4F5KA

Substrate specificity conversion of aspartate aminotransferase to tyrosine aminotransferase by the janus algorithm: chimera p6.
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
399
structure length
398
Chain Sequence
HVGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVMTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPTWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDIAYQGFGRGLEEDAEGLRAFAAMHKELIVASSCSNFSLYNERVGACTLVAADSETVDRAFGQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Janus: prediction and ranking of mutations required for functional interconversion of enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Aspartate aminotransferase
total genus 144
structure length 398
sequence length 399
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4f5kA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4f5kA01
1S07A 3GZDA 1GCKA 3AENA 3E9KA 1LS3A 3ZZKA 3I16A 3DR4A 1BKGA 4MQRA 1MAPA 2F8JA 3WY7A 4JEZA 3PIUA 2XH1A 1ZC9A 2YCNA 1CS1A 2QLRA 3FQ7A 4BA4A 2QB3A 2O7CA 4JEYA 1KL2A 2W8UA 2YKUA 1B8GA 3FVXA 3NYUA 1IX7A 2HP1A 1DJ9A 3EI8A 4K2IA 4MGRA 4UHNA 3RI6A 5BJ4A 4Y0DA 1FG7A 4ATPA 1YJYA 2R0TA 1LW4A 3PDBB 1B9HA 3HMUA 3N0LA 2E7IA 4KYOA 4UHMA 2AY4A 4OTLA 3VK4A 2BIGA 1AICA 2VLHA 4HVKA 3TQXA 4ADBA 3FVUA 4JEVA 2YKVA 3K7YA 2FNIA 1C4KA 2ZJGA 4CBRA 2AEUA 2Z9UA 3CQ5A 3ATHA 4W1XA 1IAXA 2DR1A 2WKAA 2YCPA 3FSLA 2W7HA 4XJPA 2WK7A 1BJWA 2EZ2A 1WKGA 1ASDA 2QBTA 4OC9A 3QI6A 3G8MA 2BI9A 2E7UA 4LNMA 4RM1A 2C0RA 5FT4A 2D66A 4Q75A 3LY1A 4LC3A 3WKSA 1AAWA 4FFCA 4JF0A 1Z3ZA 4CBSA 3COGA 2W7DA 3GSBA 4UHOA 3MC6A 1G7XA 1ELQA 3FQAA 3GETA 2W7IA 1ARHA 5EIGB 1IAYA 2R2NA 1WYVB 2AY2A 3VK2A 1C7NA 2DKBA 1AKAA 2BWOA 1AHFA 1N2TA 3CQ4A 3EIBA 4RKDA 3L44A 1TOIA 2VMXA 4F5IA 2YHKA 1YJSA 4EB7A 3TATA 1Z7DA 4UQVA 4ADDA 2HP2A 3LVMA 2Q7WA 2ZP7A 2JJGA 4WB0B 4GSAA 1V2DA 1BJOB 5D95A 1B5PA 3F6TA 4ZSWA 5FT6A 3L8AA 1AY8A 4OYTA 1I43A 3FFRA 3ZZJA 4OMAA 2BIEA 3E2YA 4AZJA 2VI8A 3FVSA 5E5IA 1N8PA 1YNUA 3B1CA 1IVRA 5E4ZA 1QGNA 3H14A 4XJLA 2VGWA 5EAVA 5AX8A 5M46A 3LV2A 2DKJA 4MY5A 4MKKA 1AJSB 1QZ9A 1YIZA 4NOGA 4OT8A 1CL2A 3M5UA 1E5EA 3LG0A 2EO5A 2BWPA 1D2FA 1RV3A 2OQXA 1DKAA 4WXGA 1GDEA 4WXBA 2CH2A 1TOJA 4WYAA 3E2ZB 1V2FA 3LVKA 4R2NA 3W1IA 3HBXA 3NX3A 4ZLVA 1X2AA 2BYLA 4RJ0A 1GD9A 2EPJA 3WGCA 4BQ0A 4OBUA 3HQTA 1B4XA 2AY8A 2V0YA 5F8VA 2BIAA 3WCOA 1M4NA 2CANA 3ZRQA 1C7OA 2OATA 4F5LA 3R4TA 2JJHA 4M2MA 2DGMA 4AO9A 4XJOA 2W8JA 5EFSA 4R5ZA 3H7FA 1MLZA 3WZFA 1EQBA 2VMNA 3QBOA 2QB2A 1S08A 3AATA 3GR9A 3MBBA 1CQ8A 1LC5A 3G0TA 4U2HA 2HUFA 4E3QA 5M4BA 1Y4IA 4CXRA 1BQDA 1YIYA 4F5FA 4Q6RA 1O61A 3NRAA 2JJFA 3TFUA 4XEWA 2Z9XA 4IY7A 2Z61A 4A0GA 3PJ0A 2BYJA 1JG8A 4WXFA 3HDOA 1M0PA 2VGUA 1QIRA 4ZDLA 2CB1A 5M49A 1UKJA 1AKCA 3HL2A 2HOZA 3G7QA 3RBFA 1CZEA 1WYUA 3P6KA 4ZAHA 5HDMA 5J8QA 1X28A 3MKJA 3PDBA 3ELPA 2VMTA 3ASBA 4IW7A 1IJIA 1V72A 3DRDA 4R5FA 4AH3A 2ZY3A 1KKPA 1CQ7A 3BN1A 3FKDA 3RUYA 4F5MA 4CXQA 1LW5A 2VMOA 4M2JA 4WYCA 4XJMA 1GC4A 1W3UA 3I5TA 1ZODA 2AY7A 4OCAA 2W7MA 4ZDPA 4HF8A 5HXXA 3A9YA 3FZ7A 2W7GA 3AOWA 4J5UA 2BI3A 3AENB 2BI5A 3F0HA 4ZASA 2PO3A 2DGLA 4ITGA 2W7LA 2HUIA 2OKKA 3AEPA 1MLYA 2Z1ZA 3UAKA 4P7YA 4JF1A 3UWCA 3AEJA 5F9SA 1EJIA 4QGRA 3AEOA 4BMKA 4P3MA 4GE7A 2BI2A 3BWNC 3ELEA 4WLJA 3TCMA 2FN6A 3EIAA 3Q8NA 4A0RA 3WX9A 3FRKA 2CINA 1SPAA 4LNJA 1OATA 1SF2A 1XI9A 1D7UA 1DJEA 3EI5A 3MAFB 5G2PA 3VAXA 2FQ6A 2NMPA 2WK9A 2O1BA 2D5YA 1IUGA 3RQ1A 2VYCA 2D63A 2FYFA 1RVYA 3IF2A 2Z67A 4W8IA 1D7SA 5EUNA 4E77A 3A9XA 1N31A 2FNUA 4Q76A 1GC0A 1FC4A 1RVUA 3WKRA 1MGVA 3E2FA 2Z9VA 3JU7A 1U08A 2ZUKA 3EUCA 4MKJA 3K40A 2ZY2A 1OHVA 1KMJA 1GEWA 4MQQA 2Z1YA 2W8WA 3DZZA 1WSTA 2BI1A 1ASLA 1YAAA 2VMSA 1GC3A 3QHXA 3K28A 3RBLA 3BB8A 2CFBA 3HT4A 1AIAA 2W7KA 4W5KA 4WD2A 5IWQA 5EAAA 1CZCA 2E7JA 4KXKA 5G4JA 3RCHB 2YRRA 5DB5A 4E1OA 1W7NA 1ELUA 1ASAA 3FDDA 3NYSA 2DOUA 2XBNA 1H1CA 2OKJA 2VMUA 3FQ8A 5M4DA 1SZUA 1C9CA 4OBVA 1AIBA 3EI7A 4RKCA 2AY6A 4ZSYA 2GMUA 4IYOB 3DXWA 3A9ZA 3MC6C 3BV0A 3AV7A 2HZPA 5I92A 1DTYA 1J04A 4GRXA 3BCXA 3JTXA 1I29A 1H0CA 2ZY4A 4IXOA 1LKCA 2VMRA 3II0A 1SZKA 5EUEA 2ZSMA 3WCNA 3FFHA 3JZLA 4F5KA 3FZ6A 3PAAA 1CL1A 3PPLA 3GZCA 2BKWA 1DFOA 2ORDA 3IHJA 1BQAA 1AHXA 1ZOBA 1AHYA 1LC8A 1W23A 3DC1A 3B8XA 4ITXA 3EI6A 1BJOA 4PVFA 3MAFA 4WLHA 1AMRA 1BJ4A 2AY5A 4RIZA 1M0OA 3FD0A 1J32A 5LH9A 1ASGA 2W8TA 5TF5A 1IX8A 5G2QA 2VGTA 5K8BA 2ZSLA 4XQ2A 2CSTA 2PB0A 1ARIA 1QJ3A 3HVYA 4BA5A 1MDXA 3AEMA 4WYFA 5HHYA 3CAIA 3NNKA 4KAMA 4XK1A 1G7WA 3NYTA 1ORDA 5FT8A 2JJEA 3VOMA 1AHGA 1PFFA 1WYUB 3BCBA 2EGYA 3USFA 9AATA 1BT4A 3OKSA 4AOAA 1TATA 4K2MA 1YJZA 1OHWA 4DBCA 1S09A 2R5CA 3BCAA 4E3RA 1KMKA 3RCHA 1S06A 4CVQA 2JGTA 3ISLA 3GJUA 3PDXA 4A6TA 4RJYA 3BS8A 2D65A 1OHYA 1TOEA 1ASBA 3E77A 5LHAA 2GMSA 4IYOA 4EMYA 3PD6B 4WYGA 1VEFA 4J8LA 1O4SA 1M0QA 2Z20A 4WYEA 4K2BA 2D61A 2VMQA 4WBTA 4F5HA 3FCRA 3GWPA 4GE4A 4W1WA 3ACZA 1WKHA 2VLFA 3NUBA 1MAQA 2AEVA 2G6WA 1BW0A 1CQ6A 1DJUA 1LK9A 4IXSA 1M0NA 1G4VA 3LWSA 4LW2A 4ZM3A 7AATA 1AY4A 1CJ0A 2VMWA 2FM1A 4A6UA 4GEBA 1ARGA 2HORA 3OP7A 2QMAA 1UU1A 2BWNA 3MADA 3BC8A 4BHDA 2JISA 1GBNA 1FG3A 1M7YA 3NDNA 2CH1A 4Y0HA 4N0WA 4W1VA 2AATA 4WP0A 4ZDOA 4B98A 3WLXA 1B9IA 1V2EA 3CQ6A 2C44A 3NU7A 2GQNA 2C81A 3B1EA 3MAUA 1TOGA 4R8DA 2E54A 1UU2A 2YRIA 2OGEA 1DGDA 2D64A 2HOXA 3I4JA 4JEXA 1ASMA 3DR7A 1WYTB 3QPGA 4L0OA 1OXPA 4TMRA 1E5FA 2HUUA 1TARA 2CJDA 3BWNA 1IBJA 3KKIA 3VP6A 1AKBA 1MDZA 3AEJC 2AY1A 3E6GA 4I8AA 3UE8A 4LW4A 1LC7A 2VMZA 4MSOA 1DGEA 3FDBA 3D6KA 1W7MA 3WGBA 2R5EA 1BS0A 2VMYA 3NU8A 1ASEA 4ADCA 4A6RA 1P3WA 1X0MA 1GEYA 5EIGA 3EI9A 2X3LA 1WYVA 2CY8A 3FZ8A 5FT5A 1SZSA 4A0HA 1AMAA 1EG5A 4JE5D 5D5SA 2EH6A 4A72A 3QGUA 4JE5A 4AZKA 3BWOA 3PGYA 3GZDC 5E3KA 4ZM4A 2YKYA 3N75A 4Y0IA 4ZWMA 4A0FA 3GBXA 3PA9A 2V1PA 1IX6A 4WB0A 1D7RA 3JWBA 2QA3A 2W7EA 3F9TA 2GSAA 1PMMA 4ATQA 1OXOA 2WK8A 1YOOA 4RLGA 3EZ1A 1ASCA 1O62A 1I41A 2C7TA 2AY9A 3T32A 3LVJA 5JAYA 2OGAA 3B46A 3KE3A 3AEMC 4DQ6A 4ZWVA 1KKJA 2RFVA 1O69A 3DYDA 