4F5LA

A theoretical optimized mutant for the conversion of substrate specificity and activity of aspartate aminotransferase to tyrosine aminotransferase: chimera p7.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
399
structure length
398
Chain Sequence
HVGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVMTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPTWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDIAYQGFGRGLEEDAEGLRAFAAMHKELIVASSCSNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase
publication title Janus: an algorithm for ranking functional importance of residues from protein sequence alignments.
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 146
structure length 398
sequence length 399
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4f5lA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4f5lA01
1IX8A 3FQ7A 1CQ8A 2HOYA 4ISYA 2YCPA 4AOAA 1CL2A 3PD6A 2YHKA 4ZSYA 3WY7A 4DBCA 1O69A 1W7MA 3FRKA 1D2FA 5LH9A 1WKHA 1G7WA 5BJ4A 2EH6A 3VK4A 1RV4A 3FSLA 2O7CA 2VMVA 5JAYA 3CQ6A 1QZ9A 1WYUB 3FVXA 3G0TA 4ZLVA 3WKSA 2YRRA 4XJMA 3DXVA 3LVJA 1IX6A 2GMUA 1WYTB 2D5YA 5EUEA 2W7IA 4B9BA 4EMYA 2GB3A 4IYOA 4ZASA 5FT5A 1OHVA 1M7YA 3BCXA 4JEWA 1M32A 1ZC9A 1CZEA 2ZJGA 1IJIA 1LS3A 4OCAA 4U2HA 3VK2A 4A6TA 2HP1A 1YAAA 2BI3A 3NTJA 4OBUA 4F5GA 4I8AA 2BI1A 2E54A 2C44A 4XK1A 1S09A 1DKAA 4W1XA 1S08A 4JEZA 2VIAA 4CBSA 1AICA 1GC3A 1KL2A 5HDMA 3ZZJA 1MLYA 3E2ZA 1ELUA 4LC3A 1GEXA 4Q6RA 3E2YA 1V2FA 4W5KA 1Z3ZA 3ELPA 2O1BA 5G4JA 3NDNA 3USFA 3PDBA 1MAQA 3FFHA 2CINA 3R9AA 3TFTA 1C0NA 4Q75A 2W7LA 4WXBA 2BWPA 1X2AA 4DQ6A 3KGWA 3FFRA 3MC6A 2W7MA 3QGUA 3E6GA 2CFBA 3EI7A 2JJEA 3UAKA 1KMJA 1YOOA 1V72A 1OXOA 2W8TA 5E5IA 4R8DA 3WGCA 5BJ3A 5G4IA 3BCBA 4RM1A 3FDBA 4P7YA 1FG7A 1ASAA 1TOIA 3NU7A 5D95A 2HORA 4DGTA 2VMZA 2GSAA 1D7SA 2VLFA 1IAYA 4KYOA 5M49A 2Z20A 3QI6A 2CSTA 2ZP7A 4MKJA 3CQ4A 4WLHA 5F8VA 3PPLA 1C7NA 5M4BA 2NMPA 2W8VA 2AY2A 1M0QA 4OBVA 4OYTA 4EU1A 2AY4A 4F5IA 2QMAA 3W1JA 1I48A 1BJOB 4MGRA 2ZC0A 4GE7A 3JTXA 4IXOA 1W7NA 2TPLA 2VMOA 2X8UA 1FG3A 1UU0A 2AY3A 1ASBA 3AENB 3GETA 1SPAA 4W8IA 3UWCA 1KKPA 5K8BA 1ASEA 2FQ6A 2HP2A 1RV3A 3BC8A 1I41A 3BN1A 3I16A 3DYDA 4Y0IA 5EUNA 4OT8A 3UE8A 3PJ0A 1B9IA 2VMNA 1WYVB 4M2JA 4Y0HA 3ZRRA 3FDDA 2D63A 3AEJC 1JS3A 1YJYA 4WYFA 3JW9A 3NUBA 4RJ0A 3AELA 1AHFA 4A0FA 2PO3A 3ATHA 1TARA 1QITA 5E4ZA 1B4XA 1X0MA 2C0RA 2FM1A 2OGEA 2EO5A 1CL1A 1GC4A 2W7JA 3II0A 3AV7A 4ZM4A 1JF9A 4L0OA 2JISA 2YCTA 3K7YA 2JJHA 1ZOBA 3IF2A 4ADCA 1TOKA 3T32A 1BJWA 3EIAA 1C4KA 3BWNC 3RCHB 2AATA 2D64A 4IY7A 2C81A 4W1VA 4BMKA 4A0RA 3GBXA 3DC1A 2OGAA 1LK9A 1OXPA 4KXKA 1D7VA 9AATA 1LC7A 1AHYA 3FVSA 4J8LA 3WX9A 4E3RA 3PGYA 2BI9A 1B8GA 1JS6A 4W91A 1C9CA 4MSOA 4AO9A 4ATPA 2BHXA 2CH2A 1AJSB 4XAUA 5I92A 1KL1A 3QHXA 4BHDA 2FN6A 3GR9A 3FZ8A 1VP4A 2BYJA 2R2NA 2D61A 1LC8A 4WBTA 2WK8A 4PFNA 2W8JA 1J04A 1UU2A 2OQXA 1ASMA 2X5FA 4Q31A 1AKCA 1ZODA 1AIAA 1AY8A 4H51A 1AKBA 1EJIA 3VOMA 1WYUA 1YJSA 1I29A 1DJ9A 4CVQA 5G0AA 4F5KA 2HOXA 3PD6B 1AHGA 1MDXA 4M2KA 4Q76A 5J8QA 4IXZA 4CXRA 2OKJA 4UHMA 3ASAA 2QLRA 1W23A 1BQAA 1C7GA 4K2IA 2E7JA 2CY8A 2AEVA 3MEBA 3DR7A 1BKGA 5HXXA 3CBFA 3RBLA 3HDOA 2DKBA 4J5UA 1G4XA 5AX8A 1YIYA 1DFOA 1PMOA 3TFUA 2HUIA 3A9XA 4R5ZA 5FT8A 3FZ6A 4JEVA 3RI6A 2CJGA 4FL0A 3B1DA 3COGA 1QIRA 1FC4A 4JF1A 5EAAA 2VMQA 1S06A 3BWOA 1X29A 2DR1A 3TCMA 2BYLA 4IYOB 3EIBA 3JU7A 3FVUA 2ZSMA 2W7FA 1VEFA 4XJOA 3GZDC 2ZSLA 3TQXA 1GEWA 1MLZA 4AZJA 5DJ1A 4WYEA 1AJRA 3L8AA 4LNLA 4ZSWA 1CQ6A 3WGBA 1AHEA 4E3QA 4R2NA 2VMYA 1M0PA 1Z7DA 4ATQA 2BWOA 3K28A 3F9TA 3ZZKA 1YNUA 4N0BA 3HL2A 3AEJA 3MAFB 1TOEA 1W3UA 1MAPA 3F0HA 1ECXA 4MQPA 1RVYA 3N75A 2QB2A 1YIZA 4JE5D 1J32A 4ADDA 2O0RA 3M5UA 3PDXA 8AATA 1IBJA 2W7KA 3MBBA 1I43A 1GDEA 3PAAA 2OATA 3FTBA 2Z1YA 1ASDA 1EG5A 1OATA 2W7HA 3KGXA 2ZY4A 2YKUA 1LW5A 2Q7WA 4OTLA 5FT4A 1YJZA 2BIAA 3AOVA 2DGMA 2XH1A 1ARIA 1B5OA 3Q8NA 1IAXA 4LW4A 4XJPA 4EB5A 3VP6A 4E77A 3NYSA 3B1EA 3HLMA 4A72A 1BJOA 1GC2A 4W1WA 3BWNA 4NOGA 2Z1ZA 4ZWVA 3A8UX 3CQ5A 4WP0A 3A2BA 1CS1A 3JZLA 3LG0A 4RLGA 1WSTA 1AMAA 4ZM3A 4GRXA 3NYUA 1WKGA 1V2DA 2JJFA 2VMXA 3MADA 2R5CB 2W7EA 4TN4A 3VK3A 1DGDA 5LHAA 2WK7A 3D6KA 1G7XA 1QGNA 4XJLA 1C7OA 2FNUA 1AHXA 2OKKA 2W7DA 2VYCA 1IVRA 1KMKA 4F5HA 4UQVA 4WD2A 3BV0A 3GZCA 4A6UA 1E5EA 2YRIA 2ORDA 1AAMA 4F5LA 1H1CA 3FQ8A 2G6WA 5M46A 4B98A 4WYDA 3ELEA 1AMRA 1AY5A 1BS0A 4GSAA 2VMUA 3LVMA 1SFFA 1JG8A 3I4JA 1AKAA 1XEYA 1DJUA 1AAWA 2D7YA 3VAXA 4HF8A 1CQ7A 3ISLA 4AH3A 1SZKA 2QB3A 1W7LA 3B1CA 4RITA 1LKCA 3KE3A 3DODA 2ZY2A 1ASFA 3ZRQA 4WYCA 