2NY0D 3SE4C 1XMWA 3EYUH 1K8DA 5IVOA 1P4LB 5CMAB 1NGXA 3BDYH 1E4WL 1FJ1A 4U1LB 4YUEH 4ZNEA 4KTDH 3EFDH 5KOVC 3RQ3A 5A2JH 1NMCB 1MAKA 3ARWA 3RI5F 3U9PH 3SDAC 2OJEA 3BT2H 4LNVA 4JHWH 4P2RB 2BHZA 1YEEL 1YY8B 4UV7L 3QDJA 4P4RB 3L5WB 4KROB 1HYSD 3UPCA 2JB5L 5D5MA 4QO1A 4HWZB 3A67H 2Q76A 3VD4A 4MNGA 4Z7WF 2A83A 1G6VK 4G43A 4OQTA 4XPBH 3ELAT 2LTQC 3Q6GH 2R2BA 2LU3A 3AS3A 3PJSB 2VLJB 5A40E 4ZFGH 4BQBA 2O5ZL 3WIIH 4X99A 5E8NA 1NC4B 3F5WB 2Y23A 3ZTJG 3K3QA 1TJIL 2E6JA 1MRFL 3REWB 3S88H 3T65B 1ZLWK 1MLBB 3G5VA 1F42A 3FFDA 1QQDA 2ZOKA 1MFEH 1ZA3B 3QDGB 1JWUA 3G5YB 4Z0BH 1LO5A 4PRAB 3KNBB 4L1HA 3AY4C 5GSVB 5F1KC 1YJDC 2R1YA 4LP4A 3VWKA 4ZPTB 4LAQL 2JE8A 4JEGB 4PJEB 1JZ8A 4B7IA 3ULVC 4G9FB 3I3EA 1MI5E 3MUZ1 1A64A 1JIBA 3EYUL 1G7QA 4N8CL 4QOKD 4OCLC 1AY1L 4OGAD 5D5ME 3LN9A 4PGBA 4LVNB 4PRHB 4X7CC 5B39G 3TIDB 1IM3B 1AI1L 5JORA 1GH7A 4WW2B 1CCZA 4OLYH 1A0QH 3LIZL 4RGNB 3G6AB 1HKFA 1HDMA 3RL2A 4WFGE 4FTVD 4JPWL 5F7LB 4CVZB 4U1MB 4QRSB 4LSSH 3JWOH 4Y19B 4Q9RH 3FQWA 4QNPF 3TLRA 4MAYC 5HYQA 2I27N 4WO4B 1VA9A 1NCUA 3DVGB 1XF5B 1GAFL 1ZHLB 3B43A 7CGTA 1WICA 4NBZB 1KCRH 5AEAA 3OR7A 3T0WA 3QEGL 4NC0B 3NACH 4AENA 1MI5D 1OAXL 1F4XL 4D3CH 1RV6X 3D48R 5IVXA 4FNLH 1CT8A 2VDRL 4LASL 3KWWB 1RI8A 4PJFA 4HKXB 4Y8AA 4Z18A 4NKDA 2BNRD 4YHML 2YK1L 3ZKSD 1C08A 3P0GB 1PBYA 3PP3K 1PGRB 3IU4L 1I1CA 4OKVA 1MCPL 3MRMB 3ES6A 2JIXB 3SDDD 1MNUH 2IPUK 3AROA 4YHOH 4PBVC 3MZTA 3QDMD 2HH0L 4HPYL 2BMKB 2BFVL 2BOCB 2I07B 1VEOA 3O6KL 4H88L 2X89A 4R7NA 1Q1JL 2NMSA 3GMMA 3L1OH 4IM8A 4UQ2A 5EULV 1MHCB 4WHYG 3P11L 4EOWH 1FE8L 5DDHB 3FOLA 1KB9J 1NCWH 2CD0A 1XIWA 2BRQA 3DGGA 2V5SA 3QIWC 1QVOA 2YS4A 4H25A 3VGAC 4RWYH 2FSEB 3VMNA 2VN4A 3IGAA 4X4XB 