3KGWA 1VP4A 3ZRPA 1TASA 4AO4A 1ARTA 2CTZA 2X8UA 2GB3A 2W7JA 1QJ5A 3ZRRA 1XEYA 3A2BA 4O6ZA 4MQPA 2O0RA 4JEWA 5G0AA 2TPLA 2R5CB 2JG2A 3EZSA 4IXZA 1D7VA 2AY3A 4RITA 4PIWA 3W1JA 1SFFA 5BJ3A 2X5FA 1GC2A 1AJSA 2VGZA 4F4EA 1W7LA 2VGSA 3MEBA 4Q31A 1G4XA 3DU4A 4RAEA 1AMSA 1TPLA 3PD6A 4DGTA 3B1DA 3LVLB 3DXVA 1PG8A 3AOVA 1ASNA 2VGVA 3ASAA 1C0NA 3N5MA 4EU1A 1I48A 2EZ1A 4EB5A 2CJGA 4F5JA 4PFFA 2PB2A 1AMQA 4F5GA 8AATA 1RV4A 4PFNA 1QISA 3ECDA 4LNLA 1UU0A 3FTBA 1VJOA 1AHEA 1JS6A 4ISYA 2ZY5A 4U1TA 5DJ9A 3W1HA 1X29A 4TN4A 2VIBA 1PMOA 2Z9WA 5G4IA 4FL0A 2YCTA 1ECXA 4XAUA 2CJHA 4TV7A 1AAMA 4EFFA 5DX5A 4M2KA 1JF9A 3P1TA 3QN6A 4GDYA 2VMVA 5C6UA 5EQCA 1S0AA 1ARSA 1AX4A 1M32A 2DGKA 4A00A 1AJRA 3DODA 3TFTA 4UOYA 1MDOA 4N0BA 1KL1A 3AELA 1JS3A 3E2ZA 1WYTA 4WYDA 5G09A 4B9BA 2ZC0A 2ZYJA 4W91A 1GEXA 3VK3A 1T3IA 5DJ1A 3A8UX 4ADEA 2YOBA 3R9AA 3CBFA 1QITA 3NTJA 1TOKA 1M6SA 2HOYA 2VIAA 2YKXA 3JW9A 3JWAA 2BHXA 2D7ZA 2W7FA 4IX8A 2W8VA 1BJNA 1B5OA 1ASFA 3HLMA 2VI9A 2X5DA 3NUIA 2VMPA 1C7GA 1AY5A 3KGXA 4H51A 1SVVA 5EUDA 4GE9A 2D7YA 3QM2A
chains in the Genus database with same CATH superfamily
1S07A 3GZDA 1GCKA 3AENA 3E9KA 1LS3A 3ZZKA 3I16A 3DR4A 1BKGA 4MQRA 1MAPA 2F8JA 3WY7A 4JEZA 3PIUA 2XH1A 1ZC9A 2YCNA 1CS1A 2QLRA 3FQ7A 4BA4A 2QB3A 2O7CA 4JEYA 1KL2A 2W8UA 2YKUA 1B8GA 3FVXA 3NYUA 1IX7A 2HP1A 1DJ9A 3EI8A 4K2IA 4MGRA 4UHNA 3RI6A 5BJ4A 4Y0DA 1FG7A 4ATPA 1YJYA 2R0TA 1LW4A 3PDBB 1B9HA 3HMUA 3N0LA 2E7IA 4KYOA 4UHMA 2AY4A 4OTLA 3VK4A 2BIGA 1AICA 2VLHA 4HVKA 3TQXA 4ADBA 3FVUA 4JEVA 2YKVA 3K7YA 2FNIA 1C4KA 2ZJGA 4CBRA 2AEUA 2Z9UA 3CQ5A 3ATHA 4W1XA 2QSRA 1IAXA 2DR1A 2WKAA 2YCPA 3FSLA 2W7HA 4XJPA 2WK7A 1BJWA 2EZ2A 1WKGA 1ASDA 2QBTA 4OC9A 3QI6A 3G8MA 2BI9A 2E7UA 4LNMA 4RM1A 2C0RA 5FT4A 2D66A 2WB6A 4Q75A 3LY1A 4LC3A 3WKSA 1AAWA 4FFCA 4JF0A 1Z3ZA 4CBSA 3COGA 2W7DA 3GSBA 4UHOA 3MC6A 1G7XA 1ELQA 3FQAA 3GETA 2W7IA 1ARHA 5EIGB 1IAYA 2R2NA 1WYVB 2AY2A 3VK2A 1C7NA 2DKBA 1AKAA 2BWOA 1AHFA 1N2TA 3CQ4A 3EIBA 4RKDA 3L44A 1TOIA 2VMXA 4F5IA 2YHKA 1YJSA 4EB7A 3TATA 1Z7DA 4UQVA 4ADDA 2HP2A 3LVMA 2Q7WA 2ZP7A 2JJGA 4WB0B 4GSAA 1V2DA 1BJOB 5D95A 1B5PA 3F6TA 4ZSWA 5FT6A 3L8AA 1AY8A 4OYTA 1I43A 3FFRA 3ZZJA 4OMAA 2BIEA 3E2YA 4AZJA 2VI8A 3FVSA 5E5IA 1N8PA 1YNUA 3B1CA 1IVRA 5E4ZA 1QGNA 3H14A 4XJLA 2VGWA 5EAVA 5AX8A 5M46A 3LV2A 2DKJA 4MY5A 4MKKA 1AJSB 1QZ9A 1YIZA 4NOGA 4OT8A 1CL2A 3M5UA 1E5EA 3LG0A 2EO5A 2BWPA 1D2FA 1RV3A 2OQXA 1DKAA 4WXGA 1GDEA 4WXBA 2CH2A 1TOJA 4WYAA 3E2ZB 1V2FA 3LVKA 4R2NA 3W1IA 3HBXA 3NX3A 4ZLVA 1KAFA 1X2AA 2BYLA 4RJ0A 1GD9A 2EPJA 3WGCA 4BQ0A 4OBUA 3HQTA 1B4XA 2AY8A 2V0YA 5F8VA 2BIAA 3WCOA 1M4NA 2CANA 3ZRQA 1C7OA 2OATA 4F5LA 3R4TA 2JJHA 4M2MA 2DGMA 4AO9A 4XJOA 2W8JA 5EFSA 4R5ZA 3H7FA 1MLZA 3WZFA 1EQBA 2VMNA 3QBOA 2QB2A 1S08A 3AATA 3GR9A 3MBBA 1CQ8A 1LC5A 3G0TA 4U2HA 2HUFA 4E3QA 2KFPA 5M4BA 1Y4IA 4CXRA 3N4RA 1BQDA 1YIYA 4F5FA 4Q6RA 1O61A 3NRAA 2JJFA 3TFUA 4XEWA 2Z9XA 4IY7A 2Z61A 4A0GA 3PJ0A 2BYJA 1JG8A 4WXFA 3HDOA 1M0PA 2VGUA 1QIRA 4ZDLA 2CB1A 5M49A 1UKJA 1AKCA 3HL2A 2HOZA 3G7QA 3RBFA 1CZEA 1WYUA 4K05A 3P6KA 4ZAHA 5HDMA 5KTBA 5J8QA 1X28A 3MKJA 3PDBA 3ELPA 2VMTA 3ASBA 4IW7A 1IJIA 1V72A 3DRDA 4R5FA 4AH3A 2ZY3A 1KKPA 1CQ7A 3BN1A 3FKDA 3RUYA 4F5MA 4CXQA 1LW5A 2VMOA 4M2JA 4WYCA 4XJMA 1GC4A 1W3UA 3I5TA 1ZODA 2AY7A 4OCAA 2W7MA 4ZDPA 4HF8A 5HXXA 3A9YA 3FZ7A 2W7GA 3AOWA 4J5UA 2BI3A 3AENB 2BI5A 3F0HA 4ZASA 2PO3A 2DGLA 4ITGA 2W7LA 2HUIA 2OKKA 3AEPA 1MLYA 2Z1ZA 3UAKA 4P7YA 4JF1A 3UWCA 3AEJA 5F9SA 1EJIA 4QGRA 3AEOA 4BMKA 4P3MA 4GE7A 2BI2A 3BWNC 3ELEA 4WLJA 3TCMA 2FN6A 3EIAA 3Q8NA 4A0RA 3WX9A 3FRKA 2CINA 1SPAA 4LNJA 1OATA 1SF2A 1XI9A 1D7UA 1DJEA 3EI5A 3MAFB 5G2PA 3VAXA 2FQ6A 2NMPA 2WK9A 2O1BA 2D5YA 1IUGA 3RQ1A 2VYCA 2D63A 2FYFA 1RVYA 3IF2A 2Z67A 4W8IA 1D7SA 5EUNA 4E77A 3A9XA 1N31A 2FNUA 4Q76A 1GC0A 1FC4A 1RVUA 3WKRA 1MGVA 3E2FA 2Z9VA 3JU7A 1U08A 2ZUKA 3EUCA 4MKJA 3K40A 2ZY2A 1OHVA 1KMJA 1GEWA 4MQQA 2Z1YA 2W8WA 3DZZA 1WSTA 2BI1A 1ASLA 1YAAA 2VMSA 1GC3A 3QHXA 3K28A 3RBLA 3BB8A 2CFBA 3HT4A 1AIAA 2W7KA 4W5KA 4WD2A 5IWQA 5EAAA 1CZCA 2E7JA 4KXKA 5G4JA 3RCHB 2YRRA 5DB5A 4E1OA 1W7NA 1ELUA 1ASAA 3FDDA 3NYSA 2DOUA 2XBNA 1H1CA 2OKJA 2VMUA 3FQ8A 5M4DA 1SZUA 1C9CA 4OBVA 1AIBA 3EI7A 4RKCA 2AY6A 4ZSYA 2GMUA 4IYOB 3DXWA 3A9ZA 3MC6C 3BV0A 3AV7A 2HZPA 5I92A 1DTYA 1J04A 4GRXA 3BCXA 3JTXA 1I29A 1H0CA 2ZY4A 4IXOA 1LKCA 2VMRA 3II0A 1SZKA 5EUEA 2ZSMA 3WCNA 3FFHA 3JZLA 4F5KA 3FZ6A 3PAAA 1CL1A 3PPLA 3GZCA 2BKWA 1DFOA 2ORDA 3IHJA 1BQAA 1AHXA 1ZOBA 1AHYA 1LC8A 1W23A 3DC1A 3B8XA 4ITXA 3EI6A 1BJOA 4PVFA 3MAFA 4WLHA 1AMRA 1BJ4A 2AY5A 4RIZA 1M0OA 3FD0A 1J32A 5LH9A 1ASGA 2W8TA 5TF5A 1IX8A 5G2QA 2VGTA 5K8BA 2ZSLA 4XQ2A 2CSTA 2PB0A 1ARIA 1QJ3A 3HVYA 4BA5A 1MDXA 3AEMA 3N7NA 4WYFA 5HHYA 3CAIA 3NNKA 4KAMA 4XK1A 1G7WA 3NYTA 1ORDA 5FT8A 2JJEA 3VOMA 1AHGA 1PFFA 1WYUB 3BCBA 2EGYA 3USFA 9AATA 1BT4A 3OKSA 4AOAA 1TATA 4K2MA 1YJZA 1OHWA 4DBCA 1S09A 2R5CA 3BCAA 4E3RA 1KMKA 3RCHA 1S06A 4H63Q 4CVQA 2JGTA 3ISLA 3GJUA 3PDXA 4A6TA 4RJYA 3BS8A 2D65A 1OHYA 1TOEA 1ASBA 3E77A 5LHAA 2GMSA 4IYOA 4EMYA 3PD6B 4WYGA 1VEFA 4J8LA 1O4SA 1M0QA 2Z20A 4WYEA 4K2BA 2D61A 2VMQA 4WBTA 4F5HA 3FCRA 3GWPA 4GE4A 4W1WA 3ACZA 1WKHA 2VLFA 3NUBA 1MAQA 2AEVA 2G6WA 1BW0A 1CQ6A 1DJUA 1LK9A 4IXSA 1M0NA 1G4VA 3LWSA 4LW2A 4ZM3A 7AATA 1AY4A 1CJ0A 2VMWA 2FM1A 4A6UA 4GEBA 1ARGA 2HORA 3OP7A 2QMAA 1UU1A 2A1VA 2BWNA 3MADA 3BC8A 4BHDA 2JISA 1GBNA 1FG3A 1M7YA 3NDNA 2CH1A 4Y0HA 4N0WA 4W1VA 2AATA 4WP0A 4ZDOA 4B98A 3WLXA 1B9IA 1V2EA 3CQ6A 2C44A 3NU7A 2GQNA 2C81A 3B1EA 3MAUA 1TOGA 4R8DA 2E54A 1UU2A 2YRIA 2OGEA 1DGDA 2D64A 2HOXA 3I4JA 4JEXA 1ASMA 3DR7A 1WYTB 3QPGA 4L0OA 1OXPA 4TMRA 1E5FA 2HUUA 1TARA 2G7JA 2CJDA 3BWNA 1IBJA 3KKIA 3VP6A 1AKBA 1MDZA 3AEJC 2AY1A 3E6GA 4I8AA 3UE8A 4LW4A 1LC7A 2VMZA 4MSOA 1DGEA 3FDBA 3D6KA 1W7MA 3WGBA 2R5EA 1BS0A 2VMYA 3NU8A 1ASEA 4ADCA 4A6RA 1P3WA 1X0MA 1GEYA 5EIGA 3EI9A 2X3LA 1WYVA 2CY8A 3FZ8A 5FT5A 1SZSA 4A0HA 1AMAA 1EG5A 4JE5D 5D5SA 2EH6A 4A72A 3QGUA 4JE5A 4AZKA 