3ASBA 3ECDA 3QPGA 3OP7A 5E3KA 1SZUA 1MGVA 2GMSA 1AIBA 4OC9A 4IW7A 5EIGB 2EZ1A 1IUGA 3NUIA 2AY7A 3BS8A 1M0NA 1GEYA 3FD0A 4UOYA 3AEMC 2CANA 2VGZA 4WB0B 3AATA 3KKIA 2VMWA 4GEBA 4WXGA 4BA5A 3GSBA 4M2MA 4K2BA 2EZ2A 2PB2A 1IX7A 1CJ0A 1DTYA 3NU8A 3RUYA 4K2MA 3WCNA 4IXSA 3DRDA 4PVFA 1OHYA 2D65A 4MQQA 4LNMA 3GZDA 1D7RA 2X5DA 3QBOA 3HQTA 1DJEA 2VI8A 4BA4A 4UHNA 2DKJA 2FNIA 5M4DA 1MDOA 2VMRA 4CXQA 4HVKA 2W8WA 3RBFA 4ADBA 3HT4A 2QBTA 4A6RA 4O6ZA 3F6TA 3N0LA 1Y4IA 5DX5A 4ZDLA 4EFFA 1ARSA 2JGTA 4MY5A 4TMRA 1WYTA 1PFFA 1G4VA 1M4NA 2PB0A 4U1TA 2Z9XA 1O4SA 3G7QA 4ADEA 3P1TA 3PIUA 3QN6A 3HBXA 3N5MA 2DOUA 3GJUA 3JWBA 5DJ9A 1X28A 3EI6A 3R4TA 4XQ2A 1EQBA 4Y0DA 3WZFA 3LY1A 4JEXA 2E7IA 4WYAA 1ASLA 2F8JA 3HMUA 2VGSA 4RKCA 2CJHA 1ASGA 1M6SA 5EAVA 1VJOA 4LW2A 1E5FA 3AOWA 2VIBA 1B5PA 2GQNA 4ITGA 2V0YA 3LWSA 5G09A 4WYGA 5G2PA 2Z9VA 4FFCA 3WCOA 2HUUA 2VGWA 4ITXA 2Z9WA 1GCKA 1H0CA 2EPJA 2XBNA 3DZZA 3IHJA 4TV7A 3EI5A 3RQ1A 1AMQA 3H14A 3FQAA 2AY1A 1ARGA 1BW0A 3E2ZB 2DGLA 1AY4A 2BIGA 2AY8A 4GE4A 1XI9A 1BJNA 1QJ5A 1SF2A 2ZUKA 4RJYA 2JJGA 3PDBB 3FCRA 2BI5A 3MAFA 3QM2A 4BQ0A 3LVKA 4JF0A 2Z67A 4XEWA 1O61A 2YOBA 2ZYJA 3OKSA 1RVUA 1P3WA 2BIEA 2W8UA 1KKJA 3EZ1A 1B9HA 1V2EA 2AY6A 1LW4A 2RFVA 4UHOA 5DB5A 4RKDA 5G2QA 4IX8A 5IWQA 2R5EA 3EUCA 2C7TA 1OHWA 4JEYA 2HUFA 1SVVA 1SZSA 2VI9A 4GDYA 4ZDOA 4MKKA 1M0OA 3A9YA 3NRAA 3EZSA 1D7UA 5F9SA 2BWNA 4R5FA 1AMSA 1U08A 2BKWA 4F5FA 2YCNA 2R0TA 3AENA 3I5TA 4WLJA 4AZKA 1N31A 4PFFA 4QGRA 4A0HA 3EI8A 1PG8A 1N8PA 4WXFA 3NYTA 3BCAA 1ARTA 5EQCA 1ASNA 1QISA 4JE5A 1S07A 3JWAA 2X3LA 4F5MA 4E1OA 1BT4A 1UKJA 2R5CA 3AEMA 4CBRA 1GBNA 2VLHA 1N2TA 4RAEA 3PA9A 3EI9A 1WYVA 3WKRA 1GC0A 1DGEA 2EGYA 1MDZA 3W1IA 3E2FA 2ZY5A 4MQRA 2VGVA 3ACZA 4OMAA 3DR4A 3NX3A 1AX4A 4N0WA 1LC5A 2W7GA 4KAMA 3DXWA 2AY9A 2YKXA 4ZDPA 3NNKA 1O62A 3LVLB 2VMTA 4EB7A 3DU4A 2Z9UA 3P6KA 3FKDA 2CJDA 2YKVA 3MC6C 4F5JA 3GWPA 2WK9A 1ELQA 1UU1A 1ASCA 2WKAA 3HVYA 1TATA 4LNJA 1BQDA 4F4EA 2YKYA 3B8XA 3RCHA 3G8MA 2QA3A 5C6UA 2BI2A 1TOGA 1ORDA 2DGKA 3H7FA 3MAUA 5D5SA 1S0AA 1PMMA 3MKJA 3TATA 4PIWA 2ZY3A 1QJ3A 5EFSA 2AY5A 3AEPA 5EIGA 2VMPA 2VGTA 4ZAHA 1TASA 3A9ZA 3LV2A 4A00A 3CAIA 3WLXA 5HHYA 1BJ4A 3K40A 1TOJA 2CH1A 1AJSA 3B46A 2VMSA 4WB0A 1T3IA 4P3MA 4ZWMA 3ZRPA 2CB1A 2D66A 3E77A 3FZ7A 4A0GA 3E9KA 2V1PA 5TF5A 3BB8A 2JG2A 1ARHA 2AEUA 3W1HA 2VGUA 2HZPA 3AEOA 4RIZA 5FT6A 2CTZA 3L44A 1TPLA 1CZCA 2E7UA 4AO4A 2Z61A 2D7ZA 1GD9A 7AATA 4GE9A 2FYFA 5EUDA 2HOZA
chains in the Genus database with same CATH superfamily
1IX8A 3FQ7A 1CQ8A 2HOYA 4ISYA 2YCPA 4AOAA 1CL2A 3PD6A 2YHKA 4ZSYA 3WY7A 4DBCA 1O69A 1W7MA 3FRKA 1D2FA 5LH9A 1WKHA 1G7WA 5BJ4A 2EH6A 3VK4A 1RV4A 3FSLA 2O7CA 2VMVA 5JAYA 3CQ6A 1QZ9A 1WYUB 3FVXA 3G0TA 4ZLVA 3WKSA 2YRRA 4XJMA 3DXVA 3LVJA 1IX6A 2GMUA 1WYTB 2D5YA 5EUEA 2W7IA 4B9BA 4EMYA 2GB3A 4IYOA 4ZASA 5FT5A 1OHVA 1M7YA 3BCXA 4JEWA 1M32A 1ZC9A 1CZEA 2ZJGA 1IJIA 1LS3A 4OCAA 4U2HA 3VK2A 4A6TA 2HP1A 1YAAA 2BI3A 3NTJA 4OBUA 4F5GA 4I8AA 2BI1A 2E54A 2C44A 4XK1A 1S09A 1DKAA 4W1XA 1S08A 4JEZA 2VIAA 4CBSA 1AICA 1GC3A 1KL2A 5HDMA 3ZZJA 1MLYA 3E2ZA 1ELUA 4LC3A 1GEXA 4Q6RA 3E2YA 1V2FA 4W5KA 1Z3ZA 3ELPA 2O1BA 5G4JA 3NDNA 3USFA 3PDBA 1MAQA 3FFHA 2CINA 3R9AA 3TFTA 1C0NA 4Q75A 2W7LA 4WXBA 2BWPA 1X2AA 4DQ6A 3KGWA 3FFRA 3MC6A 2W7MA 3QGUA 3E6GA 2CFBA 3EI7A 2JJEA 3UAKA 1KMJA 1YOOA 1V72A 1OXOA 2W8TA 5E5IA 4R8DA 3WGCA 5BJ3A 5G4IA 3BCBA 4RM1A 3FDBA 4P7YA 1FG7A 1ASAA 1TOIA 3NU7A 5D95A 2HORA 4DGTA 2VMZA 2GSAA 1D7SA 2VLFA 1IAYA 4KYOA 5M49A 2Z20A 3QI6A 2CSTA 2ZP7A 4MKJA 3CQ4A 4WLHA 5F8VA 3PPLA 1C7NA 5M4BA 2NMPA 2W8VA 2AY2A 1M0QA 4OBVA 4OYTA 4EU1A 2AY4A 4F5IA 2QMAA 3W1JA 1I48A 1BJOB 4MGRA 2ZC0A 4GE7A 3JTXA 4IXOA 1W7NA 2TPLA 2VMOA 2X8UA 1FG3A 1UU0A 2AY3A 1ASBA 3AENB 3GETA 1SPAA 2WB6A 4W8IA 3UWCA 1KKPA 5K8BA 1ASEA 2FQ6A 2HP2A 1RV3A 3BC8A 1I41A 3BN1A 3I16A 3DYDA 4Y0IA 5EUNA 4OT8A 3N4SA 3UE8A 3PJ0A 1B9IA 2VMNA 1WYVB 4M2JA 4Y0HA 3ZRRA 3FDDA 2D63A 3AEJC 1JS3A 1YJYA 4WYFA 3JW9A 3NUBA 4RJ0A 3AELA 1AHFA 4A0FA 2PO3A 3ATHA 1TARA 1QITA 5E4ZA 1B4XA 1X0MA 2C0RA 2FM1A 2OGEA 2EO5A 1CL1A 1GC4A 2W7JA 3II0A 3AV7A 4ZM4A 3N4RA 1JF9A 4L0OA 2JISA 2YCTA 3K7YA 2JJHA 1ZOBA 3IF2A 4ADCA 1TOKA 3T32A 1BJWA 3EIAA 1C4KA 3BWNC 3RCHB 2AATA 2D64A 4IY7A 2C81A 4W1VA 4BMKA 4A0RA 3GBXA 3DC1A 2OGAA 1LK9A 1OXPA 4KXKA 1D7VA 9AATA 1LC7A 1AHYA 3FVSA 4J8LA 3WX9A 4E3RA 3PGYA 2BI9A 1B8GA 1JS6A 4W91A 1C9CA 4MSOA 4AO9A 4ATPA 2BHXA 2CH2A 1AJSB 4XAUA 5I92A 1KL1A 3QHXA 4BHDA 2FN6A 3GR9A 3FZ8A 1VP4A 2BYJA 2R2NA 2D61A 1LC8A 4WBTA 2WK8A 4PFNA 2W8JA 1J04A 5KTBA 1UU2A 2OQXA 1ASMA 2X5FA 