4F5EA

Crystal structure of eris/sting
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
186
structure length
186
Chain Sequence
GNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTADRAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the sensing and binding of cyclic di-GMP by STING
pubmed doi rcsb
molecule keywords Transmembrane protein 173
molecule tags Immune system
source organism Homo sapiens
total genus 55
structure length 186
sequence length 186
ec nomenclature
pdb deposition date 2012-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f5eA02
4QXQA 4QXOA 4KC0A 4YP1A 5CFMA 5CFOA 4LOHA 5CFNA 4KSYA 4F9GA 5CFRA 4F9EA 4EF4A 4LOIA 4EMUA 5CFQA 5CFPA 4LOLA 4QXRA 4F5WA 4KBYA 4JC5A 5BQXA 4LOKA 4LOJA 4QXPA 4F5YA 4EMTA 4F5EA 5CFLA 4F5DA 4EF5A
chains in the Genus database with same CATH superfamily
4ZOCA 3G5LA 1R7RA 4ZYLA 1Z38A 3K7EA 4PC6A 3RHSA 1VPDA 3FZEA 5HNKA 2WR8A 1RYMA 2Y67A 13PKA 3W5HA 1G2OA 1YRAA 2V6FA 1TA4A 1W73A 5BQ5A 4LRWA 1WMDA 3T95A 1P1IA 1MA3A 1Q3KA 2WPDD 3TQCA 1GGKA 2O7RA 3AKDA 3DBOB 1OSNA 2UZ3A 4AJKA 1X1TA 2GLTA 3PI6A 1EAMA 4WASA 3THYB 3TOXA 1XEXB 3C4JA 3N76A 1BE0A 4J7CA 2ZTHA 4MGHA 2J67A 1USKA 5ES3A 1IZ0A 2UYCA 1SOUA 1G2IA 3DEKA 4KFCA 5A4KA 6CHYA 2RHTA 3OE7A 3O9ZA 5SZJA 4MGZR 4I19A 4X5OA 3RQSA 1GKLA 2VKTA 3IO3A 3A4NA 2BLLA 1DX4A 1G20B 1ZRMA 2CHGA 3FCYA 3L04A 1FVHA 3GLHB 3OFVA 4I4NA 4ID9A 5H02A 4KGZA 5JQGB 1EMDA 2VTKA 3O8QA 4K1XA 3MJDA 2ZVQX 1OBVA 1ZR2A 2Q41A 4FT4A 1OFIA 1Z82A 3AR8A 1RJ9A 3O0DA 1CY4A 3UKJA 2QZZA 4EVRA 1EIWA 1CQIA 2C1ZA 2VATA 3GELA 1Y4DE 2W00A 1D4ZA 4Z99A 1CB0A 2Q6TA 5A62A 5HKAA 4JOSA 5HKLA 1XZ8A 2P2SA 2XZPA 4XIJA 4R7GA 1Y1SA 3S44A 3U7EB 4IIUA 1UJBA 4EFLA 1S9HA 3CLSD 3CONA 3T7TA 3O9VA 2B25A 4FILA 2XA9A 5U9CA 1QWSA 2JH3A 2YJZA 4MGIR 2NUPB 4R9NA 4R1PA 2A1UA 3KPWA 3W1EA 4EFDA 3ZI4A 2P6OA 1YI1A 4QYWA 4U63A 3UHPA 2AXPA 4N7MA 1H2YA 3ICQB 3RYIA 2OO5C 2Q8NA 2XMPA 4DABA 4N3AA 3U7IA 1Y89A 4YIKA 3L2OB 2V7TA 3N8KA 4OP2A 2Y1EA 3B85A 4RJ2A 1KSHA 2VQSA 1OQAA 5JZSA 1EP2B 5DN6A 2P62A 3K1TA 4ZGBA 4PZPA 1X1SA 3U3JA 3OOJA 5AM3A 2VFAA 1P2SA 1E9RA 1CETA 2JL1A 5DPMA 3R7DA 3B6ZA 4A26A 3MWDA 1V0JA 3VU3A 1FSPA 2CYAA 2JCXA 5I4IA 3QVGB 2HDHA 4RK4A 1RM0A 3WO0A 2VHUA 1NWCA 1SR8A 1Z6XA 3L1HA 2PL9A 3Q9LA 3T9CA 2AN9A 1U2ZA 3AHIA 3OCVA 3NANA 1KDRA 1HURA 1CUHA 3U56A 2GFQA 1H5UA 2OAP1 5F7OA 2WYIA 2Q0QA 3JTMA 1U81A 3GDOA 3T3GA 4JHXA 2RHOA 5L40A 1V2GA 3VUFA 1K9VF 3JALB 3QMVA 4KIJA 3BSYA 4BNJA 2Q9CA 3EZ7A 2QQEA 3E5HA 1DBRA 2HFJA 3ZX5A 3G13A 4HY3A 3J81A 5CD1A 5CURA 3INTA 4Q7LA 1J42A 5B58C 4BJHB 4R71A 1XRQA 3I2KA 2B5WA 4YRBA 3ZWQA 5A05A 1U8YA 3T7EA 2W6QA 4U6SA 1ZAYA 5IDVA 4DWWA 1ADGA 1ICEA 5FT9A 3RHFA 4OATA 1R8YA 3LIIA 1RBQA 3WO1A 3W6UA 3NETA 1C0EA 5LP6B 3HO8A 3WZMA 5LKAA 5JY6A 4FFDA 1C81A 1H23A 3KAPA 2Z1MA 4F8JA 4AI6A 2C7OA 3N1UA 4TLEA 4MAFA 2Y05A 2VG8A 1NBWB 4C7OA 1CDOA 2P27A 3TZBA 2QJTA 2IIPA 3U7JA 2TYSB 4Z4HA 1V47A 2OK8A 1JEDA 2H8GA 4BB5A 3DF7A 3HBJA 1W36C 3HP7A 3K0FA 1BGXT 4DJTA 1QQ6A 1P72A 3NHLA 3OJXA 1K2WA 1DC8A 4GP7A 3WBFA 5FBHA 4TV9F 3IUEA 1JP7A 2VDUE 4YRSA 1KFBB 3TSYA 2MOKA 2WJGA 4BQOA 2JA2A 3WYNA 2E4AA 3VPBA 3O2NA 5I48A 3C48A 3MT8A 1SUIA 4WKPA 2QN3A 4LWPA 4LRUA 1WUHS 4ON9A 3BXXA 2ANBA 4WADA 1U0JA 5FCDA 2IWRA 4O4IF 2WJIA 4B82A 2VNSA 4B3TB 1ZRHA 2HBQA 2JLXA 2Z58A 1TLTA 4BQSA 3G1UA 2ZE7A 5I7FA 3MYRA 4GZMA 4QBGB 2GM4A 3W7BA 2XRMA 1CR6A 1CU1A 2D1RA 3OZUA 2AG6A 1O9BA 3PUWA 1CYEA 1XYGA 4HYYA 1EVIA 1V4VA 1CUIA 2JGEA 5A7HA 1V7PC 2QM8A 1T8RA 1RWPA 3QF7A 4H0FA 4D8UA 2IOHA 2EVWX 4L6CA 2DPYA 1NVXQ 1EM8B 4MYCA 1EHYA 5KJEA 3SHFA 2R65A 2GGSA 1R4ZA 1E0SA 1JL3A 4QNNA 1PS8A 1FFXB 2O8FA 3WTBA 1I7NA 2OMEA 1KY2A 3WKAA 2I6QA 4NZNA 4UTVA 5LU8A 5CHEA 421PA 1ZIOA 3JAWA 3C7TA 1W93A 2DUJA 2Z98A 1MJNA 1QYIA 2BHRA 4F3CA 1G5TA 3I0ZA 2GRJA 2PIAA 4C4PA 5DB4A 5EP4A 4UE3S 3WC4A 3DEHA 1HWYA 3IQWA 4TTTS 1QOQB 3M4JA 4EHLA 4IZIA 3E3NA 5AW2A 5HKBA 2H2FA 1CFZA 4KEAA 4EPXA 2Z0MA 1FF9A 4IH9A 3IDAA 4LDPA 4BZWA 4V02A 1KK0A 2NO0A 1OE0A 2OD9A 1TJPB 1NUTA 3F3KA 2GILA 2GYUA 2G67A 3IV6A 3M4ZA 3STWA 4BIMA 1SKQA 5BYKA 4MO2A 4RKYA 4D9MA 4EVIA 4CEHA 2XNJA 2RD2A 2W6JD 4YAEA 8AT1A 4XWAA 4N49A 2ZI7A 4AYTA 4BRZA 4H6VA 3DFFA 4WY5A 2R7MA 5K0TA 3TZLA 2C5HA 1TTHA 3I9OA 3KDSE 3LPNA 3TQQA 3EZGA 1U3DA 2EEZA 3L9WA 3KQHA 4GZLA 3ZVRA 4DQUA 1II8A 3WB1A 3DBLA 2ZUVA 3QUBA 5IW8A 1OFUA 2B8TA 4C08A 3TLBA 1VIYA 1DG1G 1C3EA 1L2TA 3VR5A 3HXQA 1ZM9A 1A50B 2A0XA 2YWFA 3FTQA 3P9QA 1XLWA 5F52A 5C1IA 4CFZA 4DTCA 2ZZNA 4N82A 4DUPA 2HPVA 2OBMA 2WD7A 3BWVA 1B8OA 1BE1A 1O94A 4F5ZA 4KPYA 4NCBA 1K86A 4R1NA 1GZVA 2OCGA 3GOQA 5E6RB 2D7JA 1A4XA 2BGTA 4G67A 2IXGA 1RAGA 1CUUA 1M33A 1Z12A 2HQRA 3GJ0A 3MFYA 3NEPX 2WSSD 4H3HB 3AY0A 1RHMA 4PQGA 4CM7A 2ZSIA 3PYMA 1U80A 4Q4JB 3QEJA 1LFDB 3IOYA 1LRLA 1NSTA 3KTAB 4FHZA 4ZV7A 4DWOA 4YRMA 2HHLA 2GJAA 4IIHA 1EA5A 4BLVA 1QGZA 1N6PA 3CRNA 4XYBA 2ECFA 1J2EA 1I7LA 2VAXA 4LMAA 2HF9A 1TZKA 2CUZA 3HR8A 3NJRA 4NV0A 1KSJA 1PSWA 1Q84A 3D6FA 1Z4MA 1WEHA 1BJRE 4MWCA 2EJVA 5KOJA 1CR4A 5EJAA 2GZSA 3D64A 3D3QA 4Q1BA 3DKIA 1Q77A 3PJFA 1RM4A 4RK7A 2Z43A 1TAHA 3A9SA 4ZP1A 3HBAA 2VJMA 5DHPA 1YXMA 