3BWOA 3PGYA 3GZDC 5E3KA 4ZM4A 2YKYA 3N75A 4Y0IA 4ZWMA 4A0FA 3GBXA 3PA9A 2V1PA 1IX6A 4WB0A 1D7RA 3JWBA 2QA3A 2W7EA 3F9TA 2GSAA 1PMMA 4ATQA 1OXOA 2WK8A 2EYQA 1YOOA 4RLGA 3EZ1A 1ASCA 1O62A 1I41A 2C7TA 2AY9A 3T32A 3LVJA 5JAYA 2OGAA 3B46A 3KE3A 3AEMC 4DQ6A 4ZWVA 1KKJA 2RFVA 1O69A 3DYDA 3KGWA 1VP4A 3ZRPA 1TASA 4AO4A 1ARTA 2CTZA 2X8UA 2GB3A 2W7JA 1QJ5A 3ZRRA 1XEYA 3H9XA 3A2BA 4O6ZA 4MQPA 2O0RA 4JEWA 5G0AA 2TPLA 2R5CB 2JG2A 3EZSA 4IXZA 1D7VA 2AY3A 4RITA 4PIWA 3W1JA 1SFFA 5BJ3A 2X5FA 3N4SA 1GC2A 1AJSA 2VGZA 4F4EA 1W7LA 2VGSA 3MEBA 4Q31A 1G4XA 3DU4A 4RAEA 1AMSA 1TPLA 3PD6A 4DGTA 3B1DA 3LVLB 3DXVA 1PG8A 3AOVA 1ASNA 2VGVA 3ASAA 1C0NA 3N5MA 4EU1A 1I48A 2EZ1A 4EB5A 2CJGA 4F5JA 4PFFA 2PB2A 1AMQA 4F5GA 8AATA 1RV4A 4PFNA 1QISA 2FKIA 3ECDA 4LNLA 1UU0A 3FTBA 1VJOA 1AHEA 1JS6A 4ISYA 2ZY5A 4U1TA 5DJ9A 3W1HA 1X29A 4TN4A 2VIBA 1PMOA 2Z9WA 5G4IA 4FL0A 2YCTA 1ECXA 4XAUA 2CJHA 4TV7A 1AAMA 4EFFA 5DX5A 4M2KA 1JF9A 3P1TA 3QN6A 4GDYA 2VMVA 5C6UA 5EQCA 1S0AA 1ARSA 1AX4A 1M32A 2DGKA 4A00A 1AJRA 3DODA 3TFTA 4UOYA 1MDOA 4N0BA 1KL1A 3AELA 1JS3A 3E2ZA 1WYTA 4WYDA 5G09A 4B9BA 2ZC0A 2ZYJA 4W91A 1GEXA 3VK3A 1T3IA 5DJ1A 3A8UX 4ADEA 2YOBA 3R9AA 3CBFA 1QITA 3NTJA 1TOKA 1M6SA 2HOYA 2VIAA 2YKXA 3JW9A 3N4XA 3JWAA 2BHXA 2D7ZA 2W7FA 4IX8A 2W8VA 1BJNA 1B5OA 1ASFA 3HLMA 2VI9A 2X5DA 3NUIA 2VMPA 1C7GA 1AY5A 3KGXA 4H51A 1SVVA 5EUDA 4GE9A 2D7YA 3QM2A
chains in the Genus database with same CATH topology
1S07A 3GZDA 1GCKA 3AENA 3E9KA 1LS3A 3ZZKA 3I16A 3DR4A 1BKGA 4MQRA 1MAPA 2F8JA 3WY7A 4JEZA 3PIUA 2XH1A 1ZC9A 2YCNA 1CS1A 2QLRA 3FQ7A 4BA4A 2QB3A 2O7CA 4JEYA 1KL2A 2W8UA 2YKUA 1B8GA 3FVXA 3NYUA 1IX7A 2HP1A 1DJ9A 3EI8A 4K2IA 4MGRA 4UHNA 3RI6A 5BJ4A 4Y0DA 1FG7A 4ATPA 1YJYA 2R0TA 1LW4A 3PDBB 1B9HA 3HMUA 3N0LA 2E7IA 4KYOA 4UHMA 2AY4A 4OTLA 3VK4A 2BIGA 1AICA 2VLHA 4HVKA 3TQXA 4ADBA 3FVUA 4JEVA 2YKVA 3K7YA 2FNIA 1C4KA 2ZJGA 4CBRA 2AEUA 2Z9UA 3CQ5A 3ATHA 4W1XA 2QSRA 1IAXA 2DR1A 2WKAA 2YCPA 3FSLA 2W7HA 4XJPA 2WK7A 1BJWA 2EZ2A 1WKGA 1ASDA 2QBTA 4OC9A 3QI6A 3G8MA 2BI9A 2E7UA 4LNMA 4RM1A 2C0RA 5FT4A 2D66A 2WB6A 4Q75A 3LY1A 4LC3A 3WKSA 1AAWA 4FFCA 4JF0A 1Z3ZA 4CBSA 3COGA 2W7DA 3GSBA 4UHOA 3MC6A 1G7XA 1ELQA 3FQAA 3GETA 2W7IA 1ARHA 5EIGB 1IAYA 2R2NA 1WYVB 2AY2A 3VK2A 1C7NA 2DKBA 1AKAA 2BWOA 1AHFA 1N2TA 3CQ4A 3EIBA 4RKDA 3L44A 1TOIA 2VMXA 4F5IA 2YHKA 1YJSA 4EB7A 3TATA 1Z7DA 4UQVA 4ADDA 2HP2A 3LVMA 2Q7WA 2ZP7A 2JJGA 4WB0B 4GSAA 1V2DA 1BJOB 5D95A 1B5PA 3F6TA 4ZSWA 5FT6A 3L8AA 1AY8A 4OYTA 1I43A 3FFRA 3ZZJA 4OMAA 2BIEA 3E2YA 4AZJA 2VI8A 3FVSA 5E5IA 1N8PA 1YNUA 3B1CA 1IVRA 5E4ZA 1QGNA 3H14A 4XJLA 2VGWA 5EAVA 5AX8A 5M46A 3LV2A 2DKJA 4MY5A 4MKKA 1AJSB 1QZ9A 1YIZA 4NOGA 4OT8A 1CL2A 3M5UA 1E5EA 3LG0A 2EO5A 2BWPA 1D2FA 1RV3A 2OQXA 1DKAA 4WXGA 1GDEA 4WXBA 2CH2A 1TOJA 4WYAA 3E2ZB 1V2FA 3LVKA 4R2NA 3W1IA 3HBXA 3NX3A 4ZLVA 1X2AA 2BYLA 4RJ0A 1GD9A 2EPJA 3WGCA 4BQ0A 4OBUA 3HQTA 1B4XA 2AY8A 2V0YA 5F8VA 2BIAA 3WCOA 1M4NA 2CANA 3ZRQA 1C7OA 2OATA 4F5LA 3R4TA 2JJHA 4M2MA 2DGMA 4AO9A 4XJOA 2W8JA 5EFSA 4R5ZA 3H7FA 1MLZA 3WZFA 1EQBA 2VMNA 3QBOA 2QB2A 1S08A 3AATA 3GR9A 3MBBA 1CQ8A 1LC5A 3G0TA 4U2HA 2HUFA 4E3QA 2KFPA 5M4BA 1Y4IA 4CXRA 3N4RA 1BQDA 1YIYA 4F5FA 4Q6RA 1O61A 3NRAA 2JJFA 3TFUA 4XEWA 2Z9XA 4IY7A 2Z61A 4A0GA 3PJ0A 2BYJA 1JG8A 4WXFA 3HDOA 1M0PA 2VGUA 1QIRA 4ZDLA 2CB1A 5M49A 1UKJA 1AKCA 3HL2A 2HOZA 3G7QA 3RBFA 1CZEA 1WYUA 4K05A 3P6KA 4ZAHA 5HDMA 5KTBA 5J8QA 1X28A 3MKJA 3PDBA 3ELPA 2VMTA 3ASBA 4IW7A 1IJIA 1V72A 3DRDA 4R5FA 4AH3A 2ZY3A 1KKPA 1CQ7A 3BN1A 3FKDA 3RUYA 4F5MA 4CXQA 1LW5A 2VMOA 4M2JA 4WYCA 4XJMA 1GC4A 1W3UA 3I5TA 1ZODA 2AY7A 4OCAA 2W7MA 4ZDPA 4HF8A 5HXXA 3A9YA 3FZ7A 2W7GA 3AOWA 4J5UA 2BI3A 3AENB 2BI5A 3F0HA 4ZASA 2PO3A 2DGLA 4ITGA 2W7LA 2HUIA 2OKKA 3AEPA 1MLYA 2Z1ZA 3UAKA 4P7YA 4JF1A 3UWCA 3AEJA 5F9SA 1EJIA 4QGRA 3AEOA 4BMKA 4P3MA 4GE7A 2BI2A 3BWNC 3ELEA 4WLJA 3TCMA 2FN6A 3EIAA 3Q8NA 4A0RA 3WX9A 3FRKA 2CINA 1SPAA 4LNJA 1OATA 1SF2A 1XI9A 1D7UA 1DJEA 3EI5A 3MAFB 5G2PA 3VAXA 2FQ6A 2NMPA 2WK9A 2O1BA 2D5YA 1IUGA 3RQ1A 2VYCA 2D63A 2FYFA 1RVYA 3IF2A 2Z67A 4W8IA 1D7SA 5EUNA 4E77A 3A9XA 1N31A 2FNUA 4Q76A 1GC0A 1FC4A 1RVUA 3WKRA 1MGVA 3E2FA 2Z9VA 3JU7A 1U08A 2ZUKA 3EUCA 4MKJA 3K40A 2ZY2A 1OHVA 1KMJA 1GEWA 4MQQA 2Z1YA 2W8WA 3DZZA 1WSTA 2BI1A 1ASLA 1YAAA 2VMSA 1GC3A 3QHXA 3K28A 3RBLA 3BB8A 2CFBA 3HT4A 1AIAA 2W7KA 4W5KA 4WD2A 5IWQA 5EAAA 1CZCA 2E7JA 4KXKA 5G4JA 3RCHB 2YRRA 5DB5A 4E1OA 1W7NA 1ELUA 1ASAA 3FDDA 3NYSA 2DOUA 2XBNA 1H1CA 2OKJA 2VMUA 3FQ8A 5M4DA 1SZUA 1C9CA 4OBVA 1AIBA 3EI7A 4RKCA 2AY6A 4ZSYA 2GMUA 4IYOB 3DXWA 3A9ZA 3MC6C 3BV0A 3AV7A 2HZPA 5I92A 1DTYA 1J04A 4GRXA 3BCXA 3JTXA 1I29A 1H0CA 2ZY4A 4IXOA 1LKCA 2VMRA 3II0A 1SZKA 5EUEA 2ZSMA 3WCNA 3FFHA 3JZLA 4F5KA 3FZ6A 3PAAA 1CL1A 3PPLA 3GZCA 2BKWA 1DFOA 2ORDA 3IHJA 1BQAA 1AHXA 1ZOBA 1AHYA 1LC8A 1W23A 3DC1A 3B8XA 4ITXA 3EI6A 1BJOA 4PVFA 3MAFA 4WLHA 1AMRA 1BJ4A 2AY5A 4RIZA 1M0OA 3FD0A 1J32A 5LH9A 1ASGA 2W8TA 5TF5A 1IX8A 5G2QA 2VGTA 5K8BA 2ZSLA 4XQ2A 2CSTA 2PB0A 1ARIA 1QJ3A 3HVYA 4BA5A 1MDXA 3AEMA 3N7NA 4WYFA 5HHYA 3CAIA 3NNKA 4KAMA 4XK1A 1G7WA 3NYTA 1ORDA 5FT8A 2JJEA 3VOMA 1AHGA 1PFFA 1WYUB 3BCBA 2EGYA 3USFA 9AATA 1BT4A 3OKSA 4AOAA 1TATA 4K2MA 1YJZA 1OHWA 4DBCA 1S09A 2R5CA 3BCAA 4E3RA 1KMKA 3RCHA 1S06A 4H63Q 4CVQA 2JGTA 3ISLA 3GJUA 3PDXA 4A6TA 4RJYA 3BS8A 2D65A 1OHYA 1TOEA 1ASBA 3E77A 5LHAA 2GMSA 4IYOA 4EMYA 3PD6B 4WYGA 1VEFA 4J8LA 1O4SA 1M0QA 2Z20A 4WYEA 4K2BA 2D61A 2VMQA 4WBTA 4F5HA 3FCRA 3GWPA 4GE4A 4W1WA 3ACZA 1WKHA 2VLFA 3NUBA 1MAQA 2AEVA 2G6WA 1BW0A 1CQ6A 1DJUA 1LK9A 4IXSA 1M0NA 1G4VA 3LWSA 4LW2A 4ZM3A 7AATA 1AY4A 1CJ0A 2VMWA 2FM1A 4A6UA 4GEBA 1ARGA 2HORA 3OP7A 2QMAA 1UU1A 2A1VA 2BWNA 3MADA 3BC8A 4BHDA 2JISA 1GBNA 1FG3A 1M7YA 3NDNA 2CH1A 4Y0HA 4N0WA 4W1VA 2AATA 4WP0A 4ZDOA 4B98A 3WLXA 1B9IA 1V2EA 3CQ6A 2C44A 3NU7A 2GQNA 2C81A 3B1EA 3MAUA 1TOGA 4R8DA 2E54A 1UU2A 2YRIA 2OGEA 1DGDA 2D64A 2HOXA 3I4JA 4JEXA 1ASMA 3DR7A 1WYTB 3QPGA 4L0OA 1OXPA 4TMRA 1E5FA 2HUUA 1TARA 