4F5GA

Rational design and directed evolution of e. coli apartate aminotransferase to tyrosine aminotransferase: mutant p2.
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
399
structure length
398
Chain Sequence
HVGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVLTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDIAYQGFGRGLEEDAEGLRAFAAMHKELIVASSCSNFGLYNERVGACTLVAADSETVDRAFGQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFVIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Janus: prediction and ranking of mutations required for functional interconversion of enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 147
structure length 398
sequence length 399
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4f5gA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4f5gA01
1I29A 1AJSA 1AMQA 1TOJA 1BJNA 2Z9UA 2R2NA 3G0TA 1W7LA 2YOBA 3HLMA 3USFA 4AZJA 3DRDA 1OHWA 4FL0A 4ZDOA 1LC7A 2X8UA 2E7JA 2VMQA 3BC8A 4XQ2A 3RBLA 5IWQA 1AY8A 4XEWA 1W3UA 2QB2A 2Z9XA 2BWNA 4ITGA 3K40A 3RCHB 1KL2A 1AHYA 5C6UA 2Z20A 1BQAA 2AATA 4LNLA 4A0RA 2BYLA 2VGZA 1AHGA 3ECDA 3EI9A 2YCTA 3EIBA 4IXOA 3FDBA 4E77A 2VLHA 1DJUA 1LS3A 1CZEA 1MAQA 3G7QA 2VI9A 1X0MA 2DGMA 4BHDA 2W8WA 1G7WA 1I43A 2JG2A 1AMRA 4MY5A 1PFFA 3NYUA 1AKBA 2OQXA 4WB0B 4F5IA 3EZ1A 2DKBA 5G0AA 9AATA 3Q8NA 1S09A 2JGTA 4M2MA 4EB7A 1V2DA 2C44A 2WK7A 1ASLA 1SPAA 2BI2A 1ELQA 2QBTA 2VGSA 5G2QA 4DBCA 4RKCA 4O6ZA 3AENA 3AEMA 3AEPA 4HF8A 3WX9A 4WYEA 1CL2A 3QGUA 2OGAA 5D95A 2ZY5A 4CBRA 1OXOA 2CB1A 2HOZA 3G8MA 4IXZA 2C0RA 4W1WA 4WYDA 3I4JA 1O62A 1ASCA 3GR9A 1E5FA 4ITXA 2DR1A 5EUDA 3WCNA 1O69A 1KKJA 3KGWA 1V72A 3QBOA 1X2AA 1GD9A 2AY2A 1BQDA 4IYOA 4HVKA 1CJ0A 5FT5A 4Y0DA 4CXQA 2R0TA 1UU1A 1GEXA 2HOYA 3L8AA 1MLZA 1OHVA 4OTLA 3II0A 4PVFA 1GDEA 3T32A 1BKGA 3P6KA 3MBBA 3BCAA 1M4NA 2D65A 1D2FA 1DFOA 1V2EA 3PA9A 1WYVA 2VMWA 4EU1A 1C4KA 2W7LA 3FSLA 4ADEA 1ECXA 1XEYA 4RLGA 1G4XA 2ZC0A 3AELA 4XJMA 1IJIA 3PD6B 1GC2A 4JEWA 4DGTA 3A9XA 1AMSA 3RQ1A 2W7EA 2Z9WA 3DC1A 3MC6A 1SF2A 4MGRA 4N0BA 2WK9A 3NTJA 4H51A 3W1JA 4AH3A 2YKUA 1KMJA 2VGWA 2GSAA 4F4EA 2PB2A 1WSTA 1C7GA 3NNKA 2W7MA 3UE8A 1LW4A 1J04A 4BA4A 2C7TA 3PDBA 4UHMA 3WLXA 3WKSA 2GMSA 1MDOA 1IBJA 3ZRRA 1TATA 2YKVA 4WLJA 1YOOA 3FKDA 5HHYA 3TQXA 1GEYA 2YHKA 2CSTA 1GC0A 2F8JA 2R5EA 4RIZA 1C0NA 2VIBA 1AKAA 1OHYA 1C7OA 3DR4A 3R4TA 2VMRA 4EMYA 1FG3A 3WZFA 5EUEA 3BWOA 3PJ0A 1DGDA 1CL1A 5DJ1A 1AJSB 1AX4A 4GE4A 5F8VA 4F5LA 3KGXA 1UKJA 1BS0A 3N0LA 5FT6A 2E54A 2QB3A 3QPGA 4MQRA 1H0CA 3WGCA 3NU8A 1M0OA 2PO3A 5HDMA 5M4BA 3NX3A 3MC6C 3FZ6A 3NU7A 2OKKA 2OKJA 2Q7WA 2DOUA 1M7YA 2VGVA 1SZUA 2GMUA 1QJ3A 3JZLA 3K7YA 2R5CA 2XBNA 5EIGA 4AZKA 1CQ6A 2W8UA 3B8XA 3GSBA 3NUIA 2AY1A 3ELEA 4LW2A 3RI6A 2W7HA 3VP6A 5G4IA 1VP4A 2AY9A 1ARGA 2VGTA 3E77A 1U08A 4EB5A 1DJ9A 2O1BA 4GSAA 3LG0A 2W8TA 3FZ8A 4I8AA 1W23A 1S0AA 3CAIA 4E3QA 4J8LA 1AICA 3LV2A 2XH1A 2FYFA 2YKYA 3COGA 1ASMA 3GETA 1TOKA 3LWSA 5DB5A 1W7MA 3AV7A 4JEZA 1LC5A 2AEUA 4KAMA 2EPJA 1AMAA 4N0WA 2D7YA 4Q75A 2QA3A 1C9CA 3AENB 1UU2A 1N31A 4UOYA 4MKJA 2ZSMA 2EZ1A 3LVMA 3NDNA 2VMUA 2X3LA 3ASBA 3QN6A 1QGNA 4WP0A 3HMUA 2YCNA 4UHNA 1T3IA 1PMMA 1W7NA 1IUGA 1IVRA 2CTZA 1SZSA 2ZSLA 2W7JA 3AEJA 1GEWA 2YRRA 2W7GA 4B98A 4GDYA 4WXFA 2HUIA 1ARTA 3EI6A 5D5SA 1BJOA 4F5FA 2EO5A 5M49A 3ACZA 2VYCA 4IYOB 3D6KA 4XAUA 3ASAA 4ZWVA 3R9AA 2CINA 5DX5A 4QGRA 3FZ7A 4B9BA 1QITA 2Z1ZA 1ASNA 5J8QA 4WD2A 1B4XA 3EIAA 3NYTA 4A6TA 2V1PA 5LH9A 5G09A 3OP7A 1TPLA 4LNJA 4MQQA 4JEVA 1WYVB 4GEBA 3ZZKA 4ATQA 2BI1A 4OC9A 2ZY3A 1G4VA 4DQ6A 1Z7DA 2D63A 1AAWA 3RUYA 3B1CA 1TARA 1AJRA 2WK8A 4ISYA 1N8PA 2CJDA 2YKXA 1IAXA 4IX8A 1WYTA 3KE3A 3EI7A 3VOMA 3AOVA 3PIUA 4CXRA 3AEJC 4Q31A 1LKCA 1VJOA 2BWOA 2CANA 3BB8A 2HOXA 3CQ5A 1RV4A 4RITA 3FVSA 4M2KA 3OKSA 2DGLA 5EAAA 3PAAA 4R2NA 4RJYA 4K2BA 5K8BA 2AY6A 2GQNA 2QLRA 4E1OA 3HQTA 1M6SA 1JF9A 3DXWA 3HBXA 3PDBB 4WBTA 4JE5D 4A6UA 1MDXA 4LNMA 2AY7A 4XK1A 3VK4A 4AOAA 3M5UA 1WYUA 4ZM4A 2JISA 1YIYA 1RVYA 2VMSA 4OMAA 1AIBA 4MQPA 3VAXA 2VI8A 2W8JA 2HUFA 2O7CA 4GE9A 3B1EA 4K2IA 1DJEA 2VMZA 2AY3A 4KYOA 3IHJA 4UHOA 1M0PA 2CY8A 5BJ3A 3ZRPA 5JAYA 3FD0A 1Y4IA 3EI5A 3HDOA 1DKAA 4LW4A 2Z67A 3TATA 2HORA 1IX6A 2ZY4A 1YAAA 2CH2A 4W1XA 2VMPA 5LHAA 2Z1YA 4WLHA 3FVXA 4ZSYA 2VMTA 3EI8A 1AY5A 2CH1A 4ZASA 4A6RA 4ZDLA 2BI3A 4ZDPA 1ZC9A 2R5CB 4LC3A 1C7NA 2HP1A 3KKIA 5EIGB 5TF5A 1AHXA 1P3WA 1LW5A 1ASFA 3AOWA 2VMYA 3ISLA 4WYCA 3MKJA 2JJEA 5E5IA 3UWCA 4EFFA 2X5FA 4RM1A 1PMOA 3P1TA 3QI6A 4OT8A 2JJGA 2BIAA 3TCMA 1CS1A 2OGEA 4NOGA 4GRXA 2BKWA 3TFTA 1FC4A 5I92A 1YJYA 4WXBA 4CBSA 3PDXA 2YCPA 1AHFA 4IW7A 2AY4A 3AEOA 2ZYJA 1ASGA 3PPLA 3L44A 1M32A 3DODA 4XJLA 2GB3A 1MGVA 4ZM3A 1JS3A 3FQ7A 3GWPA 4F5JA 1S08A 4FFCA 3A8UX 3LVLB 1AHEA 5EUNA 1O61A 4MKKA 4KXKA 3TFUA 2PB0A 1N2TA 3JTXA 1CQ7A 2V0YA 3FVUA 2BI9A 2X5DA 4Q6RA 2ZP7A 1QZ9A 4A00A 4A72A 3DZZA 4XJPA 1I41A 1MLYA 4OBVA 2ORDA 3ELPA 4W91A 1O4SA 2FN6A 1H1CA 1KMKA 4K2MA 1M0QA 2ZY2A 1RV3A 3WY7A 2TPLA 3MAFA 3FDDA 1ZOBA 3ZRQA 2O0RA 2D61A 1BJOB 1BW0A 3LVJA 3BCBA 3LVKA 1FG7A 2E7UA 3F9TA 2YRIA 4OCAA 4RJ0A 2RFVA 3F6TA 4OBUA 3B46A 4ZSWA 2JJHA 3JW9A 1AKCA 4W5KA 3BWNA 2EZ2A 3GJUA 1TASA 4ADDA 2VIAA 3E2ZA 1AY4A 1YNUA 1TOEA 1VEFA 1EJIA 2OATA 2BYJA 4IXSA 1M0NA 2NMPA 3JWBA 4Y0IA 5G2PA 3MADA 4CVQA 1CZCA 1X29A 2W7FA 5E3KA 2BIEA 5FT4A 2FNUA 4E3RA 1EG5A 2Z9VA 4UQVA 2VMVA 3E6GA 3MAUA 4JEXA 3CBFA 2VGUA 2FQ6A 3AATA 2HP2A 1EQBA 4P7YA 2W7KA 1B8GA 1WYTB 2CFBA 3RCHA 3WKRA 2D66A 2W8VA 4PFFA 1OATA 1LK9A 1ARHA 2W7IA 3E9KA 4R8DA 1IX7A 1ARIA 3B1DA 2AY5A 3DYDA 4F5HA 1OXPA 1MDZA 2BWPA 5EQCA 4WYAA 1ARSA 2D64A 3BWNC 5BJ4A 2AY8A 4RKDA 3N75A 1WYUB 4XJOA 3FFHA 4WB0A 3GZDA 1B5PA 1SFFA 2DKJA 4JF0A 5HXXA 3VK3A 2C81A 1KL1A 5M4DA 1ASDA 3BCXA 3VK2A 4U2HA 4A0HA 1X28A 1YJSA 3HL2A 2E7IA 3UAKA 3DR7A 2FNIA 4W8IA 1TOIA 3EUCA 5E4ZA 1DGEA 2EGYA 1D7UA 1BT4A 1ELUA 1G7XA 1XI9A 2D5YA 4BQ0A 1B9HA 4BA5A 1B9IA 4GE7A 5EAVA 1YJZA 5G4JA 4WYFA 1LC8A 1IAYA 4ADCA 3FTBA 7AATA 2QMAA 