4Q31A 1AKCA 1ZODA 1AIAA 1AY8A 4H51A 1AKBA 1EJIA 3VOMA 1WYUA 1YJSA 1I29A 1DJ9A 4CVQA 5G0AA 4F5KA 2HOXA 3PD6B 1AHGA 1MDXA 4M2KA 4Q76A 5J8QA 4IXZA 4CXRA 2OKJA 4UHMA 3ASAA 2QLRA 2G7JA 1W23A 3N7NA 1BQAA 1C7GA 4K2IA 2E7JA 2CY8A 2AEVA 3MEBA 3DR7A 1BKGA 5HXXA 3CBFA 3RBLA 3HDOA 2DKBA 4J5UA 1G4XA 5AX8A 1YIYA 1DFOA 1PMOA 3TFUA 2HUIA 3A9XA 4R5ZA 5FT8A 3FZ6A 4JEVA 3RI6A 2CJGA 3H9XA 4FL0A 3B1DA 3COGA 1QIRA 1FC4A 4JF1A 5EAAA 2VMQA 1S06A 3BWOA 1X29A 2DR1A 3TCMA 2BYLA 4IYOB 2QSRA 3EIBA 3JU7A 3FVUA 2ZSMA 2W7FA 1VEFA 4XJOA 3GZDC 2FKIA 2ZSLA 3TQXA 1GEWA 1MLZA 4AZJA 5DJ1A 4WYEA 1AJRA 3L8AA 4LNLA 4ZSWA 1CQ6A 3WGBA 1AHEA 4E3QA 4R2NA 2VMYA 1M0PA 1Z7DA 4ATQA 2BWOA 3K28A 3F9TA 3ZZKA 1YNUA 4N0BA 3HL2A 3AEJA 3MAFB 1TOEA 1W3UA 1MAPA 3F0HA 1ECXA 4MQPA 1RVYA 3N75A 2QB2A 1YIZA 4JE5D 1J32A 4ADDA 2O0RA 3M5UA 3PDXA 8AATA 1IBJA 2W7KA 3MBBA 1I43A 1GDEA 3PAAA 2OATA 3FTBA 2Z1YA 1ASDA 1EG5A 1OATA 2W7HA 3KGXA 2ZY4A 2YKUA 1LW5A 2Q7WA 4OTLA 5FT4A 1YJZA 2BIAA 3AOVA 2DGMA 2XH1A 1ARIA 1B5OA 3Q8NA 1IAXA 4LW4A 4XJPA 4EB5A 3VP6A 4E77A 4H63Q 3NYSA 3B1EA 3HLMA 4A72A 1BJOA 1GC2A 4W1WA 3BWNA 4NOGA 2Z1ZA 4ZWVA 3A8UX 3CQ5A 4WP0A 3A2BA 1CS1A 3JZLA 3LG0A 4RLGA 1WSTA 1AMAA 4ZM3A 4GRXA 3NYUA 1WKGA 1V2DA 2JJFA 2VMXA 3MADA 2R5CB 2W7EA 4TN4A 3VK3A 1DGDA 5LHAA 2WK7A 3D6KA 1G7XA 1QGNA 4XJLA 1C7OA 2FNUA 1AHXA 2OKKA 2W7DA 2VYCA 1IVRA 1KMKA 4F5HA 4UQVA 2KFPA 4WD2A 2A1VA 3BV0A 3GZCA 4A6UA 1E5EA 2YRIA 2ORDA 1AAMA 4F5LA 1H1CA 3FQ8A 2G6WA 5M46A 4B98A 4WYDA 3ELEA 1AMRA 1AY5A 1BS0A 4GSAA 2VMUA 3LVMA 1SFFA 1JG8A 3I4JA 1AKAA 1XEYA 1DJUA 1AAWA 2D7YA 3VAXA 4HF8A 1CQ7A 3ISLA 4AH3A 1SZKA 2QB3A 1W7LA 3B1CA 4RITA 1LKCA 3KE3A 3DODA 2ZY2A 1ASFA 3ZRQA 4WYCA 3ASBA 3ECDA 3QPGA 3OP7A 5E3KA 1SZUA 1MGVA 2GMSA 1AIBA 4OC9A 4IW7A 5EIGB 2EZ1A 1IUGA 3NUIA 2AY7A 3BS8A 1M0NA 1GEYA 3FD0A 4UOYA 3AEMC 2CANA 2VGZA 4WB0B 4K05A 3AATA 3KKIA 2VMWA 4GEBA 4WXGA 4BA5A 3GSBA 4M2MA 4K2BA 2EZ2A 2PB2A 1IX7A 1CJ0A 1DTYA 3NU8A 3RUYA 4K2MA 3WCNA 4IXSA 3DRDA 4PVFA 1OHYA 2D65A 4MQQA 4LNMA 3GZDA 1D7RA 2X5DA 3QBOA 3HQTA 1DJEA 2VI8A 4BA4A 4UHNA 2DKJA 2FNIA 5M4DA 1MDOA 2VMRA 4CXQA 4HVKA 2W8WA 3RBFA 4ADBA 3HT4A 2QBTA 4A6RA 4O6ZA 3F6TA 3N0LA 1Y4IA 5DX5A 4ZDLA 4EFFA 1ARSA 2JGTA 4MY5A 4TMRA 1WYTA 1PFFA 1G4VA 1M4NA 2PB0A 4U1TA 2Z9XA 1O4SA 3G7QA 4ADEA 3P1TA 3PIUA 3QN6A 3HBXA 3N5MA 2DOUA 3GJUA 3JWBA 5DJ9A 1X28A 3EI6A 3R4TA 4XQ2A 1EQBA 4Y0DA 3WZFA 3LY1A 4JEXA 2E7IA 4WYAA 1ASLA 2F8JA 3HMUA 2VGSA 4RKCA 2CJHA 1ASGA 1M6SA 5EAVA 1VJOA 4LW2A 1E5FA 3AOWA 2VIBA 1B5PA 2GQNA 4ITGA 2V0YA 3LWSA 5G09A 4WYGA 5G2PA 2Z9VA 4FFCA 3WCOA 2HUUA 2VGWA 4ITXA 2Z9WA 1GCKA 1H0CA 2EPJA 2XBNA 3DZZA 3IHJA 4TV7A 3EI5A 3RQ1A 1AMQA 3H14A 3FQAA 2AY1A 1ARGA 1BW0A 3E2ZB 2EYQA 2DGLA 1AY4A 2BIGA 2AY8A 4GE4A 1XI9A 1BJNA 1QJ5A 1SF2A 2ZUKA 4RJYA 2JJGA 3PDBB 3FCRA 2BI5A 3MAFA 3QM2A 4BQ0A 3LVKA 4JF0A 2Z67A 4XEWA 1O61A 2YOBA 2ZYJA 3OKSA 1RVUA 1P3WA 2BIEA 2W8UA 1KKJA 3EZ1A 1B9HA 1V2EA 2AY6A 1LW4A 2RFVA 4UHOA 5DB5A 4RKDA 5G2QA 4IX8A 5IWQA 2R5EA 3EUCA 2C7TA 1OHWA 4JEYA 2HUFA 1SVVA 1SZSA 2VI9A 4GDYA 4ZDOA 4MKKA 1M0OA 3A9YA 3NRAA 3EZSA 1D7UA 5F9SA 2BWNA 4R5FA 1AMSA 1U08A 2BKWA 4F5FA 2YCNA 2R0TA 3AENA 3I5TA 4WLJA 4AZKA 1N31A 4PFFA 4QGRA 4A0HA 3EI8A 1PG8A 1N8PA 4WXFA 3NYTA 3BCAA 1ARTA 5EQCA 1ASNA 1QISA 4JE5A 3N4XA 1S07A 3JWAA 2X3LA 4F5MA 4E1OA 1BT4A 1UKJA 2R5CA 3AEMA 4CBRA 1GBNA 2VLHA 1N2TA 4RAEA 3PA9A 3EI9A 1WYVA 3WKRA 1GC0A 1DGEA 2EGYA 1MDZA 3W1IA 3E2FA 2ZY5A 4MQRA 2VGVA 3ACZA 4OMAA 3DR4A 3NX3A 1AX4A 4N0WA 1LC5A 2W7GA 4KAMA 3DXWA 2AY9A 2YKXA 4ZDPA 3NNKA 1O62A 3LVLB 2VMTA 4EB7A 3DU4A 2Z9UA 3P6KA 3FKDA 2CJDA 2YKVA 3MC6C 4F5JA 3GWPA 2WK9A 1ELQA 1UU1A 1ASCA 2WKAA 3HVYA 1TATA 4LNJA 1BQDA 4F4EA 2YKYA 3B8XA 3RCHA 3G8MA 2QA3A 5C6UA 2BI2A 1TOGA 1ORDA 2DGKA 3H7FA 3MAUA 5D5SA 1S0AA 1PMMA 3MKJA 3TATA 4PIWA 2ZY3A 1QJ3A 5EFSA 2AY5A 3AEPA 5EIGA 2VMPA 2VGTA 4ZAHA 1TASA 3A9ZA 3LV2A 4A00A 1KAFA 3CAIA 3WLXA 5HHYA 1BJ4A 3K40A 1TOJA 2CH1A 1AJSA 3B46A 2VMSA 4WB0A 1T3IA 4P3MA 4ZWMA 3ZRPA 2CB1A 2D66A 3E77A 3FZ7A 4A0GA 3E9KA 2V1PA 5TF5A 3BB8A 2JG2A 1ARHA 2AEUA 3W1HA 2VGUA 2HZPA 3AEOA 4RIZA 5FT6A 2CTZA 3L44A 1TPLA 1CZCA 2E7UA 4AO4A 2Z61A 2D7ZA 1GD9A 7AATA 4GE9A 2FYFA 5EUDA 2HOZA
chains in the Genus database with same CATH topology