3OJMB 5A43C 2VISA 2CLVB 2VAJA 5E00A 2IFFH 1BQUA 4NM4L 4JKWA 4PJXF 2WM0A 4D9LH 2X1XR 1DLFH 2QHRL 3FB6B 4K94H 4UMGA 3SY0B 4X4YB 3WYRA 4HK3N 1T0MA 4U6TA 4WO4D 4OCXL 1TLKA 2MFNA 5CGMA 5LKNA 1REIA 2BVOB 2EEBA 1JTTA 1S9VA 5BV7B 1OTTC 4D2NA 4HJ0C 4KRPB 1ZHBB 3B9KD 4KKLC 1AP2A 2Q20A 3ILPA 4M5ZH 2XQBL 1AC0A 4PJXA 1WBYB 1B0RB 4JHAH 5M7QA 1D7FA 3QUYC 2Q87A 4CMHB 2K3TA 3HR5A 2ADGB 4KK6D 4NZUH 2BVOA 2EDFA 1AQDA 4TNVK 3MRJB 3QEQB 4OLUH 3OXRB 5D7KE 4M7ZC 5D70L 1CR9H 3FO9B 2O5ZH 3FJTA 5EU5A 3CVHA 3DO7A 4M5ZL 5KOMC 3CVIL 2I9TA 5I1LA 3TO4A 4KK5C 5CBEB 4IHOA 4RNRA 1GZQB 1I8MA 3LKRA 5SWSD 1WAAE 4WI9A 4P46A 5TFSH 1J1XH 3CMOH 2PETA 1KIPB 4NKIH 1HINL 3TZVA 4APQA 5TQ0H 4R7NB 3F6IA 4YHKL 4MD4B 1TTFA 4PGCB 3UBXI 3M1BB 1VFOA 3NZ8A 3U7WL 2A38A 1TZGL 5I73B 1RZ8B 3KS0J 3S96A 3TZVD 5C07E 2VDPL 5AG8A 1MIEL 1LQSR 1I7UA 3LSOB 5DK2A 2GEEA 3DX7A 4HEME 2B1AL 2V5RA 3IKKA 3OJDA 2VDRH 3BIAX 3C5ZB 5I66A 5HGBB 5CD3A 2FR4A 4EN3A 1IM9B 4E5XA 1QFWM 1I75A 4M61A 4P3DA 3UTTD 4ELME 5AYUH 4H0HB 1ZS8A 2DQFA 3FT2B 4CKVX 3W9EB 5E7FA 5DA0B 4M9PA 1RZ7H 2WBJC 3T65A 1WC7B 4G3YL 4JDTH 1OP5K 1YMMB 2H1PL 2AK4B 5L7XL 4M1GL 3RWEA 4NQEA 2R1WB 5JXEA 4ETQB 2MKWA 1F45A 1A6VH 4L4VA 1XF5A 5DQDL 3X14A 4LCYB 3JZ7A 1MREL 3HNVL 4FQ1L 3X11B 3DTXB 4ODWB 4XBGB 2YPLD 2DS4A 1FBIH 5KS9E 3EKCA 3MRNB 3SDXB 3UBXG 2G2RA 4G43B 3TA3D 4Y4FB 4U1NA 2NY5H 5FUCC 4ZXBC 1OT2A 1CVSC 2WQ8A 4LLMB 3QEGH 1A6TA 4K7FB 3H2WA 4QRUB 1DJSA 5LQBL 3F62A 1YMHA 4YGAB 4E5XB 1OAYL 2OJEB 3W5MA 3BH9A 3SGKA 4Z7OF 1X7QB 2ZUXA 3PXHA 4MD5B 3S3JA 1B4JL 5C8JA 1Q72H 4ZO9A 4Q9QL 2J88H 4JDVB 1FH5H 2NY1D 2XY2A 3FRPG 2ZUWA 1ZA6B 1J10A 1DN0A 2EYRB 1BAFH 2CK0H 3D3VB 5E8EB 5GSVA 3L7FB 4JFXA 3OAZK 4LCYA 3FFCE 