1WKHA 3DXVA 4AO9A 3BN1A 5F9SA 1Z3ZA 2VMXA 4WXGA 4Y0HA 1GBNA 3GBXA 3W1HA 4ZWMA 3ATHA 3AEMC 4BMKA 5FT8A 2BIGA 3A9YA 4F5MA 3WCOA 4JF1A 3HT4A 1AAMA 4PFNA 1V2FA 1I48A 3IF2A 2CJGA 2HZPA 8AATA 1ASAA 1E5EA 1YIZA 3GZDC 3I16A 1CQ8A 3A9ZA 1AIAA 4J5UA 4A0FA 4ADBA 5M46A 2DGKA 3A2BA 2D7ZA 2EH6A 3FRKA 4P3MA 1RVUA 3JU7A 1BJWA 1QJ5A 3QHXA 3EZSA 2W7DA 4OYTA 2ZUKA 4RAEA 3E2YA 4F5KA 1SVVA 2VMOA 4M2JA 1ZODA 3FQ8A 3HVYA 3CQ6A 3K28A 5EFSA 1GCKA 4PIWA 4L0OA 1GC4A 3FFRA 1S06A 2CJHA 2JJFA 2VMNA 4ZLVA 3PD6A 1D7SA 4U1TA 2WKAA 1PG8A 1KKPA 3FQAA 3H7FA 1QISA 1TOGA 3BS8A 1GC3A 2Z61A 4MSOA 4F5GA 4ATPA 1ORDA 2FM1A 4W1VA 3DU4A 1IX8A 1B5OA 2ZJGA 4TV7A 1DTYA 3MEBA 3JWAA 1S07A 1JG8A 3NUBA 3PGYA 1QIRA 4R5FA 4TMRA 3CQ4A 5DJ9A 4AO4A 1JS6A 3WGBA 1ASEA 1J32A 2BI5A 3FCRA 3NRAA 2AEVA 3N5MA 1BJ4A 4JE5A 3MAFB 4ZAHA 3QM2A 3GZCA 4R5ZA 2BHXA 4WYGA 1D7VA 4IY7A 1WKGA 1ASBA 2VLFA 4TN4A 1MAPA 1D7RA 4JEYA 5AX8A 2HUUA 3ZZJA 3H14A 3E2FA 3I5TA 4A0GA 3E2ZB 3LY1A 3BV0A 2G6WA 3NYSA 3W1IA 1SZKA 3F0HA 1UU0A 4Q76A 3RBFA
chains in the Genus database with same CATH superfamily
1I29A 1AJSA 1AMQA 1TOJA 1BJNA 2Z9UA 2R2NA 3G0TA 1W7LA 2YOBA 3HLMA 3USFA 4AZJA 3DRDA 1OHWA 4FL0A 4ZDOA 1LC7A 2X8UA 2E7JA 2VMQA 3BC8A 4XQ2A 3RBLA 5IWQA 1AY8A 4XEWA 1W3UA 2QB2A 2Z9XA 2BWNA 4ITGA 3K40A 3RCHB 1KL2A 1AHYA 5C6UA 2Z20A 1BQAA 2AATA 4LNLA 4A0RA 2BYLA 2VGZA 1AHGA 3ECDA 3EI9A 2YCTA 3EIBA 4IXOA 3FDBA 4E77A 2VLHA 1DJUA 1LS3A 1CZEA 1MAQA 3G7QA 2VI9A 1X0MA 2DGMA 4BHDA 2W8WA 1G7WA 1I43A 2JG2A 1AMRA 4MY5A 1PFFA 3NYUA 1AKBA 2OQXA 4WB0B 4F5IA 3EZ1A 2DKBA 5G0AA 9AATA 3Q8NA 1S09A 2JGTA 4M2MA 4EB7A 1V2DA 2C44A 2WK7A 1ASLA 1SPAA 2BI2A 1ELQA 2QBTA 2VGSA 5G2QA 4DBCA 4RKCA 4O6ZA 3AENA 3AEMA 3AEPA 4HF8A 3WX9A 4WYEA 1CL2A 3QGUA 2OGAA 5D95A 2ZY5A 4CBRA 1OXOA 2CB1A 2HOZA 3G8MA 4IXZA 2C0RA 4W1WA 4WYDA 3I4JA 1O62A 1ASCA 3GR9A 1E5FA 4ITXA 2DR1A 5EUDA 3WCNA 1O69A 1KKJA 3KGWA 1V72A 3QBOA 1X2AA 1GD9A 2AY2A 1BQDA 4IYOA 4HVKA 1CJ0A 5FT5A 4Y0DA 4CXQA 2R0TA 1UU1A 1GEXA 2HOYA 3L8AA 1MLZA 1OHVA 4OTLA 3II0A 4PVFA 1GDEA 3T32A 1BKGA 3P6KA 3MBBA 3BCAA 1M4NA 2D65A 1D2FA 1DFOA 1V2EA 3PA9A 1WYVA 2VMWA 4EU1A 1C4KA 2W7LA 3FSLA 4ADEA 1ECXA 1XEYA 4RLGA 1G4XA 2ZC0A 3AELA 4XJMA 1IJIA 3PD6B 1GC2A 4JEWA 4DGTA 3A9XA 1AMSA 3RQ1A 2W7EA 3N4SA 2Z9WA 3DC1A 3MC6A 1SF2A 4MGRA 4N0BA 2WK9A 3NTJA 4H51A 3W1JA 4AH3A 2YKUA 1KMJA 2VGWA 2GSAA 4F4EA 2PB2A 1WSTA 1C7GA 3NNKA 2W7MA 3UE8A 1LW4A 1J04A 4BA4A 2C7TA 3PDBA 4UHMA 3WLXA 3WKSA 2GMSA 1MDOA 1IBJA 3ZRRA 1TATA 2YKVA 4WLJA 1YOOA 3FKDA 5HHYA 3TQXA 1GEYA 2YHKA 2CSTA 1GC0A 2F8JA 2R5EA 4RIZA 1C0NA 2VIBA 1AKAA 1OHYA 1C7OA 3DR4A 3R4TA 2VMRA 4EMYA 1FG3A 3WZFA 5EUEA 3BWOA 3PJ0A 1DGDA 1CL1A 5DJ1A 1AJSB 1AX4A 4GE4A 5F8VA 4F5LA 2QSRA 3KGXA 1UKJA 1BS0A 3N0LA 5FT6A 2E54A 2QB3A 3QPGA 4MQRA 1H0CA 3WGCA 3NU8A 1M0OA 2PO3A 5HDMA 5M4BA 3NX3A 3MC6C 3FZ6A 3NU7A 2OKKA 2OKJA 2Q7WA 2DOUA 1M7YA 2VGVA 1SZUA 2GMUA 1QJ3A 3JZLA 3K7YA 2R5CA 2XBNA 5EIGA 4AZKA 1CQ6A 2W8UA 3B8XA 3GSBA 3NUIA 2AY1A 3ELEA 4LW2A 3RI6A 2W7HA 3VP6A 2A1VA 5G4IA 1VP4A 2AY9A 1ARGA 2VGTA 3E77A 1U08A 4EB5A 1DJ9A 2O1BA 4GSAA 3LG0A 2W8TA 3FZ8A 4I8AA 1W23A 1S0AA 3CAIA 4E3QA 4J8LA 1AICA 3LV2A 2XH1A 2FYFA 2YKYA 3COGA 1ASMA 3GETA 1TOKA 3LWSA 5DB5A 1W7MA 3AV7A 4JEZA 1LC5A 2AEUA 4KAMA 2EPJA 1AMAA 4N0WA 2D7YA 4Q75A 2QA3A 1C9CA 3AENB 1UU2A 1N31A 4UOYA 4MKJA 4H63Q 2ZSMA 2EZ1A 3LVMA 3NDNA 2VMUA 2X3LA 3ASBA 3QN6A 1QGNA 4WP0A 3HMUA 2YCNA 4UHNA 1T3IA 1PMMA 1W7NA 1IUGA 1IVRA 2CTZA 1SZSA 2ZSLA 2W7JA 3AEJA 1GEWA 2YRRA 2W7GA 4B98A 4GDYA 4WXFA 2HUIA 1ARTA 3EI6A 5D5SA 1BJOA 4F5FA 2EO5A 5M49A 3ACZA 2VYCA 4IYOB 3D6KA 4XAUA 3ASAA 4ZWVA 3R9AA 2CINA 5DX5A 4QGRA 3FZ7A 4B9BA 1QITA 2Z1ZA 1ASNA 5J8QA 4WD2A 1B4XA 3EIAA 3NYTA 4A6TA 2V1PA 5LH9A 5G09A 2G7JA 3OP7A 1TPLA 4LNJA 4MQQA 4JEVA 1WYVB 4GEBA 3ZZKA 4ATQA 2BI1A 4OC9A 2ZY3A 1G4VA 4DQ6A 1Z7DA 2D63A 1AAWA 3RUYA 3B1CA 1TARA 1AJRA 2WK8A 4ISYA 1N8PA 2CJDA 2YKXA 1IAXA 4IX8A 1WYTA 3KE3A 3EI7A 3VOMA 3AOVA 3PIUA 4CXRA 3AEJC 4Q31A 1LKCA 1VJOA 2BWOA 2CANA 3BB8A 2HOXA 3CQ5A 1RV4A 4RITA 3FVSA 4M2KA 3OKSA 2DGLA 5EAAA 3PAAA 4R2NA 3N7NA 4RJYA 4K2BA 5K8BA 2AY6A 2GQNA 2QLRA 4E1OA 3HQTA 1M6SA 1JF9A 3DXWA 3HBXA 3PDBB 4WBTA 4JE5D 4A6UA 1MDXA 4LNMA 2AY7A 4XK1A 3VK4A 4AOAA 3M5UA 1WYUA 4ZM4A 2JISA 1YIYA 1RVYA 2VMSA 4OMAA 1AIBA 4MQPA 3VAXA 2VI8A 2W8JA 2HUFA 2O7CA 4GE9A 3B1EA 4K2IA 1DJEA 2VMZA 2AY3A 4KYOA 3IHJA 4UHOA 1M0PA 2CY8A 5BJ3A 3ZRPA 5JAYA 3FD0A 1Y4IA 3EI5A 3HDOA 1DKAA 4LW4A 2Z67A 3TATA 2HORA 1IX6A 2ZY4A 1YAAA 2CH2A 4W1XA 2VMPA 5LHAA 2Z1YA 4WLHA 3FVXA 4ZSYA 2VMTA 3EI8A 1AY5A 2CH1A 4ZASA 4A6RA 4ZDLA 2BI3A 4ZDPA 1ZC9A 2R5CB 4LC3A 1C7NA 2HP1A 3KKIA 5EIGB 5TF5A 1AHXA 1P3WA 1LW5A 1ASFA 3AOWA 2VMYA 3ISLA 4WYCA 3MKJA 2JJEA 5E5IA 3UWCA 4EFFA 2X5FA 4RM1A 1PMOA 3P1TA 3QI6A 4OT8A 2JJGA 2BIAA 3TCMA 1CS1A 2OGEA 4NOGA 4GRXA 2BKWA 3TFTA 1FC4A 5I92A 1YJYA 4WXBA 4CBSA 3PDXA 2YCPA 1AHFA 4IW7A 2AY4A 3AEOA 2ZYJA 1ASGA 3PPLA 3L44A 1M32A 3DODA 4XJLA 2GB3A 1MGVA 4ZM3A 1JS3A 3FQ7A 3GWPA 4F5JA 1S08A 4FFCA 3A8UX 3LVLB 1AHEA 5EUNA 1O61A 4MKKA 4KXKA 3TFUA 2PB0A 1N2TA 3JTXA 1CQ7A 2V0YA 3FVUA 2BI9A 2X5DA 4Q6RA 2ZP7A 1QZ9A 4A00A 4A72A 3DZZA 4XJPA 1I41A 1MLYA 4OBVA 2ORDA 3ELPA 4W91A 1O4SA 2FN6A 1H1CA 1KMKA 4K2MA 1M0QA 2KFPA 1RV3A 2ZY2A 3WY7A 2TPLA 3MAFA 3FDDA 1ZOBA 3ZRQA 5KTBA 2O0RA 2D61A 1BJOB 1BW0A 3LVJA 3BCBA 3LVKA 1FG7A 2E7UA 3F9TA 2YRIA 4OCAA 4RJ0A 2RFVA 3F6TA 4OBUA 3B46A 4ZSWA 2JJHA 3JW9A 1AKCA 4W5KA 3BWNA 2EZ2A 3GJUA 1TASA 4ADDA 2VIAA 3E2ZA 1AY4A 1YNUA 1TOEA 1VEFA 1EJIA 2OATA 2BYJA 4IXSA 1M0NA 2NMPA 3JWBA 4Y0IA 5G2PA 3MADA 4CVQA 1CZCA 4K05A 1X29A 2W7FA 5E3KA 2BIEA 5FT4A 2FNUA 4E3RA 1EG5A 2Z9VA 4UQVA 2VMVA 3E6GA 3MAUA 4JEXA 3CBFA 2VGUA 2FQ6A 3AATA 2HP2A 1EQBA 4P7YA 2W7KA 1B8GA 1WYTB 2CFBA 3RCHA 3WKRA 2D66A 2W8VA 3H9XA 4PFFA 1OATA 1LK9A 1ARHA 2W7IA 3E9KA 4R8DA 1IX7A 1ARIA 3B1DA 2AY5A 3DYDA 2EYQA 4F5HA 1OXPA 1MDZA 2BWPA 5EQCA 4WYAA 1ARSA 2D64A 3BWNC 5BJ4A 2AY8A 4RKDA 3N75A 1WYUB 4XJOA 3FFHA 3N4RA 4WB0A 3GZDA 