1IX8A 3FQ7A 1CQ8A 2HOYA 4ISYA 2YCPA 4AOAA 1CL2A 3PD6A 2YHKA 4ZSYA 3WY7A 4DBCA 1O69A 1W7MA 3FRKA 1D2FA 5LH9A 1WKHA 1G7WA 5BJ4A 2EH6A 3VK4A 1RV4A 3FSLA 2O7CA 2VMVA 5JAYA 3CQ6A 1QZ9A 1WYUB 3FVXA 3G0TA 4ZLVA 3WKSA 2YRRA 4XJMA 3DXVA 3LVJA 1IX6A 2GMUA 1WYTB 2D5YA 5EUEA 2W7IA 4B9BA 4EMYA 2GB3A 4IYOA 4ZASA 5FT5A 1OHVA 1M7YA 3BCXA 4JEWA 1M32A 1ZC9A 1CZEA 2ZJGA 1IJIA 1LS3A 4OCAA 4U2HA 3VK2A 4A6TA 2HP1A 1YAAA 2BI3A 3NTJA 4OBUA 4F5GA 4I8AA 2BI1A 2E54A 2C44A 4XK1A 1S09A 1DKAA 4W1XA 1S08A 4JEZA 2VIAA 4CBSA 1AICA 1GC3A 1KL2A 5HDMA 3ZZJA 1MLYA 3E2ZA 1ELUA 4LC3A 1GEXA 4Q6RA 3E2YA 1V2FA 4W5KA 1Z3ZA 3ELPA 2O1BA 5G4JA 3NDNA 3USFA 3PDBA 1MAQA 3FFHA 2CINA 3R9AA 3TFTA 1C0NA 4Q75A 2W7LA 4WXBA 2BWPA 1X2AA 4DQ6A 3KGWA 3FFRA 3MC6A 2W7MA 3QGUA 3E6GA 2CFBA 3EI7A 2JJEA 3UAKA 1KMJA 1YOOA 1V72A 1OXOA 2W8TA 5E5IA 4R8DA 3WGCA 5BJ3A 5G4IA 3BCBA 4RM1A 3FDBA 4P7YA 1FG7A 1ASAA 1TOIA 3NU7A 5D95A 2HORA 4DGTA 2VMZA 2GSAA 1D7SA 2VLFA 1IAYA 4KYOA 5M49A 2Z20A 3QI6A 2CSTA 2ZP7A 4MKJA 3CQ4A 4WLHA 5F8VA 3PPLA 1C7NA 5M4BA 2NMPA 2W8VA 2AY2A 1M0QA 4OBVA 4OYTA 4EU1A 2AY4A 4F5IA 2QMAA 3W1JA 1I48A 1BJOB 4MGRA 2ZC0A 4GE7A 3JTXA 4IXOA 1W7NA 2TPLA 2VMOA 2X8UA 1FG3A 1UU0A 2AY3A 1ASBA 3AENB 3GETA 1SPAA 2WB6A 4W8IA 3UWCA 1KKPA 5K8BA 1ASEA 2FQ6A 2HP2A 1RV3A 3BC8A 1I41A 3BN1A 3I16A 3DYDA 4Y0IA 5EUNA 4OT8A 3N4SA 3UE8A 3PJ0A 1B9IA 2VMNA 1WYVB 4M2JA 4Y0HA 3ZRRA 3FDDA 2D63A 3AEJC 1JS3A 1YJYA 4WYFA 3JW9A 3NUBA 4RJ0A 3AELA 1AHFA 4A0FA 2PO3A 3ATHA 1TARA 1QITA 5E4ZA 1B4XA 1X0MA 2C0RA 2FM1A 2OGEA 2EO5A 1CL1A 1GC4A 2W7JA 3II0A 3AV7A 4ZM4A 3N4RA 1JF9A 4L0OA 2JISA 2YCTA 3K7YA 2JJHA 1ZOBA 3IF2A 4ADCA 1TOKA 3T32A 1BJWA 3EIAA 1C4KA 3BWNC 3RCHB 2AATA 2D64A 4IY7A 2C81A 4W1VA 4BMKA 4A0RA 3GBXA 3DC1A 2OGAA 1LK9A 1OXPA 4KXKA 1D7VA 9AATA 1LC7A 1AHYA 3FVSA 4J8LA 3WX9A 4E3RA 3PGYA 2BI9A 1B8GA 1JS6A 4W91A 1C9CA 4MSOA 4AO9A 4ATPA 2BHXA 2CH2A 1AJSB 4XAUA 5I92A 1KL1A 3QHXA 4BHDA 2FN6A 3GR9A 3FZ8A 1VP4A 2BYJA 2R2NA 2D61A 1LC8A 4WBTA 2WK8A 4PFNA 2W8JA 1J04A 5KTBA 1UU2A 2OQXA 1ASMA 2X5FA 4Q31A 1AKCA 1ZODA 1AIAA 1AY8A 4H51A 1AKBA 1EJIA 3VOMA 1WYUA 1YJSA 1I29A 1DJ9A 4CVQA 5G0AA 4F5KA 2HOXA 3PD6B 1AHGA 1MDXA 4M2KA 4Q76A 5J8QA 4IXZA 4CXRA 2OKJA 4UHMA 3ASAA 2QLRA 2G7JA 1W23A 3N7NA 1BQAA 1C7GA 4K2IA 2E7JA 2CY8A 2AEVA 3MEBA 3DR7A 1BKGA 5HXXA 3CBFA 3RBLA 3HDOA 2DKBA 4J5UA 1G4XA 5AX8A 1YIYA 1DFOA 1PMOA 3TFUA 2HUIA 3A9XA 4R5ZA 5FT8A 3FZ6A 4JEVA 3RI6A 2CJGA 3H9XA 4FL0A 3B1DA 3COGA 1QIRA 1FC4A 4JF1A 5EAAA 2VMQA 1S06A 3BWOA 1X29A 2DR1A 3TCMA 2BYLA 4IYOB 2QSRA 3EIBA 3JU7A 3FVUA 2ZSMA 2W7FA 1VEFA 4XJOA 3GZDC 2FKIA 2ZSLA 3TQXA 1GEWA 1MLZA 4AZJA 5DJ1A 4WYEA 1AJRA 3L8AA 4LNLA 4ZSWA 1CQ6A 3WGBA 1AHEA 4E3QA 4R2NA 2VMYA 1M0PA 1Z7DA 4ATQA 2BWOA 3K28A 3F9TA 3ZZKA 1YNUA 4N0BA 3HL2A 3AEJA 3MAFB 1TOEA 1W3UA 1MAPA 3F0HA 1ECXA 4MQPA 1RVYA 3N75A 2QB2A 1YIZA 4JE5D 1J32A 4ADDA 2O0RA 3M5UA 3PDXA 8AATA 1IBJA 2W7KA 3MBBA 1I43A 1GDEA 3PAAA 2OATA 3FTBA 2Z1YA 1ASDA 1EG5A 1OATA 2W7HA 3KGXA 2ZY4A 2YKUA 1LW5A 2Q7WA 4OTLA 5FT4A 1YJZA 2BIAA 3AOVA 2DGMA 2XH1A 1ARIA 1B5OA 3Q8NA 1IAXA 4LW4A 4XJPA 4EB5A 3VP6A 4E77A 4H63Q 3NYSA 3B1EA 3HLMA 4A72A 1BJOA 1GC2A 4W1WA 3BWNA 4NOGA 2Z1ZA 4ZWVA 3A8UX 3CQ5A 4WP0A 3A2BA 1CS1A 3JZLA 3LG0A 4RLGA 1WSTA 1AMAA 4ZM3A 4GRXA 3NYUA 1WKGA 1V2DA 2JJFA 2VMXA 3MADA 2R5CB 2W7EA 4TN4A 3VK3A 1DGDA 5LHAA 2WK7A 3D6KA 1G7XA 1QGNA 4XJLA 1C7OA 2FNUA 1AHXA 2OKKA 2W7DA 2VYCA 1IVRA 1KMKA 4F5HA 4UQVA 2KFPA 4WD2A 2A1VA 3BV0A 3GZCA 4A6UA 1E5EA 2YRIA 2ORDA 1AAMA 4F5LA 1H1CA 3FQ8A 2G6WA 5M46A 4B98A 4WYDA 3ELEA 1AMRA 1AY5A 1BS0A 4GSAA 2VMUA 3LVMA 1SFFA 1JG8A 3I4JA 1AKAA 1XEYA 1DJUA 1AAWA 2D7YA 3VAXA 4HF8A 1CQ7A 3ISLA 4AH3A 1SZKA 2QB3A 1W7LA 3B1CA 4RITA 1LKCA 3KE3A 3DODA 2ZY2A 1ASFA 3ZRQA 4WYCA 3ASBA 3ECDA 3QPGA 3OP7A 5E3KA 1SZUA 1MGVA 2GMSA 1AIBA 4OC9A 4IW7A 5EIGB 2EZ1A 1IUGA 3NUIA 2AY7A 3BS8A 1M0NA 1GEYA 3FD0A 4UOYA 3AEMC 2CANA 2VGZA 4WB0B 4K05A 3AATA 3KKIA 2VMWA 4GEBA 4WXGA 4BA5A 3GSBA 4M2MA 4K2BA 2EZ2A 2PB2A 1IX7A 1CJ0A 1DTYA 3NU8A 3RUYA 4K2MA 3WCNA 4IXSA 3DRDA 4PVFA 1OHYA 2D65A 4MQQA 4LNMA 3GZDA 1D7RA 2X5DA 3QBOA 3HQTA 1DJEA 2VI8A 4BA4A 4UHNA 2DKJA 2FNIA 5M4DA 1MDOA 2VMRA 4CXQA 4HVKA 2W8WA 3RBFA 4ADBA 3HT4A 2QBTA 4A6RA 4O6ZA 3F6TA 3N0LA 1Y4IA 5DX5A 4ZDLA 4EFFA 1ARSA 2JGTA 4MY5A 4TMRA 1WYTA 1PFFA 1G4VA 1M4NA 2PB0A 4U1TA 2Z9XA 1O4SA 3G7QA 4ADEA 3P1TA 3PIUA 3QN6A 3HBXA 3N5MA 2DOUA 3GJUA 3JWBA 5DJ9A 1X28A 3EI6A 3R4TA 4XQ2A 1EQBA 4Y0DA 3WZFA 3LY1A 4JEXA 2E7IA 4WYAA 1ASLA 2F8JA 3HMUA 2VGSA 4RKCA 2CJHA 1ASGA 1M6SA 5EAVA 1VJOA 4LW2A 1E5FA 3AOWA 2VIBA 1B5PA 2GQNA 4ITGA 2V0YA 3LWSA 5G09A 4WYGA 5G2PA 2Z9VA 4FFCA 3WCOA 2HUUA 2VGWA 4ITXA 2Z9WA 1GCKA 1H0CA 2EPJA 2XBNA 3DZZA 3IHJA 4TV7A 3EI5A 3RQ1A 1AMQA 3H14A 3FQAA 2AY1A 1ARGA 1BW0A 3E2ZB 2EYQA 2DGLA 1AY4A 2BIGA 2AY8A 4GE4A 1XI9A 1BJNA 1QJ5A 1SF2A 2ZUKA 4RJYA 2JJGA 3PDBB 3FCRA 2BI5A 3MAFA 3QM2A 4BQ0A 3LVKA 4JF0A 2Z67A 4XEWA 