3QW4B 1TQ8A 2NYRA 2MDTA 5B64A 1TUEA 2E6KA 2BR3A 2RH8A 1T9AA 4KNVA 2CNWA 1ZUHA 2W42A 1MRNA 4JNCA 1O8CA 5C34B 5HZKA 1GZ7A 5FFFA 2Y0CA 2A67A 4MIOA 1J9GA 4Q05A 1DQNA 4Q66C 1U99A 4I66A 1TQ2A 2MINB 3SZ3A 3VU0A 4JP8A 1UFQA 1MO6A 4V2UA 1RWMA 2I2AA 4UM9B 4A6XA 1JJIA 2B5OA 2JFXA 3NO4A 4BECA 1RQLA 3WGMA 4HNVA 3LQKA 3QMPA 1YRWA 3JQ8B 4GSYA 1DXYA 4V0KA 4LDRA 3OF2A 1A7KA 1WCV1 3BEOA 3I1YA 1CYDA 2Z5GA 3N2KA 5IX8A 3KKZA 3PXXA 4JLBA 3PU6A 3FYTA 4UOQA 1VG0B 1Z08A 3UV3A 3WADA 2DQYA 2EL9A 1W1UA 3ASYA 2BGKA 2JEOA 5ARCA 3VYTB 4LMPA 4PTLA 1B23P 4NNOA 3L8FA 4YH1A 2YHIA 4FCWA 4TS4A 3UYKA 4CM9A 5ADHA 1F7VA 2VCYA 5DW0A 3FKJA 4DA0A 1ZK3A 1X2EA 2XMRA 1IRXA 1SRQA 3HRKA 3I4FA 4QUDA 2IHTA 3HCBA 3I39X 2IHVA 2R1VB 4AYXA 1B73A 2J4DA 4RGVA 3UJ3X 2Q4OA 3RC3A 2VLIA 4U9UA 2JGKA 3X1ZA 1N0VC 3HY3A 4D9BA 3CVUA 2PRSA 3E8SA 1P19A 5I9LA 4C6SA 2DBZA 3HFSA 4KIFA 1MQAA 1QFSA 2EZ9A 1AT1A 4RD6A 4RF4A 5CLQA 5FTKA 3P9IA 1SG0A 2VEOA 3RC1A 4JSRA 3GLGB 4YP5A 2BI8A 4F1KA 1H66A 3RK1A 4AF8A 1GPUA 3V80A 2EFDB 1ABEA 1D5WA 2V7UA 1GGFA 1C3LA 1EBUA 2BVNA 3EOBI 1JVBA 1TKBA 4DQKA 2R68A 2HLDA 3TG2A 1WETA 3KVVA 2NQTA 3LA8A 3L0SA 1B74A 3I6MA 3QEMA 6GPBA 1JU4A 1EDZA 1O54A 4EF6A 1IEWA 2KBFA 2DETA 4NOMA 4QGAA 3MLEA 1RBMA 1BS1A 3AIOA 1VLQA 5EKDA 3T4UA 4F5YA 1CBUA 4JJIA 4L27A 4BNUA 4QSMA 2R4QA 3VNRA 4A3SA 4DLZA 1KU6A 2NN3C 3KOOA 5KYNA 4PCLA 3I53A 1KC1A 4N8DA 4BRWA 1U02A 1U1IA 1YFKA 2B1JA 1P6QA 5DWDA 3DLIA 1PR5A 2HI0A 3BMNB 1MIOA 1U5CA 5EJ8A 1RTKA 5FUXA 3U4IA 1UFOA 2ZTVA 2V4ZA 2V6MA 5JWOA 1C9DB 2EL7A 1K89A 4P8RA 3L7YA 2OCPA 5E95A 4QZVA 4F92B 4WCFC 2ODBA 4EEZA 3E23A 1QGUA 4HWRA 3K2QA 3HB4X 3GI1A 1EP1B 3ITDA 1W7AA 2OXIA 1RIIA 2YUTA 3BWCA 4D02A 2OAGA 3AR4A 2NIPA 3EGOA 2P8SA 4X91A 2JASA 3AR5A 1PJ8A 3DULA 2A35A 3PUXA 2XUOA 4HS4A 1Q3TA 3QFHA 1F9AA 4E5VA 3IA2A 1DO8A 1UBUS 3ANLA 3D3WA 3QWAA 3EY4A 1RKXA 4KKVA 5I7EA 4PO1A 1S1CA 3UICA 3Q12A 3A70A 3TJZA 1E9VA 3ND5A 1OF1A 4BNHA 2IX9A 4FGZA 5JC1A 2FMHA 5FPQA 3EXHB 2RB5A 5AJUA 2F1OA 1HG0A 3AY6A 2B7LA 3RB8A 3VSEA 4DLYA 1MOQA 3CNOA 1HTWA 1GU7A 1QTQA 3O6VA 3C24A 4LXIA 3ETHA 4HKTA 1PT6A 3RU9A 3ZGNA 3ZHXA 1K97A 1PT8A 2K7FA 1G7SA 4PZUA 4DR2B 2I6XA 1Z6YA 4Z9YA 1R4NB 5DI3B 1NOKA 3FBGA 4B4UA 1XQWA 2LTAA 1C2YA 4XM0A 3X1XA 5KYTA 3FOFC 3TTXA 1J2RA 1SO8A 1W9MA 3BXGA 3U3DA 3BWEA 1N2XA 1M2WA 3EVZA 1KZYC 3QVTA 4PZYA 1KJYA 2BFEB 2JJ1D 4RHFA 2GVNA 4TUYF 3MILA 2NO1A 3UVEA 1PNRA 3MOIA 1AQUA 1LK0A 5ECGC 2IEIA 3GYGA 2OP0A 1A9PA 2ALJA 2UXCB 1ZA1A 2QIPA 4UM8B 5IF3A 2C0QA 4G4SO 1S3IA 2G9NA 2O8EB 1I3LA 3VR2D 1GZ4A 5B6JA 1VECA 1W29A 3KAQA 4R83A 4A2WA 3BMQA 1VSBA 1W0KA 2XMBA 1W47A 3AX6A 4ZEOA 3COSA 5LBIA 3QOXA 5JJKA 4YCMA 3LYHA 2QV7A 1M8PA 1WS6A 3HFJA 3FBWA 1HDXA 1QDEA 2ET6A 3QKIA 1G0OA 4AMYA 4E6EA 2Q2QA 4L85A 1E1NA 3FY4A 4UVGA 4XDGA 4RFLA 4EJSC 3CZ4A 4PQEA 3WGNA 1SKAA 4R2KA 4FFPA 1RWKA 2DPXA 3DZJA 1EUYA 3TOSA 2QTVB 1DQSA 5HTKA 1JA1A 1W2HA 4LS3A 3QE9Y 2FDXA 4I50A 3WL6A 4BDSA 5K8JB 2RH5A 3NYQA 1V45E 5DTQA 2GT1A 4JX9A 3V00A 1Q14A 4MKIA 2QDKA 1E3TA 1I6MA 3PZBA 2VPPA 2REQB 2Z56A 4WBNF 3C3EA 3PFCA 3G2PA 4WK6A 4Y9DA 3V4ZA 1FCJA 3RS9A 3DLAA 3UCEA 1FP7A 3R5HA 2FQWA 4BZQA 3KNZA 4HQKA 3EGDA 4XA8A 3ZE2B 4EKDA 2IW1A 3S1AA 4BVJA 4MKHA 1TZBA 2FLVA 4J0DA 2XF8A 1BKYA 4IXNA 4QC2A 4DV0B 1L7EA 3CGGA 4WZAA 1JR2A 1PL7A 3PDCA 3OD5A 3WJ2A 1GRRA 2WWIA 1LDMA 2O06A 3Q2KA 3QWHA 1LSUA 1RSZA 3FGZA 3TLZA 2W8BA 2ZIUB 1HNXB 1NY5A 3GA0A 1XRSB 2JRCA 4BJ3A 4E33A 1LZLA 4S1TA 1ZIPA 3EWSA 1JLLB 3JQ7B 1QZZA 5D5PA 4OI0A 4GP6A 2ZBEA 2ZYDA 3Q85A 1SBQA 3ZNQA 3LHDA 1F8XA 2XUIA 4JBWA 3FOEC 1NVBA 4G0PA 3K9NA 4XD7D 1T6NA 2B8JA 1SOAA 5ICMA 1N8NA 4G2TA 4BX0A 4ADSG 3FCUB 4D8YA 4EGJA 2OG1A 5GADl 3CWZA 1YZ3A 3HDHA 3UHFA 4DQ0A 3V7NA 5KOHA 1GL6A 4KLRA 3AP1A 5K51A 2UKDA 3CUEF 2HWKA 5CCBA 1MRZA 2BRUC 2Y1LA 3C43A 1ZGJA 3VPHA 1QU2A 4TTRA 1X7XA 2H8KA 2PFSA 2DMRA 1UJNA 1LLUA 2WF5A 3H42B 4QA9A 4XEUA 2HMSA 3IP3A 5KQSA 3WBBA 2JGNA 3UFXB 1CRPA 1FXWF 3DPSA 1EQUA 2BSAA 1P33A 1NR7A 4HC4A 3GGDA 2VJAA 5J1TB 3RV3A 1UBMS 2ISCA 3DE4X 4BEBA 2RKBA 4EQ6A 1U1EA 3T61A 2PMCA 2C4TA 4QQFA 4UUAA 5KAMA 4C3UA 5C5IA 5CAEA 1GLGA 1WVIA 1QUFA 4HGOA 4K9SA 1CP3A 4FOPA 2XZDA 2AEEA 3QUQA 4MWTA 2BTEA 2PHZA 3EG9A 3GLFB 3R5KA 3HKEA 5BRJA 3CINA 1WKVA 5FTWA 4L6AA 3H4TA 4P84A 4YCCA 4XQ9A 2E5WA 3BE5A 1OMOA 1Z0JA 3AB3A 1KAMA 1FUIA 2JEZA 4KPUA 1IY9A 1UKVY 2IVFA 4B3JA 1N3LA 5K4HA 3P45A 2L0XA 2UYYA 3C39A 1J1UA 3QUAA 4QTXA 5ECYA 2YWEA 4NU8X 1PNTA 2ZE8A 4N3NA 1MX9A 2AD5A 5C51B 3DG9A 3LKDA 5LSAA 4C14A 2BUBA 1PG5A 3MZ0A 4ZV9A 1AQ6A 3R76A 1VJTA 1XN4A 3TTUA 2VRCA 3VPCA 1FLDA 1VOTA 4MV9A 3WB2A 2I4IA 2LD4A 4W1PA 3WV5A 1JQAA 1ZAKA 4HDSA 3OCYA 2YVAA 2BEUB 2JNWA 3H11A 4KH0A 5TMDA 1SBIA 4C21A 5DYYA 2Q2OA 2PA0A 5BN5A 5KHLB 4M3NA 2YZ2A 1I13A 3Q5GA 4B33A 3K70C 1JKMA 1MR3F 2AXQA 4DXHA 1H1LA 1TGVA 4CI9A 2OFPA 3EIXA 1TK9A 3TBHA 3I9V1 1D6JA 2XXAA 4UUBA 4B76A 1N3YA 5JAZA 4KN6A 3CXUA 2FQXA 3UMCA 5J5AA 1ODIA 1E1RA 2HMAA 2XYGA 3IBCA 4C6RA 3U7GA 1BMFD 2F6RA 2EBFX 2P40A 3NI2A 3NIBA 1R16A 3IELA 5EXTA 3FWZA 4LYAA 4XSHA 4K6HA 2QE7A 4CF6A 3S0JA 1VQ1A 4DYDA 5C8YB 1BXRB 1YC2A 3M83A 1G20E 2C9DA 3U7HB 2GNOA 2QVZX 3GLHE 3ZDRA 1IBRA 1V26A 