1B5PA 1SFFA 2DKJA 4JF0A 5HXXA 3VK3A 2C81A 1KL1A 5M4DA 1ASDA 3BCXA 3VK2A 4U2HA 4A0HA 1X28A 1YJSA 3HL2A 2E7IA 1KAFA 3UAKA 3DR7A 2FNIA 4W8IA 1TOIA 3EUCA 5E4ZA 1DGEA 2EGYA 1D7UA 1BT4A 1ELUA 1G7XA 1XI9A 2D5YA 4BQ0A 1B9HA 4BA5A 1B9IA 4GE7A 5EAVA 1YJZA 5G4JA 4WYFA 1LC8A 1IAYA 4ADCA 3FTBA 7AATA 2QMAA 1WKHA 3DXVA 4AO9A 3BN1A 5F9SA 1Z3ZA 2VMXA 4WXGA 4Y0HA 1GBNA 3GBXA 3W1HA 4ZWMA 3ATHA 3AEMC 4BMKA 5FT8A 2BIGA 3A9YA 4F5MA 3WCOA 4JF1A 3HT4A 1AAMA 4PFNA 1V2FA 1I48A 3IF2A 2CJGA 2HZPA 8AATA 1ASAA 1E5EA 1YIZA 3GZDC 3I16A 1CQ8A 3A9ZA 1AIAA 4J5UA 4A0FA 4ADBA 5M46A 2FKIA 2WB6A 2DGKA 3A2BA 2D7ZA 2EH6A 3FRKA 4P3MA 1RVUA 3JU7A 1BJWA 1QJ5A 3QHXA 3EZSA 2W7DA 4OYTA 2ZUKA 4RAEA 3E2YA 4F5KA 1SVVA 2VMOA 4M2JA 1ZODA 3FQ8A 3HVYA 3CQ6A 3K28A 3N4XA 5EFSA 1GCKA 4PIWA 4L0OA 1GC4A 3FFRA 1S06A 2CJHA 2JJFA 2VMNA 4ZLVA 3PD6A 1D7SA 4U1TA 2WKAA 1PG8A 1KKPA 3FQAA 3H7FA 1QISA 1TOGA 3BS8A 1GC3A 2Z61A 4MSOA 4F5GA 4ATPA 1ORDA 2FM1A 4W1VA 3DU4A 1IX8A 1B5OA 2ZJGA 4TV7A 1DTYA 3MEBA 3JWAA 1S07A 1JG8A 3NUBA 3PGYA 1QIRA 4R5FA 4TMRA 3CQ4A 5DJ9A 4AO4A 1JS6A 3WGBA 1ASEA 1J32A 2BI5A 3FCRA 3NRAA 2AEVA 3N5MA 1BJ4A 4JE5A 3MAFB 4ZAHA 3QM2A 3GZCA 4R5ZA 2BHXA 4WYGA 1D7VA 4IY7A 1WKGA 1ASBA 2VLFA 4TN4A 1MAPA 1D7RA 4JEYA 5AX8A 2HUUA 3ZZJA 3H14A 3E2FA 3I5TA 4A0GA 3E2ZB 3LY1A 3BV0A 2G6WA 3NYSA 3W1IA 1SZKA 3F0HA 1UU0A 4Q76A 3RBFA
chains in the Genus database with same CATH topology
1I29A 1AJSA 1AMQA 1TOJA 1BJNA 2Z9UA 2R2NA 3G0TA 1W7LA 2YOBA 3HLMA 3USFA 4AZJA 3DRDA 1OHWA 4FL0A 4ZDOA 1LC7A 2X8UA 2E7JA 2VMQA 3BC8A 4XQ2A 3RBLA 5IWQA 1AY8A 4XEWA 1W3UA 2QB2A 2Z9XA 2BWNA 4ITGA 3K40A 3RCHB 1KL2A 1AHYA 5C6UA 2Z20A 1BQAA 2AATA 4LNLA 4A0RA 2BYLA 2VGZA 1AHGA 3ECDA 3EI9A 2YCTA 3EIBA 4IXOA 3FDBA 4E77A 2VLHA 1DJUA 1LS3A 1CZEA 1MAQA 3G7QA 2VI9A 1X0MA 2DGMA 4BHDA 2W8WA 1G7WA 1I43A 2JG2A 1AMRA 4MY5A 1PFFA 3NYUA 1AKBA 2OQXA 4WB0B 4F5IA 3EZ1A 2DKBA 5G0AA 9AATA 3Q8NA 1S09A 2JGTA 4M2MA 4EB7A 1V2DA 2C44A 2WK7A 1ASLA 1SPAA 2BI2A 1ELQA 2QBTA 2VGSA 5G2QA 4DBCA 4RKCA 4O6ZA 3AENA 3AEMA 3AEPA 4HF8A 3WX9A 4WYEA 1CL2A 3QGUA 2OGAA 5D95A 2ZY5A 4CBRA 1OXOA 2CB1A 2HOZA 3G8MA 4IXZA 2C0RA 4W1WA 4WYDA 3I4JA 1O62A 1ASCA 3GR9A 1E5FA 4ITXA 2DR1A 5EUDA 3WCNA 1O69A 1KKJA 3KGWA 1V72A 3QBOA 1X2AA 1GD9A 2AY2A 1BQDA 4IYOA 4HVKA 1CJ0A 5FT5A 4Y0DA 4CXQA 2R0TA 1UU1A 1GEXA 2HOYA 3L8AA 1MLZA 1OHVA 4OTLA 3II0A 4PVFA 1GDEA 3T32A 1BKGA 3P6KA 3MBBA 3BCAA 1M4NA 2D65A 1D2FA 1DFOA 1V2EA 3PA9A 1WYVA 2VMWA 4EU1A 1C4KA 2W7LA 3FSLA 4ADEA 1ECXA 1XEYA 4RLGA 1G4XA 2ZC0A 3AELA 4XJMA 1IJIA 3PD6B 1GC2A 4JEWA 4DGTA 3A9XA 1AMSA 3RQ1A 2W7EA 3N4SA 2Z9WA 3DC1A 3MC6A 1SF2A 4MGRA 4N0BA 2WK9A 3NTJA 4H51A 3W1JA 4AH3A 2YKUA 1KMJA 2VGWA 2GSAA 4F4EA 2PB2A 1WSTA 1C7GA 3NNKA 2W7MA 3UE8A 1LW4A 1J04A 4BA4A 2C7TA 3PDBA 4UHMA 3WLXA 3WKSA 2GMSA 1MDOA 1IBJA 3ZRRA 1TATA 2YKVA 4WLJA 1YOOA 3FKDA 5HHYA 3TQXA 1GEYA 2YHKA 2CSTA 1GC0A 2F8JA 2R5EA 4RIZA 1C0NA 2VIBA 1AKAA 1OHYA 1C7OA 3DR4A 3R4TA 2VMRA 4EMYA 1FG3A 3WZFA 5EUEA 3BWOA 3PJ0A 1DGDA 1CL1A 5DJ1A 1AJSB 1AX4A 4GE4A 5F8VA 4F5LA 2QSRA 3KGXA 1UKJA 1BS0A 3N0LA 5FT6A 2E54A 2QB3A 3QPGA 4MQRA 1H0CA 3WGCA 3NU8A 1M0OA 2PO3A 5HDMA 5M4BA 3NX3A 3MC6C 3FZ6A 3NU7A 2OKKA 2OKJA 2Q7WA 2DOUA 1M7YA 2VGVA 1SZUA 2GMUA 1QJ3A 3JZLA 3K7YA 2R5CA 2XBNA 5EIGA 4AZKA 1CQ6A 2W8UA 3B8XA 3GSBA 3NUIA 2AY1A 3ELEA 4LW2A 3RI6A 2W7HA 3VP6A 2A1VA 5G4IA 1VP4A 2AY9A 1ARGA 2VGTA 3E77A 1U08A 4EB5A 1DJ9A 2O1BA 4GSAA 3LG0A 2W8TA 3FZ8A 4I8AA 1W23A 1S0AA 3CAIA 4E3QA 4J8LA 1AICA 3LV2A 2XH1A 2FYFA 2YKYA 3COGA 1ASMA 3GETA 1TOKA 3LWSA 5DB5A 1W7MA 3AV7A 4JEZA 1LC5A 2AEUA 4KAMA 2EPJA 1AMAA 4N0WA 2D7YA 4Q75A 2QA3A 1C9CA 3AENB 1UU2A 1N31A 4UOYA 4MKJA 4H63Q 2ZSMA 2EZ1A 3LVMA 3NDNA 2VMUA 2X3LA 3ASBA 3QN6A 1QGNA 4WP0A 3HMUA 2YCNA 4UHNA 1T3IA 1PMMA 1W7NA 1IUGA 1IVRA 2CTZA 1SZSA 2ZSLA 2W7JA 3AEJA 1GEWA 2YRRA 2W7GA 4B98A 4GDYA 4WXFA 2HUIA 1ARTA 3EI6A 5D5SA 1BJOA 4F5FA 2EO5A 5M49A 3ACZA 2VYCA 4IYOB 3D6KA 4XAUA 3ASAA 4ZWVA 3R9AA 2CINA 5DX5A 4QGRA 3FZ7A 4B9BA 1QITA 2Z1ZA 1ASNA 5J8QA 4WD2A 1B4XA 3EIAA 3NYTA 4A6TA 2V1PA 5LH9A 5G09A 2G7JA 3OP7A 1TPLA 4LNJA 4MQQA 4JEVA 1WYVB 4GEBA 3ZZKA 4ATQA 2BI1A 4OC9A 2ZY3A 1G4VA 4DQ6A 1Z7DA 2D63A 1AAWA 3RUYA 3B1CA 1TARA 1AJRA 2WK8A 4ISYA 1N8PA 2CJDA 2YKXA 1IAXA 4IX8A 1WYTA 3KE3A 3EI7A 3VOMA 3AOVA 3PIUA 4CXRA 3AEJC 4Q31A 1LKCA 1VJOA 2BWOA 2CANA 3BB8A 2HOXA 3CQ5A 1RV4A 4RITA 3FVSA 4M2KA 3OKSA 2DGLA 5EAAA 3PAAA 4R2NA 3N7NA 4RJYA 4K2BA 5K8BA 2AY6A 2GQNA 2QLRA 4E1OA 3HQTA 1M6SA 1JF9A 3DXWA 3HBXA 3PDBB 4WBTA 4JE5D 4A6UA 1MDXA 4LNMA 2AY7A 4XK1A 3VK4A 4AOAA 3M5UA 1WYUA 4ZM4A 2JISA 1YIYA 1RVYA 2VMSA 4OMAA 1AIBA 4MQPA 3VAXA 2VI8A 2W8JA 2HUFA 2O7CA 4GE9A 3B1EA 4K2IA 1DJEA 2VMZA 2AY3A 4KYOA 3IHJA 4UHOA 1M0PA 2CY8A 5BJ3A 3ZRPA 5JAYA 3FD0A 1Y4IA 3EI5A 3HDOA 1DKAA 4LW4A 2Z67A 3TATA 2HORA 1IX6A 2ZY4A 1YAAA 2CH2A 4W1XA 2VMPA 5LHAA 2Z1YA 4WLHA 3FVXA 4ZSYA 2VMTA 3EI8A 1AY5A 2CH1A 4ZASA 4A6RA 4ZDLA 2BI3A 4ZDPA 1ZC9A 2R5CB 4LC3A 1C7NA 2HP1A 3KKIA 5EIGB 5TF5A 1AHXA 1P3WA 1LW5A 1ASFA 3AOWA 2VMYA 3ISLA 4WYCA 3MKJA 2JJEA 5E5IA 3UWCA 4EFFA 2X5FA 4RM1A 1PMOA 3P1TA 3QI6A 4OT8A 2JJGA 2BIAA 3TCMA 1CS1A 2OGEA 4NOGA 4GRXA 2BKWA 3TFTA 1FC4A 5I92A 1YJYA 4WXBA 4CBSA 3PDXA 2YCPA 1AHFA 4IW7A 2AY4A 3AEOA 2ZYJA 1ASGA 3PPLA 3L44A 1M32A 3DODA 4XJLA 2GB3A 1MGVA 4ZM3A 1JS3A 3FQ7A 3GWPA 4F5JA 1S08A 4FFCA 3A8UX 3LVLB 1AHEA 5EUNA 1O61A 4MKKA 4KXKA 3TFUA 2PB0A 1N2TA 3JTXA 1CQ7A 2V0YA 3FVUA 2BI9A 2X5DA 4Q6RA 2ZP7A 1QZ9A 4A00A 4A72A 3DZZA 4XJPA 1I41A 1MLYA 4OBVA 2ORDA 3ELPA 4W91A 1O4SA 2FN6A 1H1CA 1KMKA 4K2MA 1M0QA 2KFPA 1RV3A 2ZY2A 3WY7A 2TPLA 3MAFA 3FDDA 1ZOBA 3ZRQA 5KTBA 2O0RA 2D61A 1BJOB 1BW0A 3LVJA 3BCBA 3LVKA 1FG7A 2E7UA 3F9TA 2YRIA 4OCAA 4RJ0A 2RFVA 3F6TA 4OBUA 3B46A 4ZSWA 2JJHA 3JW9A 1AKCA 4W5KA 3BWNA 2EZ2A 3GJUA 1TASA 4ADDA 2VIAA 3E2ZA 1AY4A 1YNUA 1TOEA 1VEFA 1EJIA 2OATA 2BYJA 4IXSA 1M0NA 2NMPA 3JWBA 4Y0IA 5G2PA 3MADA 4CVQA 1CZCA 4K05A 1X29A 2W7FA 5E3KA 2BIEA 5FT4A 2FNUA 4E3RA 1EG5A 2Z9VA 4UQVA 