1O61A 2YOBA 2ZYJA 3OKSA 1RVUA 1P3WA 2BIEA 2W8UA 1KKJA 3EZ1A 1B9HA 1V2EA 2AY6A 1LW4A 2RFVA 4UHOA 5DB5A 4RKDA 5G2QA 4IX8A 5IWQA 2R5EA 3EUCA 2C7TA 1OHWA 4JEYA 2HUFA 1SVVA 1SZSA 2VI9A 4GDYA 4ZDOA 4MKKA 1M0OA 3A9YA 3NRAA 3EZSA 1D7UA 5F9SA 2BWNA 4R5FA 1AMSA 1U08A 2BKWA 4F5FA 2YCNA 2R0TA 3AENA 3I5TA 4WLJA 4AZKA 1N31A 4PFFA 4QGRA 4A0HA 3EI8A 1PG8A 1N8PA 4WXFA 3NYTA 3BCAA 1ARTA 5EQCA 1ASNA 1QISA 4JE5A 3N4XA 1S07A 3JWAA 2X3LA 4F5MA 4E1OA 1BT4A 1UKJA 2R5CA 3AEMA 4CBRA 1GBNA 2VLHA 1N2TA 4RAEA 3PA9A 3EI9A 1WYVA 3WKRA 1GC0A 1DGEA 2EGYA 1MDZA 3W1IA 3E2FA 2ZY5A 4MQRA 2VGVA 3ACZA 4OMAA 3DR4A 3NX3A 1AX4A 4N0WA 1LC5A 2W7GA 4KAMA 3DXWA 2AY9A 2YKXA 4ZDPA 3NNKA 1O62A 3LVLB 2VMTA 4EB7A 3DU4A 2Z9UA 3P6KA 3FKDA 2CJDA 2YKVA 3MC6C 4F5JA 3GWPA 2WK9A 1ELQA 1UU1A 1ASCA 2WKAA 3HVYA 1TATA 4LNJA 1BQDA 4F4EA 2YKYA 3B8XA 3RCHA 3G8MA 2QA3A 5C6UA 2BI2A 1TOGA 1ORDA 2DGKA 3H7FA 3MAUA 5D5SA 1S0AA 1PMMA 3MKJA 3TATA 4PIWA 2ZY3A 1QJ3A 5EFSA 2AY5A 3AEPA 5EIGA 2VMPA 2VGTA 4ZAHA 1TASA 3A9ZA 3LV2A 4A00A 3CAIA 3WLXA 5HHYA 1BJ4A 3K40A 1TOJA 2CH1A 1AJSA 3B46A 2VMSA 4WB0A 1T3IA 4P3MA 4ZWMA 3ZRPA 2CB1A 2D66A 3E77A 3FZ7A 4A0GA 3E9KA 2V1PA 5TF5A 3BB8A 2JG2A 1ARHA 2AEUA 3W1HA 2VGUA 2HZPA 3AEOA 4RIZA 5FT6A 2CTZA 3L44A 1TPLA 1CZCA 2E7UA 4AO4A 2Z61A 2D7ZA 1GD9A 7AATA 4GE9A 2FYFA 5EUDA 2HOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX8 A;  3FQ7 A;  1CQ8 A;  2HOY A;  4ISY A;  2YCP A;  4AOA A;  1CL2 A;  3PD6 A;  2YHK A;  4ZSY A;  3WY7 A;  4DBC A;  1O69 A;  1W7M A;  3FRK A;  1D2F A;  5LH9 A;  1WKH A;  1G7W A;  5BJ4 A;  2EH6 A;  3VK4 A;  1RV4 A;  3FSL A;  2O7C A;  2VMV A;  5JAY A;  3CQ6 A;  1QZ9 A;  1WYU B;  3FVX A;  3G0T A;  4ZLV A;  3WKS A;  2YRR A;  4XJM A;  3DXV A;  3LVJ A;  1IX6 A;  2GMU A;  1WYT B;  2D5Y A;  5EUE A;  2W7I A;  4B9B A;  4EMY A;  2GB3 A;  4IYO A;  4ZAS A;  5FT5 A;  1OHV A;  1M7Y A;  3BCX A;  4JEW A;  1M32 A;  1ZC9 A;  1CZE A;  2ZJG A;  1IJI A;  1LS3 A;  4OCA A;  4U2H A;  3VK2 A;  4A6T A;  2HP1 A;  1YAA A;  2BI3 A;  3NTJ A;  4OBU A;  4F5G A;  4I8A A;  2BI1 A;  2E54 A;  2C44 A;  4XK1 A;  1S09 A;  1DKA A;  4W1X A;  1S08 A;  4JEZ A;  2VIA A;  4CBS A;  1AIC A;  1GC3 A;  1KL2 A;  5HDM A;  3ZZJ A;  1MLY A;  3E2Z A;  1ELU A;  4LC3 A;  1GEX A;  4Q6R A;  3E2Y A;  1V2F A;  4W5K A;  1Z3Z A;  3ELP A;  2O1B A;  5G4J A;  3NDN A;  3USF A;  3PDB A;  1MAQ A;  3FFH A;  2CIN A;  3R9A A;  3TFT A;  1C0N A;  4Q75 A;  2W7L A;  4WXB A;  2BWP A;  1X2A A;  4DQ6 A;  3KGW A;  3FFR A;  3MC6 A;  2W7M A;  3QGU A;  3E6G A;  2CFB A;  3EI7 A;  2JJE A;  3UAK A;  1KMJ A;  1YOO A;  1V72 A;  1OXO A;  2W8T A;  5E5I A;  4R8D A;  3WGC A;  5BJ3 A;  5G4I A;  3BCB A;  4RM1 A;  3FDB A;  4P7Y A;  1FG7 A;  1ASA A;  1TOI A;  3NU7 A;  5D95 A;  2HOR A;  4DGT A;  2VMZ A;  2GSA A;  1D7S A;  2VLF A;  1IAY A;  4KYO A;  5M49 A;  2Z20 A;  3QI6 A;  2CST A;  2ZP7 A;  4MKJ A;  3CQ4 A;  4WLH A;  5F8V A;  3PPL A;  1C7N A;  5M4B A;  2NMP A;  2W8V A;  2AY2 A;  1M0Q A;  4OBV A;  4OYT A;  4EU1 A;  2AY4 A;  4F5I A;  2QMA A;  3W1J A;  1I48 A;  1BJO B;  4MGR A;  2ZC0 A;  4GE7 A;  3JTX A;  4IXO A;  1W7N A;  2TPL A;  2VMO A;  2X8U A;  1FG3 A;  1UU0 A;  2AY3 A;  1ASB A;  3AEN B;  3GET A;  1SPA A;  4W8I A;  3UWC A;  1KKP A;  5K8B A;  1ASE A;  2FQ6 A;  2HP2 A;  1RV3 A;  3BC8 A;  1I41 A;  3BN1 A;  3I16 A;  3DYD A;  4Y0I A;  5EUN A;  4OT8 A;  3UE8 A;  3PJ0 A;  1B9I A;  2VMN A;  1WYV B;  4M2J A;  4Y0H A;  3ZRR A;  3FDD A;  2D63 A;  3AEJ C;  1JS3 A;  1YJY A;  4WYF A;  3JW9 A;  3NUB A;  4RJ0 A;  3AEL A;  1AHF A;  4A0F A;  2PO3 A;  3ATH A;  1TAR A;  1QIT A;  5E4Z A;  1B4X A;  1X0M A;  2C0R A;  2FM1 A;  2OGE A;  2EO5 A;  1CL1 A;  1GC4 A;  2W7J A;  3II0 A;  3AV7 A;  4ZM4 A;  1JF9 A;  4L0O A;  2JIS A;  2YCT A;  3K7Y A;  2JJH A;  1ZOB A;  3IF2 A;  4ADC A;  1TOK A;  3T32 A;  1BJW A;  3EIA A;  1C4K A;  3BWN C;  3RCH B;  2AAT A;  2D64 A;  4IY7 A;  2C81 A;  4W1V A;  4BMK A;  4A0R A;  3GBX A;  3DC1 A;  2OGA A;  1LK9 A;  1OXP A;  4KXK A;  1D7V A;  9AAT A;  1LC7 A;  1AHY A;  3FVS A;  4J8L A;  3WX9 A;  4E3R A;  3PGY A;  2BI9 A;  1B8G A;  1JS6 A;  4W91 A;  1C9C A;  4MSO A;  4AO9 A;  4ATP A;  2BHX A;  2CH2 A;  1AJS B;  4XAU A;  5I92 A;  1KL1 A;  3QHX A;  4BHD A;  2FN6 A;  3GR9 A;  3FZ8 A;  1VP4 A;  2BYJ A;  2R2N A;  2D61 A;  1LC8 A;  4WBT A;  2WK8 A;  4PFN A;  2W8J A;  1J04 A;  1UU2 A;  2OQX A;  1ASM A;  2X5F A;  4Q31 A;  1AKC A;  1ZOD A;  1AIA A;  1AY8 A;  4H51 A;  1AKB A;  1EJI A;  3VOM A;  1WYU A;  1YJS A;  1I29 A;  1DJ9 A;  4CVQ A;  5G0A A;  4F5K A;  2HOX A;  