3A6JA 1XXHA 1Z13A 5I9NA 5LIPA 5C7IO 4JQCA 2BHNA 3LUCA 1VJRA 2ZI9A 4ZGWA 1XMOB 2C83A 4CTOA 1SN7A 5KKAA 5L7YA 4CCAA 4ISCA 1G8PA 2E5FA 3C14C 1Z83A 4I4TB 4TROA 4YGYA 4YASA 1X74A 5E7JA 4NK4A 3SF8B 1FJGB 4HVAA 1RLTA 1R12A 3JQGA 2QTBA 4FGUA 3Q7SA 4UNQA 4FLEA 4L16A 1UBNA 2R4TA 3T7DA 2Q7XA 3BL8A 4EG6A 3LLUA 4RVFA 1T5OA 1PEYA 5I9IA 1PS0A 5DNYB 3EIFA 4G26A 4ERXA 4EJ2A 1JIUA 1KYZA 1ZHFA 4DBVO 3LHSA 1EYZA 3C1OA 5K0SA 2CEAA 3CS3A 1QIEA 3RUIA 1IZ9A 4ETIA 5K0JA 1J7JA 3ITNA 3MTGA 1D2MA 2YYYA 5JSZA 1EK2A 1YB7A 1EWKA 3BK2A 4U3JA 3SZOA 4B3GA 3QG5A 2ZTMA 3DOOA 1U8FO 1ORRA 1Z6PA 3EPHA 1FSSA 1GXSA 1N25A 2B0JA 2V54A 4TYQA 3ZTWA 2ECKA 3KHSA 1PJCA 4IUCS 3OY2A 4NAHA 4E11A 2YBEA 4MV4A 3SM9A 4OA8A 3JX9A 4JK3A 3EAFA 4DY4A 2KMLA 4CKCA 1AKWA 1G9XA 4PICA 1C0IA 2M2IA 5JLAA 4KOEC 3UMGA 4BGUA 2Q6LA 1GQQA 4PG5A 4U4AA 4WKGA 2A0UA 4AUEA 4DRXB 3HR7A 1E69A 6Q21A 3QFTA 4HH3C 2Q6IA 4MQFA 4UD6A 3CEJA 1GILA 2O6HA 4EL5A 2FXVA 3E6AA 3QXSA 2W2LD 4LYGA 4YJ2A 3A9CA 2P6NA 3WYBA 5IS2A 1V9LA 4FFWA 3AIIA 3RG2A 5IRCD 1VI5A 1O5TA 2B37A 1VI6A 3K1AA 4AZWA 3G79A 4UHHA 1O9GA 5HTOA 4B09A 4WFJA 4D9KA 3OHMA 3QVLA 4XIGS 2GNPA 4FTWA 4DLSA 4V1CB 4ND6A 1BH6A 2G6BA 2I2CA 5CT9A 4J3NA 2NT4A 5K4GA 4G0OA 1E3JA 2XCIA 2PMKA 4NYMQ 4ME6A 1Y4UA 2HPAA 3A9UA 4MJXA 4R2LA 4Q93A 2IBMA 4S2UA 5FUWA 4B45A 2X5NA 3H2HA 4D99A 3STTA 4L6IA 4AWAA 5K0GA 3A1CA 4WGFA 1U6IA 3SY8A 1Y7IA 2V4MA 2GDZA 4UVDA 3O38A 3OE5A 3TPFA 2DQ4A 4YROA 4N01A 1UMCB 3IIMA 1ZGCA 1H4VB 3CG4A 3HUUA 4RKFA 4TKUB 3TECE 1L5HB 1LB1B 3MGAA 4WVFA 2SBTA 2WIFA 4M1OA 1L0BA 3SYLA 4C0XA 5LLTA 5IKXA 1TFUA 3JW8A 3U3MA 4AMVA 1PP4A 4P81A 4XFDA 1ZL2A 5JYBA 3T3MB 4WNYA 1NT4A 4Z1OA 9GPBA 5C4MA 5K5EA 4RAOA 3ZQ6A 1JR3D 3AERA 1JDPA 3B1VA 4UM9D 4RVOA 2PZBA 4FS8A 3MGGA 3CR8A 3O93A 5A2GA 1DIBA 2Y76A 3DMPA 3JU3A 5BMVB 2WZQA 3B53X 3HJNA 4NPAA 4L22A 4OJMX 1WCWA 2PXCA 5EZ5A 3B7GA 2HWWA 1HK7A 3ETJA 3OU6A 4JI4B 2I87A 2OOKA 4D46A 3RNLA 4W9NC 3C5HA 4AWXA 3HWX1 3DBHA 5J5VA 2WHYA 3GHHA 2JPDA 2PFKA 3JD2A 2A9VA 4EG3A 4V0LA 5EMJA 1IL0A 1F06A 3CF4A 3EIQA 3KXPA 3O0TA 1DINA 5GQSA 3I9LA 3KQVA 4UEJA 3ORRA 4EYKA 5CM2Z 4K7JA 1E3QA 1E8DA 3CR3C 4YWJA 4B17A 4ER0A 2AG5A 1GO2A 1RI3A 2ZS8A 4D41A 3LUKA 1BDJA 4B6OA 4Z49A 3Q3CA 3ODGA 2HNKA 1QS0A 3AFGA 3IOEA 1PFUA 1YDHA 3O26A 4GKBA 4KAFA 3RC2A 2RK6A 2CF5A 3KJFA 5M7EA 4NVRA 3WV4A 5CM9C 3DOEA 4TLDA 1ZM4A 3WYFA 3CX7A 4Q3OA 1J33A 1DBPA 1EU1A 1YS4A 2NZWA 3QUSA 4F5DA 1LW7A 3R3XA 4ANFA 4RZUA 4B73A 1EDEA 4WINA 4CR8A 1E9FA 2XI4A 3ILXA 4JVMA 5EJ5A 2O2XA 4P0QB 2HMYB 4P4TA 5K0LA 5JPCA 5JYCA 5LMZA 3FZQA 3GY0A 5CCXA 4C43A 5KI6A 3IJPA 5GAJA 2VIIA 2QQ0A 1GFSA 1FP1D 2O2YA 3HJUA 3HZRA 1HY3A 3CUUA 4CUZA 3BB4A 2QR3A 3MRXA 1ZJZA 4ZYTA 5IKEA 3DTTA 4N6GA 4RXTA 3B1ZA 4X1OA 1ONPA 1JNYA 3LY5A 5LJIA 5LUAA 1C3XA 1V8BA 2Y1WA 5CG2A 1QGED 2J3EA 4MW2A 1O94C 1Y80A 3FROA 2QB5A 1Q0PA 5E8JA 1GZHB 1HYHA 2BEWB 1SU6A 3BHMA 3MCUA 2C2XA 4TMYA 5HF8A 3DGEC 4PZEA 3F8WA 5EQJB 2CFSA 4BPBA 4A9AA 3NHMA 3PF9A 5BWLA 1SEVA 1U6JA 2JZCA 2B3DA 3DE5X 3K0AA 4NQRA 5JCOA 4KLCA 1YE8A 2R8ZA 3ABRB 1RRGA 3FTCA 1RJFA 4HFRA 4R1UA 4RY9A 4DLXA 1O1YA 1V4BA 1ZA2A 4COKA 4EMSA 1TFRA 4Z4GA 1H1TA 1XC7A 1C9KA 2OEPA 3Q88A 4YJGB 1PGJA 3GUCA 1J8MF 2AF3C 2E4YA 2EX0A 2X8BA 4W5WA 3RRMA 4DCMA 2X3FA 5KWVA 5JCXA 4AO7A 3NM6B 4NC9A 5J4LA 1MABB 4Q1CA 1RZRA 1DMSA 1QFXA 2ZI5A 1OX4B 3GJYA 3O4IA 2P77A 4EGAA 4ZVNA 1RAAA 1Z0SA 4MAAA 3DVAB 1FA9A 8MHTA 2EF1A 1EG7A 1K88A 1YBAA 1Z8FA 4M7OA 1FX1A 3EQ2A 4YRDA 3ASVA 3EN0A 2ZJYA 1EGAA 5TQ2B 3UJNA 5JW6A 4QYMA 2Q6OA 4KO4S 1YZHA 4B6EA 4DR4B 1HE4A 2C3OA 2H1HA 3OQNA 3IMFA 1EUQA 3Q15C 3HYLA 1Y3FE 1QH9A 3E82A 3TRIA 4RM3A 1O9HA 1UM9A 3KYCB 3L9XA 1Y1RA 4IV0A 1TUBB 2FW8A 1BRTA 2J3MA 1D6MA 1BX1A 1A69A 2WG0A 3KEGA 4QM7A 5ELXA 1NJ2A 4B35A 2OMKA 1Y3HA 2JD0A 4Q4HA 3S2SA 2UXBB 1D7OA 1A3CA 3VR6D 3K6JA 1U2GC 3PB3A 3N9IA 4G9BA 5IBPA 2ZJ1A 3ZWXA 1ETUA 1CR1A 3GJ5A 4HTFB 3NVAA 3S2GA 3MFQA 1DGQA 2RGAA 2P3QA 3E1SA 2BFFA 5LA6A 5ED4A 4D44A 4ZKEA 3DO6A 4MV3A 2ECQA 3MWEB 1GCIA 1RYBA 1CRZA 4LEIA 3F97A 3UA3A 3EXIA 2HF8A 3AJEA 2QLNA 4ZTUB 3B9BA 4V0SA 1AK2A 1HKHA 2A4MA 3SXPA 1HEIA 3U6BA 4M86A 4ZOBA 1O4VA 3QGMA 1YI0A 4NBSA 1WIWA 2GCOA 5CB8A 2XEDA 1Q7BA 2R44A 4HEA1 1P2FA 3AJRA 3BGDA 3GJRA 3QX7A 4LXYA 4WEOA 5EI5A 4F3NA 4M37A 5FR1A 3GOHA 5A3JA 3WIOA 5CA1F 5E4JA 4RIHA 3E70C 1IY8A 3KVYA 1LLFA 1SHLA 3R3HA 4IXMA 221PA 1Q50A 2FPXA 3CJRA 4Q7KA 1R0XA 3BXFA 4XKJA 5K3FA 3PIDA 4PNEA 1CB7A 5DNVA 2FSIA 4P5PA 4DDUA 3HU3A 2BJWA 4BVAA 1QANA 3VPAA 2VHVA 2E82A 4J6EA 3EZYA 2YJ5A 3R0QA 5ENDA 4XYLA 1RDFA 1JXOA 1VZ3A 2HREA 5JJIA 1XCGB 2JVKA 4DMCA 5DYWA 3I5YA 5EJEA 5TB5A 4CLDA 3KLNA 3V4PB 1FNSA 1JEQB 4BB0A 4KR7A 4FX5A 2O8BA 1A9YA 4NG5A 1XNGA 5EESA 3SN6A 1GR1A 3V3KA 1REQB 1H65A 4GS5A 2V7GA 3G0DA 1R9NA 2E49A 1NW8A 1Z4IA 2VZ0A 3I9V6 3MPOA 1VL1A 1T6BY 1RWVA 1OTXA 5B58T 1ZH4A 2B3TA 4FYHA 4DADA 5AJZA 4HBGA 1XPUA 5A6VA 4NCNA 5JPIA 4RVNA 2R48A 3ULKA 1JSZA 4IGFA 3THXB 1VL0A 2G3YA 2ODNA 2X0IA 1WHTB 1SC4A 5A3VA 3W90A 4QOJA 4UDNA 3RS0A 4EW3A 3LI2A 4EA8A 1YS2X 4Y6OA 2Q3CA 3H2ZA 4TWZA 4BWYA 1FDSA 2RMKA 4O2BA 1SWWA 2VYVD 4W9RA 1CT9A 1CY2A 2Z9BA 3MCTA 4U1RA 4YONB 3VR6H 1KYTA 