2VMVA 3E6GA 3MAUA 4JEXA 3CBFA 2VGUA 2FQ6A 3AATA 2HP2A 1EQBA 4P7YA 2W7KA 1B8GA 1WYTB 2CFBA 3RCHA 3WKRA 2D66A 2W8VA 3H9XA 4PFFA 1OATA 1LK9A 1ARHA 2W7IA 3E9KA 4R8DA 1IX7A 1ARIA 3B1DA 2AY5A 3DYDA 2EYQA 4F5HA 1OXPA 1MDZA 2BWPA 5EQCA 4WYAA 1ARSA 2D64A 3BWNC 5BJ4A 2AY8A 4RKDA 3N75A 1WYUB 4XJOA 3FFHA 3N4RA 4WB0A 3GZDA 1B5PA 1SFFA 2DKJA 4JF0A 5HXXA 3VK3A 2C81A 1KL1A 5M4DA 1ASDA 3BCXA 3VK2A 4U2HA 4A0HA 1X28A 1YJSA 3HL2A 2E7IA 3UAKA 3DR7A 2FNIA 4W8IA 1TOIA 3EUCA 5E4ZA 1DGEA 2EGYA 1D7UA 1BT4A 1ELUA 1G7XA 1XI9A 2D5YA 4BQ0A 1B9HA 4BA5A 1B9IA 4GE7A 5EAVA 1YJZA 5G4JA 4WYFA 1LC8A 1IAYA 4ADCA 3FTBA 7AATA 2QMAA 1WKHA 3DXVA 4AO9A 3BN1A 5F9SA 1Z3ZA 2VMXA 4WXGA 4Y0HA 1GBNA 3GBXA 3W1HA 4ZWMA 3ATHA 3AEMC 4BMKA 5FT8A 2BIGA 3A9YA 4F5MA 3WCOA 4JF1A 3HT4A 1AAMA 4PFNA 1V2FA 1I48A 3IF2A 2CJGA 2HZPA 8AATA 1ASAA 1E5EA 1YIZA 3GZDC 3I16A 1CQ8A 3A9ZA 1AIAA 4J5UA 4A0FA 4ADBA 5M46A 2FKIA 2WB6A 2DGKA 3A2BA 2D7ZA 2EH6A 3FRKA 4P3MA 1RVUA 3JU7A 1BJWA 1QJ5A 3QHXA 3EZSA 2W7DA 4OYTA 2ZUKA 4RAEA 3E2YA 4F5KA 1SVVA 2VMOA 4M2JA 1ZODA 3FQ8A 3HVYA 3CQ6A 3K28A 3N4XA 5EFSA 1GCKA 4PIWA 4L0OA 1GC4A 3FFRA 1S06A 2CJHA 2JJFA 2VMNA 4ZLVA 3PD6A 1D7SA 4U1TA 2WKAA 1PG8A 1KKPA 3FQAA 3H7FA 1QISA 1TOGA 3BS8A 1GC3A 2Z61A 4MSOA 4F5GA 4ATPA 1ORDA 2FM1A 4W1VA 3DU4A 1IX8A 1B5OA 2ZJGA 4TV7A 1DTYA 3MEBA 3JWAA 1S07A 1JG8A 3NUBA 3PGYA 1QIRA 4R5FA 4TMRA 3CQ4A 5DJ9A 4AO4A 1JS6A 3WGBA 1ASEA 1J32A 2BI5A 3FCRA 3NRAA 2AEVA 3N5MA 1BJ4A 4JE5A 3MAFB 4ZAHA 3QM2A 3GZCA 4R5ZA 2BHXA 4WYGA 1D7VA 4IY7A 1WKGA 1ASBA 2VLFA 4TN4A 1MAPA 1D7RA 4JEYA 5AX8A 2HUUA 3ZZJA 3H14A 3E2FA 3I5TA 4A0GA 3E2ZB 3LY1A 3BV0A 2G6WA 3NYSA 3W1IA 1SZKA 3F0HA 1UU0A 4Q76A 3RBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I29 A;  1AJS A;  1AMQ A;  1TOJ A;  1BJN A;  2Z9U A;  2R2N A;  3G0T A;  1W7L A;  2YOB A;  3HLM A;  3USF A;  4AZJ A;  3DRD A;  1OHW A;  4FL0 A;  4ZDO A;  1LC7 A;  2X8U A;  2E7J A;  2VMQ A;  3BC8 A;  4XQ2 A;  3RBL A;  5IWQ A;  1AY8 A;  4XEW A;  1W3U A;  2QB2 A;  2Z9X A;  2BWN A;  4ITG A;  3K40 A;  3RCH B;  1KL2 A;  1AHY A;  5C6U A;  2Z20 A;  1BQA A;  2AAT A;  4LNL A;  4A0R A;  2BYL A;  2VGZ A;  1AHG A;  3ECD A;  3EI9 A;  2YCT A;  3EIB A;  4IXO A;  3FDB A;  4E77 A;  2VLH A;  1DJU A;  1LS3 A;  1CZE A;  1MAQ A;  3G7Q A;  2VI9 A;  1X0M A;  2DGM A;  4BHD A;  2W8W A;  1G7W A;  1I43 A;  2JG2 A;  1AMR A;  4MY5 A;  1PFF A;  3NYU A;  1AKB A;  2OQX A;  4WB0 B;  4F5I A;  3EZ1 A;  2DKB A;  5G0A A;  9AAT A;  3Q8N A;  1S09 A;  2JGT A;  4M2M A;  4EB7 A;  1V2D A;  2C44 A;  2WK7 A;  1ASL A;  1SPA A;  2BI2 A;  1ELQ A;  2QBT A;  2VGS A;  5G2Q A;  4DBC A;  4RKC A;  4O6Z A;  3AEN A;  3AEM A;  3AEP A;  4HF8 A;  3WX9 A;  4WYE A;  1CL2 A;  3QGU A;  2OGA A;  5D95 A;  2ZY5 A;  4CBR A;  1OXO A;  2CB1 A;  2HOZ A;  3G8M A;  4IXZ A;  2C0R A;  4W1W A;  4WYD A;  3I4J A;  1O62 A;  1ASC A;  3GR9 A;  1E5F A;  4ITX A;  2DR1 A;  5EUD A;  3WCN A;  1O69 A;  1KKJ A;  3KGW A;  1V72 A;  3QBO A;  1X2A A;  1GD9 A;  2AY2 A;  1BQD A;  4IYO A;  4HVK A;  1CJ0 A;  5FT5 A;  4Y0D A;  4CXQ A;  2R0T A;  1UU1 A;  1GEX A;  2HOY A;  3L8A A;  1MLZ A;  1OHV A;  4OTL A;  3II0 A;  4PVF A;  1GDE A;  3T32 A;  1BKG A;  3P6K A;  3MBB A;  3BCA A;  1M4N A;  2D65 A;  1D2F A;  1DFO A;  1V2E A;  3PA9 A;  1WYV A;  2VMW A;  4EU1 A;  1C4K A;  2W7L A;  3FSL A;  4ADE A;  1ECX A;  1XEY A;  4RLG A;  1G4X A;  2ZC0 A;  3AEL A;  4XJM A;  1IJI A;  3PD6 B;  1GC2 A;  4JEW A;  4DGT A;  3A9X A;  1AMS A;  3RQ1 A;  2W7E A;  2Z9W A;  3DC1 A;  3MC6 A;  1SF2 A;  4MGR A;  4N0B A;  2WK9 A;  3NTJ A;  4H51 A;  3W1J A;  4AH3 A;  2YKU A;  1KMJ A;  2VGW A;  2GSA A;  4F4E A;  2PB2 A;  1WST A;  1C7G A;  3NNK A;  2W7M A;  3UE8 A;  1LW4 A;  1J04 A;  4BA4 A;  2C7T A;  3PDB A;  4UHM A;  3WLX A;  3WKS A;  2GMS A;  1MDO A;  1IBJ A;  3ZRR A;  1TAT A;  2YKV A;  4WLJ A;  1YOO A;  3FKD A;  5HHY A;  3TQX A;  1GEY A;  2YHK A;  2CST A;  1GC0 A;  2F8J A;  2R5E A;  4RIZ A;  1C0N A;  2VIB A;  1AKA A;  1OHY A;  1C7O A;  3DR4 A;  3R4T A;  2VMR A;  4EMY A;  1FG3 A;  3WZF A;  5EUE A;  3BWO A;  3PJ0 A;  1DGD A;  1CL1 A;  5DJ1 A;  1AJS B;  1AX4 A;  4GE4 A;  5F8V A;  4F5L A;  3KGX A;  1UKJ A;  1BS0 A;  3N0L A;  5FT6 A;  2E54 A;  2QB3 A;  3QPG A;  4MQR A;  1H0C A;  3WGC A;  3NU8 A;  1M0O A;  2PO3 A;  5HDM A;  5M4B A;  3NX3 A;  3MC6 C;  3FZ6 A;  3NU7 A;  2OKK A;  2OKJ A;  2Q7W A;  2DOU A;  1M7Y A;  2VGV A;  1SZU A;  2GMU A;  1QJ3 A;  3JZL A;  3K7Y A;  2R5C A;  2XBN A;  5EIG A;  4AZK A;  1CQ6 A;  2W8U A;  3B8X A;  3GSB A;  3NUI A;  2AY1 A;  3ELE A;  4LW2 A;  3RI6 A;  2W7H A;  3VP6 A;  5G4I A;  1VP4 A;  2AY9 A;  1ARG A;  2VGT A;  3E77 A;  1U08 A;  4EB5 A;  1DJ9 A;  2O1B A;  4GSA A;  3LG0 A;  2W8T A;  3FZ8 A;  4I8A A;  1W23 A;  1S0A A;  3CAI A;  4E3Q A;  4J8L A;  1AIC A;  3LV2 A;  2XH1 A;  2FYF A;  2YKY A;  3COG A;  1ASM A;  3GET A;  1TOK A;  3LWS A;  5DB5 A;  1W7M A;  3AV7 A;  4JEZ A;  1LC5 A;  2AEU A;  4KAM A;  2EPJ A;  1AMA A;  4N0W A;  2D7Y A;  4Q75 A;  2QA3 A;  1C9C A;  3AEN B;  1UU2 A;  1N31 A;  4UOY A;  4MKJ A;  2ZSM A;  2EZ1 A;  3LVM A;  3NDN A;  2VMU A;  2X3L A;  3ASB A;  3QN6 A;  1QGN A;  4WP0 A;  3HMU A;  2YCN A;  4UHN A;  1T3I A;  1PMM A;  1W7N A;  1IUG A;  1IVR A;  2CTZ A;  1SZS A;  2ZSL A;  2W7J A;  3AEJ A;  1GEW A;  2YRR A;  2W7G A;  4B98 A;  4GDY A;  4WXF A;  2HUI A;  1ART A;  3EI6 A;  5D5S A;  1BJO A;  4F5F A;  2EO5 A;  5M49 A;  3ACZ A;  2VYC A;  4IYO B;  3D6K A;  4XAU A;  3ASA A;  4ZWV A;  3R9A A;  2CIN A;  5DX5 A;  4QGR A;  3FZ7 A;  4B9B A;  1QIT A;  2Z1Z A;  1ASN A;  5J8Q A;  4WD2 A;  1B4X A;  3EIA A;  3NYT A;  4A6T A;  2V1P A;  5LH9 A;  5G09 A;  3OP7 A;  1TPL A;  4LNJ A;  4MQQ A;  4JEV A;  1WYV B;  4GEB A;  3ZZK A;  4ATQ A;  2BI1 A;  4OC9 A;  2ZY3 A;  1G4V A;  4DQ6 A;  1Z7D A;  2D63 A;  1AAW A;  3RUY A;  3B1C A;  1TAR A;  1AJR A;  2WK8 A;  4ISY A;  1N8P A;  2CJD A;  2YKX A;  1IAX A;  4IX8 A;  1WYT A;  3KE3 A;  3EI7 A;  