3PD6 B;  1AHG A;  1MDX A;  4M2K A;  4Q76 A;  5J8Q A;  4IXZ A;  4CXR A;  2OKJ A;  4UHM A;  3ASA A;  2QLR A;  1W23 A;  1BQA A;  1C7G A;  4K2I A;  2E7J A;  2CY8 A;  2AEV A;  3MEB A;  3DR7 A;  1BKG A;  5HXX A;  3CBF A;  3RBL A;  3HDO A;  2DKB A;  4J5U A;  1G4X A;  5AX8 A;  1YIY A;  1DFO A;  1PMO A;  3TFU A;  2HUI A;  3A9X A;  4R5Z A;  5FT8 A;  3FZ6 A;  4JEV A;  3RI6 A;  2CJG A;  4FL0 A;  3B1D A;  3COG A;  1QIR A;  1FC4 A;  4JF1 A;  5EAA A;  2VMQ A;  1S06 A;  3BWO A;  1X29 A;  2DR1 A;  3TCM A;  2BYL A;  4IYO B;  3EIB A;  3JU7 A;  3FVU A;  2ZSM A;  2W7F A;  1VEF A;  4XJO A;  3GZD C;  2ZSL A;  3TQX A;  1GEW A;  1MLZ A;  4AZJ A;  5DJ1 A;  4WYE A;  1AJR A;  3L8A A;  4LNL A;  4ZSW A;  1CQ6 A;  3WGB A;  1AHE A;  4E3Q A;  4R2N A;  2VMY A;  1M0P A;  1Z7D A;  4ATQ A;  2BWO A;  3K28 A;  3F9T A;  3ZZK A;  1YNU A;  4N0B A;  3HL2 A;  3AEJ A;  3MAF B;  1TOE A;  1W3U A;  1MAP A;  3F0H A;  1ECX A;  4MQP A;  1RVY A;  3N75 A;  2QB2 A;  1YIZ A;  4JE5 D;  1J32 A;  4ADD A;  2O0R A;  3M5U A;  3PDX A;  8AAT A;  1IBJ A;  2W7K A;  3MBB A;  1I43 A;  1GDE A;  3PAA A;  2OAT A;  3FTB A;  2Z1Y A;  1ASD A;  1EG5 A;  1OAT A;  2W7H A;  3KGX A;  2ZY4 A;  2YKU A;  1LW5 A;  2Q7W A;  4OTL A;  5FT4 A;  1YJZ A;  2BIA A;  3AOV A;  2DGM A;  2XH1 A;  1ARI A;  1B5O A;  3Q8N A;  1IAX A;  4LW4 A;  4XJP A;  4EB5 A;  3VP6 A;  4E77 A;  3NYS A;  3B1E A;  3HLM A;  4A72 A;  1BJO A;  1GC2 A;  4W1W A;  3BWN A;  4NOG A;  2Z1Z A;  4ZWV A;  3A8U X;  3CQ5 A;  4WP0 A;  3A2B A;  1CS1 A;  3JZL A;  3LG0 A;  4RLG A;  1WST A;  1AMA A;  4ZM3 A;  4GRX A;  3NYU A;  1WKG A;  1V2D A;  2JJF A;  2VMX A;  3MAD A;  2R5C B;  2W7E A;  4TN4 A;  3VK3 A;  1DGD A;  5LHA A;  2WK7 A;  3D6K A;  1G7X A;  1QGN A;  4XJL A;  1C7O A;  2FNU A;  1AHX A;  2OKK A;  2W7D A;  2VYC A;  1IVR A;  1KMK A;  4F5H A;  4UQV A;  4WD2 A;  3BV0 A;  3GZC A;  4A6U A;  1E5E A;  2YRI A;  2ORD A;  1AAM A;  4F5L A;  1H1C A;  3FQ8 A;  2G6W A;  5M46 A;  4B98 A;  4WYD A;  3ELE A;  1AMR A;  1AY5 A;  1BS0 A;  4GSA A;  2VMU A;  3LVM A;  1SFF A;  1JG8 A;  3I4J A;  1AKA A;  1XEY A;  1DJU A;  1AAW A;  2D7Y A;  3VAX A;  4HF8 A;  1CQ7 A;  3ISL A;  4AH3 A;  1SZK A;  2QB3 A;  1W7L A;  3B1C A;  4RIT A;  1LKC A;  3KE3 A;  3DOD A;  2ZY2 A;  1ASF A;  3ZRQ A;  4WYC A;  3ASB A;  3ECD A;  3QPG A;  3OP7 A;  5E3K A;  1SZU A;  1MGV A;  2GMS A;  1AIB A;  4OC9 A;  4IW7 A;  5EIG B;  2EZ1 A;  1IUG A;  3NUI A;  2AY7 A;  3BS8 A;  1M0N A;  1GEY A;  3FD0 A;  4UOY A;  3AEM C;  2CAN A;  2VGZ A;  4WB0 B;  3AAT A;  3KKI A;  2VMW A;  4GEB A;  4WXG A;  4BA5 A;  3GSB A;  4M2M A;  4K2B A;  2EZ2 A;  2PB2 A;  1IX7 A;  1CJ0 A;  1DTY A;  3NU8 A;  3RUY A;  4K2M A;  3WCN A;  4IXS A;  3DRD A;  4PVF A;  1OHY A;  2D65 A;  4MQQ A;  4LNM A;  3GZD A;  1D7R A;  2X5D A;  3QBO A;  3HQT A;  1DJE A;  2VI8 A;  4BA4 A;  4UHN A;  2DKJ A;  2FNI A;  5M4D A;  1MDO A;  2VMR A;  4CXQ A;  4HVK A;  2W8W A;  3RBF A;  4ADB A;  3HT4 A;  2QBT A;  4A6R A;  4O6Z A;  3F6T A;  3N0L A;  1Y4I A;  5DX5 A;  4ZDL A;  4EFF A;  1ARS A;  2JGT A;  4MY5 A;  4TMR A;  1WYT A;  1PFF A;  1G4V A;  1M4N A;  2PB0 A;  4U1T A;  2Z9X A;  1O4S A;  3G7Q A;  4ADE A;  3P1T A;  3PIU A;  3QN6 A;  3HBX A;  3N5M A;  2DOU A;  3GJU A;  3JWB A;  5DJ9 A;  1X28 A;  3EI6 A;  3R4T A;  4XQ2 A;  1EQB A;  4Y0D A;  3WZF A;  3LY1 A;  4JEX A;  2E7I A;  4WYA A;  1ASL A;  2F8J A;  3HMU A;  2VGS A;  4RKC A;  2CJH A;  1ASG A;  1M6S A;  5EAV A;  1VJO A;  4LW2 A;  1E5F A;  3AOW A;  2VIB A;  1B5P A;  2GQN A;  4ITG A;  2V0Y A;  3LWS A;  5G09 A;  4WYG A;  5G2P A;  2Z9V A;  4FFC A;  3WCO A;  2HUU A;  2VGW A;  4ITX A;  2Z9W A;  1GCK A;  1H0C A;  2EPJ A;  2XBN A;  3DZZ A;  3IHJ A;  4TV7 A;  3EI5 A;  3RQ1 A;  1AMQ A;  3H14 A;  3FQA A;  2AY1 A;  1ARG A;  1BW0 A;  3E2Z B;  2DGL A;  1AY4 A;  2BIG A;  2AY8 A;  4GE4 A;  1XI9 A;  1BJN A;  1QJ5 A;  1SF2 A;  2ZUK A;  4RJY A;  2JJG A;  3PDB B;  3FCR A;  2BI5 A;  3MAF A;  3QM2 A;  4BQ0 A;  3LVK A;  4JF0 A;  2Z67 A;  4XEW A;  1O61 A;  2YOB A;  2ZYJ A;  3OKS A;  1RVU A;  1P3W A;  2BIE A;  2W8U A;  1KKJ A;  3EZ1 A;  1B9H A;  1V2E A;  2AY6 A;  1LW4 A;  2RFV A;  4UHO A;  5DB5 A;  4RKD A;  5G2Q A;  4IX8 A;  5IWQ A;  2R5E A;  3EUC A;  2C7T A;  1OHW A;  4JEY A;  2HUF A;  1SVV A;  1SZS A;  2VI9 A;  4GDY A;  4ZDO A;  4MKK A;  1M0O A;  3A9Y A;  3NRA A;  3EZS A;  1D7U A;  5F9S A;  2BWN A;  4R5F A;  1AMS A;  1U08 A;  2BKW A;  4F5F A;  2YCN A;  2R0T A;  3AEN A;  3I5T A;  4WLJ A;  4AZK A;  1N31 A;  4PFF A;  4QGR A;  4A0H A;  3EI8 A;  1PG8 A;  1N8P A;  