3D02A 4B75A 3I01A 2PK3A 3VR4H 1Q0HA 4Q12A 3TVTA 1KXJA 5KVQA 3OETA 2I8AA 3OHPA 4ND3A 2UVPB 4B2LA 5TJ9A 4YO7A 3VDMA 4X9XA 5JXWA 2I34A 1AS0A 3BKXA 4L76A 3LXXA 4OHVA 1PNVA 2BP7B 5DHRA 4E5YA 3VTAA 3U5ZB 2QD4A 4TKLA 3Q40A 1KI1A 3FVRA 1DAOA 3OT5A 3DMNA 2WAMA 1Q0LA 4TZKA 3S2ZA 4ZHQA 1DAHA 1Q1EA 3AF3A 3ANTA 3Q2IA 2ZIEA 1XZKA 2OD2A 4IRXA 4MHOA 5FA6A 1FVFA 1PD1A 3A6LA 3IAHA 1NFQA 1SPBS 2RI1A 4D42A 4XLTA 3PXUA 2C59A 4LYEA 1XCMA 2FW1A 4KJXA 5EIAA 2W6MA 4FYPA 1D1SA 4NCHA 3R3UA 4UEWA 2YJNA 4KYIB 3TTTA 4BMZA 4P4NA 3LPMA 1BEZA 4LSWA 4B83A 1TM2A 1JIKA 4KLNA 1AN0A 1WCIA 4V03A 2V97A 1SQGA 2UU9B 1DEOA 4B44A 3DFZA 4RMHA 1BHSA 1F17A 2AHRA 1N0HA 2H06A 4DIUA 4AYWA 1BAPA 4HXEB 1FMLA 1P9LA 1EFTA 2EBHX 4CLRB 3ECCA 2WD9A 2WIBA 1D8AA 5DNUA 1THZA 4N40A 3BXHA 5JNTA 4IDEA 4R05A 4W5NA 1BQ4A 4C89A 3D7LA 3DMTA 1WW8A 3SEQA 4ZZ3A 2HU7A 2C7BA 3MRVA 1ZW1A 1GFZA 2EDCA 2I0FA 4PINA 1XPJA 1KQNA 2P1RA 4E14A 1JWLA 2GN2A 3NBFA 5GIOE 1GA6A 4FGLA 1M75A 2VSXA 3QKUA 3A6ZA 1KHTA 3AXSA 5AW4A 1LDGA 2A6PA 2I6FA 2X5OA 3WNBA 1PQUA 4Q1VA 3H2SA 4CMJA 4YMHA 1DCTA 4BQPA 5K6RA 1EVYA 4CFSA 3RUEA 2AG0A 5BNIA 5EA2A 4ZICA 1QX3A 3UMJA 2IE8A 1FQOA 2HSGA 1U1DA 2DH6A 1NP6A 1WXWA 1T2AA 3LL7A 4WGGA 4CUJA 3AK4A 3VMFA 1OV4A 1VTKA 3P2YA 1PI3A 1XZAA 3OG9A 1QBKC 1CEXA 2Z6VA 3T4PA 3L92A 4JYCA 1KS9A 1JDTA 2TMKA 3W8EA 3QHPA 2FZ4A 1XCOA 2XHZA 3GVPA 1D4OA 4Q3NA 4ZAFA 1KYIA 5FOVA 3AB7A 1Z7YA 3IVRA 4LRQA 4DLLA 2PGNA 1RLMA 1GSAA 2G71A 2PU5A 3Q3VA 3WLOA 4C0AC 4TZ0A 4KRFA 1OXSC 3P26A 4X8LA 3WVNA 2ZLBA 3FHTA 2C07A 3VISA 5F12A 3UB4A 2PEYA 1VYHA 2AE1A 2I1WA 2NSLA 3EVFA 4MA0A 4RKWA 2IF2A 1FU8A 3SMVA 5IKPA 3LOPA 1N32B 4B8WA 5FBRB 4EAQA 2DBQA 4GO1A 5JNWA 1APBA 3ROPA 1Y5NA 3B6KA 3MK31 1DBIA 3OQ6A 1VCNA 1JEYB 1V5WA 1O4WA 3C41J 3IXQA 2QF7A 3AKYA 4G85A 2BYTA 4G5FA 1UQRA 2FPGA 2XCRB 2HJSA 2JCSA 1ZS9A 2PH1A 1A71A 3CPEA 1PUXA 2HGZA 1KO1A 1Q0UA 1ULTA 4TL7A 3IIEA 3IPYA 2AT1A 2QTAA 2C3YA 3PXEA 4I3FA 4JOBA 2RARA 4M55A 4NX2A 4NATA 3S55A 4P3PA 4X3CA 2P30A 4TSKA 2WC1A 3GAZA 1U8EA 2GTIA 4NSNA 2UZAA 3R7AA 5ITZB 3C7DB 2C9MA 3SKVA 3PNQA 4ONEA 5AJYA 1QPZA 4WXHA 2FRDA 5CFOA 1QFYA 2XYHA 3RQIA 2VPQA 4LRYA 4FHCA 3L8DA 4LYJA 4EG0A 4XVCA 2C2BA 5CXXA 2ZI3A 1S8FA 2BE9A 2Y99A 3PFHA 5K3SA 1DTWA 1YDEA 2RGUA 1E1QA 1WKCA 2QP9X 2WUDA 4LI0A 4S1NA 5FFMA 4CEJA 2DVMA 4C6TB 1DLJA 2A1TS 1KQPA 2VUSA 3B12A 4M1QA 2A3RA 2ZJ0A 3I0NA 2ZUFA 3WWCA 3OM8A 4GI5A 2GVDC 3DBRB 1YHYA 3FPEA 5MN5A 3WWDA 1Q17A 1X8LA 3FE2A 3IOBA 2PCJA 3OFNA 3W8RA 3GRKA 2XWQA 1HE1C 3PGLA 4PEVA 2AJ8A 4M6WA 1MQSA 3HY6A 1CZOA 2WU0A 2F3SA 1RLOA 4Q1FA 1FP2A 1ZWKA 3OU2A 1QHHB 3L79A 4TTJA 3RSGA 2AXEA 5ICCA 1GYPA 1LPBB 4CEIA 3LK6A 2JJQA 4MVJI 4HZGA 2A0KA 3PDIB 3RSSA 2H16A 2GYWA 4G5YA 4G5QA 3TGWA 3GIDA 5CFRA 2W2KA 3MMZA 2NG1A 3KETA 3V1KA 1E4OA 1YCDA 3VVCA 4BVFA 1GQOA 2GZ1A 5TC4A 3WIEA 3SS7X 4QBFA 5CFQA 3QMMA 2GTPA 4TMFA 1OH8A 4AM8A 4YCBA 2DTEA 3HZHA 3KKQA 1TO6A 4P4GA 3VKVA 1SXGA 1VJDA 2VPYA 1LRJA 1Y5LA 3I3SR 1J2JA 5FRDA 5CNMA 3TLGB 4CKWB 1RYNA 3MWGA 5F21A 2D4HA 3WQSB 2QQ5A 1M8KA 2RFLA 3GZJA 4M0DA 2OCLA 2PGLA 5TIIA 3SQXA 4N3GA 4L5BA 2IHZA 2H08A 1WZUA 3A4TA 1OIVA 2O2JA 3OJEA 1GPH1 2HYDA 4J0HA 4M8NE 5CDUA 3Q5EA 1JR4A 2YZNA 2X5XA 3AM1A 1CWUA 3ECSA 2R8BA 5AQEA 2VJYA 2WNSA 4WECA 1ZSNA 5IEBA 2VAWA 3OY7A 3GH1A 3NWPA 1E32A 3HE3A 4GXTA 2RHDA 1T4GA 1UBTS 1MFZA 2R8EA 1AVTA 3CGWA 5CHYA 3WGKA 4YLEA 5J47A 2X77A 4YY3B 3LG2A 3ZQ4A 4F46A 3F47A 3JARB 4NABA 4N54A 3UZUA 5IAAA 2OVFA 4ACBA 1Q21A 3JQ6A 5JS7A 1PJBA 2GO7A 3IQGX 7REQA 4GBJA 3ZD6A 1SZCA 1QSGA 3DMRA 3JTEA 1A5SB 3D0OA 4LY6A 3BAFA 3CNBA 4C1NA 4K3VA 3LUGA 5JSUA 3HHPA 4MUMA 3KPYA 4C0JA 5JSFA 2QENA 3DAOA 4J16C 1V5IA 2H4HA 4M9SA 1ZSVA 2PG3A 2I55A 2WUFA 2OWEA 3L6BA 5IJAA 3OFKA 3WAGA 1JSRA 3BWMA 4B6JA 1R00A 4HH4A 4WXRA 1HLPA 1H9CA 4P7BA 1O57A 3ENKA 3ZH9B 2WMDA 1XF9A 2G5PA 4O3FA 2EP8A 3WQBA 3KSUA 3AKEA 2PJRA 5CXUA 5T5QA 2W4IA 3BBPA 5K05A 4LECA 3OPYI 4KREA 4QJ4A 5CVVA 1KMQA 1S3FA 3V4RA 3B7WA 1XZQA 2V6BA 4U00A 4ARBA 1IY1A 1DU4A 1NKVA 4NFHA 5L3QA 2HYIC 2O8DB 3ACBA 3BRSA 1E64A 1HL3A 1U2PA 4MVJM 5ITVA 4Z4FA 3OCUA 3IUYA 4HEA6 2WDPA 2IT1A 5A0FA 3WHPA 1IU9A 5F5NA 4PCAA 4Y1FA 2PRYA 4JX8A 1GCAA 1RC1A 3CPJB 5A9SA 3RABA 4IIJF 1Z37A 5IDQA 3TZ6A 2XB8A 3ET5A 5FAKA 3QEAZ 3H5NA 3PRJA 1P45A 2PXXA 1CUFA 1E2IA 3KOYA 3WAKA 3TQOA 3EUWA 3L46A 1NDQA 3L8YA 3OEEA 1P29A 4YJ3F 4MQ4A 1GZDA 4DREA 2B98A 2ZT7A 3L0OA 5I4BA 4MIYA 4KRXA 1LCIA 4I55B 1E5TA 4JCCA 2R6CA 3NTQA 4GI7A 4HNUA 1S9DA 3DLTA 5FBVB 3FTFA 1E6MA 2HXGA 2GK3A 3AO0B 4M21A 2GS9A 2F8LA 3VYUB 4CRWB 1YB2A 3KSBC 1SVIA 5LP1A 3K8QA 5MN6A 7ADHA 2EERA 3U39A 1L9KA 4AURA 2XKKA 2Z4TA 3SQMA 721PA 3PEYA 2DE0X 2ZQYA 4C0QC 2A7QA 2XB4A 3K4PA 3NORA 4GICA 5LR6A 1FNBA 1JDBB 2P7IA 4NS4A 1E3SA 1K27A 2DAPA 4G63A 5EWJB 1GAXA 2CHUA 2YY6A 1NJ6A 4X0EA 1OH6A 5JDCA 1BFKA 1OIXA 2VTEA 2AFHB 1V7ZA 3KYBA 2ZDHA 3GN1A 4H4CA 4L4SA 5JZVA 3AQ4A 1QGYA 2WYHA 4RFVA 4D9FA 4WESB 3WWYA 3ZY3A 1D0IA 3PNLA 2C4HA 2WKQA 1P31A 5I5EA 1CTQA 5ILQA 4DV1B 5G40A 1M9NA 4YCNA 2Q2NA 3DQPA 4BLPA 4ENVA 4LXTA 4G09A 4OY3A 3UUGA 4E21A 1OX6A 3G2QA 2XMSA 1HLGA 3DMHA 1NN5A 1ZNWA 1YH3A 1IRIA 1NNSA 1B0AA 3P9XA 5JS2A 4IHAA 