3VOM A;  3AOV A;  3PIU A;  4CXR A;  3AEJ C;  4Q31 A;  1LKC A;  1VJO A;  2BWO A;  2CAN A;  3BB8 A;  2HOX A;  3CQ5 A;  1RV4 A;  4RIT A;  3FVS A;  4M2K A;  3OKS A;  2DGL A;  5EAA A;  3PAA A;  4R2N A;  4RJY A;  4K2B A;  5K8B A;  2AY6 A;  2GQN A;  2QLR A;  4E1O A;  3HQT A;  1M6S A;  1JF9 A;  3DXW A;  3HBX A;  3PDB B;  4WBT A;  4JE5 D;  4A6U A;  1MDX A;  4LNM A;  2AY7 A;  4XK1 A;  3VK4 A;  4AOA A;  3M5U A;  1WYU A;  4ZM4 A;  2JIS A;  1YIY A;  1RVY A;  2VMS A;  4OMA A;  1AIB A;  4MQP A;  3VAX A;  2VI8 A;  2W8J A;  2HUF A;  2O7C A;  4GE9 A;  3B1E A;  4K2I A;  1DJE A;  2VMZ A;  2AY3 A;  4KYO A;  3IHJ A;  4UHO A;  1M0P A;  2CY8 A;  5BJ3 A;  3ZRP A;  5JAY A;  3FD0 A;  1Y4I A;  3EI5 A;  3HDO A;  1DKA A;  4LW4 A;  2Z67 A;  3TAT A;  2HOR A;  1IX6 A;  2ZY4 A;  1YAA A;  2CH2 A;  4W1X A;  2VMP A;  5LHA A;  2Z1Y A;  4WLH A;  3FVX A;  4ZSY A;  2VMT A;  3EI8 A;  1AY5 A;  2CH1 A;  4ZAS A;  4A6R A;  4ZDL A;  2BI3 A;  4ZDP A;  1ZC9 A;  2R5C B;  4LC3 A;  1C7N A;  2HP1 A;  3KKI A;  5EIG B;  5TF5 A;  1AHX A;  1P3W A;  1LW5 A;  1ASF A;  3AOW A;  2VMY A;  3ISL A;  4WYC A;  3MKJ A;  2JJE A;  5E5I A;  3UWC A;  4EFF A;  2X5F A;  4RM1 A;  1PMO A;  3P1T A;  3QI6 A;  4OT8 A;  2JJG A;  2BIA A;  3TCM A;  1CS1 A;  2OGE A;  4NOG A;  4GRX A;  2BKW A;  3TFT A;  1FC4 A;  5I92 A;  1YJY A;  4WXB A;  4CBS A;  3PDX A;  2YCP A;  1AHF A;  4IW7 A;  2AY4 A;  3AEO A;  2ZYJ A;  1ASG A;  3PPL A;  3L44 A;  1M32 A;  3DOD A;  4XJL A;  2GB3 A;  1MGV A;  4ZM3 A;  1JS3 A;  3FQ7 A;  3GWP A;  4F5J A;  1S08 A;  4FFC A;  3A8U X;  3LVL B;  1AHE A;  5EUN A;  1O61 A;  4MKK A;  4KXK A;  3TFU A;  2PB0 A;  1N2T A;  3JTX A;  1CQ7 A;  2V0Y A;  3FVU A;  2BI9 A;  2X5D A;  4Q6R A;  2ZP7 A;  1QZ9 A;  4A00 A;  4A72 A;  3DZZ A;  4XJP A;  1I41 A;  1MLY A;  4OBV A;  2ORD A;  3ELP A;  4W91 A;  1O4S A;  2FN6 A;  1H1C A;  1KMK A;  4K2M A;  1M0Q A;  2ZY2 A;  1RV3 A;  3WY7 A;  2TPL A;  3MAF A;  3FDD A;  1ZOB A;  3ZRQ A;  2O0R A;  2D61 A;  1BJO B;  1BW0 A;  3LVJ A;  3BCB A;  3LVK A;  1FG7 A;  2E7U A;  3F9T A;  2YRI A;  4OCA A;  4RJ0 A;  2RFV A;  3F6T A;  4OBU A;  3B46 A;  4ZSW A;  2JJH A;  3JW9 A;  1AKC A;  4W5K A;  3BWN A;  2EZ2 A;  3GJU A;  1TAS A;  4ADD A;  2VIA A;  3E2Z A;  1AY4 A;  1YNU A;  1TOE A;  1VEF A;  1EJI A;  2OAT A;  2BYJ A;  4IXS A;  1M0N A;  2NMP A;  3JWB A;  4Y0I A;  5G2P A;  3MAD A;  4CVQ A;  1CZC A;  1X29 A;  2W7F A;  5E3K A;  2BIE A;  5FT4 A;  2FNU A;  4E3R A;  1EG5 A;  2Z9V A;  4UQV A;  2VMV A;  3E6G A;  3MAU A;  4JEX A;  3CBF A;  2VGU A;  2FQ6 A;  3AAT A;  2HP2 A;  1EQB A;  4P7Y A;  2W7K A;  1B8G A;  1WYT B;  2CFB A;  3RCH A;  3WKR A;  2D66 A;  2W8V A;  4PFF A;  1OAT A;  1LK9 A;  1ARH A;  2W7I A;  3E9K A;  4R8D A;  1IX7 A;  1ARI A;  3B1D A;  2AY5 A;  3DYD A;  4F5H A;  1OXP A;  1MDZ A;  2BWP A;  5EQC A;  4WYA A;  1ARS A;  2D64 A;  3BWN C;  5BJ4 A;  2AY8 A;  4RKD A;  3N75 A;  1WYU B;  4XJO A;  3FFH A;  4WB0 A;  3GZD A;  1B5P A;  1SFF A;  2DKJ A;  4JF0 A;  5HXX A;  3VK3 A;  2C81 A;  1KL1 A;  5M4D A;  1ASD A;  3BCX A;  3VK2 A;  4U2H A;  4A0H A;  1X28 A;  1YJS A;  3HL2 A;  2E7I A;  3UAK A;  3DR7 A;  2FNI A;  4W8I A;  1TOI A;  3EUC A;  5E4Z A;  1DGE A;  2EGY A;  1D7U A;  1BT4 A;  1ELU A;  1G7X A;  1XI9 A;  2D5Y A;  4BQ0 A;  1B9H A;  4BA5 A;  1B9I A;  4GE7 A;  5EAV A;  1YJZ A;  5G4J A;  4WYF A;  1LC8 A;  1IAY A;  4ADC A;  3FTB A;  7AAT A;  2QMA A;  1WKH A;  3DXV A;  4AO9 A;  3BN1 A;  5F9S A;  1Z3Z A;  2VMX A;  4WXG A;  4Y0H A;  1GBN A;  3GBX A;  3W1H A;  4ZWM A;  3ATH A;  3AEM C;  4BMK A;  5FT8 A;  2BIG A;  3A9Y A;  4F5M A;  3WCO A;  4JF1 A;  3HT4 A;  1AAM A;  4PFN A;  1V2F A;  1I48 A;  3IF2 A;  2CJG A;  2HZP A;  8AAT A;  1ASA A;  1E5E A;  1YIZ A;  3GZD C;  3I16 A;  1CQ8 A;  3A9Z A;  1AIA A;  4J5U A;  4A0F A;  4ADB A;  5M46 A;  2DGK A;  3A2B A;  2D7Z A;  2EH6 A;  3FRK A;  4P3M A;  1RVU A;  3JU7 A;  1BJW A;  1QJ5 A;  3QHX A;  3EZS A;  2W7D A;  4OYT A;  2ZUK A;  4RAE A;  3E2Y A;  4F5K A;  1SVV A;  2VMO A;  4M2J A;  1ZOD A;  3FQ8 A;  3HVY A;  3CQ6 A;  3K28 A;  5EFS A;  1GCK A;  4PIW A;  4L0O A;  1GC4 A;  3FFR A;  1S06 A;  2CJH A;  2JJF A;  2VMN A;  4ZLV A;  3PD6 A;  1D7S A;  4U1T A;  2WKA A;  1PG8 A;  1KKP A;  3FQA A;  3H7F A;  1QIS A;  1TOG A;  3BS8 A;  1GC3 A;  2Z61 A;  4MSO A;  4F5G A;  4ATP A;  1ORD A;  2FM1 A;  4W1V A;  3DU4 A;  1IX8 A;  1B5O A;  2ZJG A;  4TV7 A;  1DTY A;  3MEB A;  3JWA A;  1S07 A;  1JG8 A;  3NUB A;  3PGY A;  1QIR A;  4R5F A;  4TMR A;  3CQ4 A;  5DJ9 A;  4AO4 A;  1JS6 A;  3WGB A;  1ASE A;  1J32 A;  2BI5 A;  3FCR A;  3NRA A;  2AEV A;  3N5M A;  1BJ4 A;  4JE5 A;  3MAF B;  4ZAH A;  3QM2 A;  3GZC A;  4R5Z A;  2BHX A;  4WYG A;  1D7V A;  4IY7 A;  1WKG A;  1ASB A;  2VLF A;  4TN4 A;  1MAP A;  1D7R A;  4JEY A;  5AX8 A;  2HUU A;  3ZZJ A;  3H14 A;  3E2F A;  3I5T A;  4A0G A;  3E2Z B;  3LY1 A;  3BV0 A;  2G6W A;  3NYS A;  3W1I A;  1SZK A;  3F0H A;  1UU0 A;  4Q76 A;  3RBF A; 
#chains in the Genus database with same CATH topology
 1I29 A;  1AJS A;  1AMQ A;  1TOJ A;  1BJN A;  2Z9U A;  2R2N A;  3G0T A;  1W7L A;  2YOB A;  3HLM A;  3USF A;  4AZJ A;  3DRD A;  1OHW A;  4FL0 A;  4ZDO A;  1LC7 A;  2X8U A;  2E7J A;  2VMQ A;  3BC8 A;  4XQ2 A;  3RBL A;  5IWQ A;  1AY8 A;  4XEW A;  1W3U A;  2QB2 A;  2Z9X A;  2BWN A;  4ITG A;  3K40 A;  3RCH B;  1KL2 A;  1AHY A;  5C6U A;  2Z20 A;  1BQA A;  2AAT A;  4LNL A;  4A0R A;  2BYL A;  2VGZ A;  1AHG A;  3ECD A;  3EI9 A;  2YCT A;  3EIB A;  4IXO A;  3FDB A;  4E77 A;  2VLH A;  1DJU A;  1LS3 A;  1CZE A;  1MAQ A;  3G7Q A;  2VI9 A;  1X0M A;  2DGM A;  4BHD A;  2W8W A;  1G7W A;  1I43 A;  2JG2 A;  1AMR A;  4MY5 A;  1PFF A;  3NYU A;  1AKB A;  2OQX A;  4WB0 B;  4F5I A;  3EZ1 A;  2DKB A;  5G0A A;  9AAT A;  3Q8N A;  1S09 A;  2JGT A;  4M2M A;  4EB7 A;  1V2D A;  2C44 A;  2WK7 A;  1ASL A;  1SPA A;  2BI2 A;  1ELQ A;  2QBT A;  2VGS A;  5G2Q A;  4DBC A;  4RKC A;  4O6Z A;  3AEN A;  