4WXF A;  3NYT A;  3BCA A;  1ART A;  5EQC A;  1ASN A;  1QIS A;  4JE5 A;  1S07 A;  3JWA A;  2X3L A;  4F5M A;  4E1O A;  1BT4 A;  1UKJ A;  2R5C A;  3AEM A;  4CBR A;  1GBN A;  2VLH A;  1N2T A;  4RAE A;  3PA9 A;  3EI9 A;  1WYV A;  3WKR A;  1GC0 A;  1DGE A;  2EGY A;  1MDZ A;  3W1I A;  3E2F A;  2ZY5 A;  4MQR A;  2VGV A;  3ACZ A;  4OMA A;  3DR4 A;  3NX3 A;  1AX4 A;  4N0W A;  1LC5 A;  2W7G A;  4KAM A;  3DXW A;  2AY9 A;  2YKX A;  4ZDP A;  3NNK A;  1O62 A;  3LVL B;  2VMT A;  4EB7 A;  3DU4 A;  2Z9U A;  3P6K A;  3FKD A;  2CJD A;  2YKV A;  3MC6 C;  4F5J A;  3GWP A;  2WK9 A;  1ELQ A;  1UU1 A;  1ASC A;  2WKA A;  3HVY A;  1TAT A;  4LNJ A;  1BQD A;  4F4E A;  2YKY A;  3B8X A;  3RCH A;  3G8M A;  2QA3 A;  5C6U A;  2BI2 A;  1TOG A;  1ORD A;  2DGK A;  3H7F A;  3MAU A;  5D5S A;  1S0A A;  1PMM A;  3MKJ A;  3TAT A;  4PIW A;  2ZY3 A;  1QJ3 A;  5EFS A;  2AY5 A;  3AEP A;  5EIG A;  2VMP A;  2VGT A;  4ZAH A;  1TAS A;  3A9Z A;  3LV2 A;  4A00 A;  3CAI A;  3WLX A;  5HHY A;  1BJ4 A;  3K40 A;  1TOJ A;  2CH1 A;  1AJS A;  3B46 A;  2VMS A;  4WB0 A;  1T3I A;  4P3M A;  4ZWM A;  3ZRP A;  2CB1 A;  2D66 A;  3E77 A;  3FZ7 A;  4A0G A;  3E9K A;  2V1P A;  5TF5 A;  3BB8 A;  2JG2 A;  1ARH A;  2AEU A;  3W1H A;  2VGU A;  2HZP A;  3AEO A;  4RIZ A;  5FT6 A;  2CTZ A;  3L44 A;  1TPL A;  1CZC A;  2E7U A;  4AO4 A;  2Z61 A;  2D7Z A;  1GD9 A;  7AAT A;  4GE9 A;  2FYF A;  5EUD A;  2HOZ A; 
#chains in the Genus database with same CATH topology
 1IX8 A;  3FQ7 A;  1CQ8 A;  2HOY A;  4ISY A;  2YCP A;  4AOA A;  1CL2 A;  3PD6 A;  2YHK A;  4ZSY A;  3WY7 A;  4DBC A;  1O69 A;  1W7M A;  3FRK A;  1D2F A;  5LH9 A;  1WKH A;  1G7W A;  5BJ4 A;  2EH6 A;  3VK4 A;  1RV4 A;  3FSL A;  2O7C A;  2VMV A;  5JAY A;  3CQ6 A;  1QZ9 A;  1WYU B;  3FVX A;  3G0T A;  4ZLV A;  3WKS A;  2YRR A;  4XJM A;  3DXV A;  3LVJ A;  1IX6 A;  2GMU A;  1WYT B;  2D5Y A;  5EUE A;  2W7I A;  4B9B A;  4EMY A;  2GB3 A;  4IYO A;  4ZAS A;  5FT5 A;  1OHV A;  1M7Y A;  3BCX A;  4JEW A;  1M32 A;  1ZC9 A;  1CZE A;  2ZJG A;  1IJI A;  1LS3 A;  4OCA A;  4U2H A;  3VK2 A;  4A6T A;  2HP1 A;  1YAA A;  2BI3 A;  3NTJ A;  4OBU A;  4F5G A;  4I8A A;  2BI1 A;  2E54 A;  2C44 A;  4XK1 A;  1S09 A;  1DKA A;  4W1X A;  1S08 A;  4JEZ A;  2VIA A;  4CBS A;  1AIC A;  1GC3 A;  1KL2 A;  5HDM A;  3ZZJ A;  1MLY A;  3E2Z A;  1ELU A;  4LC3 A;  1GEX A;  4Q6R A;  3E2Y A;  1V2F A;  4W5K A;  1Z3Z A;  3ELP A;  2O1B A;  5G4J A;  3NDN A;  3USF A;  3PDB A;  1MAQ A;  3FFH A;  2CIN A;  3R9A A;  3TFT A;  1C0N A;  4Q75 A;  2W7L A;  4WXB A;  2BWP A;  1X2A A;  4DQ6 A;  3KGW A;  3FFR A;  3MC6 A;  2W7M A;  3QGU A;  3E6G A;  2CFB A;  3EI7 A;  2JJE A;  3UAK A;  1KMJ A;  1YOO A;  1V72 A;  1OXO A;  2W8T A;  5E5I A;  4R8D A;  3WGC A;  5BJ3 A;  5G4I A;  3BCB A;  4RM1 A;  3FDB A;  4P7Y A;  1FG7 A;  1ASA A;  1TOI A;  3NU7 A;  5D95 A;  2HOR A;  4DGT A;  2VMZ A;  2GSA A;  1D7S A;  2VLF A;  1IAY A;  4KYO A;  5M49 A;  2Z20 A;  3QI6 A;  2CST A;  2ZP7 A;  4MKJ A;  3CQ4 A;  4WLH A;  5F8V A;  3PPL A;  1C7N A;  5M4B A;  2NMP A;  2W8V A;  2AY2 A;  1M0Q A;  4OBV A;  4OYT A;  4EU1 A;  2AY4 A;  4F5I A;  2QMA A;  3W1J A;  1I48 A;  1BJO B;  4MGR A;  2ZC0 A;  4GE7 A;  3JTX A;  4IXO A;  1W7N A;  2TPL A;  2VMO A;  2X8U A;  1FG3 A;  1UU0 A;  2AY3 A;  1ASB A;  3AEN B;  3GET A;  1SPA A;  2WB6 A;  4W8I A;  3UWC A;  1KKP A;  5K8B A;  1ASE A;  2FQ6 A;  2HP2 A;  1RV3 A;  3BC8 A;  1I41 A;  3BN1 A;  3I16 A;  3DYD A;  4Y0I A;  5EUN A;  4OT8 A;  3N4S A;  3UE8 A;  3PJ0 A;  1B9I A;  2VMN A;  1WYV B;  4M2J A;  4Y0H A;  3ZRR A;  3FDD A;  2D63 A;  3AEJ C;  1JS3 A;  1YJY A;  4WYF A;  3JW9 A;  3NUB A;  4RJ0 A;  3AEL A;  1AHF A;  4A0F A;  2PO3 A;  3ATH A;  1TAR A;  1QIT A;  5E4Z A;  1B4X A;  1X0M A;  2C0R A;  2FM1 A;  2OGE A;  2EO5 A;  1CL1 A;  1GC4 A;  2W7J A;  3II0 A;  3AV7 A;  4ZM4 A;  3N4R A;  1JF9 A;  4L0O A;  2JIS A;  2YCT A;  3K7Y A;  2JJH A;  1ZOB A;  3IF2 A;  4ADC A;  1TOK A;  3T32 A;  1BJW A;  3EIA A;  1C4K A;  3BWN C;  3RCH B;  2AAT A;  2D64 A;  4IY7 A;  2C81 A;  4W1V A;  4BMK A;  4A0R A;  3GBX A;  3DC1 A;  2OGA A;  1LK9 A;  1OXP A;  4KXK A;  1D7V A;  9AAT A;  1LC7 A;  1AHY A;  3FVS A;  4J8L A;  3WX9 A;  4E3R A;  3PGY A;  2BI9 A;  1B8G A;  1JS6 A;  4W91 A;  1C9C A;  4MSO A;  4AO9 A;  4ATP A;  2BHX A;  2CH2 A;  1AJS B;  4XAU A;  5I92 A;  1KL1 A;  3QHX A;  4BHD A;  2FN6 A;  3GR9 A;  3FZ8 A;  1VP4 A;  2BYJ A;  2R2N A;  2D61 A;  1LC8 A;  4WBT A;  2WK8 A;  4PFN A;  2W8J A;  1J04 A;  5KTB A;  1UU2 A;  2OQX A;  1ASM A;  2X5F A;  4Q31 A;  1AKC