4GXRA 1FFWA 1EQ2A 2DWCA 3A0RB 3B13B 3DL4A 1EK6A 2CJYA 5LC1A 3RTDA 2Y77A 3KBBA 3MJEA 4W5JA 4EKYA 2QBYA 1ISPA 1I1OA 2WZDA 1GT6A 2FPPB 2X6TA 3ISTA 3P0RA 5KPDA 3PVZA 4B9EA 1JR6A 3B6MA 1U8CB 3TLCA 3WL7A 2XCQA 3ZJ4A 1QK5A 3OEYA 2ZCJA 4D25A 4L72A 5L9AA 4XGIA 4D9HA 3TNYA 2YZKA 2IYLD 2Q4DA 4WOKA 3S70A 5AXAA 5HRAA 5ICGA 5IVKA 4R8LA 2Q9AA 4YRRA 5EC8A 3U3XA 1AHHA 1CE8B 1M2GA 1YR9A 3E8MA 4HB0A 5G41A 4CIDA 4BX2A 4A2CA 1NUPA 4QUBA 1RR6A 2P0YA 4LFBB 2WWFA 4HJXA 2DSNA 4B6QA 4HGNA 4XW2A 3NS7A 3CG0A 2CHQA 5FAXA 3OCXA 3H18A 3BE4A 1Z8HA 5JCZA 5F9HA 3O9MA 3ETDA 3N7UA 3FWPA 5FPSA 5EVJA 5D51S 3QU4A 3LF2A 2HK9A 3A4LA 4DC1A 2QTMA 3A2NA 4PZDA 2PA3A 2ADMA 3NOOA 1CHNA 2ZAOA 3TQSA 4CMIB 1J0BA 1OY1A 1OASA 1YVRA 3KO8A 4R1MA 5CMLA 5DYIA 3URMA 5CD9A 4DXDA 2WWVD 2Y2UA 1R0RE 3IKMB 1BCRA 1P1RA 3RF7A 1Q91A 4KWHA 1W0JD 1N34B 2QQFA 1XMPA 2XHEA 5LQUA 2AC2A 2QN1A 3HO1A 2IIQA 1PQYA 3PQFA 3Q6MA 5CA0A 1YRHA 1Z15A 2AGVA 2ZR8A 3WHKA 2IUTA 621PA 1CEQA 3TTWA 3NPAA 3VTFA 2Z4SA 1QP4A 1CUEA 3NHRA 2HX1A 3O8QB 3S81A 2ZJ7A 4FI3F 5T4BA 3CZCA 1CZHA 3IP1A 3NIFB 1RJ9B 3AG5A 3WDKA 1E96A 1CQIB 1ACLA 4MPRA 5FA5A 2PWZA 5EJFA 1OPRA 2JFPA 2WKPA 3ZW7A 4BFTA 4TXNA 4BIIA 3AVYA 3N6RA 3CZAA 2XW6A 1F2TA 3BJMA 1K7SN 5HIAA 4EW1A 1SCKA 3FTNA 1FTGA 1UBGA 4XDYA 2A1UB 2PSJA 3OX1A 3ZGYA 1WB6A 5BVGA 3KG2A 5EIBC 5FNVF 1E9DA 3AHHA 3K0HA 4EY8A 1SXHA 4X65B 5FFNA 2EFGA 4PU0A 2XUKA 3WDMA 2VZ9A 1N2ZA 3RYIB 1X2BA 3FLBA 2YHAA 3PRYA 2E3JA 4QDUA 1K4KA 1M67A 1MEJA 2FPRA 1E2GA 3MRSA 4H17A 4PR3A 3JASA 1I3NA 2VTDA 1GYQA 1UBSB 4UEOA 7YASA 2LKCA 5EUQB 2XQIA 1RIFA 2XNSA 5F3RA 3A10A 1ZI9A 2ZEJA 1C41A 3A1WA 5BSRA 2NUBA 2VQ3A 3MWDB 4LPSA 4JD5A 3IXLA 2GLUA 4HAIA 2PIDA 1IPFA 4PW0A 4RK0A 2YWHA 1P3DA 3GT3A 4Q9IA 3EWIA 1RYHA 1KP3A 3LBHA 1SU7A 1UKBA 2TMYA 5GONA 4CDGA 4X1KA 4ZIRB 1NASA 4RSHA 1RP1A 1LDYA 2MR6A 5J2UF 3HLTA 3H2GA 5G4LA 1U3CA 2FDCA 3HXTA 3G0HA 4LY3A 5ESDA 5G1PA 1QE5A 2BBOA 1RI2A 3N3BC 4E15A 1T5LA 3R2JA 1Y98A 4Y67A 4ALMA 2W5UA 4DAEA 4UNNA 1IBLB 4S12A 2OG2A 3KB6A 5J23A 2AG1A 1RQRA 2GN0A 2VKQA 4KXNA 4OU4A 2CWWA 2ZYAA 5FQNA 2X9VA 1IWOA 3WLQA 4BNIA 4Z0TA 1OBCA 5FO0A 3EZXA 1UDWA 4O4JA 3VKWA 3FKQA 4XCVA 3T7JA 2ZIAA 4DHWA 3RFXA 1Z5NA 2VSQA 3BFKA 1R37A 1O87A 2NW6A 3BULA 3L1IA 1ABBA 2VDJA 1Y3AA 1NI5A 3GVHA 1AUPA 4C7OB 2LDXA 3LW7A 1GZ5A 1PJTA 2PUEA 2LXNA 1EUCA 3RD5A 3AETA 4NBWA 5FUYA 2D62A 3VHQA 1XMXA 2M6SA 2R6GA 3K0FB 5BP7A 3B36A 3P5BA 4ID3A 5DBGA 1CQJA 2LPMA 1GNRA 5HMLA 4AJOA 4EZIA 3LUFA 5IANA 4QPJC 1OH7A 4UEQA 10MHA 3K32A 3WK6A 1V3VA 1Q1GA 3FAZA 1N2HA 1TB4A 2ZJ2A 4G97A 4X85A 5HUJA 5L4SA 5LZ8A 4ZT6A 1MORA 1SY7A 2P5SA 2ODEA 3PGVA 3SNHA 3TIGA 3TS1A 3V1MA 1JHVA 3A05A 3ID6C 4MQMA 1GL3A 3Q7QA 5CX4A 1Y8CA 5EJIA 3M6IA 1PBTA 3YASA 3HKCA 5AW0A 4BX3A 3B1FA 5JY1A 3TLJA 1E4YA 2QDXA 3F6YA 4QBHA 3P0HA 5C9ZA 5IULC 3U4QA 4KVGA 1WXFA 3O4HA 3HCOA 4GR9A 1X8KA 2CJWA 3OEWA 2J6CA 2M6KA 3ISVA 1TVKA 4EZBA 3TSCA 5L45A 1KI3A 1LTKA 1ZITA 3DOIA 5LU9A 4KRGA 4C22A 3SIXA 1E20A 4RHXA 1WP9A 2YNMD 3JZDA 4FX2A 1R18A 3RU3A 5FWAA 3ZTTA 4MOWA 1WB5A 2LIVA 3GGPA 3TF5A 3W5AA 3JAWB 3TXXA 3ED5A 2Q6VA 3I2GA 5BV2P 3KXLA 4J0KA 4OHXA 3PYLA 4J0GA 4EITA 2JIZA 1L4KA 3LUAA 2BI7A 3L6EA 4LW8A 3ELWA 3WS7A 4TKVB 5IC4A 3C6MA 4D26A 1Z4QA 1Y3BE 4F9FA 3D8TA 2OYCA 4GI2A 1KO7A 3L4EA 4HHEA 4HRAA 4AROA 3V9AA 3AOGA 2ANCA 2RJNA 4JQZA 3MXOA 4UBKA 5E3JA 5HDBB 1W59A 2JFWA 2MSEB 4TVBA 3RVRA 3EFBA 2FZEA 2I76A 2ZB4A 1GPBA 2I4OA 3AC0A 4LJLA 1FDWA 1NF9A 1A76A 4AUMA 1G3UA 1T0JB 4BBAA 1AE1A 3BB1A 4LF5B 3BRQA 1P7PA 1EG2A 1PK9A 1XAJA 2V58A 3NBQA 2ILVA 3V32A 4DR3B 2IPAB 2Z9DA 4OHCA 4A1OA 2W2XA 4TRNA 3F7MA 5M29A 2ZREA 5K0BA 1ZUWA 4ZVPA 2GEJA 4M9CA 1T4DA 4YP0A 2XGSA 1FP6A 4RTQA 1XQ9A 1K75A 1FDOA 3M7IA 1N2OA 3G02A 1II8B 1V8PA 3W8DA 2Z8XA 1EPUA 2H6EA 3DBLB 4HAZA 4B4VA 3G9TA 5BWBA 4Q7MB 2IPOA 1Z88A 2BEVA 3CKLA 3JQCA 5AVKA 3FVQA 2O19A 1EVQA 2K6GA 2BZ1A 2DPMA 2X4IA 3TTYA 4EY4A 5IMSA 4GEGA 2WD7B 1OYOA 3FPAA 4OB8A 3VDXA 4BATA 2BONA 5L7TA 1AZSC 5ALXA 4ZU6X 2XLCA 5CVCA 4Z9BA 5I9TA 4AX4A 1CDZA 1U3UA 2CFOA 2JLSA 4W7SA 3E9NA 4B4OA 2ZYIA 4K9PA 1F5NA 1HFEL 4MSUA 3TCNA 3QTBA 1LV7A 3VX3A 1KJIA 2PZMA 3RKRA 4R0MA 5B6PA 3WRYA 2O0LA 4TT3A 2XGJA 4M38A 3RS3A 2X13A 5BW5A 1H4SA 2O7NA 2XAUA 3V6LA 5EMMA 1B6RA 4DB4A 4PLGA 1T2EA 2WMOB 4DCNA 5L51A 5JZBA 1GLVA 4QLBA 3ICWA 3AL0C 1E2BA 3H97A 4F2WA 4O33A 1SHKA 2QYTA 1AKVA 2GASA 3GA5A 4EX6A 2Q0SA 3F49S 1EKXA 1SVUA 5B3KA 1AF7A 2VJMB 4BEVA 2JI9A 1A8QA 3LQ1A 5KNLA 1GA4A 3TVDA 3JQEA 1OR8A 1NQVA 3O73A 4US1R 1D1TA 3SVTA 3EDOA 3ZVNA 3SWWA 3CZQA 3M1YA 3I8SA 3CLTC 1JDZA 1P2TA 2X9NA 5BNFA 2C2WA 3U4DA 5B4TA 1JFSA 4A4DA 3GFGA 1QOPB 2ORVA 2R6JA 2PAAA 5LD2B 3B51X 3BHNA 5KCMA 4R7TA 1KDTA 3P9CA 3WYEA 3PUHA 2EHJA 1FFYA 5IFKA 1WBJB 1W0CA 3N2KB 1N2CB 4FR2A 2RAPA 1L3BA 4X6LA 4QHSA 1ECPA 4NENA 3ROTA 4DAOA 4A03A 3AI1A 3ZNOA 4CETA 1NVMB 2ARKA 2QTLA 2R751 3H9QA 3J7TA 1Y8AA 1YRLA 2K4MA 3KJQA 3L7KA 1EEHA 4GPZA 3V8QA 3ZWAA 2YHIB 4U2BA 5KJFA 1BU8A 1J8VA 2BCJQ 1A4UA 1T0UA 3ZZNA 3SZGA 2R97A 4E51A 1G42A 8ABPA 5FH9A 3T1TA 5DLDA 2XQFA 4KO1S 4V0OA 5E9JA 5L3RA 3VTKA 1GITA 5FO1A 2Y3IA 3VU1A 2OPBA 2FHPA 3BYZA 4D56A 2IYYA 3BD7A 4FHEA 