2G7JA 2CJDA 3BWNA 1IBJA 3KKIA 3VP6A 1AKBA 1MDZA 3AEJC 2AY1A 3E6GA 4I8AA 3UE8A 4LW4A 1LC7A 2VMZA 4MSOA 1DGEA 3FDBA 3D6KA 1W7MA 3WGBA 2R5EA 1BS0A 2VMYA 3NU8A 1ASEA 4ADCA 4A6RA 1P3WA 1X0MA 1GEYA 5EIGA 3EI9A 2X3LA 1WYVA 2CY8A 3FZ8A 5FT5A 1SZSA 4A0HA 1AMAA 1EG5A 4JE5D 5D5SA 2EH6A 4A72A 3QGUA 4JE5A 4AZKA 3BWOA 3PGYA 3GZDC 5E3KA 4ZM4A 2YKYA 3N75A 4Y0IA 4ZWMA 4A0FA 3GBXA 3PA9A 2V1PA 1IX6A 4WB0A 1D7RA 3JWBA 2QA3A 2W7EA 3F9TA 2GSAA 1PMMA 4ATQA 1OXOA 2WK8A 2EYQA 1YOOA 4RLGA 3EZ1A 1ASCA 1O62A 1I41A 2C7TA 2AY9A 3T32A 3LVJA 5JAYA 2OGAA 3B46A 3KE3A 3AEMC 4DQ6A 4ZWVA 1KKJA 2RFVA 1O69A 3DYDA 3KGWA 1VP4A 3ZRPA 1TASA 4AO4A 1ARTA 2CTZA 2X8UA 2GB3A 2W7JA 1QJ5A 3ZRRA 1XEYA 3H9XA 3A2BA 4O6ZA 4MQPA 2O0RA 4JEWA 5G0AA 2TPLA 2R5CB 2JG2A 3EZSA 4IXZA 1D7VA 2AY3A 4RITA 4PIWA 3W1JA 1SFFA 5BJ3A 2X5FA 3N4SA 1GC2A 1AJSA 2VGZA 4F4EA 1W7LA 2VGSA 3MEBA 4Q31A 1G4XA 3DU4A 4RAEA 1AMSA 1TPLA 3PD6A 4DGTA 3B1DA 3LVLB 3DXVA 1PG8A 3AOVA 1ASNA 2VGVA 3ASAA 1C0NA 3N5MA 4EU1A 1I48A 2EZ1A 4EB5A 2CJGA 4F5JA 4PFFA 2PB2A 1AMQA 4F5GA 8AATA 1RV4A 4PFNA 1QISA 2FKIA 3ECDA 4LNLA 1UU0A 3FTBA 1VJOA 1AHEA 1JS6A 4ISYA 2ZY5A 4U1TA 5DJ9A 3W1HA 1X29A 4TN4A 2VIBA 1PMOA 2Z9WA 5G4IA 4FL0A 2YCTA 1ECXA 4XAUA 2CJHA 4TV7A 1AAMA 4EFFA 5DX5A 4M2KA 1JF9A 3P1TA 3QN6A 4GDYA 2VMVA 5C6UA 5EQCA 1S0AA 1ARSA 1AX4A 1M32A 2DGKA 4A00A 1AJRA 3DODA 3TFTA 4UOYA 1MDOA 4N0BA 1KL1A 3AELA 1JS3A 3E2ZA 1WYTA 4WYDA 5G09A 4B9BA 2ZC0A 2ZYJA 4W91A 1GEXA 3VK3A 1T3IA 5DJ1A 3A8UX 4ADEA 2YOBA 3R9AA 3CBFA 1QITA 3NTJA 1TOKA 1M6SA 2HOYA 2VIAA 2YKXA 3JW9A 3N4XA 3JWAA 2BHXA 2D7ZA 2W7FA 4IX8A 2W8VA 1BJNA 1B5OA 1ASFA 3HLMA 2VI9A 2X5DA 3NUIA 2VMPA 1C7GA 1AY5A 3KGXA 4H51A 1SVVA 5EUDA 4GE9A 2D7YA 3QM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S07 A;  3GZD A;  1GCK A;  3AEN A;  3E9K A;  1LS3 A;  3ZZK A;  3I16 A;  3DR4 A;  1BKG A;  4MQR A;  1MAP A;  2F8J A;  3WY7 A;  4JEZ A;  3PIU A;  2XH1 A;  1ZC9 A;  2YCN A;  1CS1 A;  2QLR A;  3FQ7 A;  4BA4 A;  2QB3 A;  2O7C A;  4JEY A;  1KL2 A;  2W8U A;  2YKU A;  1B8G A;  3FVX A;  3NYU A;  1IX7 A;  2HP1 A;  1DJ9 A;  3EI8 A;  4K2I A;  4MGR A;  4UHN A;  3RI6 A;  5BJ4 A;  4Y0D A;  1FG7 A;  4ATP A;  1YJY A;  2R0T A;  1LW4 A;  3PDB B;  1B9H A;  3HMU A;  3N0L A;  2E7I A;  4KYO A;  4UHM A;  2AY4 A;  4OTL A;  3VK4 A;  2BIG A;  1AIC A;  2VLH A;  4HVK A;  3TQX A;  4ADB A;  3FVU A;  4JEV A;  2YKV A;  3K7Y A;  2FNI A;  1C4K A;  2ZJG A;  4CBR A;  2AEU A;  2Z9U A;  3CQ5 A;  3ATH A;  4W1X A;  1IAX A;  2DR1 A;  2WKA A;  2YCP A;  3FSL A;  2W7H A;  4XJP A;  2WK7 A;  1BJW A;  2EZ2 A;  1WKG A;  1ASD A;  2QBT A;  4OC9 A;  3QI6 A;  3G8M A;  2BI9 A;  2E7U A;  4LNM A;  4RM1 A;  2C0R A;  5FT4 A;  2D66 A;  4Q75 A;  3LY1 A;  4LC3 A;  3WKS A;  1AAW A;  4FFC A;  4JF0 A;  1Z3Z A;  4CBS A;  3COG A;  2W7D A;  3GSB A;  4UHO A;  3MC6 A;  1G7X A;  1ELQ A;  3FQA A;  3GET A;  2W7I A;  1ARH A;  5EIG B;  1IAY A;  2R2N A;  1WYV B;  2AY2 A;  3VK2 A;  1C7N A;  2DKB A;  1AKA A;  2BWO A;  1AHF A;  1N2T A;  3CQ4 A;  3EIB A;  4RKD A;  3L44 A;  1TOI A;  2VMX A;  4F5I A;  2YHK A;  1YJS A;  4EB7 A;  3TAT A;  1Z7D A;  4UQV A;  4ADD A;  2HP2 A;  3LVM A;  2Q7W A;  2ZP7 A;  2JJG A;  4WB0 B;  4GSA A;  1V2D A;  1BJO B;  5D95 A;  1B5P A;  3F6T A;  4ZSW A;  5FT6 A;  3L8A A;  1AY8 A;  4OYT A;  1I43 A;  3FFR A;  3ZZJ A;  4OMA A;  2BIE A;  3E2Y A;  4AZJ A;  2VI8 A;  3FVS A;  5E5I A;  1N8P A;  1YNU A;  3B1C A;  1IVR A;  5E4Z A;  1QGN A;  3H14 A;  4XJL A;  2VGW A;  5EAV A;  5AX8 A;  5M46 A;  3LV2 A;  2DKJ A;  4MY5 A;  4MKK A;  1AJS B;  1QZ9 A;  1YIZ A;  4NOG A;  4OT8 A;  1CL2 A;  3M5U A;  1E5E A;  3LG0 A;  2EO5 A;  2BWP A;  1D2F A;  1RV3 A;  2OQX A;  1DKA A;  4WXG A;  1GDE A;  4WXB A;  2CH2 A;  1TOJ A;  4WYA A;  3E2Z B;  1V2F A;  3LVK A;  4R2N A;  3W1I A;  3HBX A;  3NX3 A;  4ZLV A;  1X2A A;  2BYL A;  4RJ0 A;  1GD9 A;  2EPJ A;  3WGC A;  4BQ0 A;  4OBU A;  3HQT A;  1B4X A;  2AY8 A;  2V0Y A;  5F8V A;  2BIA A;  3WCO A;  1M4N A;  2CAN A;  3ZRQ A;  1C7O A;  2OAT A;  4F5L A;  3R4T A;  2JJH A;  4M2M A;  2DGM A;  4AO9 A;  4XJO A;  2W8J A;  5EFS A;  4R5Z A;  3H7F A;  1MLZ A;  3WZF A;  1EQB A;  2VMN A;  3QBO A;  2QB2 A;  1S08 A;  3AAT A;  3GR9 A;  3MBB A;  1CQ8 A;  1LC5 A;  3G0T A;  4U2H A;  2HUF A;  4E3Q A;  5M4B A;  1Y4I A;  4CXR A;  1BQD A;  1YIY A;  4F5F A;  4Q6R A;  1O61 A;  3NRA A;  2JJF A;  3TFU A;  4XEW A;  2Z9X A;  4IY7 A;  2Z61 A;  4A0G A;  3PJ0 A;  2BYJ A;  1JG8 A;  4WXF A;  3HDO A;  1M0P A;  2VGU A;  1QIR A;  4ZDL A;  2CB1 A;  5M49 A;  1UKJ A;  1AKC A;  3HL2 A;  2HOZ A;  3G7Q A;  3RBF A;  1CZE A;  1WYU A;  3P6K A;  4ZAH A;  5HDM A;  5J8Q A;  1X28 A;  3MKJ A;  3PDB A;  3ELP A;  2VMT A;  3ASB A;  4IW7 A;  1IJI A;  1V72 A;  3DRD A;  4R5F A;  4AH3 A;  2ZY3 A;  1KKP A;  1CQ7 A;  3BN1 A;  3FKD A;  3RUY A;  4F5M A;  4CXQ A;  1LW5 A;  2VMO A;  4M2J A;  4WYC A;  4XJM A;  1GC4 A;  1W3U A;  3I5T A;  1ZOD A;  2AY7 A;  4OCA A;  2W7M A;  4ZDP A;  4HF8 A;  5HXX A;  3A9Y A;  3FZ7 A;  2W7G A;  3AOW A;  4J5U A;  2BI3 A;  3AEN B;  2BI5 A;  3F0H A;  4ZAS A;  2PO3 A;  2DGL A;  4ITG A;  2W7L A;  2HUI A;  2OKK A;  3AEP A;  1MLY A;  2Z1Z A;  3UAK A;  4P7Y A;  4JF1 A;  3UWC A;  3AEJ A;  5F9S A;  1EJI A;  4QGR A;  3AEO A;  4BMK A;  4P3M A;  4GE7 A;  2BI2 A;  3BWN C;  3ELE A;  4WLJ A;  3TCM A;  2FN6 A;  3EIA A;  3Q8N A;  4A0R A;  3WX9 A;  3FRK A;  2CIN A;  1SPA A;  4LNJ A;  1OAT A;  1SF2 A;  1XI9 A;  1D7U A;  1DJE A;  3EI5 A;  3MAF B;  5G2P A;  3VAX A;  2FQ6 A;  2NMP A;  2WK9 A;  2O1B A;  2D5Y A;  1IUG A;  3RQ1 A;  2VYC A;  2D63 A;  2FYF A;  1RVY A;  3IF2 A;  2Z67 A;  4W8I A;  1D7S A;  5EUN A;  4E77 A;  3A9X A;  1N31 A;  2FNU A;  4Q76 A;  1GC0 A;  1FC4 A;  1RVU A;  3WKR A;  1MGV A;  3E2F A;  2Z9V A;  3JU7 A;  1U08 A;  2ZUK A;  3EUC A;  4MKJ A;  3K40 A;  2ZY2 A;  1OHV A;  1KMJ A;  1GEW A;  4MQQ A;  2Z1Y A;  2W8W A;  3DZZ A;  1WST A;  2BI1 A;  1ASL A;  1YAA A;  2VMS A;  1GC3 A;  