3AEM A;  3AEP A;  4HF8 A;  3WX9 A;  4WYE A;  1CL2 A;  3QGU A;  2OGA A;  5D95 A;  2ZY5 A;  4CBR A;  1OXO A;  2CB1 A;  2HOZ A;  3G8M A;  4IXZ A;  2C0R A;  4W1W A;  4WYD A;  3I4J A;  1O62 A;  1ASC A;  3GR9 A;  1E5F A;  4ITX A;  2DR1 A;  5EUD A;  3WCN A;  1O69 A;  1KKJ A;  3KGW A;  1V72 A;  3QBO A;  1X2A A;  1GD9 A;  2AY2 A;  1BQD A;  4IYO A;  4HVK A;  1CJ0 A;  5FT5 A;  4Y0D A;  4CXQ A;  2R0T A;  1UU1 A;  1GEX A;  2HOY A;  3L8A A;  1MLZ A;  1OHV A;  4OTL A;  3II0 A;  4PVF A;  1GDE A;  3T32 A;  1BKG A;  3P6K A;  3MBB A;  3BCA A;  1M4N A;  2D65 A;  1D2F A;  1DFO A;  1V2E A;  3PA9 A;  1WYV A;  2VMW A;  4EU1 A;  1C4K A;  2W7L A;  3FSL A;  4ADE A;  1ECX A;  1XEY A;  4RLG A;  1G4X A;  2ZC0 A;  3AEL A;  4XJM A;  1IJI A;  3PD6 B;  1GC2 A;  4JEW A;  4DGT A;  3A9X A;  1AMS A;  3RQ1 A;  2W7E A;  3N4S A;  2Z9W A;  3DC1 A;  3MC6 A;  1SF2 A;  4MGR A;  4N0B A;  2WK9 A;  3NTJ A;  4H51 A;  3W1J A;  4AH3 A;  2YKU A;  1KMJ A;  2VGW A;  2GSA A;  4F4E A;  2PB2 A;  1WST A;  1C7G A;  3NNK A;  2W7M A;  3UE8 A;  1LW4 A;  1J04 A;  4BA4 A;  2C7T A;  3PDB A;  4UHM A;  3WLX A;  3WKS A;  2GMS A;  1MDO A;  1IBJ A;  3ZRR A;  1TAT A;  2YKV A;  4WLJ A;  1YOO A;  3FKD A;  5HHY A;  3TQX A;  1GEY A;  2YHK A;  2CST A;  1GC0 A;  2F8J A;  2R5E A;  4RIZ A;  1C0N A;  2VIB A;  1AKA A;  1OHY A;  1C7O A;  3DR4 A;  3R4T A;  2VMR A;  4EMY A;  1FG3 A;  3WZF A;  5EUE A;  3BWO A;  3PJ0 A;  1DGD A;  1CL1 A;  5DJ1 A;  1AJS B;  1AX4 A;  4GE4 A;  5F8V A;  4F5L A;  2QSR A;  3KGX A;  1UKJ A;  1BS0 A;  3N0L A;  5FT6 A;  2E54 A;  2QB3 A;  3QPG A;  4MQR A;  1H0C A;  3WGC A;  3NU8 A;  1M0O A;  2PO3 A;  5HDM A;  5M4B A;  3NX3 A;  3MC6 C;  3FZ6 A;  3NU7 A;  2OKK A;  2OKJ A;  2Q7W A;  2DOU A;  1M7Y A;  2VGV A;  1SZU A;  2GMU A;  1QJ3 A;  3JZL A;  3K7Y A;  2R5C A;  2XBN A;  5EIG A;  4AZK A;  1CQ6 A;  2W8U A;  3B8X A;  3GSB A;  3NUI A;  2AY1 A;  3ELE A;  4LW2 A;  3RI6 A;  2W7H A;  3VP6 A;  2A1V A;  5G4I A;  1VP4 A;  2AY9 A;  1ARG A;  2VGT A;  3E77 A;  1U08 A;  4EB5 A;  1DJ9 A;  2O1B A;  4GSA A;  3LG0 A;  2W8T A;  3FZ8 A;  4I8A A;  1W23 A;  1S0A A;  3CAI A;  4E3Q A;  4J8L A;  1AIC A;  3LV2 A;  2XH1 A;  2FYF A;  2YKY A;  3COG A;  1ASM A;  3GET A;  1TOK A;  3LWS A;  5DB5 A;  1W7M A;  3AV7 A;  4JEZ A;  1LC5 A;  2AEU A;  4KAM A;  2EPJ A;  1AMA A;  4N0W A;  2D7Y A;  4Q75 A;  2QA3 A;  1C9C A;  3AEN B;  1UU2 A;  1N31 A;  4UOY A;  4MKJ A;  4H63 Q;  2ZSM A;  2EZ1 A;  3LVM A;  3NDN A;  2VMU A;  2X3L A;  3ASB A;  3QN6 A;  1QGN A;  4WP0 A;  3HMU A;  2YCN A;  4UHN A;  1T3I A;  1PMM A;  1W7N A;  1IUG A;  1IVR A;  2CTZ A;  1SZS A;  2ZSL A;  2W7J A;  3AEJ A;  1GEW A;  2YRR A;  2W7G A;  4B98 A;  4GDY A;  4WXF A;  2HUI A;  1ART A;  3EI6 A;  5D5S A;  1BJO A;  4F5F A;  2EO5 A;  5M49 A;  3ACZ A;  2VYC A;  4IYO B;  3D6K A;  4XAU A;  3ASA A;  4ZWV A;  3R9A A;  2CIN A;  5DX5 A;  4QGR A;  3FZ7 A;  4B9B A;  1QIT A;  2Z1Z A;  1ASN A;  5J8Q A;  4WD2 A;  1B4X A;  3EIA A;  3NYT A;  4A6T A;  2V1P A;  5LH9 A;  5G09 A;  2G7J A;  3OP7 A;  1TPL A;  4LNJ A;  4MQQ A;  4JEV A;  1WYV B;  4GEB A;  3ZZK A;  4ATQ A;  2BI1 A;  4OC9 A;  2ZY3 A;  1G4V A;  4DQ6 A;  1Z7D A;  2D63 A;  1AAW A;  3RUY A;  3B1C A;  1TAR A;  1AJR A;  2WK8 A;  4ISY A;  1N8P A;  2CJD A;  2YKX A;  1IAX A;  4IX8 A;  1WYT A;  3KE3 A;  3EI7 A;  3VOM A;  3AOV A;  3PIU A;  4CXR A;  3AEJ C;  4Q31 A;  1LKC A;  1VJO A;  2BWO A;  2CAN A;  3BB8 A;  2HOX A;  3CQ5 A;  1RV4 A;  4RIT A;  3FVS A;  4M2K A;  3OKS A;  2DGL A;  5EAA A;  3PAA A;  4R2N A;  3N7N A;  4RJY A;  4K2B A;  5K8B A;  2AY6 A;  2GQN A;  2QLR A;  4E1O A;  3HQT A;  1M6S A;  1JF9 A;  3DXW A;  3HBX A;  3PDB B;  4WBT A;  4JE5 D;  4A6U A;  1MDX A;  4LNM A;  2AY7 A;  4XK1 A;  3VK4 A;  4AOA A;  3M5U A;  1WYU A;  4ZM4 A;  2JIS A;  1YIY A;  1RVY A;  2VMS A;  4OMA A;  1AIB A;  4MQP A;  3VAX A;  2VI8 A;  2W8J A;  2HUF A;  2O7C A;  4GE9 A;  3B1E A;  4K2I A;  1DJE A;  2VMZ A;  2AY3 A;  4KYO A;  3IHJ A;  4UHO A;  1M0P A;  2CY8 A;  5BJ3 A;  3ZRP A;  5JAY A;  3FD0 A;  1Y4I A;  3EI5 A;  3HDO A;  1DKA A;  4LW4 A;  2Z67 A;  3TAT A;  2HOR A;  1IX6 A;  2ZY4 A;  1YAA A;  2CH2 A;  4W1X A;  2VMP A;  5LHA A;  2Z1Y A;  4WLH A;  3FVX A;  4ZSY A;  2VMT A;  3EI8 A;  1AY5 A;  2CH1 A;  4ZAS A;  4A6R A;  4ZDL A;  2BI3 A;  4ZDP A;  1ZC9 A;  2R5C B;  4LC3 A;  1C7N A;  2HP1 A;  3KKI A;  5EIG B;  5TF5 A;  1AHX A;  1P3W A;  1LW5 A;  1ASF A;  3AOW A;  2VMY A;  3ISL A;  4WYC A;  3MKJ A;  2JJE A;  5E5I A;  3UWC A;  4EFF A;  2X5F A;  4RM1 A;  1PMO A;  3P1T A;  3QI6 A;  4OT8 A;  2JJG A;  2BIA A;  3TCM A;  1CS1 A;  2OGE A;  4NOG A;  4GRX A;  2BKW A;  3TFT A;  1FC4 A;  5I92 A;  1YJY A;  4WXB A;  4CBS A;  3PDX A;  2YCP A;  1AHF A;  4IW7 A;  2AY4 A;  3AEO A;  2ZYJ A;  1ASG A;  3PPL A;  3L44 A;  1M32 A;  3DOD A;  4XJL A;  2GB3 A;  1MGV A;  4ZM3 A;  1JS3 A;  3FQ7 A;  3GWP A;  4F5J A;  1S08 A;  4FFC A;  3A8U X;  3LVL B;  1AHE A;  5EUN A;  1O61 A;  4MKK A;  4KXK A;  3TFU A;  2PB0 A;  1N2T A;  3JTX A;  1CQ7 A;  2V0Y A;  3FVU A;  2BI9 A;  2X5D A;  4Q6R A;  2ZP7 A;  1QZ9 A;  4A00 A;  4A72 A;  3DZZ A;  4XJP A;  1I41 A;  1MLY A;  4OBV A;  2ORD A;  3ELP A;  4W91 A;  1O4S A;  2FN6 A;  1H1C A;  1KMK A;  4K2M A;  1M0Q A;  2KFP A;  1RV3 A;  2ZY2 A;  3WY7 A;  2TPL A;  3MAF A;  3FDD A;  1ZOB A;  3ZRQ A;  5KTB A;  2O0R A;  2D61 A;  1BJO B;  1BW0 A;  3LVJ A;  3BCB A;  3LVK A;  1FG7 A;  2E7U A;  3F9T A;  2YRI A;  4OCA A;  4RJ0 A;  2RFV A;  3F6T A;  4OBU A;  3B46 A;  4ZSW A;  2JJH A;  3JW9 A;  1AKC A;  4W5K A;  3BWN A;  2EZ2 A;  3GJU A;  1TAS A;  4ADD A;  2VIA A;  3E2Z A;  1AY4 A;  1YNU A;  1TOE A;  1VEF A;  1EJI A;  2OAT A;  2BYJ A;  4IXS A;  1M0N A;  2NMP A;  3JWB A;  4Y0I A;  5G2P A;  3MAD A;  4CVQ A;  1CZC A;  4K05 A;  1X29 A;  2W7F A;  5E3K A;  2BIE A;  5FT4 A;  2FNU A;  4E3R A;  1EG5 A;  2Z9V A;  4UQV A;  2VMV A;  3E6G A;  3MAU A;  4JEX A;  3CBF A;  2VGU A;  2FQ6 A;  