3BRWD 5K2MA 2A5FA 3G6KA 1BD3A 1U2SA 1VG9B 4YV2A 5BSVA 1PFQA 3HA5A 4YXFA 1ZD9A 4OSPA 5H4HA 4OQPA 1GWNA 2XKJE 2JJ2A 5KYYB 4PAOA 4X41A 3GB9A 4PS1A 3CLUD 1R5NA 4F8YA 4KNYA 1CG6A 4LV8B 4I5GA 4UTPA 1YE5A 3QEMB 1QNFA 3CWCA 3PJGA 4JBGA 5B3JC 5CBPA 1ULBA 1HF3A 2W4QA 1KI4A 1BVHA 1J0EA 1KQOA 1Q12A 2E89A 2NZYA 3KT0A 2QEQA 2HA0A 3FOWA 1PEKE 5D01A 1MGOA 1PJRA 2CUTA 5TQVA 2FK7A 1PV1A 2AMYA 4BFYA 5JI2E 1MIHA 4PX9A 3QPVA 4JBHA 3WZ2A 3FCOA 1TO2E 3VMMA 4ND8B 5PNTA 3FNHA 3MC1A 3RIHA 1SC9A 1WV0A 1MIOB 2CL7X 3RAFC 3KQWA 3SJZA 1YZGA 1ODFA 2VRBA 1KZ7B 2ETVA 3QNMA 4EABA 2C4NA 4CG0A 1T4MA 3CBQA 5ALQA 4K9OA 3SR4A 5JATA 2P2ZA 3HLYA 4F4FA 5DHTA 4I1PA 2UAGA 1ZC3A 3HNPA 1QGUB 2ZWOA 3UOGA 4B6FA 2GKOA 2D8AA 1JKXA 4J0CA 4WBSA 3BWXA 2FOXA 4P80A 3KL2A 3L6UA 4PIVA 3HVRA 1Z0ZA 2F00A 1W1WA 4KE7A 5IZCA 1KR2A 1Z7BA 4RQTA 1KMMA 3CIFA 1IQUA 4L7QA 1BXZA 1OXBB 2Y1KA 3D3WB 4IHKA 1WSDA 3SF0A 3K6RA 2PDAA 2IZ5A 2Z2XA 4QUGA 4IF6A 3FSEA 3TOVA 2CXPA 4GX1A 2CE7A 3F74A 1GJRA 4PNHA 2N46A 4WERA 4UOEA 2P65A 5DF1A 1VJ0A 1E0DA 4K9MA 4XX0B 5KOYA 1IUKA 4PM4A 2P91A 3DUWA 1S7CA 2H7CA 1XLTA 1E18A 1VPEA 2VPXA 1B42A 5DLQC 4BNGA 3WWPA 2N3ZA 4PYJA 4R1LA 3OZXA 4U9IS 3KOXA 4EBFA 3CN7A 3F4LA 1BZYA 2C9BA 1WMAA 1OYVA 1QVAA 1O5IA 1U9CA 1R0BA 1D2AA 2CYBA 4HO1X 1R74A 1JI3A 1ZPDA 3C8ZA 3H8JA 3ZWDA 4M36A 4NKRA 1VPLA 2PQ6A 2PV0A 4Z9AA 4LWQA 2Y9MB 4CMBA 4CMEC 4XAQA 5DM1A 2OBNA 1E2JA 1CJKC 2B1GA 2Q4EA 4F60A 2PKXA 5JS8A 4E12A 2B9EA 3FW1A 1YWGO 2Y66A 4IVNA 1AS2A 2OENG 8ATCA 4IQFA 3TR0A 3L4JA 4DIDA 3OTHA 4QJ5A 3ADOA 3I5MA 4DV3B 4AY3A 2OXCA 1QB7A 2PZAA 4Y2HA 1T3SA 3IEXA 4JLOA 3VV2A 2QGNA 1WSWA 3BMQB 1QV7A 4D0GA 2Y1OA 3ZLJA 5DYGA 4BY9E 2CD7A 5JJLA 1P9NA 1Q0RA 4Z7QB 3IXMA 2H4JA 2V65A 3GZTB 3C87A 4J0IA 4KSBA 5ALJA 5H1YA 1G98A 3OLXA 3U61B 1JUDA 3CYFA 5JAHA 2IY7A 4IILA 4GE3A 4EELA 2QR2A 4Z5XA 1LU9A 2FEXA 2R7AA 1RJWA 1IG0A 3G85A 2RHGB 2BTQA 2ZUEA 1UINA 4YYZA 2ONZA 1AZTA 3G9ZA 4I50B 1L4EA 3ZHUA 3MTDA 4X92A 1QZTA 1UK7A 3DZGA 2JJMA 4M1WA 3T4EA 1JDSA 3GWZA 3CVJA 4OEHA 4BQIA 3V1TC 3E5MA 2AQHA 2FSSA 3ENZA 4ZCMA 4AY6A 4IICA 4JLPA 4JLNA 4IKPA 4QFMA 4AJEA 1SVNA 4RM2A 5DKFA 5TRTA 3L41A 2A30A 3BMXA 3TMAA 1OLXA 3CF6R 3I9KA 1XWWA 3HEAA 1N5KA 3PNYA 5F5LA 3EGDB 1G66A 4GWKA 3INRA 4PQYA 5HF5A 4RHUA 3DR3A 2E4UA 4KIUA 3HU5A 1IHYA 3PXBA 1EFVB 5SYAA 1FJ2A 2H57A 3UJ8A 4R4JA 2QXTA 3PF8A 4IO1A 4WZAB 2V8BA 3C7KA 4R8SA 2BGRA 2J0UA 3ORHA 5AVQA 3TYXA 2VJDA 5TPZA 3RYFB 3T5CA 1MB2A 2WK1A 2V7PA 4PLHA 4EUHA 5IVPA 1H94A 2X8JA 2OXRA 5AHRA 2ORYA 3TUIC 1PV4A 2HADA 3ZGLA 5U4XA 1PR9A 1A97A 4PHCA 2YIDA 2OL4A 1Q1NA 3OIUA 3D3EA 1YRBA 2QL6A 1T8YA 4IDHA 2PKQP 4RSGA 4UDYX 2B8WA 3MCWA 5COBA 3DDHA 5FB3A 1ZCZA 3W78A 3NHFA 2WQ7A 2QTGA 4J4TA 3NR2A 3EIHA 1THGA 1WU8A 3G1TA 3L5OA 2FF7A 4UPDA 3DZFA 2HF7A 3AMVA 3PSAA 3WRXA 2O5CA 1NU8A 1NYLA 4JL8A 5DHSA 3DYBA 1ESNA 3PCRB 5KOHB 3ZD7A 3R75A 3UXYA 4DDKA 1M6VB 4ZRDA 1NBEA 1Y33E 4FFOA 1B00A 3P9SA 1X7XB 4KOAA 3ZN2A 4DKJA 1TK3A 1Z2DA 4HGZA 4IX1A 4RZ2A 1HZZC 4OYHA 1P0FA 1RC0A 4TXJA 3UBTA 4RTRA 4HLDA 5ECDA 4G1MB 2D2IA 2NXJA 3GARA 4PHGA 3QWFA 4YAGA 2WABA 3PPYA 3VNSA 1CP2A 3VH3A 4EQ6B 1WNFA 2HPZA 2NGRA 4CIVA 4YACA 3CUWA 3QSGA 5GOTA 4WRRA 2BM0A 3PVSA 2ZIXA 5EIWA 5JO9A 4DCTA 5BN3A 3HKEB 3DJYA 4DR7B 1AGRA 4MS1A 4ZQIA 4N6NA 1TRHA 1H3EA 2FUG1 2PJZA 5AKJA 1L5SA 4LF6B 1SXJB 2P4SA 3KKMA 2FUKA 4O8CA 5BY2A 2F3PA 5JJ5A 2OD7A 2XY4A 1JG2A 3L0DA 1D6SA 3AUXA 4GSLA 4A1FA 5LZ4A 1I24A 2C03A 3P2IA 3WGVA 1DG9A 1OLUB 1ZI6A 821PA 1RHKA 3QA3E 2Q3DA 4HPXB 3M3DA 2ZJ8A 3RK4A 3S7ZA 4ZOLA 3K15A 4EGQA 4YB8A 3DQQA 4KUHA 1T4BA 1TZ2A 4A91A 2AG8A 2VAPA 4GU5A 4ZMRA 3MJRA 1RKUA 1ZM7A 5J9FA 1SZDA 2VDNB 3G5UA 2O4CA 4L08A 3TNDA 2HWYA 1DCKA 1DBSA 1OWPA 2YXEA 3H11B 4JAVC 3AWIA 3LKZA 3TZCA 4FZ5A 3NCHA 2CBXA 3MBIA 1G3IA 1E99A 5J2TF 4AO6A 3EVNA 2FR8C 1W19A 3IR5A 4DDWA 1H1LB 3D4OA 1ISMA 4R1OA 4V2IA 4ZZ2A 2JGRA 4ZU3A 3WAJA 2XXAB 2OBLA 2WU8A 2YIMA 1AA9A 4NBTA 2CKMA 3DMGA 3IRVA 2WVGA 5AM0A 5GM1A 4KUGA 1D7AA 4OA5A 5KHAA 2GAFA 2OHGA 4JP2A 2WVAA 4OX9B 2FEOA 2YX1A 3SXUB 2RGXA 3CW9A 3LL4A 2BE7A 2C4MA 4IX9A 3U4CA 2VUHB 5J58A 3RASA 4NARA 4XQEA 2BFMA 3BMCA 4L15A 3SR0A 4YQYA 4LX8A 1E5VA 3WHLA 4HMOA 3REQA 2UZIR 3O1LA 4MP8A 1IIRA 4KWTA 3A3PA 3HY4A 4N39A 1ADYA 1XXHB 3QOFA 4JS0A 1QMGA 4Y2GA 5G0UA 4ZHSA 4PPQA 4HLCA 4WZ6A 3PHJA 3RK0A 1OGIA 1DEHA 3BIXA 4JEMA 4CL8A 2WMNB 4RZQA 1JMVA 1IAVA 1NBHA 4ZI5A 1NXVA 1OHHD 1SUCA 2VS1A 5IJ0A 3MAAC 4F6CA 3WICA 3EOAI 3F4KA 5DLYA 5JALA 3EFOA 3GW8A 3SIRA 3RYCB 3H2BA 4MV8A 4FOTA 3AM5A 1U94A 4X62B 3ESRA 2V7WA 1BDIA 2QRVA 4JCOA 4E46A 2DJ5A 4KW7A 3NTUA 3RSHA 1KEWA 5AUNB 2X1VA 5DT9A 1YUBA 3I45A 5BORA 1T9KA 4D92A 3GNLA 3HJCA 1PE0A 5IDYA 4QUHA 1G8MA 1A96A 3VSBA 5JMPA 3AUUA 4CU2A 3TD2A 4FN4A 4DRZA 1G5FA 1WKBA 2QI9F 2JVIA 3OTWA 2LCQA 4DG9A 4EHIA 5C5CA 3UW1A 5JFGA 1VA4A 5DN9A 4KR9A 2A1TR 2FEPA 2QAJA 2PX2A 2XT6A 1PWEA 3FGOA 4L9SA 3KEMA 2C92A 3ZTYA 4A8HA 3FUWA 2EBWA 1GXSB 1HO3A 1C8VB 2FZWA 1NG9A 1YS9A 3RJTA 5ADUS 3DKVA 2EWMA 1U9IC 4JBYA 1G64A 4BCBA 3OO0A 2EFJA 3NIWA 4LZNA 4PIPA 4X95A 1J70A 3LHKA 2CDBA 1GHTA 1VRCA 4M4SA 4CKCB 5HXAA 3WMRA 2GN8A 2J08A 2I1QA 1YL7A 1IUNA 3PJDA 2O2IA 1A5ZA 