3QHX A;  3K28 A;  3RBL A;  3BB8 A;  2CFB A;  3HT4 A;  1AIA A;  2W7K A;  4W5K A;  4WD2 A;  5IWQ A;  5EAA A;  1CZC A;  2E7J A;  4KXK A;  5G4J A;  3RCH B;  2YRR A;  5DB5 A;  4E1O A;  1W7N A;  1ELU A;  1ASA A;  3FDD A;  3NYS A;  2DOU A;  2XBN A;  1H1C A;  2OKJ A;  2VMU A;  3FQ8 A;  5M4D A;  1SZU A;  1C9C A;  4OBV A;  1AIB A;  3EI7 A;  4RKC A;  2AY6 A;  4ZSY A;  2GMU A;  4IYO B;  3DXW A;  3A9Z A;  3MC6 C;  3BV0 A;  3AV7 A;  2HZP A;  5I92 A;  1DTY A;  1J04 A;  4GRX A;  3BCX A;  3JTX A;  1I29 A;  1H0C A;  2ZY4 A;  4IXO A;  1LKC A;  2VMR A;  3II0 A;  1SZK A;  5EUE A;  2ZSM A;  3WCN A;  3FFH A;  3JZL A;  4F5K A;  3FZ6 A;  3PAA A;  1CL1 A;  3PPL A;  3GZC A;  2BKW A;  1DFO A;  2ORD A;  3IHJ A;  1BQA A;  1AHX A;  1ZOB A;  1AHY A;  1LC8 A;  1W23 A;  3DC1 A;  3B8X A;  4ITX A;  3EI6 A;  1BJO A;  4PVF A;  3MAF A;  4WLH A;  1AMR A;  1BJ4 A;  2AY5 A;  4RIZ A;  1M0O A;  3FD0 A;  1J32 A;  5LH9 A;  1ASG A;  2W8T A;  5TF5 A;  1IX8 A;  5G2Q A;  2VGT A;  5K8B A;  2ZSL A;  4XQ2 A;  2CST A;  2PB0 A;  1ARI A;  1QJ3 A;  3HVY A;  4BA5 A;  1MDX A;  3AEM A;  4WYF A;  5HHY A;  3CAI A;  3NNK A;  4KAM A;  4XK1 A;  1G7W A;  3NYT A;  1ORD A;  5FT8 A;  2JJE A;  3VOM A;  1AHG A;  1PFF A;  1WYU B;  3BCB A;  2EGY A;  3USF A;  9AAT A;  1BT4 A;  3OKS A;  4AOA A;  1TAT A;  4K2M A;  1YJZ A;  1OHW A;  4DBC A;  1S09 A;  2R5C A;  3BCA A;  4E3R A;  1KMK A;  3RCH A;  1S06 A;  4CVQ A;  2JGT A;  3ISL A;  3GJU A;  3PDX A;  4A6T A;  4RJY A;  3BS8 A;  2D65 A;  1OHY A;  1TOE A;  1ASB A;  3E77 A;  5LHA A;  2GMS A;  4IYO A;  4EMY A;  3PD6 B;  4WYG A;  1VEF A;  4J8L A;  1O4S A;  1M0Q A;  2Z20 A;  4WYE A;  4K2B A;  2D61 A;  2VMQ A;  4WBT A;  4F5H A;  3FCR A;  3GWP A;  4GE4 A;  4W1W A;  3ACZ A;  1WKH A;  2VLF A;  3NUB A;  1MAQ A;  2AEV A;  2G6W A;  1BW0 A;  1CQ6 A;  1DJU A;  1LK9 A;  4IXS A;  1M0N A;  1G4V A;  3LWS A;  4LW2 A;  4ZM3 A;  7AAT A;  1AY4 A;  1CJ0 A;  2VMW A;  2FM1 A;  4A6U A;  4GEB A;  1ARG A;  2HOR A;  3OP7 A;  2QMA A;  1UU1 A;  2BWN A;  3MAD A;  3BC8 A;  4BHD A;  2JIS A;  1GBN A;  1FG3 A;  1M7Y A;  3NDN A;  2CH1 A;  4Y0H A;  4N0W A;  4W1V A;  2AAT A;  4WP0 A;  4ZDO A;  4B98 A;  3WLX A;  1B9I A;  1V2E A;  3CQ6 A;  2C44 A;  3NU7 A;  2GQN A;  2C81 A;  3B1E A;  3MAU A;  1TOG A;  4R8D A;  2E54 A;  1UU2 A;  2YRI A;  2OGE A;  1DGD A;  2D64 A;  2HOX A;  3I4J A;  4JEX A;  1ASM A;  3DR7 A;  1WYT B;  3QPG A;  4L0O A;  1OXP A;  4TMR A;  1E5F A;  2HUU A;  1TAR A;  2CJD A;  3BWN A;  1IBJ A;  3KKI A;  3VP6 A;  1AKB A;  1MDZ A;  3AEJ C;  2AY1 A;  3E6G A;  4I8A A;  3UE8 A;  4LW4 A;  1LC7 A;  2VMZ A;  4MSO A;  1DGE A;  3FDB A;  3D6K A;  1W7M A;  3WGB A;  2R5E A;  1BS0 A;  2VMY A;  3NU8 A;  1ASE A;  4ADC A;  4A6R A;  1P3W A;  1X0M A;  1GEY A;  5EIG A;  3EI9 A;  2X3L A;  1WYV A;  2CY8 A;  3FZ8 A;  5FT5 A;  1SZS A;  4A0H A;  1AMA A;  1EG5 A;  4JE5 D;  5D5S A;  2EH6 A;  4A72 A;  3QGU A;  4JE5 A;  4AZK A;  3BWO A;  3PGY A;  3GZD C;  5E3K A;  4ZM4 A;  2YKY A;  3N75 A;  4Y0I A;  4ZWM A;  4A0F A;  3GBX A;  3PA9 A;  2V1P A;  1IX6 A;  4WB0 A;  1D7R A;  3JWB A;  2QA3 A;  2W7E A;  3F9T A;  2GSA A;  1PMM A;  4ATQ A;  1OXO A;  2WK8 A;  1YOO A;  4RLG A;  3EZ1 A;  1ASC A;  1O62 A;  1I41 A;  2C7T A;  2AY9 A;  3T32 A;  3LVJ A;  5JAY A;  2OGA A;  3B46 A;  3KE3 A;  3AEM C;  4DQ6 A;  4ZWV A;  1KKJ A;  2RFV A;  1O69 A;  3DYD A;  3KGW A;  1VP4 A;  3ZRP A;  1TAS A;  4AO4 A;  1ART A;  2CTZ A;  2X8U A;  2GB3 A;  2W7J A;  1QJ5 A;  3ZRR A;  1XEY A;  3A2B A;  4O6Z A;  4MQP A;  2O0R A;  4JEW A;  5G0A A;  2TPL A;  2R5C B;  2JG2 A;  3EZS A;  4IXZ A;  1D7V A;  2AY3 A;  4RIT A;  4PIW A;  3W1J A;  1SFF A;  5BJ3 A;  2X5F A;  1GC2 A;  1AJS A;  2VGZ A;  4F4E A;  1W7L A;  2VGS A;  3MEB A;  4Q31 A;  1G4X A;  3DU4 A;  4RAE A;  1AMS A;  1TPL A;  3PD6 A;  4DGT A;  3B1D A;  3LVL B;  3DXV A;  1PG8 A;  3AOV A;  1ASN A;  2VGV A;  3ASA A;  1C0N A;  3N5M A;  4EU1 A;  1I48 A;  2EZ1 A;  4EB5 A;  2CJG A;  4F5J A;  4PFF A;  2PB2 A;  1AMQ A;  4F5G A;  8AAT A;  1RV4 A;  4PFN A;  1QIS A;  3ECD A;  4LNL A;  1UU0 A;  3FTB A;  1VJO A;  1AHE A;  1JS6 A;  4ISY A;  2ZY5 A;  4U1T A;  5DJ9 A;  3W1H A;  1X29 A;  4TN4 A;  2VIB A;  1PMO A;  2Z9W A;  5G4I A;  4FL0 A;  2YCT A;  1ECX A;  4XAU A;  2CJH A;  4TV7 A;  1AAM A;  4EFF A;  5DX5 A;  4M2K A;  1JF9 A;  3P1T A;  3QN6 A;  4GDY A;  2VMV A;  5C6U A;  5EQC A;  1S0A A;  1ARS A;  1AX4 A;  1M32 A;  2DGK A;  4A00 A;  1AJR A;  3DOD A;  3TFT A;  4UOY A;  1MDO A;  4N0B A;  1KL1 A;  3AEL A;  1JS3 A;  3E2Z A;  1WYT A;  4WYD A;  5G09 A;  4B9B A;  2ZC0 A;  2ZYJ A;  4W91 A;  1GEX A;  3VK3 A;  1T3I A;  5DJ1 A;  3A8U X;  4ADE A;  2YOB A;  3R9A A;  3CBF A;  1QIT A;  3NTJ A;  1TOK A;  1M6S A;  2HOY A;  2VIA A;  2YKX A;  3JW9 A;  3JWA A;  2BHX A;  2D7Z A;  2W7F A;  4IX8 A;  2W8V A;  1BJN A;  1B5O A;  1ASF A;  3HLM A;  2VI9 A;  2X5D A;  3NUI A;  2VMP A;  1C7G A;  1AY5 A;  3KGX A;  4H51 A;  1SVV A;  5EUD A;  4GE9 A;  2D7Y A;  3QM2 A; 
#chains in the Genus database with same CATH topology
 1S07 A;  3GZD A;  1GCK A;  3AEN A;  3E9K A;  1LS3 A;  3ZZK A;  3I16 A;  3DR4 A;  1BKG A;  4MQR A;  1MAP A;  2F8J A;  3WY7 A;  4JEZ A;  3PIU A;  2XH1 A;  1ZC9 A;  2YCN A;  1CS1 A;  2QLR A;  3FQ7 A;  4BA4 A;  2QB3 A;  2O7C A;  4JEY A;  1KL2 A;  2W8U A;  2YKU A;  1B8G A;  3FVX A;  3NYU A;  1IX7 A;  2HP1 A;  1DJ9 A;  3EI8 A;  4K2I A;  4MGR A;  4UHN A;  3RI6 A;  5BJ4 A;  4Y0D A;  1FG7 A;  4ATP A;  1YJY A;  2R0T A;  1LW4 A;  3PDB B;  1B9H A;  3HMU A;  3N0L A;  2E7I A;  4KYO A;  4UHM A;  2AY4 A;  4OTL A;  3VK4 A;  2BIG A;  1AIC A;  2VLH A;  4HVK A;  3TQX A;  4ADB A;  3FVU A;  4JEV A;  2YKV A;  3K7Y A;  2FNI A;  1C4K A;  2ZJG A;  4CBR A;  2AEU A;  2Z9U A;  3CQ5 A;  3ATH A;  4W1X A;  2QSR A;  1IAX A;  2DR1 A;  2WKA A;  2YCP A;  3FSL A;  2W7H A;  4XJP A;  2WK7 A;  1BJW A;  2EZ2 A;  1WKG A;  1ASD A;  2QBT A;  4OC9 A;  3QI6 A;  3G8M A;  2BI9 A;  2E7U A;  