3AAT A;  2HP2 A;  1EQB A;  4P7Y A;  2W7K A;  1B8G A;  1WYT B;  2CFB A;  3RCH A;  3WKR A;  2D66 A;  2W8V A;  3H9X A;  4PFF A;  1OAT A;  1LK9 A;  1ARH A;  2W7I A;  3E9K A;  4R8D A;  1IX7 A;  1ARI A;  3B1D A;  2AY5 A;  3DYD A;  2EYQ A;  4F5H A;  1OXP A;  1MDZ A;  2BWP A;  5EQC A;  4WYA A;  1ARS A;  2D64 A;  3BWN C;  5BJ4 A;  2AY8 A;  4RKD A;  3N75 A;  1WYU B;  4XJO A;  3FFH A;  3N4R A;  4WB0 A;  3GZD A;  1B5P A;  1SFF A;  2DKJ A;  4JF0 A;  5HXX A;  3VK3 A;  2C81 A;  1KL1 A;  5M4D A;  1ASD A;  3BCX A;  3VK2 A;  4U2H A;  4A0H A;  1X28 A;  1YJS A;  3HL2 A;  2E7I A;  1KAF A;  3UAK A;  3DR7 A;  2FNI A;  4W8I A;  1TOI A;  3EUC A;  5E4Z A;  1DGE A;  2EGY A;  1D7U A;  1BT4 A;  1ELU A;  1G7X A;  1XI9 A;  2D5Y A;  4BQ0 A;  1B9H A;  4BA5 A;  1B9I A;  4GE7 A;  5EAV A;  1YJZ A;  5G4J A;  4WYF A;  1LC8 A;  1IAY A;  4ADC A;  3FTB A;  7AAT A;  2QMA A;  1WKH A;  3DXV A;  4AO9 A;  3BN1 A;  5F9S A;  1Z3Z A;  2VMX A;  4WXG A;  4Y0H A;  1GBN A;  3GBX A;  3W1H A;  4ZWM A;  3ATH A;  3AEM C;  4BMK A;  5FT8 A;  2BIG A;  3A9Y A;  4F5M A;  3WCO A;  4JF1 A;  3HT4 A;  1AAM A;  4PFN A;  1V2F A;  1I48 A;  3IF2 A;  2CJG A;  2HZP A;  8AAT A;  1ASA A;  1E5E A;  1YIZ A;  3GZD C;  3I16 A;  1CQ8 A;  3A9Z A;  1AIA A;  4J5U A;  4A0F A;  4ADB A;  5M46 A;  2FKI A;  2WB6 A;  2DGK A;  3A2B A;  2D7Z A;  2EH6 A;  3FRK A;  4P3M A;  1RVU A;  3JU7 A;  1BJW A;  1QJ5 A;  3QHX A;  3EZS A;  2W7D A;  4OYT A;  2ZUK A;  4RAE A;  3E2Y A;  4F5K A;  1SVV A;  2VMO A;  4M2J A;  1ZOD A;  3FQ8 A;  3HVY A;  3CQ6 A;  3K28 A;  3N4X A;  5EFS A;  1GCK A;  4PIW A;  4L0O A;  1GC4 A;  3FFR A;  1S06 A;  2CJH A;  2JJF A;  2VMN A;  4ZLV A;  3PD6 A;  1D7S A;  4U1T A;  2WKA A;  1PG8 A;  1KKP A;  3FQA A;  3H7F A;  1QIS A;  1TOG A;  3BS8 A;  1GC3 A;  2Z61 A;  4MSO A;  4F5G A;  4ATP A;  1ORD A;  2FM1 A;  4W1V A;  3DU4 A;  1IX8 A;  1B5O A;  2ZJG A;  4TV7 A;  1DTY A;  3MEB A;  3JWA A;  1S07 A;  1JG8 A;  3NUB A;  3PGY A;  1QIR A;  4R5F A;  4TMR A;  3CQ4 A;  5DJ9 A;  4AO4 A;  1JS6 A;  3WGB A;  1ASE A;  1J32 A;  2BI5 A;  3FCR A;  3NRA A;  2AEV A;  3N5M A;  1BJ4 A;  4JE5 A;  3MAF B;  4ZAH A;  3QM2 A;  3GZC A;  4R5Z A;  2BHX A;  4WYG A;  1D7V A;  4IY7 A;  1WKG A;  1ASB A;  2VLF A;  4TN4 A;  1MAP A;  1D7R A;  4JEY A;  5AX8 A;  2HUU A;  3ZZJ A;  3H14 A;  3E2F A;  3I5T A;  4A0G A;  3E2Z B;  3LY1 A;  3BV0 A;  2G6W A;  3NYS A;  3W1I A;  1SZK A;  3F0H A;  1UU0 A;  4Q76 A;  3RBF A; 
#chains in the Genus database with same CATH homology
 1I29 A;  1AJS A;  1AMQ A;  1TOJ A;  1BJN A;  2Z9U A;  2R2N A;  3G0T A;  1W7L A;  2YOB A;  3HLM A;  3USF A;  4AZJ A;  3DRD A;  1OHW A;  4FL0 A;  4ZDO A;  1LC7 A;  2X8U A;  2E7J A;  2VMQ A;  3BC8 A;  4XQ2 A;  3RBL A;  5IWQ A;  1AY8 A;  4XEW A;  1W3U A;  2QB2 A;  2Z9X A;  2BWN A;  4ITG A;  3K40 A;  3RCH B;  1KL2 A;  1AHY A;  5C6U A;  2Z20 A;  1BQA A;  2AAT A;  4LNL A;  4A0R A;  2BYL A;  2VGZ A;  1AHG A;  3ECD A;  3EI9 A;  2YCT A;  3EIB A;  4IXO A;  3FDB A;  4E77 A;  2VLH A;  1DJU A;  1LS3 A;  1CZE A;  1MAQ A;  3G7Q A;  2VI9 A;  1X0M A;  2DGM A;  4BHD A;  2W8W A;  1G7W A;  1I43 A;  2JG2 A;  1AMR A;  4MY5 A;  1PFF A;  3NYU A;  1AKB A;  2OQX A;  4WB0 B;  4F5I A;  3EZ1 A;  2DKB A;  5G0A A;  9AAT A;  3Q8N A;  1S09 A;  2JGT A;  4M2M A;  4EB7 A;  1V2D A;  2C44 A;  2WK7 A;  1ASL A;  1SPA A;  2BI2 A;  1ELQ A;  2QBT A;  2VGS A;  5G2Q A;  4DBC A;  4RKC A;  4O6Z A;  3AEN A;  3AEM A;  3AEP A;  4HF8 A;  3WX9 A;  4WYE A;  1CL2 A;  3QGU A;  2OGA A;  5D95 A;  2ZY5 A;  4CBR A;  1OXO A;  2CB1 A;  2HOZ A;  3G8M A;  4IXZ A;  2C0R A;  4W1W A;  4WYD A;  3I4J A;  1O62 A;  1ASC A;  3GR9 A;  1E5F A;  4ITX A;  2DR1 A;  5EUD A;  3WCN A;  1O69 A;  1KKJ A;  3KGW A;  1V72 A;  3QBO A;  1X2A A;  1GD9 A;  2AY2 A;  1BQD A;  4IYO A;  4HVK A;  1CJ0 A;  5FT5 A;  4Y0D A;  4CXQ A;  2R0T A;  1UU1 A;  1GEX A;  2HOY A;  3L8A A;  1MLZ A;  1OHV A;  4OTL A;  3II0 A;  4PVF A;  1GDE A;  3T32 A;  1BKG A;  3P6K A;  3MBB A;  3BCA A;  1M4N A;  2D65 A;  1D2F A;  1DFO A;  1V2E A;  3PA9 A;  1WYV A;  2VMW A;  4EU1 A;  1C4K A;  2W7L A;  3FSL A;  4ADE A;  1ECX A;  1XEY A;  4RLG A;  1G4X A;  2ZC0 A;  3AEL A;  4XJM A;  1IJI A;  3PD6 B;  1GC2 A;  4JEW A;  4DGT A;  3A9X A;  1AMS A;  3RQ1 A;  2W7E A;  3N4S A;  2Z9W A;  3DC1 A;  3MC6 A;  1SF2 A;  4MGR A;  4N0B A;  2WK9 A;  3NTJ A;  4H51 A;  3W1J A;  4AH3 A;  2YKU A;  1KMJ A;  2VGW A;  2GSA A;  4F4E A;  2PB2 A;  1WST A;  1C7G A;  3NNK A;  2W7M A;  3UE8 A;  1LW4 A;  1J04 A;  4BA4 A;  2C7T A;  3PDB A;  4UHM A;  3WLX A;  3WKS A;  2GMS A;  1MDO A;  1IBJ A;  3ZRR A;  1TAT A;  2YKV A;  4WLJ A;  1YOO A;  3FKD A;  5HHY A;  3TQX A;  1GEY A;  2YHK A;  2CST A;  1GC0 A;  2F8J A;  2R5E A;  4RIZ A;  1C0N A;  2VIB A;  1AKA A;  1OHY A;  1C7O A;  3DR4 A;  3R4T A;  2VMR A;  4EMY A;  1FG3 A;  3WZF A;  5EUE A;  3BWO A;  3PJ0 A;  1DGD A;  1CL1 A;  5DJ1 A;  1AJS B;  1AX4 A;  4GE4 A;  5F8V A;  4F5L A;  2QSR A;  3KGX A;  1UKJ A;  1BS0 A;  3N0L A;  5FT6 A;  2E54 A;  2QB3 A;  3QPG A;  4MQR A;  1H0C A;  3WGC A;  3NU8 A;  1M0O A;  2PO3 A;  5HDM A;  5M4B A;  3NX3 A;  3MC6 C;  3FZ6 A;  3NU7 A;  2OKK A;  2OKJ A;  2Q7W A;  2DOU A;  1M7Y A;  2VGV A;  1SZU A;  2GMU A;  1QJ3 A;  3JZL A;  3K7Y A;  2R5C A;  2XBN A;  5EIG A;  4AZK A;  1CQ6 A;  2W8U A;  3B8X A;  3GSB A;  3NUI A;  2AY1 A;  3ELE A;  4LW2 A;  3RI6 A;  2W7H A;  3VP6 A;  2A1V A;  5G4I A;  1VP4 A;  2AY9 A;  1ARG A;  2VGT A;  3E77 A;  1U08 A;  4EB5 A;  1DJ9 A;  2O1B A;  4GSA A;  3LG0 A;  2W8T A;  3FZ8 A;  4I8A A;  1W23 A;  1S0A A;  3CAI A;  4E3Q A;  4J8L A;  1AIC A;  3LV2 A;  2XH1 A;  2FYF A;  2YKY A;  3COG A;  1ASM A;  3GET A;  1TOK A;  3LWS A;  5DB5 A;  1W7M A;  3AV7 A;  4JEZ A;  1LC5 A;  2AEU A;  4KAM A;  2EPJ A;  1AMA A;  4N0W A;  2D7Y A;  4Q75 A;  2QA3 A;  1C9C A;  3AEN B;  1UU2 A;  1N31 A;  4UOY A;  4MKJ A;  4H63 Q;  2ZSM A;  2EZ1 A;  3LVM A;  3NDN A;  2VMU A;  2X3L A;  3ASB