3M1BA 3SJVE 1DANT 5GRVK 3WIFA 4Q6YA 1T66C 1Q72L 4QCIA 3AVEA 1NGPH 1S7QA 1OAKL 1NC4A 4E0RB 4HBCL 1GZPA 2BXYA 3GJFH 2AJUL 2DB8A 1IM9A 2NY7L 5CSBA 1A2YB 3BEVB 3WFCH 2HTLC 2PTVA 3EJZC 1F97A 3PWLB 1Q9LB 1BP3B 3KXFE 3S88L 3BIKB 4K7PH 4L8BA 2H26B 4K3EH 2F74B 4D8PA 2XN9D 3KPSB 2HRPH 3GMRB 1G7PB 5HHNA 4PD4K 4UTAL 4YDJB 5FKPB 3SDYL 4D9RD 1C5CH 5IOPB 2X10A 3OKLA 4NQDA 4KJQC 3L3GA 4IOIA 1CGUA 2J2ZA 3JWDC 2DD8H 2DJ4A 5EFIA 3LS5H 4F58H 2WIMA 3KPPB 3TJEL 1P4BL 4ZUTA 1G7MA 5DR5H 5JXAH 1F4YL 1X4XA 4UV7H 4BZ1L 4KVNH 4MQTB 5C0GA 5EWIL 1H3PH 3QCUL 5L8KB 2FLRT 4TRPH 3MRGB 3KYNA 1UEYA 4LL9A 5GGUA 3KPRB 2OR8A 1OSPL 3RVVC 3V79C 3MNVA 4G5ZH 3G6JB 1GGTA 2NY2C 1Q38A 2ZUQC 4M48L 2ZUYA 3V5HA 1WIOA 1XR8A 4PJXB 3QI9D 3ILPB 1FV1B 1AP2B 5TFSL 4JFFA 5F3HB 1BVLA 1IAOB 3D1MC 4OM1L 4ZYKA 1KT2A 1AO7D 4RQQB 1JV5A 3FFCD 1I7ZA 5DMIL 2WWKO 3F7VB 4WW2C 4YX2L 1GIGL 4LLUA 4OZHB 3U0WL 2UY7A 4CVUA 4MHHG 3W39B 2NZIA 2P5EA 2CDEA 3H3PL 4YDLB 4KUZH 5C08A 5JZ7D 1VPOH 1NDMB 5D1QD 1CIUA 4UDTB 2Y6SC 5FUZH 4GMTH 4U4BA 4ALAL 4KJPC 4FQXD 3MV9E 2I26N 1DQJB 5DJCA 3MNZA 4R0LA 2D7TH 4ZD3H 3P4MB 5I19H 4HLZG 1IGTA 1HNGA 2FEDC 3GM0A 5D7IF 1LK3L 2NY4C 3LKSB 5IVNA 4JN1H 4P99A 4MJ2A 5D71L 2BOCA 4U6YA 4G7VL 3FQTA 1TIUA 1NANH 4X6BA 4QRSA 3ARFC 1ZLUK 1MHHB 2YRLA 4NSKA 4ZXBB 4OI7A 1AR1D 1JF5A 4U31A 3K0WA 2Y25A 3GRWH 4TSAH 3ARZA 4RGNE 5IOPA 1F4YH 3OB0K 2BY1A 5EIIB 2RAMA 4QXTB 4UNTA 4EDXA 4DVBA 5ACZB 1XF4B 2CDGB 2R39A 3QO0A 5C70A 5IQ7H 2OS7A 3RWCA 1V5JA 2EO9A 1N64H 4ZPVB 3IFLL 1NUNB 2XQYG 3ZTJH 1DBJH 1YY9D 3AAZA 5DD0H 1A9BB 4PLJD 5JNYB 5GRUH 2HYMA 4CVZA 1S7RB 4DGYL 4NKMB 2HKHH 4GH7B 1JN6A 2HVJB 2I9LB 4MYWB 3H7LA 3V6FA 4CAGA 4P59L 5C0BA 2W0PA 5JO5A 1AGEA 3BUYA 