4LNM A;  4RM1 A;  2C0R A;  5FT4 A;  2D66 A;  2WB6 A;  4Q75 A;  3LY1 A;  4LC3 A;  3WKS A;  1AAW A;  4FFC A;  4JF0 A;  1Z3Z A;  4CBS A;  3COG A;  2W7D A;  3GSB A;  4UHO A;  3MC6 A;  1G7X A;  1ELQ A;  3FQA A;  3GET A;  2W7I A;  1ARH A;  5EIG B;  1IAY A;  2R2N A;  1WYV B;  2AY2 A;  3VK2 A;  1C7N A;  2DKB A;  1AKA A;  2BWO A;  1AHF A;  1N2T A;  3CQ4 A;  3EIB A;  4RKD A;  3L44 A;  1TOI A;  2VMX A;  4F5I A;  2YHK A;  1YJS A;  4EB7 A;  3TAT A;  1Z7D A;  4UQV A;  4ADD A;  2HP2 A;  3LVM A;  2Q7W A;  2ZP7 A;  2JJG A;  4WB0 B;  4GSA A;  1V2D A;  1BJO B;  5D95 A;  1B5P A;  3F6T A;  4ZSW A;  5FT6 A;  3L8A A;  1AY8 A;  4OYT A;  1I43 A;  3FFR A;  3ZZJ A;  4OMA A;  2BIE A;  3E2Y A;  4AZJ A;  2VI8 A;  3FVS A;  5E5I A;  1N8P A;  1YNU A;  3B1C A;  1IVR A;  5E4Z A;  1QGN A;  3H14 A;  4XJL A;  2VGW A;  5EAV A;  5AX8 A;  5M46 A;  3LV2 A;  2DKJ A;  4MY5 A;  4MKK A;  1AJS B;  1QZ9 A;  1YIZ A;  4NOG A;  4OT8 A;  1CL2 A;  3M5U A;  1E5E A;  3LG0 A;  2EO5 A;  2BWP A;  1D2F A;  1RV3 A;  2OQX A;  1DKA A;  4WXG A;  1GDE A;  4WXB A;  2CH2 A;  1TOJ A;  4WYA A;  3E2Z B;  1V2F A;  3LVK A;  4R2N A;  3W1I A;  3HBX A;  3NX3 A;  4ZLV A;  1KAF A;  1X2A A;  2BYL A;  4RJ0 A;  1GD9 A;  2EPJ A;  3WGC A;  4BQ0 A;  4OBU A;  3HQT A;  1B4X A;  2AY8 A;  2V0Y A;  5F8V A;  2BIA A;  3WCO A;  1M4N A;  2CAN A;  3ZRQ A;  1C7O A;  2OAT A;  4F5L A;  3R4T A;  2JJH A;  4M2M A;  2DGM A;  4AO9 A;  4XJO A;  2W8J A;  5EFS A;  4R5Z A;  3H7F A;  1MLZ A;  3WZF A;  1EQB A;  2VMN A;  3QBO A;  2QB2 A;  1S08 A;  3AAT A;  3GR9 A;  3MBB A;  1CQ8 A;  1LC5 A;  3G0T A;  4U2H A;  2HUF A;  4E3Q A;  2KFP A;  5M4B A;  1Y4I A;  4CXR A;  3N4R A;  1BQD A;  1YIY A;  4F5F A;  4Q6R A;  1O61 A;  3NRA A;  2JJF A;  3TFU A;  4XEW A;  2Z9X A;  4IY7 A;  2Z61 A;  4A0G A;  3PJ0 A;  2BYJ A;  1JG8 A;  4WXF A;  3HDO A;  1M0P A;  2VGU A;  1QIR A;  4ZDL A;  2CB1 A;  5M49 A;  1UKJ A;  1AKC A;  3HL2 A;  2HOZ A;  3G7Q A;  3RBF A;  1CZE A;  1WYU A;  4K05 A;  3P6K A;  4ZAH A;  5HDM A;  5KTB A;  5J8Q A;  1X28 A;  3MKJ A;  3PDB A;  3ELP A;  2VMT A;  3ASB A;  4IW7 A;  1IJI A;  1V72 A;  3DRD A;  4R5F A;  4AH3 A;  2ZY3 A;  1KKP A;  1CQ7 A;  3BN1 A;  3FKD A;  3RUY A;  4F5M A;  4CXQ A;  1LW5 A;  2VMO A;  4M2J A;  4WYC A;  4XJM A;  1GC4 A;  1W3U A;  3I5T A;  1ZOD A;  2AY7 A;  4OCA A;  2W7M A;  4ZDP A;  4HF8 A;  5HXX A;  3A9Y A;  3FZ7 A;  2W7G A;  3AOW A;  4J5U A;  2BI3 A;  3AEN B;  2BI5 A;  3F0H A;  4ZAS A;  2PO3 A;  2DGL A;  4ITG A;  2W7L A;  2HUI A;  2OKK A;  3AEP A;  1MLY A;  2Z1Z A;  3UAK A;  4P7Y A;  4JF1 A;  3UWC A;  3AEJ A;  5F9S A;  1EJI A;  4QGR A;  3AEO A;  4BMK A;  4P3M A;  4GE7 A;  2BI2 A;  3BWN C;  3ELE A;  4WLJ A;  3TCM A;  2FN6 A;  3EIA A;  3Q8N A;  4A0R A;  3WX9 A;  3FRK A;  2CIN A;  1SPA A;  4LNJ A;  1OAT A;  1SF2 A;  1XI9 A;  1D7U A;  1DJE A;  3EI5 A;  3MAF B;  5G2P A;  3VAX A;  2FQ6 A;  2NMP A;  2WK9 A;  2O1B A;  2D5Y A;  1IUG A;  3RQ1 A;  2VYC A;  2D63 A;  2FYF A;  1RVY A;  3IF2 A;  2Z67 A;  4W8I A;  1D7S A;  5EUN A;  4E77 A;  3A9X A;  1N31 A;  2FNU A;  4Q76 A;  1GC0 A;  1FC4 A;  1RVU A;  3WKR A;  1MGV A;  3E2F A;  2Z9V A;  3JU7 A;  1U08 A;  2ZUK A;  3EUC A;  4MKJ A;  3K40 A;  2ZY2 A;  1OHV A;  1KMJ A;  1GEW A;  4MQQ A;  2Z1Y A;  2W8W A;  3DZZ A;  1WST A;  2BI1 A;  1ASL A;  1YAA A;  2VMS A;  1GC3 A;  3QHX A;  3K28 A;  3RBL A;  3BB8 A;  2CFB A;  3HT4 A;  1AIA A;  2W7K A;  4W5K A;  4WD2 A;  5IWQ A;  5EAA A;  1CZC A;  2E7J A;  4KXK A;  5G4J A;  3RCH B;  2YRR A;  5DB5 A;  4E1O A;  1W7N A;  1ELU A;  1ASA A;  3FDD A;  3NYS A;  2DOU A;  2XBN A;  1H1C A;  2OKJ A;  2VMU A;  3FQ8 A;  5M4D A;  1SZU A;  1C9C A;  4OBV A;  1AIB A;  3EI7 A;  4RKC A;  2AY6 A;  4ZSY A;  2GMU A;  4IYO B;  3DXW A;  3A9Z A;  3MC6 C;  3BV0 A;  3AV7 A;  2HZP A;  5I92 A;  1DTY A;  1J04 A;  4GRX A;  3BCX A;  3JTX A;  1I29 A;  1H0C A;  2ZY4 A;  4IXO A;  1LKC A;  2VMR A;  3II0 A;  1SZK A;  5EUE A;  2ZSM A;  3WCN A;  3FFH A;  3JZL A;  4F5K A;  3FZ6 A;  3PAA A;  1CL1 A;  3PPL A;  3GZC A;  2BKW A;  1DFO A;  2ORD A;  3IHJ A;  1BQA A;  1AHX A;  1ZOB A;  1AHY A;  1LC8 A;  1W23 A;  3DC1 A;  3B8X A;  4ITX A;  3EI6 A;  1BJO A;  4PVF A;  3MAF A;  4WLH A;  1AMR A;  1BJ4 A;  2AY5 A;  4RIZ A;  1M0O A;  3FD0 A;  1J32 A;  5LH9 A;  1ASG A;  2W8T A;  5TF5 A;  1IX8 A;  5G2Q A;  2VGT A;  5K8B A;  2ZSL A;  4XQ2 A;  2CST A;  2PB0 A;  1ARI A;  1QJ3 A;  3HVY A;  4BA5 A;  1MDX A;  3AEM A;  3N7N A;  4WYF A;  5HHY A;  3CAI A;  3NNK A;  4KAM A;  4XK1 A;  1G7W A;  3NYT A;  1ORD A;  5FT8 A;  2JJE A;  3VOM A;  1AHG A;  1PFF A;  1WYU B;  3BCB A;  2EGY A;  3USF A;  9AAT A;  1BT4 A;  3OKS A;  4AOA A;  1TAT A;  4K2M A;  1YJZ A;  1OHW A;  4DBC A;  1S09 A;  2R5C A;  3BCA A;  4E3R A;  1KMK A;  3RCH A;  1S06 A;  4H63 Q;  4CVQ A;  2JGT A;  3ISL A;  3GJU A;  3PDX A;  4A6T A;  4RJY A;  3BS8 A;  2D65 A;  1OHY A;  1TOE A;  1ASB A;  3E77 A;  5LHA A;  2GMS A;  4IYO A;  4EMY A;  3PD6 B;  4WYG A;  1VEF A;  4J8L A;  1O4S A;  1M0Q A;  2Z20 A;  4WYE A;  4K2B A;  2D61 A;  2VMQ A;  4WBT A;  4F5H A;  3FCR A;  3GWP A;  4GE4 A;  4W1W A;  3ACZ A;  1WKH A;  2VLF A;  3NUB A;  1MAQ A;  2AEV A;  2G6W A;  1BW0 A;  1CQ6 A;  1DJU A;  1LK9 A;  4IXS A;  1M0N A;  1G4V A;  3LWS A;  4LW2 A;  4ZM3 A;  7AAT A;  1AY4 A;  1CJ0 A;  2VMW A;  2FM1 A;  4A6U A;  4GEB A;  1ARG A;  2HOR A;  3OP7 A;  2QMA A;  1UU1 A;  2A1V A;  2BWN A;  3MAD A;  3BC8 A;  4BHD A;  2JIS A;  1GBN A;  1FG3 A;  1M7Y A;  3NDN A;  2CH1 A;  4Y0H A;  4N0W A;  4W1V A;  2AAT A;  4WP0 A;  4ZDO A;  4B98 A;  3WLX A;  1B9I A;  1V2E A;  3CQ6 A;  2C44 A;  3NU7 A;  2GQN A;  2C81 A;  3B1E A;  3MAU A;  1TOG A;  4R8D A;  2E54 A;  1UU2 A;  2YRI A;  2OGE A;  1DGD A;  2D64 A;  2HOX A;  3I4J A;  4JEX A;  1ASM A;  3DR7 A;  1WYT B;  3QPG A;  4L0O A;  1OXP A;  4TMR A;  1E5F A;  2HUU A;  1TAR A;  2G7J A;  2CJD A;  3BWN A;  1IBJ A;  3KKI A;  3VP6 A;  1AKB A;  1MDZ A;  3AEJ C;  2AY1 A;  