2BFAA 2VF5X 3ZU4A 4QAQA 2UUAB 3K6KA 3RAEC 2C78A 5SYNA 3ABZA 2WHXA 3GAAA 3UV6A 2YZ7A 4D81A 3PJRA 2YMLA 3B3GA 3CZPA 4OF4A 2FDRA 2PX4A 2JLQA 3NNNA 3PC8A 1TL7C 1NP3A 2QZ4A 4UJ3A 4A0HA 4UCFA 3PR1A 5G3ZA 4P08A 4BO6A 3E81A 3M49A 1NI4A 2OHVA 1LSJA 3FB1A 3K0BA 2QORA 1XAIA 5H59A 5JAQA 4KN9S 2ZUBA 3PT9A 1T2VA 2P9TA 1QX4A 1KPHA 1J7KA 4EVSA 5KCZA 3EPJA 1EXDA 1YKGA 2WMYA 3KKOA 4LXHA 3WQRA 4A0SA 4QTYA 4W5TA 2AOVA 2GJSA 2ZPAA 4OUDB 5CVEA 4LQDA 3W79A 4F4CA 5KQGA 1QRRA 4URYR 2J5BA 1PN3A 2DJIA 2QY6A 2XMCA 2QV0A 5A5FA 1THMA 2PUJA 1XVAA 2QN7A 1UMDA 2XTZA 5CG1A 4GKAA 3RT1A 3O4JA 1M2EA 1MO5A 3R9IA 3QXHA 3T35A 5JANA 2OESA 1C7EA 4ML3A 4E5KA 3IQDB 4IUYA 3V55A 5IT5A 4KO8A 4ZEWA 2GM9A 1CQWA 2XLBA 4LC9A 6NULA 1XRMA 2E48A 3O82A 2HMVA 1ZD3A 2CNWD 2UVDA 4LOLA 5C8YF 3HJHA 2DWQA 4F2DA 1X38A 4IIVA 3CHYA 4MWSA 4WN9A 4TYNA 2R60A 2O52A 3I52A 4YHBA 5BSGA 3AERB 5AIBA 2B99A 1V7QA 3ONWA 3HP4A 1UAYA 5EZQA 2P4UA 3RLFA 1UJ4A 2C7RA 1DXHA 1NLZA 3OCZA 1FUEA 3TLXA 4B71A 4GLJA 5CEEA 3O8DA 5TEWA 3RRNA 2OPHA 3PL5A 4TXLA 4JZYA 2R8RA 2JK0A 4HUJA 3SQLA 1JGTA 4BEJA 4LY0A 4XQCA 1PL0A 5EFOA 4M7WA 5HF6A 4B48A 1OB5A 1NI3A 1SQ6A 3IHWA 3DBHB 1ZW6A 2PUVA 3LDAA 2GZ2A 4FGWA 4CM9D 4GNKA 3D2LA 4A0FA 5BQ3A 2D1TA 3DXYA 3V2IA 1E58A 2VUIB 4HTAA 2PSFA 1KNQA 2O2ZA 2JF0A 2PXAA 2Y92A 2NACA 4JJAA 4CKXA 4ATNA 1LVHA 4HSGA 4EHAA 4BUZA 3E9CA 3MTIA 1JG6A 2WUGA 1C14A 2BOVA 4HAXA 1FTWA 2JJ1A 3VR5H 1DJOA 2FLWA 2P75A 2PR7A 4XGNA 2G1AA 4LISA 4I3HA 1HRKA 1PCXA 4I5EA 3AV3A 1TQ4A 1YJ5A 4JP1A 4YRQA 1GARA 5M5BA 4QU5A 3HQ4O 3B7PA 2YC4C 4X20A 5K6TA 2XCOA 4NFLA 3Q1KA 1A9QA 2GA8A 4L0CA 4MVXA 5F2EA 3VPSA 3UK6A 1PJQA 3OLCX 5FI0B 2HLDD 4YUVA 3D7KA 4H15A 3BG5A 1MHPA 2PMFA 1L5GB 3VGPA 4MKRA 3WIBA 1JDNA 1YU9A 4RE6A 1UDRA 3A6GA 1H6DA 1T5BA 2AN4A 4OB7A 3DFUA 5ISMA 1QE3A 4B3IA 3I2JA 4HYQA 1C29B 4R69A 1PV2A 1S8AA 4X7RA 3R74A 5HSGA 4RWEA 5A4JA 1MFPA 1XZBA 3ETLA 5REQA 4EKNB 3FLEA 4NE2A 4GOKA 2XT9A 5E1MA 2IYZA 5JTUA 3IUQA 3Q6IA 4PXYA 3RVQA 3GEPA 1M7BA 5HHTA 3JQFA 4R3NA 5AJVB 1YQ9A 2RI0A 3DNFA 4XIYA 3AGQA 2A9JA 4WD3A 3BB3A 3BN3A 2Q5HA 1NIJA 1H05A 4RVGA 4WKOA 1NRIA 5LYJF 5FTJA 3ZC3A 1KRHA 3NV9A 3QQPA 4GZ6A 1G20A 1S96A 1TM4E 1DPFA 3NU1A 3GLHA 2PX3A 4EIWA 3DPIA 4RU1A 3U3RA 1QH0A 3NM4A 1PLKA 5TJHA 2JCYA 1NR5A 1K8ZB 1LK5A 1W4CA 3NLLA 5EQTA 4F8EA 2P9CA 3ROXA 2C57A 4OQQA 4F6LA 4NZZA 3KK0A 4QX6A 3A4VA 1P9WA 2MYTA 5DHAA 1Y1KE 3T5AA 1OD6A 5GTDA 2HGSA 2PTGA 6YASA 2IKSA 1M66A 4AJJA 4C6HA 2C2ZA 2RC6A 2X1LA 5FUVA 2OZEA 2GF0A 4HYEA 4ZVKA 5LCXA 1BHO1 2DCUA 4ZYVA 4J1NA 4YDHB 3L0BA 2HRQA 3KQKA 1YJCA 2KYRA 3G9UA 5I01A 4O4IA 3ACDA 5CB0A 4ZI7A 4W8HA 5BSWA 4XR4A 5MF6A 1SCDA 3PZRA 1ZISA 5AJXA 4HLUA 3UAYA 4U7TB 4LMRA 1XQ1A 2C9CA 2IELA 5EXPA 4AWBA 4M49A 1UM9B 4L3OA 1I2MA 1NMEA 1W2WB 1P4SA 1T5SA 1XDSA 2V6GA 3PKZA 1S2GA 3QWIA 4B85A 5JWRA 1JHDA 2DZDA 3COJA 2AUTA 5H5JA 1P77A 1TLFA 1G8GA 4Q4HB 3DBVO 4BL5A 1KWGA 3TQIA 2QTFA 4YDSA 5C1OA 7ABPA 2FW9A 3UH0A 4L57A 3QKWA 1D2RA 1BCSB 1W0KD 3IBFA 4DARA 2BFFB 3EA4A 4CVNA 2XE7A 2ACKA 1VMKA 3LDUA 3RJ5A 1TJ4A 4KI0A 1H2AS 1LC0A 1MAAA 2QLBA 2WIDA 3IIKA 4HG2A 3MGCA 5JAMA 1UQTA 3EXIB 4B0OA 2BUCA 5BR8B 1CS0A 1WCYA 1VFPA 3W8NA 4L4YA 1COZA 2GCOB 1Y5RA 2J5QA 3DAYA 5GZ6A 3UB2A 1PR1A 4YMSA 3C2QA 1Z17A 3WIUA 3P8ZA 4BX8A 1MG0A 2LP4Y 2ZBGA 4BNWA 1OWMA 1CY6A 1Z3CA 3A2MA 2CZCA 3HBFA 4UZFA 4PAGA 3RLIA 5D1NA 1MVLA 4GXQA 3LX6A 2CV1A 2CB0A 4IR7A 1R6XA 3OOWA 4G5SA 5JZ9A 2PXHA 2V9CA 3JQ9A 3DZIA 2YFYA 5ALUA 1ZOSA 4RW0A 5CVJA 2IGTA 4MDHA 2ZYUX 3CURA 1DWQA 3D4LA 1JKIA 2BBSA 2IYXA 2GN6A 1F38A 3P94A 4XIFA 3ZCSA 1Z0FA 4A23A 1X7YA 1XJCA 4DUGA 4NV1A 3NDBB 3DO8A 2WWYA 3KKPA 4BNDA 4RNCA 3SCZA 3TXAA 3NDJA 1CQXA 1LDEA 1KYXA 4FMDF 4WDRA 3ZIDA 1OBHA 4Y2UA 5EJGA 5JSYA 2XUDA 1EP9A 3VSCA 4Y98A 2Q28A 5AQ1A 1U90A 4GC5A 3WGOA 2Q6KA 1P5RA 1VJCA 3DEFA 3I62A 2XGOA 3MB5A 3K1JA 4NONA 4ZDKA 1BMFA 4HVTA 4F5WA 1PX2A 2VYQA 3GJSA 5IZCC 1WO8A 1T3ZA 4I5IA 1A1VA 1NXOA 1S2LA 1XZIA 2ZAIA 1R15A 4FE3A 3SFVA 3ZKWB 1N0UA 1E77A 4IDGA 1I14A 4JB3A 4TSRA 3W9YA 3A32A 1XLVA 1ZGGA 5AICA 4KC0A 3ZJYA 1JXAA 1W76A 4JOCA 3E27A 5M3BA 4YRZA 4XFJA 1NNEA 3CLSC 5C8XA 1G8AA 3A3OA 4I1RA 3IDQA 4OHRA 5J43A 1XLTC 3CTMA 4IIDA 2F4VB 1Z4JA 2IW3A 2J9FA 2XKBA 3L7AA 4H7HA 1C8BA 2VJNA 2YH2A 1XMVA 1XZLA 5CUQA 1U8AA 1YQTA 3WLTA 3X2FA 3VH1A 5IKMA 2FJPA 4GDMA 2Q45A 1OLOA 2IEYA 1YU6A 1ABFA 4REMA 3MJFA 3DCJA 1UOEA 1WBDA 4RC9A 1PVOA 1VGVA 1X9IA 2D54A 2XADA 1RAFA 4H16A 1MT3A 1Z39A 3HV0A 4RK6A 3P0FA 4M9RA 4KZPA 1SURA 4KQ9A 2ZANA 1Z7WA 3G2HA 1D6NA 1HQCA 4URUR 4DKXA 1U3TA 1SXJD 1W35A 2AB0A 3G5TA 3ZCUA 3BFXA 4ZCLA 1B8UA 4IDFA 5CVUA 4ZCTA 3P27A 1QH1B 3FNBA 4PS0A 2IOFA 3WTCA 2UYHA 3TNJA 3WGIA 8LDHA 2QTZA 3GXBA 1SUBA 4D79A 4FDUA 4F93B 1JHYA 5CIQA 1U4OA 1VGRA 1IY0A 3I28A 1FL9A 1IMOA 2BKEA 1PL6A 3FPKA 3M6MD 3ETCA 3U4HA 2GEUA 4OXRA 3W5IA 2TSYB 1M2VA 2HDOA 3L7BA 4ZQHA 2ZUTA 3OWHA 4OMFG 2W2PA 5AOBA 2IY9A 3JQQA 1KRXA 1DAIA 1JBEA 4MP6A 5ALIA 4UU1A 4X60A 1VLHA 4DIEA 1DLIA 2IU3A 1IM5A 4DIKA 3GU3A 2QS9A 3DCNA 5F78A 3N2GB 1EFRA 1JDVA 4BYMA 1YQWA 5E9WA 3M0EA 3HCWA 1KDPA 4TL6A 3ZCXA 5F3WB 4Q4JA 3M6UA 5C7YA 5CLGA 3KSRA 2BGNA 3LUJA 3UGTA 1E1RD 1XTQA 