4PJIF 5HHVH 4HZAA 5D1XD 5IK3B 5FO7B 1H0DA 3EUUA 5J8OA 3AREA 2YA0A 4Y2DA 4LFHG 3VWJB 5KJRL 2CUIA 3WDJA 4PGBB 4K3DH 4C56A 3KG5A 4KHTH 2VLRE 3UDWA 1YDPB 2HJLB 4ZUUA 4XP9H 2EO1A 1NDGB 2B0SH 2QSCL 4RDQG 2A9MH 3BKMH 3DV6B 5D7KD 2ICWI 2DYPA 1UKSA 1B3JA 2E3VA 3O2WH 4F15B 5C0NC 3O3EB 1MHPH 1N59B 3JWOL 4LEOA 4XNXH 4CJ1A 1U3YA 3T3ME 3T0BA 4OZGA 4Y1AD 1N3NA 4OLZL 4EVNA 3IDIB 3C5ZC 5BMFH 1PY4A 4JR9H 3GI9H 2DLGA 1DCLA 4ODWA 4XBGA 1WBZB 5CBAA 2Z8SA 5MENE 4CVXA 3ULVH 1XGPA 5A2IH 2ITCB 2Z31D 1R0AL 1ZVSB 3X14B 4L4VB 5IB3A 1U8HB 2BHUA 4POZD 1EUUA 1CLZL 5E9DB 4QTHA 5BO1L 2HRPL 2P5WD 2X1WL 2YWZA 4MNGB 4PS4H 5IEHB 4URTB 3ARDC 3SGEH 1ORQA 3QFDB 1HCVA 4M7JL 4OIAA 3ARXA 2ADIB 2QADB 2C3XA 1MREH 3WUWG 2WUBL 4UDTA 4WNQA 1MHEA 1WGOA 4ZOEA 5AYQA 43CAA 1TJIH 2BNQB 4O51B 4EUPB 5KSBE 4J3XA 4KI5C 5C0CE 1FLRL 1K5NB 2Y36H 1I1RA 3KR3L 3MRFB 4N0UE 1J9CT 3QFJB 1OOAA 5CZVH 3ZHKA 1R3KB 2AJZB 3ARFB 1G1CA 3BGFB 2R56L 1S7XB 2WNGA 2ATPA 4J12A 4MNHA 5DVMA 3E2HB 3HZYB 4XPAH 5LVEA 1T04A 4GS7B 1KEGH 3HE7B 3QUXA 5FGSA 2HKHL 1MFDL 1T22B 5J12C 5D8JH 3QJFA 3VCLB 4L4TA 3ZDYF 2B1AH 3VXME 2WWKT 3K4DA 1AFVH 1FNGB 3RY6C 1E6OH 4QRTB 4OD2B 5DK0B 5ESVB 1X5ZA 4F9LC 3MRQB 2DQTH 3MLVL 3TFKC 4Y4HA 1KTDB 2FX9L 1A1MB 4GG8B 5CBEA 4NNYB 3O0RH 1O7SA 3FO2B 4LU5H 2NX5E 5TQ0L 4DFIA 4Z5RA 2Y72A 4PJAA 3KLDA 2XWBB 4MA1B 1U6AL 1KENH 3O2VH 1BZ9A 5T3ZL 4PJ7F 1PDKA 4JCMA 3CFKA 1SVZA 2XWTA 5LBSH 2OL3A 2XV6B 4HC1L 3GJFK 2DTMH 5TH2B 1KULA 3TBTB 4S2SB 1MOEA 4J6RL 4TSAL 1ED3A 1SEQL 4TVPD 2E9JA 3WE6A 2WBWB 5JW4Q 4YHIB 5DRXA 4LLQB 4KHXH 1OHQA 3ULUF 5CJXA 4PJBF 2AJXH 2YUVA 1JCKA 2BY2A 1FGNL 4XB7A 3GBNH 3KAAA 4NZJA 1RHHA 3OKLB 4AT6A 5L2KD 1TVHB 1OAZH 1RJZB 3NIGE 3FRUA 4F3FA 