A;  3QN6 A;  1QGN A;  4WP0 A;  3HMU A;  2YCN A;  4UHN A;  1T3I A;  1PMM A;  1W7N A;  1IUG A;  1IVR A;  2CTZ A;  1SZS A;  2ZSL A;  2W7J A;  3AEJ A;  1GEW A;  2YRR A;  2W7G A;  4B98 A;  4GDY A;  4WXF A;  2HUI A;  1ART A;  3EI6 A;  5D5S A;  1BJO A;  4F5F A;  2EO5 A;  5M49 A;  3ACZ A;  2VYC A;  4IYO B;  3D6K A;  4XAU A;  3ASA A;  4ZWV A;  3R9A A;  2CIN A;  5DX5 A;  4QGR A;  3FZ7 A;  4B9B A;  1QIT A;  2Z1Z A;  1ASN A;  5J8Q A;  4WD2 A;  1B4X A;  3EIA A;  3NYT A;  4A6T A;  2V1P A;  5LH9 A;  5G09 A;  2G7J A;  3OP7 A;  1TPL A;  4LNJ A;  4MQQ A;  4JEV A;  1WYV B;  4GEB A;  3ZZK A;  4ATQ A;  2BI1 A;  4OC9 A;  2ZY3 A;  1G4V A;  4DQ6 A;  1Z7D A;  2D63 A;  1AAW A;  3RUY A;  3B1C A;  1TAR A;  1AJR A;  2WK8 A;  4ISY A;  1N8P A;  2CJD A;  2YKX A;  1IAX A;  4IX8 A;  1WYT A;  3KE3 A;  3EI7 A;  3VOM A;  3AOV A;  3PIU A;  4CXR A;  3AEJ C;  4Q31 A;  1LKC A;  1VJO A;  2BWO A;  2CAN A;  3BB8 A;  2HOX A;  3CQ5 A;  1RV4 A;  4RIT A;  3FVS A;  4M2K A;  3OKS A;  2DGL A;  5EAA A;  3PAA A;  4R2N A;  3N7N A;  4RJY A;  4K2B A;  5K8B A;  2AY6 A;  2GQN A;  2QLR A;  4E1O A;  3HQT A;  1M6S A;  1JF9 A;  3DXW A;  3HBX A;  3PDB B;  4WBT A;  4JE5 D;  4A6U A;  1MDX A;  4LNM A;  2AY7 A;  4XK1 A;  3VK4 A;  4AOA A;  3M5U A;  1WYU A;  4ZM4 A;  2JIS A;  1YIY A;  1RVY A;  2VMS A;  4OMA A;  1AIB A;  4MQP A;  3VAX A;  2VI8 A;  2W8J A;  2HUF A;  2O7C A;  4GE9 A;  3B1E A;  4K2I A;  1DJE A;  2VMZ A;  2AY3 A;  4KYO A;  3IHJ A;  4UHO A;  1M0P A;  2CY8 A;  5BJ3 A;  3ZRP A;  5JAY A;  3FD0 A;  1Y4I A;  3EI5 A;  3HDO A;  1DKA A;  4LW4 A;  2Z67 A;  3TAT A;  2HOR A;  1IX6 A;  2ZY4 A;  1YAA A;  2CH2 A;  4W1X A;  2VMP A;  5LHA A;  2Z1Y A;  4WLH A;  3FVX A;  4ZSY A;  2VMT A;  3EI8 A;  1AY5 A;  2CH1 A;  4ZAS A;  4A6R A;  4ZDL A;  2BI3 A;  4ZDP A;  1ZC9 A;  2R5C B;  4LC3 A;  1C7N A;  2HP1 A;  3KKI A;  5EIG B;  5TF5 A;  1AHX A;  1P3W A;  1LW5 A;  1ASF A;  3AOW A;  2VMY A;  3ISL A;  4WYC A;  3MKJ A;  2JJE A;  5E5I A;  3UWC A;  4EFF A;  2X5F A;  4RM1 A;  1PMO A;  3P1T A;  3QI6 A;  4OT8 A;  2JJG A;  2BIA A;  3TCM A;  1CS1 A;  2OGE A;  4NOG A;  4GRX A;  2BKW A;  3TFT A;  1FC4 A;  5I92 A;  1YJY A;  4WXB A;  4CBS A;  3PDX A;  2YCP A;  1AHF A;  4IW7 A;  2AY4 A;  3AEO A;  2ZYJ A;  1ASG A;  3PPL A;  3L44 A;  1M32 A;  3DOD A;  4XJL A;  2GB3 A;  1MGV A;  4ZM3 A;  1JS3 A;  3FQ7 A;  3GWP A;  4F5J A;  1S08 A;  4FFC A;  3A8U X;  3LVL B;  1AHE A;  5EUN A;  1O61 A;  4MKK A;  4KXK A;  3TFU A;  2PB0 A;  1N2T A;  3JTX A;  1CQ7 A;  2V0Y A;  3FVU A;  2BI9 A;  2X5D A;  4Q6R A;  2ZP7 A;  1QZ9 A;  4A00 A;  4A72 A;  3DZZ A;  4XJP A;  1I41 A;  1MLY A;  4OBV A;  2ORD A;  3ELP A;  4W91 A;  1O4S A;  2FN6 A;  1H1C A;  1KMK A;  4K2M A;  1M0Q A;  2KFP A;  1RV3 A;  2ZY2 A;  3WY7 A;  2TPL A;  3MAF A;  3FDD A;  1ZOB A;  3ZRQ A;  5KTB A;  2O0R A;  2D61 A;  1BJO B;  1BW0 A;  3LVJ A;  3BCB A;  3LVK A;  1FG7 A;  2E7U A;  3F9T A;  2YRI A;  4OCA A;  4RJ0 A;  2RFV A;  3F6T A;  4OBU A;  3B46 A;  4ZSW A;  2JJH A;  3JW9 A;  1AKC A;  4W5K A;  3BWN A;  2EZ2 A;  3GJU A;  1TAS A;  4ADD A;  2VIA A;  3E2Z A;  1AY4 A;  1YNU A;  1TOE A;  1VEF A;  1EJI A;  2OAT A;  2BYJ A;  4IXS A;  1M0N A;  2NMP A;  3JWB A;  4Y0I A;  5G2P A;  3MAD A;  4CVQ A;  1CZC A;  4K05 A;  1X29 A;  2W7F A;  5E3K A;  2BIE A;  5FT4 A;  2FNU A;  4E3R A;  1EG5 A;  2Z9V A;  4UQV A;  2VMV A;  3E6G A;  3MAU A;  4JEX A;  3CBF A;  2VGU A;  2FQ6 A;  3AAT A;  2HP2 A;  1EQB A;  4P7Y A;  2W7K A;  1B8G A;  1WYT B;  2CFB A;  3RCH A;  3WKR A;  2D66 A;  2W8V A;  3H9X A;  4PFF A;  1OAT A;  1LK9 A;  1ARH A;  2W7I A;  3E9K A;  4R8D A;  1IX7 A;  1ARI A;  3B1D A;  2AY5 A;  3DYD A;  2EYQ A;  4F5H A;  1OXP A;  1MDZ A;  2BWP A;  5EQC A;  4WYA A;  1ARS A;  2D64 A;  3BWN C;  5BJ4 A;  2AY8 A;  4RKD A;  3N75 A;  1WYU B;  4XJO A;  3FFH A;  3N4R A;  4WB0 A;  3GZD A;  1B5P A;  1SFF A;  2DKJ A;  4JF0 A;  5HXX A;  3VK3 A;  2C81 A;  1KL1 A;  5M4D A;  1ASD A;  3BCX A;  3VK2 A;  4U2H A;  4A0H A;  1X28 A;  1YJS A;  3HL2 A;  2E7I A;  3UAK A;  3DR7 A;  2FNI A;  4W8I A;  1TOI A;  3EUC A;  5E4Z A;  1DGE A;  2EGY A;  1D7U A;  1BT4 A;  1ELU A;  1G7X A;  1XI9 A;  2D5Y A;  4BQ0 A;  1B9H A;  4BA5 A;  1B9I A;  4GE7 A;  5EAV A;  1YJZ A;  5G4J A;  4WYF A;  1LC8 A;  1IAY A;  4ADC A;  3FTB A;  7AAT A;  2QMA A;  1WKH A;  3DXV A;  4AO9 A;  3BN1 A;  5F9S A;  1Z3Z A;  2VMX A;  4WXG A;  4Y0H A;  1GBN A;  3GBX A;  3W1H A;  4ZWM A;  3ATH A;  3AEM C;  4BMK A;  5FT8 A;  2BIG A;  3A9Y A;  4F5M A;  3WCO A;  4JF1 A;  3HT4 A;  1AAM A;  4PFN A;  1V2F A;  1I48 A;  3IF2 A;  2CJG A;  2HZP A;  8AAT A;  1ASA A;  1E5E A;  1YIZ A;  3GZD C;  3I16 A;  1CQ8 A;  3A9Z A;  1AIA A;  4J5U A;  4A0F A;  4ADB A;  5M46 A;  2FKI A;  2WB6 A;  2DGK A;  3A2B A;  2D7Z A;  2EH6 A;  3FRK A;  4P3M A;  1RVU A;  3JU7 A;  1BJW A;  1QJ5 A;  3QHX A;  3EZS A;  2W7D A;  4OYT A;  2ZUK A;  4RAE A;  3E2Y A;  4F5K A;  1SVV A;  2VMO A;  4M2J A;  1ZOD A;  3FQ8 A;  3HVY A;  3CQ6 A;  3K28 A;  3N4X A;  5EFS A;  1GCK A;  4PIW A;  4L0O A;  1GC4 A;  3FFR A;  1S06 A;  2CJH A;  2JJF A;  2VMN A;  4ZLV A;  3PD6 A;  1D7S A;  4U1T A;  2WKA A;  1PG8 A;  1KKP A;  3FQA A;  3H7F A;  1QIS A;  1TOG A;  3BS8 A;  1GC3 A;  2Z61 A;  4MSO A;  4F5G A;  4ATP A;  1ORD A;  2FM1 A;  4W1V A;  3DU4 A;  1IX8 A;  1B5O A;  2ZJG A;  4TV7 A;  1DTY A;  3MEB A;  3JWA A;  1S07 A;  1JG8 A;  3NUB A;  3PGY A;  1QIR A;  4R5F A;  4TMR A;  3CQ4 A;  5DJ9 A;  4AO4 A;  1JS6 A;  3WGB A;  1ASE A;  1J32 A;  2BI5 A;  3FCR A;  3NRA A;  2AEV A;  3N5M A;  1BJ4 A;  4JE5 A;  3MAF B;  4ZAH A;  3QM2 A;  3GZC A;  4R5Z A;  2BHX A;  4WYG A;  1D7V A;  4IY7 A;  1WKG A;  1ASB A;  2VLF A;  4TN4 A;  1MAP A;  1D7R A;  4JEY A;  5AX8 A;  2HUU A;  3ZZJ A;  3H14 A;  3E2F A;  3I5T A;  4A0G A;  3E2Z B;  3LY1 A;  3BV0 A;  2G6W A;  3NYS A;  3W1I A;  1SZK A;  3F0H A;  1UU0 A;  4Q76 A;  3RBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...