3E6G A;  4I8A A;  3UE8 A;  4LW4 A;  1LC7 A;  2VMZ A;  4MSO A;  1DGE A;  3FDB A;  3D6K A;  1W7M A;  3WGB A;  2R5E A;  1BS0 A;  2VMY A;  3NU8 A;  1ASE A;  4ADC A;  4A6R A;  1P3W A;  1X0M A;  1GEY A;  5EIG A;  3EI9 A;  2X3L A;  1WYV A;  2CY8 A;  3FZ8 A;  5FT5 A;  1SZS A;  4A0H A;  1AMA A;  1EG5 A;  4JE5 D;  5D5S A;  2EH6 A;  4A72 A;  3QGU A;  4JE5 A;  4AZK A;  3BWO A;  3PGY A;  3GZD C;  5E3K A;  4ZM4 A;  2YKY A;  3N75 A;  4Y0I A;  4ZWM A;  4A0F A;  3GBX A;  3PA9 A;  2V1P A;  1IX6 A;  4WB0 A;  1D7R A;  3JWB A;  2QA3 A;  2W7E A;  3F9T A;  2GSA A;  1PMM A;  4ATQ A;  1OXO A;  2WK8 A;  2EYQ A;  1YOO A;  4RLG A;  3EZ1 A;  1ASC A;  1O62 A;  1I41 A;  2C7T A;  2AY9 A;  3T32 A;  3LVJ A;  5JAY A;  2OGA A;  3B46 A;  3KE3 A;  3AEM C;  4DQ6 A;  4ZWV A;  1KKJ A;  2RFV A;  1O69 A;  3DYD A;  3KGW A;  1VP4 A;  3ZRP A;  1TAS A;  4AO4 A;  1ART A;  2CTZ A;  2X8U A;  2GB3 A;  2W7J A;  1QJ5 A;  3ZRR A;  1XEY A;  3H9X A;  3A2B A;  4O6Z A;  4MQP A;  2O0R A;  4JEW A;  5G0A A;  2TPL A;  2R5C B;  2JG2 A;  3EZS A;  4IXZ A;  1D7V A;  2AY3 A;  4RIT A;  4PIW A;  3W1J A;  1SFF A;  5BJ3 A;  2X5F A;  3N4S A;  1GC2 A;  1AJS A;  2VGZ A;  4F4E A;  1W7L A;  2VGS A;  3MEB A;  4Q31 A;  1G4X A;  3DU4 A;  4RAE A;  1AMS A;  1TPL A;  3PD6 A;  4DGT A;  3B1D A;  3LVL B;  3DXV A;  1PG8 A;  3AOV A;  1ASN A;  2VGV A;  3ASA A;  1C0N A;  3N5M A;  4EU1 A;  1I48 A;  2EZ1 A;  4EB5 A;  2CJG A;  4F5J A;  4PFF A;  2PB2 A;  1AMQ A;  4F5G A;  8AAT A;  1RV4 A;  4PFN A;  1QIS A;  2FKI A;  3ECD A;  4LNL A;  1UU0 A;  3FTB A;  1VJO A;  1AHE A;  1JS6 A;  4ISY A;  2ZY5 A;  4U1T A;  5DJ9 A;  3W1H A;  1X29 A;  4TN4 A;  2VIB A;  1PMO A;  2Z9W A;  5G4I A;  4FL0 A;  2YCT A;  1ECX A;  4XAU A;  2CJH A;  4TV7 A;  1AAM A;  4EFF A;  5DX5 A;  4M2K A;  1JF9 A;  3P1T A;  3QN6 A;  4GDY A;  2VMV A;  5C6U A;  5EQC A;  1S0A A;  1ARS A;  1AX4 A;  1M32 A;  2DGK A;  4A00 A;  1AJR A;  3DOD A;  3TFT A;  4UOY A;  1MDO A;  4N0B A;  1KL1 A;  3AEL A;  1JS3 A;  3E2Z A;  1WYT A;  4WYD A;  5G09 A;  4B9B A;  2ZC0 A;  2ZYJ A;  4W91 A;  1GEX A;  3VK3 A;  1T3I A;  5DJ1 A;  3A8U X;  4ADE A;  2YOB A;  3R9A A;  3CBF A;  1QIT A;  3NTJ A;  1TOK A;  1M6S A;  2HOY A;  2VIA A;  2YKX A;  3JW9 A;  3N4X A;  3JWA A;  2BHX A;  2D7Z A;  2W7F A;  4IX8 A;  2W8V A;  1BJN A;  1B5O A;  1ASF A;  3HLM A;  2VI9 A;  2X5D A;  3NUI A;  2VMP A;  1C7G A;  1AY5 A;  3KGX A;  4H51 A;  1SVV A;  5EUD A;  4GE9 A;  2D7Y A;  3QM2 A; 
#chains in the Genus database with same CATH homology
 1S07 A;  3GZD A;  1GCK A;  3AEN A;  3E9K A;  1LS3 A;  3ZZK A;  3I16 A;  3DR4 A;  1BKG A;  4MQR A;  1MAP A;  2F8J A;  3WY7 A;  4JEZ A;  3PIU A;  2XH1 A;  1ZC9 A;  2YCN A;  1CS1 A;  2QLR A;  3FQ7 A;  4BA4 A;  2QB3 A;  2O7C A;  4JEY A;  1KL2 A;  2W8U A;  2YKU A;  1B8G A;  3FVX A;  3NYU A;  1IX7 A;  2HP1 A;  1DJ9 A;  3EI8 A;  4K2I A;  4MGR A;  4UHN A;  3RI6 A;  5BJ4 A;  4Y0D A;  1FG7 A;  4ATP A;  1YJY A;  2R0T A;  1LW4 A;  3PDB B;  1B9H A;  3HMU A;  3N0L A;  2E7I A;  4KYO A;  4UHM A;  2AY4 A;  4OTL A;  3VK4 A;  2BIG A;  1AIC A;  2VLH A;  4HVK A;  3TQX A;  4ADB A;  3FVU A;  4JEV A;  2YKV A;  3K7Y A;  2FNI A;  1C4K A;  2ZJG A;  4CBR A;  2AEU A;  2Z9U A;  3CQ5 A;  3ATH A;  4W1X A;  2QSR A;  1IAX A;  2DR1 A;  2WKA A;  2YCP A;  3FSL A;  2W7H A;  4XJP A;  2WK7 A;  1BJW A;  2EZ2 A;  1WKG A;  1ASD A;  2QBT A;  4OC9 A;  3QI6 A;  3G8M A;  2BI9 A;  2E7U A;  4LNM A;  4RM1 A;  2C0R A;  5FT4 A;  2D66 A;  2WB6 A;  4Q75 A;  3LY1 A;  4LC3 A;  3WKS A;  1AAW A;  4FFC A;  4JF0 A;  1Z3Z A;  4CBS A;  3COG A;  2W7D A;  3GSB A;  4UHO A;  3MC6 A;  1G7X A;  1ELQ A;  3FQA A;  3GET A;  2W7I A;  1ARH A;  5EIG B;  1IAY A;  2R2N A;  1WYV B;  2AY2 A;  3VK2 A;  1C7N A;  2DKB A;  1AKA A;  2BWO A;  1AHF A;  1N2T A;  3CQ4 A;  3EIB A;  4RKD A;  3L44 A;  1TOI A;  2VMX A;  4F5I A;  2YHK A;  1YJS A;  4EB7 A;  3TAT A;  1Z7D A;  4UQV A;  4ADD A;  2HP2 A;  3LVM A;  2Q7W A;  2ZP7 A;  2JJG A;  4WB0 B;  4GSA A;  1V2D A;  1BJO B;  5D95 A;  1B5P A;  3F6T A;  4ZSW A;  5FT6 A;  3L8A A;  1AY8 A;  4OYT A;  1I43 A;  3FFR A;  3ZZJ A;  4OMA A;  2BIE A;  3E2Y A;  4AZJ A;  2VI8 A;  3FVS A;  5E5I A;  1N8P A;  1YNU A;  3B1C A;  1IVR A;  5E4Z A;  1QGN A;  3H14 A;  4XJL A;  2VGW A;  5EAV A;  5AX8 A;  5M46 A;  3LV2 A;  2DKJ A;  4MY5 A;  4MKK A;  1AJS B;  1QZ9 A;  1YIZ A;  4NOG A;  4OT8 A;  1CL2 A;  3M5U A;  1E5E A;  3LG0 A;  2EO5 A;  2BWP A;  1D2F A;  1RV3 A;  2OQX A;  1DKA A;  4WXG A;  1GDE A;  4WXB A;  2CH2 A;  1TOJ A;  4WYA A;  3E2Z B;  1V2F A;  3LVK A;  4R2N A;  3W1I A;  3HBX A;  3NX3 A;  4ZLV A;  1X2A A;  2BYL A;  4RJ0 A;  1GD9 A;  2EPJ A;  3WGC A;  4BQ0 A;  4OBU A;  3HQT A;  1B4X A;  2AY8 A;  2V0Y A;  5F8V A;  2BIA A;  3WCO A;  1M4N A;  2CAN A;  3ZRQ A;  1C7O A;  2OAT A;  4F5L A;  3R4T A;  2JJH A;  4M2M A;  2DGM A;  4AO9 A;  4XJO A;  2W8J A;  5EFS A;  4R5Z A;  3H7F A;  1MLZ A;  3WZF A;  1EQB A;  2VMN A;  3QBO A;  2QB2 A;  1S08 A;  3AAT A;  3GR9 A;  3MBB A;  1CQ8 A;  1LC5 A;  3G0T A;  4U2H A;  2HUF A;  4E3Q A;  2KFP A;  5M4B A;  1Y4I A;  4CXR A;  3N4R A;  1BQD A;  1YIY A;  4F5F A;  4Q6R A;  1O61 A;  3NRA A;  2JJF A;  3TFU A;  4XEW A;  2Z9X A;  4IY7 A;  2Z61 A;  4A0G A;  3PJ0 A;  2BYJ A;  1JG8 A;  4WXF A;  3HDO A;  1M0P A;  2VGU A;  1QIR A;  4ZDL A;  2CB1 A;  5M49 A;  1UKJ A;  1AKC A;  3HL2 A;  2HOZ A;  3G7Q A;  3RBF A;  1CZE A;  1WYU A;  4K05 A;  3P6K A;  4ZAH A;  5HDM A;  5KTB A;  5J8Q A;  1X28 A;  3MKJ A;  3PDB A;  3ELP A;  2VMT A;  3ASB A;  4IW7 A;  1IJI A;  1V72 A;  3DRD A;  4R5F A;  4AH3 A;  2ZY3 A;  1KKP A;  1CQ7 A;  3BN1 A;  3FKD A;  3RUY A;  4F5M A;  4CXQ A;  1LW5 A;  2VMO A;  4M2J A;  4WYC A;  4XJM A;  1GC4 A;  1W3U A;  3I5T A;  1ZOD A;  2AY7 A;  4OCA A;  2W7M A;  4ZDP A;  4HF8 A;  5HXX A;  3A9Y A;  3FZ7 A;  2W7G A;  3AOW A;  4J5U A;  2BI3 A;  3AEN B;  2BI5 A;  3F0H A;  4ZAS A;  2PO3 A;  2DGL A;  4ITG A;  2W7L A;  2HUI A;  2OKK