4WO4C 3MRBA 3ULUE 4EOWL 2ZUQB 1EIBA 1MH5B 4RA0C 3IAQA 4JM2F 1EGJL 1UM5L 1OF2A 5JIKA 5EBLA 1AD0B 4ONFH 4CADA 2XWBA 3N06B 4M6MH 3DHJA 1KJ2B 4XPBL 3SE8L 5IMLA 4B50A 4KJYA 4H25B 3T2NL 3MLSL 5B38B 3WJLC 1IC4L 1GZPB 5LJYH 2GSGB 2IANB 2AGJH 4NM8L 2I60H 3WD5L 1QA9A 1XZ0B 2KQNA 4QHLA 3UPAA 4LSUL 3VXRA 2RFXA 1J86A 3TBSB 2OR9H 4AIXA 1HKLL 3W82A 5E2JA 4WUUA 5DMJB 3RHWF 1NBYB 1GIGH 2VL5A 4HD9A 1T6VN 5JPNB 3QUKA 2DLIA 4FHBD 1BFOB 3TT3H 4P23C 1NJ9A 4HMEA 3NBNA 2OL3H 2V17H 3KPQA 4JFYA 1KG0A 3MOQA 3X3FL 5D1ZD 4O00A 2YPLB 4PV8B 3NCMA 3V2AR 3IVKA 3K4AA 3Q5OA 1OB1A 1WISA 2ID5A 3MJ7A 2W60B 5LGHL 4APQD 1ZSDB 1EXUA 2FX9H 4XXCA 4L8CA 4HWEH 4Y16D 1GGCH 3QWQB 2EXWC 4Z95L 1RFDH 3U36B 1JK8A 3PWUA 4KY1L 5T1KB 2R29H 1NMBL 4NZUL 1BJ1J 5CJOH 4OGZA 4GSDH 1PKQB 1HEZA 4DOHE 1JFQL 3TJEH 5DQ9B 1A7PH 1L0YA 1IGJA 1CYGA 4I8DA 3H9ZA 1QRNB 1J88A 1WZMA 1P9MC 2DWEB 3KR3H 2D7TL 5J11B 3QUZB 1TVBB 4FQLH 2NTSP 3QIUC 4PJ8A 2VZ1A 1AXIB 3LQAL 3RA7L 5HDBF 2JB6A 4EI6B 4FXLA 3EO9L 4GW4B 1HH9B 1AGDB 3ZT7A 2VDKH 1PSKH 3PNWA 4IJ3B 2IAND 3MV7D 3RPIA 3MA7A 4JFEB 4N0CC 3SDCC 5J13C 4N90D 4NN6C 2X9XA 3ORJA 4Y5YB 4OAWB 4QOKA 5B21A 4GRLB 3EZ8A 1IGFL 5IMKB 4MDIB 2GSIB 1JI2A 4YFLI 3PWVA 2DTSA 4G9FA 1JTPA 1FC2D 4KDTA 3WKMH 1ORSA 4X7SH 1NAMA 2H8PB 2NXZD 3WIHH 1I3VA 5E08L 5J4MA 3VFOA 5SX5H 3NGBB 1CIDA 1ADQL 2VITA 3Q3GB 3W0WA 3B4NA 1RUAL 3P3YA 1UT9A 3SPVB 1OD9A 1T1XB 3X12B 5HDQL 5DLMH 2WBJB 1U8IB 1BQSA 5CLTA 2IQAB 4HUVA 3VFGH 1AGCB 2CUMA 5I1LB 4O2FB 1MCLA 2HN7A 5C9KA 2FIKB 2AABL 3BKML 4OGYH 1OGAB 2BVTA 1XCQA 3JWOC 2D7MA 5LGJB 3C8KA 5ESQA 5MHSD 4G8EA 4M6NH 4FQ2L 3S9DB 3ESVF 1BQLH 2DQHL 3BKCH 4PR5B 4WWKB 3R8BB 1N0XL 1FVDA 5DEGA 4K8RC 1QTYT 3HNTL 3L3JA 4HFWA 