2FEKA 3AP2A 4MUBA 4AAYA 4WNIA 3U60B 3HC7A 4JIMA 3NHKA 1EQAA 5AUQA 1FLAA 2RHJA 1T43A 2IWHA 4FMCB 2QE7D 2C3PA 1JG1A 1KOLA 1VE6A 3TIXB 5HGJA 2C20A 1NJ1A 5KU7A 5JIBA 1XHFA 4TLBA 4XYEA 1ZINA 2OQRA 2R6AA 2ZT6A 1X39A 1ZDMA 3A7DA 2E87A 1QAOA 3AKCA 3NP9A 4U2CA 1VKZA 3VHXA 3VO8A 1XVIA 2CVOA 2VDVE 3EZFA 4LIPD 4YMLA 1ONOA 4MI3A 1ZJWA 3GIWA 4R1QA 1T8TA 3A28A 4PYRA 3GJ4A 4OD0A 3TVYA 2POQX 1MAUA 4WLOA 5EE0A 2R79A 1QFZA 2BKXA 3NTRA 1N2GA 4WNCA 3KYIB 2FPOA 2BF7A 3G17A 3R5FA 4XZ3A 1HX7A 4RAQA 2XH8A 5AK6A 1HH4A 4DLKA 2O1WA 4G1CA 2GAJA 1AHNA 1ORVA 1NNI1 3M6WA 1RJGA 2FPGB 2IRWA 2DT5A 1K9SA 2G6TA 3F3SA 3MGBA 3AHJA 3OUUA 4O0LA 521PA 1IVYA 4PXAA 1XE3A 2G06A 4HV4A 2GH1A 3R8CA 3C3BA 2Y68A 4U7JA 1B4DA 3K9BA 1SVLA 5IJWA 4DPMA 3PUZA 1YZKA 3SKYA 3P5SA 1OCEA 1KI9A 2BGMA 3ESYA 2C54A 2R3SA 3OAAA 4L07A 1DWUA 2D3TA 5CPBA 3AINA 1V1JA 5KU1A 1Y42X 3BORA 3KR1A 5CH8A 1N5IA 4BKOA 1EFCA 1K08A 2IXFA 2R25B 1AKEA 4RDXA 1I4OA 1DWPA 3K72B 2PWAA 3VOBA 3GP8A 1K63A 3CXRA 3OVMA 1DTWB 3GPBA 1JTFA 2FXIA 2WYOA 1ZCAA 5KTSA 2P2LA 4CEJB 4LV6A 1G3RA 4Q03A 1DTSA 3KQNA 3BOSA 3P0EA 5JASA 1P0MA 1X8JA 3DVQX 4YRLA 5EZYB 1EFPB 3OQHA 3NALA 3W6PA 4LX0A 5KSWB 4TUYA 1GKIA 3QI7A 4E2XA 2OFOA 1Z75A 5KEIA 2BFDA 2F59A 2IHJA 3GL9A 3ZXSA 3SEFA 4DGSA 1OJ7A 3ES9A 1CLEA 4LC1A 1L8LA 4D57A 1WW3A 4FHGA 5GV7A 5GIPE 2A8YA 1VKNA 4HH0A 4N65A 4M6WB 2O3RA 1L7AA 2AX4A 3H2KA 3OU7A 5HQJA 1KAEA 1SXJE 1ODKA 3ASUA 5CBKA 4LTDA 4CM5A 3A1EA 2ZGVA 4ER5A 4CEIB 4XVUA 5G53C 5HKKA 1AGYA 2WM3A 3M6VA 1SKUA 4KDEA 3WA7A 2CUNA 2B2XA 4PZ9A 4HEJA 1ZP6A 5D87A 5DO9A 5AFSA 4NYJR 4F2PA 2VDQB 1F2UA 2VDPB 2W2KB 3CO0S 1ZESA 3DC2A 5KBYA 5NLLA 2I7CA 2MSNA 2Y9PB 1BS9A 2J7PD 2P9JA 1RVDA 2H92A 3STYA 3RC8A 1ILEA 1V3TA 4OB6A 4IIXA 3OQOA 2O1EA 3ZDZB 4PYQA 2E37A 4HZUB 2C0CA 4XDHA 4BKPA 4PBRA 3KSAC 3R5XA 3G88A 5AI5A 4BE7B 4D3XA 4IWYA 1A27A 3WQQA 5IM4A 2NP6A 5L95A 5LZ5A 3A14A 4LQLA 4FGKA 4WBNA 1XZFA 5A7GA 1KVUA 1M1UA 2FSGA 2ES4A 1NW6A 4B87A 1GU0A 1EK0A 1U04A 1FZQA 2W2OA 4EB6A 2BM9A 1HSZA 1MAVA 5CDFE 3DT9A 3PHIA 2G04A 3F71A 2OCYC 1ZK2A 3CVWA 1KYYA 4OREX 2H5JA 4Z8XA 4B5LA 2HDNB 5EUMA 1JN0A 4K6GA 5FX2A 2OC4A 4YR9A 2QLFA 2R8YA 4EB3A 5CLHA 4CIAA 4DILA 4PLTA 1QWOA 5KHOC 2CMFA 2QPLA 3BJRA 2VA8A 2QW1A 1TU0A 1XMJA 2VUTA 3O83A 4YMIA 1P7YA 2QLTA 3OTOB 1QQ7A 1FLNA 7REQB 3WP1B 5FBQB 3G0IA 2VZ8A 1FNMA 1L8AA 2OGZA 3S29A 4XWKA 1BROA 2OY0A 4NL4H 3EEOA 2HD4A 2H00A 2ONYA 2QG4A 1A9SA 5EGSA 2FNAA 3KYDB 3IQFA 3HXMA 1T26A 5K0FA 3UXMA 4MICA 1J97A 1C7FA 1UR5A 4DSNA 1QB8A 4YXWD 4QYSA 2E1PA 1EJ2A 3GRCA 3VR4A 2PPVA 1KF0A 2QAGA 2FN8A 1I9CA 1A4RA 3AJAA 3LWNA 4E09A 1ZSYA 5DI9A 4P1ZA 1IE3A 4AL4A 1N6RA 4QPPA 2CDAA 3NJ4A 3BJZA 1ISFA 2R5WA 4OJQA 4REQA 5TMEA 1KHHA 2C9YA 3OUZA 5JJBA 1VCIA 2W8ZA 2X7XA 5I7OA 2FSVC 1ZJ4A 5L3QB 3OA2A 4ZT5A 2QTVA 3MEQA 2GPAA 3FWHA 1IOLA 2P9HA 4WK0B 1V8ZA 2PZLA 1FS5A 4BO8A 1YBVA 2JLRA 3H65A 3KTFA 3AF2A 3A06A 4GRIA 3VYRB 1QGDA 3IVXA 4LRSB 1FSGA 2VCEA 1B3RA 4XWYA 5ARBA 5AD1A 2OTCA 3U3OA 3ETEA 5JECA 5ALMA 2E21A 4H7IA 1DFGA 3I2HA 4R8VA 2XDQA 5G02A 3RODA 2D74A 4GG1A 3WNQA 4ZFNA 4YDQA 1GG2A 2C00A 2HJVA 2IUSA 3FOAA 3NTVA 3STXA 2WF8A 1DAFA 3S2FA 1MO4A 4LVNA 3DAGA 3LWDA 4IVQA 3TSAA 3GXOA 5HR5A 3ANSA 4G25A 3TEJA 4D8WA 2QIOA 2FQ1A 4GH5A 4MJ3A 4F2GA 1JAXA 4BMDA 1UOPA 5KNBA 1PYGA 2OM2A 2LZ0A 3I04M 3INNA 4O08A 3ZV3A 4QVKA 4WKBA 1DT3A 3GR6A 3KTOA 4JR1A 3SGLA 3X2SA 1YSCA 1GR0A 2G82A 1XQYA 4J9UE 3E2MA 1DX6A 1EK5A 5HJ2A 2HF2A 3GFVA 3GDFA 1FU7A 4X63A 1RZRD 2QE6A 2IHNA 4DCOA 2YHUA 4V0ME 3RROA 2Q2VA 2QY9A 3SBOA 2V6IA 1BVRA 4DJDC 3JD4A 3SJUA 2V9ZA 3W05A 1ZZEA 4AS1A 4L02A 2BN4A 4G1BA 2Q5LA 1SBNE 3CZ9A 1JBQA 3A8TA 2PGXA 3ZUPA 1ZLYA 1N7HA 5AI6A 3ROFA 5HILA 4MR9A 3FF4A 3VPDA 4LHWA 4QQRA 4BMYA 2GPSA 2QXYA 4RZHA 1OX5A 2J07A 1GPKA 2V74B 3QPUA 4NULA 5EY5B 2VYVA 4QGHA 4K9QA 5TARA 1KYWA 2WHPA 1EB9A 4QTTB 2EFHB 4YGXB 3EC7A 3UAOA 2QW8A 3VHRA 3U44A 2G9VA 5D3QA 4KR3A 1NW9B 2YICA 5EWLA 4ES6A 1RQ7A 5FQOA 2DXIA 2ZVPX 3UFXA 1F1BA 1FDTA 5TPWB 5ESXA 2I3ZA 3BUSA 3IUJA 2MSLA 2YZGA 3KKNA 3OLVA 4RQUA 1N0IA 2CZQA 3KT6A 4K6OA 4JJ7A 3QI2A 2UUOA 3AJ9A 3UG7A 4AICA 5I3CA 3BT7A 4UW9A 1E3LA 1TT5A 1COWA 1UFRA 4KYUA 4JI6B 3U9SA 1K6EA 1QVZA 1JB9A 1LVUA 3EXFB 4XJTA 2ATEA 1GV0A 5D1HA 4KGXA 1KOGA 4H1WA 3K05A 4JV5B 4MI9A 2BFCA 4H7FA 4B80A 3LT0A 3T9AA 3OIYA 5DRTA 5LQKA 4RD0A 2QX8A 3ZZTA 2DY1A 1UFVA 1EZ1A 1T3LA 2K87A 2JW5A 3L8CA 4GMKA 2VEDA 2WYVA 3HKDA 3TUZC 4KQEA 2GBCA 1U7WA 3N0VA 4LHVA 1P7CA 1GGEA 3W34A 2ZBPA 3DH0A 3SYKA 3PCXA 1ONSA 2YJ6A 1TM3E 4B2YA 3OZAA 4FYWA 2AZDA 2CT8A 4RHEA 4W1QA 4D6PA 2VXOA 2BGJA 2LKDA 3DJFA 4RY8A 3HUFA 2WHEA 3K5WA 3MT0A 4KXUA 4TLAA 3FVVA 4JYMA 4X1IA 2VXBA 5DIZA 2GXQA 3TCKA 1FS6A 3OX3A 2X2PA 3T7SA 5K0NA 5A6SB 1YQUA 3CH4B 1BCRB 2D2FA 1UEIA 3GMDA 1UK9A 2Z3VA 3OCCA 5EXSA 4IDOA 4PLCA 4FBLA 2R6ZA 1CVLA 1Y4ZA 5K3EA 1XZGA 2X58A 4EDHA 3BIJA 2RDMA 2JGMA 3C3JA 5LQSA 3R77A 1QHYA 1UM8A 2CMHA 2WJWA 3PLNA 4NRDA 3DO5A 1P0PA 4OHWA 3UKOA 2X1HA 1JIQA 1ZONA 1R8SA 1Y6GA 1CNMA 4WI1A 3JQDA 4JY7A 3JYOA 4UHJA 1YIDA 2DHQA 5E6UA 3FYCA 3K70B 3QXJA 3FYSA 1C7JA 5HWSA 2BSXA 3HJGA 2VAVA 1JZSA 1UKAA 3ZY6A 1F2TB 1XEAA 1F0PA 5EHIA 3HK2A 3PIRA