A;  3AEP A;  1MLY A;  2Z1Z A;  3UAK A;  4P7Y A;  4JF1 A;  3UWC A;  3AEJ A;  5F9S A;  1EJI A;  4QGR A;  3AEO A;  4BMK A;  4P3M A;  4GE7 A;  2BI2 A;  3BWN C;  3ELE A;  4WLJ A;  3TCM A;  2FN6 A;  3EIA A;  3Q8N A;  4A0R A;  3WX9 A;  3FRK A;  2CIN A;  1SPA A;  4LNJ A;  1OAT A;  1SF2 A;  1XI9 A;  1D7U A;  1DJE A;  3EI5 A;  3MAF B;  5G2P A;  3VAX A;  2FQ6 A;  2NMP A;  2WK9 A;  2O1B A;  2D5Y A;  1IUG A;  3RQ1 A;  2VYC A;  2D63 A;  2FYF A;  1RVY A;  3IF2 A;  2Z67 A;  4W8I A;  1D7S A;  5EUN A;  4E77 A;  3A9X A;  1N31 A;  2FNU A;  4Q76 A;  1GC0 A;  1FC4 A;  1RVU A;  3WKR A;  1MGV A;  3E2F A;  2Z9V A;  3JU7 A;  1U08 A;  2ZUK A;  3EUC A;  4MKJ A;  3K40 A;  2ZY2 A;  1OHV A;  1KMJ A;  1GEW A;  4MQQ A;  2Z1Y A;  2W8W A;  3DZZ A;  1WST A;  2BI1 A;  1ASL A;  1YAA A;  2VMS A;  1GC3 A;  3QHX A;  3K28 A;  3RBL A;  3BB8 A;  2CFB A;  3HT4 A;  1AIA A;  2W7K A;  4W5K A;  4WD2 A;  5IWQ A;  5EAA A;  1CZC A;  2E7J A;  4KXK A;  5G4J A;  3RCH B;  2YRR A;  5DB5 A;  4E1O A;  1W7N A;  1ELU A;  1ASA A;  3FDD A;  3NYS A;  2DOU A;  2XBN A;  1H1C A;  2OKJ A;  2VMU A;  3FQ8 A;  5M4D A;  1SZU A;  1C9C A;  4OBV A;  1AIB A;  3EI7 A;  4RKC A;  2AY6 A;  4ZSY A;  2GMU A;  4IYO B;  3DXW A;  3A9Z A;  3MC6 C;  3BV0 A;  3AV7 A;  2HZP A;  5I92 A;  1DTY A;  1J04 A;  4GRX A;  3BCX A;  3JTX A;  1I29 A;  1H0C A;  2ZY4 A;  4IXO A;  1LKC A;  2VMR A;  3II0 A;  1SZK A;  5EUE A;  2ZSM A;  3WCN A;  3FFH A;  3JZL A;  4F5K A;  3FZ6 A;  3PAA A;  1CL1 A;  3PPL A;  3GZC A;  2BKW A;  1DFO A;  2ORD A;  3IHJ A;  1BQA A;  1AHX A;  1ZOB A;  1AHY A;  1LC8 A;  1W23 A;  3DC1 A;  3B8X A;  4ITX A;  3EI6 A;  1BJO A;  4PVF A;  3MAF A;  4WLH A;  1AMR A;  1BJ4 A;  2AY5 A;  4RIZ A;  1M0O A;  3FD0 A;  1J32 A;  5LH9 A;  1ASG A;  2W8T A;  5TF5 A;  1IX8 A;  5G2Q A;  2VGT A;  5K8B A;  2ZSL A;  4XQ2 A;  2CST A;  2PB0 A;  1ARI A;  1QJ3 A;  3HVY A;  4BA5 A;  1MDX A;  3AEM A;  3N7N A;  4WYF A;  5HHY A;  3CAI A;  3NNK A;  4KAM A;  4XK1 A;  1G7W A;  3NYT A;  1ORD A;  5FT8 A;  2JJE A;  3VOM A;  1AHG A;  1PFF A;  1WYU B;  3BCB A;  2EGY A;  3USF A;  9AAT A;  1BT4 A;  3OKS A;  4AOA A;  1TAT A;  4K2M A;  1YJZ A;  1OHW A;  4DBC A;  1S09 A;  2R5C A;  3BCA A;  4E3R A;  1KMK A;  3RCH A;  1S06 A;  4H63 Q;  4CVQ A;  2JGT A;  3ISL A;  3GJU A;  3PDX A;  4A6T A;  4RJY A;  3BS8 A;  2D65 A;  1OHY A;  1TOE A;  1ASB A;  3E77 A;  5LHA A;  2GMS A;  4IYO A;  4EMY A;  3PD6 B;  4WYG A;  1VEF A;  4J8L A;  1O4S A;  1M0Q A;  2Z20 A;  4WYE A;  4K2B A;  2D61 A;  2VMQ A;  4WBT A;  4F5H A;  3FCR A;  3GWP A;  4GE4 A;  4W1W A;  3ACZ A;  1WKH A;  2VLF A;  3NUB A;  1MAQ A;  2AEV A;  2G6W A;  1BW0 A;  1CQ6 A;  1DJU A;  1LK9 A;  4IXS A;  1M0N A;  1G4V A;  3LWS A;  4LW2 A;  4ZM3 A;  7AAT A;  1AY4 A;  1CJ0 A;  2VMW A;  2FM1 A;  4A6U A;  4GEB A;  1ARG A;  2HOR A;  3OP7 A;  2QMA A;  1UU1 A;  2A1V A;  2BWN A;  3MAD A;  3BC8 A;  4BHD A;  2JIS A;  1GBN A;  1FG3 A;  1M7Y A;  3NDN A;  2CH1 A;  4Y0H A;  4N0W A;  4W1V A;  2AAT A;  4WP0 A;  4ZDO A;  4B98 A;  3WLX A;  1B9I A;  1V2E A;  3CQ6 A;  2C44 A;  3NU7 A;  2GQN A;  2C81 A;  3B1E A;  3MAU A;  1TOG A;  4R8D A;  2E54 A;  1UU2 A;  2YRI A;  2OGE A;  1DGD A;  2D64 A;  2HOX A;  3I4J A;  4JEX A;  1ASM A;  3DR7 A;  1WYT B;  3QPG A;  4L0O A;  1OXP A;  4TMR A;  1E5F A;  2HUU A;  1TAR A;  2G7J A;  2CJD A;  3BWN A;  1IBJ A;  3KKI A;  3VP6 A;  1AKB A;  1MDZ A;  3AEJ C;  2AY1 A;  3E6G A;  4I8A A;  3UE8 A;  4LW4 A;  1LC7 A;  2VMZ A;  4MSO A;  1DGE A;  3FDB A;  3D6K A;  1W7M A;  3WGB A;  2R5E A;  1BS0 A;  2VMY A;  3NU8 A;  1ASE A;  4ADC A;  4A6R A;  1P3W A;  1X0M A;  1GEY A;  5EIG A;  3EI9 A;  2X3L A;  1WYV A;  2CY8 A;  3FZ8 A;  5FT5 A;  1SZS A;  4A0H A;  1AMA A;  1EG5 A;  4JE5 D;  5D5S A;  2EH6 A;  4A72 A;  3QGU A;  4JE5 A;  4AZK A;  3BWO A;  3PGY A;  3GZD C;  5E3K A;  4ZM4 A;  2YKY A;  3N75 A;  4Y0I A;  4ZWM A;  4A0F A;  3GBX A;  3PA9 A;  2V1P A;  1IX6 A;  4WB0 A;  1D7R A;  3JWB A;  2QA3 A;  2W7E A;  3F9T A;  2GSA A;  1PMM A;  4ATQ A;  1OXO A;  2WK8 A;  2EYQ A;  1YOO A;  4RLG A;  3EZ1 A;  1ASC A;  1O62 A;  1I41 A;  2C7T A;  2AY9 A;  3T32 A;  3LVJ A;  5JAY A;  2OGA A;  3B46 A;  3KE3 A;  3AEM C;  4DQ6 A;  4ZWV A;  1KKJ A;  2RFV A;  1O69 A;  3DYD A;  3KGW A;  1VP4 A;  3ZRP A;  1TAS A;  4AO4 A;  1ART A;  2CTZ A;  2X8U A;  2GB3 A;  2W7J A;  1QJ5 A;  3ZRR A;  1XEY A;  3H9X A;  3A2B A;  4O6Z A;  4MQP A;  2O0R A;  4JEW A;  5G0A A;  2TPL A;  2R5C B;  2JG2 A;  3EZS A;  4IXZ A;  1D7V A;  2AY3 A;  4RIT A;  4PIW A;  3W1J A;  1SFF A;  5BJ3 A;  2X5F A;  3N4S A;  1GC2 A;  1AJS A;  2VGZ A;  4F4E A;  1W7L A;  2VGS A;  3MEB A;  4Q31 A;  1G4X A;  3DU4 A;  4RAE A;  1AMS A;  1TPL A;  3PD6 A;  4DGT A;  3B1D A;  3LVL B;  3DXV A;  1PG8 A;  3AOV A;  1ASN A;  2VGV A;  3ASA A;  1C0N A;  3N5M A;  4EU1 A;  1I48 A;  2EZ1 A;  4EB5 A;  2CJG A;  4F5J A;  4PFF A;  2PB2 A;  1AMQ A;  4F5G A;  8AAT A;  1RV4 A;  4PFN A;  1QIS A;  2FKI A;  3ECD A;  4LNL A;  1UU0 A;  3FTB A;  1VJO A;  1AHE A;  1JS6 A;  4ISY A;  2ZY5 A;  4U1T A;  5DJ9 A;  3W1H A;  1X29 A;  4TN4 A;  2VIB A;  1PMO A;  2Z9W A;  5G4I A;  4FL0 A;  2YCT A;  1ECX A;  4XAU A;  2CJH A;  4TV7 A;  1AAM A;  4EFF A;  5DX5 A;  4M2K A;  1JF9 A;  3P1T A;  3QN6 A;  4GDY A;  2VMV A;  5C6U A;  5EQC A;  1S0A A;  1ARS A;  1AX4 A;  1M32 A;  2DGK A;  4A00 A;  1AJR A;  3DOD A;  3TFT A;  4UOY A;  1MDO A;  4N0B A;  1KL1 A;  3AEL A;  1JS3 A;  3E2Z A;  1WYT A;  4WYD A;  5G09 A;  4B9B A;  2ZC0 A;  2ZYJ A;  4W91 A;  1GEX A;  3VK3 A;  1T3I A;  5DJ1 A;  3A8U X;  4ADE A;  2YOB A;  3R9A A;  3CBF A;  1QIT A;  3NTJ A;  1TOK A;  1M6S A;  2HOY A;  2VIA A;  2YKX A;  3JW9 A;  3N4X A;  3JWA A;  2BHX A;  2D7Z A;  2W7F A;  4IX8 A;  2W8V A;  1BJN A;  1B5O A;  1ASF A;  3HLM A;  2VI9 A;  2X5D A;  3NUI A;  2VMP A;  1C7G A;  1AY5 A;  3KGX A;  4H51 A;  1SVV A;  5EUD A;  4GE9 A;  2D7Y A;  3QM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...