4HCRL 4U0RC 3AREC 3QPXH 4YHIA 1S9VB 5DRXB 4BQ6A 4NN7B 4MD0B 4TYUA 1JVKA 4S1QH 2WWMC 4BQ9A 3O3BA 5HVWA 1WFNA 2SEBB 2P43B 3LIZH 1K8DB 5D1XC 1C1EH 5T3XL 2Y7QA 3FB6A 2FL5B 2VLKE 5E5MA 1BZ9B 4X98A 3RY5A 1ACYL 2C4XA 2NY0B 5I1CH 1YYML 3BP5B 1OL0A 3BW9A 5DQJB 4QHKJ 5KSUB 2LFGA 3TYFA 4MMXC 1CU4H 1ZMYA 1NBQA 1HSAB 1CFVH 2HVKA 1K4DB 5HVFB 2XG4A 1AIFA 1LO4L 3V52H 3BPNB 1D9KD 2DM2A 1R5IA 2Z93B 4D94A 1VFBA 2A1WH 4HGKC 4W81A 3CZFB 5KN5B 1QUNA 3QJFB 3VCLA 4Q97A 3QIUB 5TPWL 2KL6A 1WIUA 1CGTA 3DX8A 5IB1A 1OM3L 1T04B 5E6ZA 2DBLL 5BV7C 1ZEAH 2A73A 4LSQL 3NFPA 4Z7NE 4GKZB 3ARFA 4MA7H 3WSQH 1D6VL 2A1WL 2C5DC 1OGAD 4HXBL 5F8RC 2QKIB 3V6ZA 3VFVA 4JFFB 1OTUC 5GGQL 4LCIL 5AUMA 1W0WB 5KN5A 1ZTXH 1CD9B 3QZWA 5BCAA 2F53D 3GSOA 4ALAH 2AK4E 4GBXA 2EYTB 4HGWB 5I1EL 1NMAL 3QIWB 3UYPA 3DMMA 3QUMB 2YMXH 1MCWW 5GPRA 3MLYH 3T0ED 2P42B 1M7IB 3U0TA 4XCFL 4EDWH 5ENWA 3BD3A 3HAEH 1SBSH 2VUOA 2O61A 1IQWH 3EFDL 1XGQA 3RKDD 1KGCD 2FZ3B 3KYKH 2FJHB 1JPFB 3MR9A 1KXVC 2XTJD 3BMWA 4R96B 1KUMA 1MRCL 1X5GA 4JRXA 2CRIA 3B2UC 4NWTL 1F2QA 1MVFA 1C5DA 3CFIC 3RAJH 3RWFA 1DQMH 3I85A 2BDNH 4YPJA 3QHTC 2YHGA 4UINL 5CKGA 3WCYA 4N9GA 4UU9B 5AZ2L 1UACH 4R6UA 4OZIA 1CGWA 4WY7L 3O6FB 3EDKA 1NDGA 5IWLC 5E99L 3RDTC 5F6HJ 1A7RL 2IG2H 3K1DA 5D7JA 4JZNA 4JFFE 1FO0A 3RNKA 4UQ3B 4YBHA 2ITDB 3E6FA 3LQZA 3UPRB 2YA1A 4FQJL 4ORGA 4YBLB 4OGXL 1PZ5B 5HHMB 3T1WA 4GKSB 4ERSL 1F4HA 4Q74A 3JTSA 2J3SA 5I71B 2F54E 2ZOKB 2Y06H 4Y5VC 4Y5VB 1P4IH 1DBBH 1QFHA 2VERN 1EJOL 5EU7E 3ZSTA 1YEKL 2E27L 5INDB 1W72L 2FGWL 2CK2A 1Z3GH 3HUJB 1H3WM 3QEUA 4H88H 1RQ5A 3V7MA 5IJKA 3KJ6L 4PJEF 4RAHA 4ZXBD 2EH7H 4QHMB 2OI9C 1IGFH 4Y4KD 3UPRA 2PW1B 3CDCA 2DWDA 3EYOB 1LNUB 3LH2H 5HHXH 4TTGA 5C2UB 5FGBC 3C5SA 2X4SB 4LSUH 2NZ9D 1A5FH 3MYZA 3O2DL 4ZFZB 5KS9B 2VLKB 1MY5A 4NFDA 1ZVHA 2BNUB 1KC5L 2ED9A 1FN4B 5JA8B 5CFHA 5JLZB 1RU9H 3QDJB 5EOCJ 3QPXL 3U4AA 2GCYB 1EHLH 3V0VB 4QRPD 4QRUA 1KCSH 4B0MM 1N4XH 5GISL 4KU1A 1Z0MA 4OD1H 5I0ZA 2AQ1A 5GRJH 4LHUB 4JQVA 4R96A 5ADOL 4X4ZA 1FJ1B 4RBPK 2D7PA 4OB5H 3MLXL 3DTXA 3SKOB 3IFPB 4PGZA 4GW5B 4N0RA 4HMDA 3CLEL 4HK3J 5T33L 2XA3A 1ONQA 2VLJD 4OD3L 1U8OA 4TNWF 3S97C 1SY6L 2HFFA 5TPWH 4HDIB 4YFLF 3RZCB 2XFXA 3O8XC 5C0CA 3MNWA 3O3DA 4GRWB 4XHQA 4Z0XB 3REVB 2XZZA 4F7EA 4DZBA 3LEVL 1D9KC 2GKIA 4TPRH 4DCQA 4NIKB 5D2LB 3G9VA 3IU3B 2VZOA 5AUMB 1IEBA 3KGRA 2F53B 4PGDA 1U8NA 3LEXA 2Z92A 1E27B 3IXAA 5IBUG 3ULSB 1UM6H 3BD4A 4YDVB 5D9SA 4O4YH 4U1HA 2CRYA 4MJIA 2NY6D 4Q2ZB 1XH3B 4ZFFA 1RZ8A 3S96B 4M43H 1I8KA 3BYYA 2G75A 1AFVL 4JPKH 1Q9KA 2G5BB 4KZDH 2F19H 4UOJA 1NAML 3TA3C 1FORH 2GAZA 3PL6C 5EOQH 1MCNA 5DGRA 5F3BB 4MA8L 2VRAA 3QB7C 4L3EE 2PW2B 3LAFA 4HPOH 2PO6B 1PG7L 4XPAL 1GZQA 2HRLA 1CDBA 4XP6H 1BWMA 3QQ9D 2H3NA 3B2VH 5HHOB 5IW1A 2NY3B 1IT9H 2B7DT 1PVHA 1HIML 4FQ2H 3GKWL 4XGZA 1A6UH 3R06B 1LDPL 1IEAA 3HFML 5C0GB 3MLTA 1OAZL 4E41E 3ZTNL 4XH2B 3BPLB 4YO0B 2Z35A 3TN0C 2PTTB 4GAYB 2YD5A 3T0EA 4F7TA 2A9NH 2F54B 1DR9A 3HZVB 4JY5H 3RJQB 2BNRB 1UVQB 4WWKA 3RWHA 1A6UL 3WDIA 4BQCA 5DJZB 2CDFB 4XWGH 4MB4A 5LBSL 3CCHA 3OZ9H 3RPKA 4HS3A 2R9HD 4JFDE 1QBML 3TZVC 2CIIB 2AEQH 2YPKA 3DI2B 1YQVL 4X4YA 3MJ8B 2E6PA 3HI6L 3H9SD 4PB9H 3DLQR 1SYSA 3BSZL 4EEEA 5BS0A 4YNYA 5C0RL 2AJ3A 4OLXL 2CLVA 3VFUB 1S8DB 2P8LB 5K9QI 4KZDL 1MHPL 1MAJA 2FWOB 2IAMC 2GYSA 2EKSA 1YN7A 1RZGB 3BKYL 4ORZC 4ZOBA 1WJ3A 5F1NA 1G9NC 4XAKD 1DBML 1KTKE 2PCPB 4I3RH 5CLWA 2WZPD 3VFWA 3S34H 3VFTB 3QIUD 4JG0L 2UZIL 3WIIL 35C8H 4XNMB 3PWNB 2DM4A 1UCTA 3QCVH 5I6XB 4LLVB 1GC1H 4XP6L 2UZIH 5JOPD 3HG1E 5KSAC 4JKPL 1I9JL 4D0DA 1U91B 4OBRA 4PV9B 2ZSVB 3PGCA 5EB9A 1LK2B 3TH4T 5LCVH 1T4KA 4IJ3C 4JFDA 3LRGA 5EOQL 1GGBH 4NO3A 3MLWH 2V7NB 3GM8A 3T8XB 3P77A 3MZGB 1NBZA 1A9EB 4WUUE 4PG9A 4ZS7H 3QUZD 4KRPC 4I2XB 5IG7B 3HPJB 3GBNL 1ZHKA 1U8PA 3MOBL 2ADIA 2C3WA 5TGBB 3UROR 5E0QA 4PRNA 4ZDHA 2VIRB 4XB8A 5ITFB 3HR6A 3RTQA 1SJVA 2R4SH 3HC0B 4HDIA 5F88A 3NA9L 1QRNA 1Z5LB 5GS2H 1HH6B 2UV3A 4ESKA 4YGVA 4JR9L 4F37K 1T0NA 1G7IA 3I50H 4LSRL 4YXHH 1D5IL 3AB0B 1NUFA 1FSKB 4KQ3H 2A6IB 3ARGD 5C9JB 1PD6A 4JY5L 1AJ7H 3BH8A 3CFDB 2XTJB 3VXQB 4Y2DD 3M07A 1JRHH 1MLCA 3P9LA 3BZFA 3LZFH 4KWUA 1FFNB 3KPLB 1JL8A 2X4NA 4MGXA 1QNZH 1ADQA 1OW0A 2FJGA 2D9CA 4LEOB 3PWPB 1NCAH 5D71H 1MCIA 4QXWA 1HWGB 2LVCA 1EO7A 1DBAL 2GJ6B 2VDQH 4POZC 1MVUA 2YPLA 2E7LC 3OJDB 5C7XH 4LDEB 5IFAL 3V4UH 3QXVA 2VLLB 2BVQA 3CLFH 1N2RA 1UQSA 3QQ3A 3KVQA 3L5IA 2ZNWA 2NYYC 1EJOH 1GSMA 4RGOL 3RWGA 5EC1B 3WKNA 2FBJH 5JPNA 3VG9B 2VL5B 3BP7A 4Y4KC 5ILTL 4MD4A 4ELKB 5C6PB 3QEUB 4XVUD 2Q8BH 1P6FA 1S5HA 4HXBH 3WXVH 3VDAA 5B3NA 1WIPA 3HTLX 2HFEB 2W91A 2ZG3A 5TE6H 1CD0A 4LSVH 2FBOJ 3QCTL 4X99B 5E8NB 5DJ2B 1H3XA 1YMMD 1AH1A 1ERNA 4ORGB 3P4OA 4LSPH 2X40A 4P4KB 4OM1H 4NQTA 4MAYB 4NC2B 4JANA 5EOCL 4JRXE 5KVFL 1KYOK 3BKJH 3FO0H 4LQFH 1MPAH 3CNKA 3CUPA 4LIQE 4RIRB 5KVEL 5CWSB 3O2VL 1ZXQA 5A2FA 1UFUA 2CIIA 3DSFL 3I9GL 1DQDL 5DFVD 3DUHA 1P84J 3SQBA 3OXSB 2Y5TA 3ECBA 3O11A 4PJDE 1F6AA 1YJDL 4XPHL 2G60L 4P2OB 1MHHA 4Y4HD 4Z7VA 3QCUH 2CKBA 3P30L 4BZ1H 2VLRA 2NW2A 2E7HA 1IAIL 1GRWA 1BEYH 4MA1C 2IBBA 4PJFF 2ORBH 4ZTOH 3E8UH 4UINH 1MQ8A 1Z9LA 1RUQL 4ZNEE 1V3MA 5C0ND 1OARH 3LB6D 4UT9H