A;  1ZOD A;  1AIA A;  1AY8 A;  4H51 A;  1AKB A;  1EJI A;  3VOM A;  1WYU A;  1YJS A;  1I29 A;  1DJ9 A;  4CVQ A;  5G0A A;  4F5K A;  2HOX A;  3PD6 B;  1AHG A;  1MDX A;  4M2K A;  4Q76 A;  5J8Q A;  4IXZ A;  4CXR A;  2OKJ A;  4UHM A;  3ASA A;  2QLR A;  2G7J A;  1W23 A;  3N7N A;  1BQA A;  1C7G A;  4K2I A;  2E7J A;  2CY8 A;  2AEV A;  3MEB A;  3DR7 A;  1BKG A;  5HXX A;  3CBF A;  3RBL A;  3HDO A;  2DKB A;  4J5U A;  1G4X A;  5AX8 A;  1YIY A;  1DFO A;  1PMO A;  3TFU A;  2HUI A;  3A9X A;  4R5Z A;  5FT8 A;  3FZ6 A;  4JEV A;  3RI6 A;  2CJG A;  3H9X A;  4FL0 A;  3B1D A;  3COG A;  1QIR A;  1FC4 A;  4JF1 A;  5EAA A;  2VMQ A;  1S06 A;  3BWO A;  1X29 A;  2DR1 A;  3TCM A;  2BYL A;  4IYO B;  2QSR A;  3EIB A;  3JU7 A;  3FVU A;  2ZSM A;  2W7F A;  1VEF A;  4XJO A;  3GZD C;  2FKI A;  2ZSL A;  3TQX A;  1GEW A;  1MLZ A;  4AZJ A;  5DJ1 A;  4WYE A;  1AJR A;  3L8A A;  4LNL A;  4ZSW A;  1CQ6 A;  3WGB A;  1AHE A;  4E3Q A;  4R2N A;  2VMY A;  1M0P A;  1Z7D A;  4ATQ A;  2BWO A;  3K28 A;  3F9T A;  3ZZK A;  1YNU A;  4N0B A;  3HL2 A;  3AEJ A;  3MAF B;  1TOE A;  1W3U A;  1MAP A;  3F0H A;  1ECX A;  4MQP A;  1RVY A;  3N75 A;  2QB2 A;  1YIZ A;  4JE5 D;  1J32 A;  4ADD A;  2O0R A;  3M5U A;  3PDX A;  8AAT A;  1IBJ A;  2W7K A;  3MBB A;  1I43 A;  1GDE A;  3PAA A;  2OAT A;  3FTB A;  2Z1Y A;  1ASD A;  1EG5 A;  1OAT A;  2W7H A;  3KGX A;  2ZY4 A;  2YKU A;  1LW5 A;  2Q7W A;  4OTL A;  5FT4 A;  1YJZ A;  2BIA A;  3AOV A;  2DGM A;  2XH1 A;  1ARI A;  1B5O A;  3Q8N A;  1IAX A;  4LW4 A;  4XJP A;  4EB5 A;  3VP6 A;  4E77 A;  4H63 Q;  3NYS A;  3B1E A;  3HLM A;  4A72 A;  1BJO A;  1GC2 A;  4W1W A;  3BWN A;  4NOG A;  2Z1Z A;  4ZWV A;  3A8U X;  3CQ5 A;  4WP0 A;  3A2B A;  1CS1 A;  3JZL A;  3LG0 A;  4RLG A;  1WST A;  1AMA A;  4ZM3 A;  4GRX A;  3NYU A;  1WKG A;  1V2D A;  2JJF A;  2VMX A;  3MAD A;  2R5C B;  2W7E A;  4TN4 A;  3VK3 A;  1DGD A;  5LHA A;  2WK7 A;  3D6K A;  1G7X A;  1QGN A;  4XJL A;  1C7O A;  2FNU A;  1AHX A;  2OKK A;  2W7D A;  2VYC A;  1IVR A;  1KMK A;  4F5H A;  4UQV A;  2KFP A;  4WD2 A;  2A1V A;  3BV0 A;  3GZC A;  4A6U A;  1E5E A;  2YRI A;  2ORD A;  1AAM A;  4F5L A;  1H1C A;  3FQ8 A;  2G6W A;  5M46 A;  4B98 A;  4WYD A;  3ELE A;  1AMR A;  1AY5 A;  1BS0 A;  4GSA A;  2VMU A;  3LVM A;  1SFF A;  1JG8 A;  3I4J A;  1AKA A;  1XEY A;  1DJU A;  1AAW A;  2D7Y A;  3VAX A;  4HF8 A;  1CQ7 A;  3ISL A;  4AH3 A;  1SZK A;  2QB3 A;  1W7L A;  3B1C A;  4RIT A;  1LKC A;  3KE3 A;  3DOD A;  2ZY2 A;  1ASF A;  3ZRQ A;  4WYC A;  3ASB A;  3ECD A;  3QPG A;  3OP7 A;  5E3K A;  1SZU A;  1MGV A;  2GMS A;  1AIB A;  4OC9 A;  4IW7 A;  5EIG B;  2EZ1 A;  1IUG A;  3NUI A;  2AY7 A;  3BS8 A;  1M0N A;  1GEY A;  3FD0 A;  4UOY A;  3AEM C;  2CAN A;  2VGZ A;  4WB0 B;  4K05 A;  3AAT A;  3KKI A;  2VMW A;  4GEB A;  4WXG A;  4BA5 A;  3GSB A;  4M2M A;  4K2B A;  2EZ2 A;  2PB2 A;  1IX7 A;  1CJ0 A;  1DTY A;  3NU8 A;  3RUY A;  4K2M A;  3WCN A;  4IXS A;  3DRD A;  4PVF A;  1OHY A;  2D65 A;  4MQQ A;  4LNM A;  3GZD A;  1D7R A;  2X5D A;  3QBO A;  3HQT A;  1DJE A;  2VI8 A;  4BA4 A;  4UHN A;  2DKJ A;  2FNI A;  5M4D A;  1MDO A;  2VMR A;  4CXQ A;  4HVK A;  2W8W A;  3RBF A;  4ADB A;  3HT4 A;  2QBT A;  4A6R A;  4O6Z A;  3F6T A;  3N0L A;  1Y4I A;  5DX5 A;  4ZDL A;  4EFF A;  1ARS A;  2JGT A;  4MY5 A;  4TMR A;  1WYT A;  1PFF A;  1G4V A;  1M4N A;  2PB0 A;  4U1T A;  2Z9X A;  1O4S A;  3G7Q A;  4ADE A;  3P1T A;  3PIU A;  3QN6 A;  3HBX A;  3N5M A;  2DOU A;  3GJU A;  3JWB A;  5DJ9 A;  1X28 A;  3EI6 A;  3R4T A;  4XQ2 A;  1EQB A;  4Y0D A;  3WZF A;  3LY1 A;  4JEX A;  2E7I A;  4WYA A;  1ASL A;  2F8J A;  3HMU A;  2VGS A;  4RKC A;  2CJH A;  1ASG A;  1M6S A;  5EAV A;  1VJO A;  4LW2 A;  1E5F A;  3AOW A;  2VIB A;  1B5P A;  2GQN A;  4ITG A;  2V0Y A;  3LWS A;  5G09 A;  4WYG A;  5G2P A;  2Z9V A;  4FFC A;  3WCO A;  2HUU A;  2VGW A;  4ITX A;  2Z9W A;  1GCK A;  1H0C A;  2EPJ A;  2XBN A;  3DZZ A;  3IHJ A;  4TV7 A;  3EI5 A;  3RQ1 A;  1AMQ A;  3H14 A;  3FQA A;  2AY1 A;  1ARG A;  1BW0 A;  3E2Z B;  2EYQ A;  2DGL A;  1AY4 A;  2BIG A;  2AY8 A;  4GE4 A;  1XI9 A;  1BJN A;  1QJ5 A;  1SF2 A;  2ZUK A;  4RJY A;  2JJG A;  3PDB B;  3FCR A;  2BI5 A;  3MAF A;  3QM2 A;  4BQ0 A;  3LVK A;  4JF0 A;  2Z67 A;  4XEW A;  1O61 A;  2YOB A;  2ZYJ A;  3OKS A;  1RVU A;  1P3W A;  2BIE A;  2W8U A;  1KKJ A;  3EZ1 A;  1B9H A;  1V2E A;  2AY6 A;  1LW4 A;  2RFV A;  4UHO A;  5DB5 A;  4RKD A;  5G2Q A;  4IX8 A;  5IWQ A;  2R5E A;  3EUC A;  2C7T A;  1OHW A;  4JEY A;  2HUF A;  1SVV A;  1SZS A;  2VI9 A;  4GDY A;  4ZDO A;  4MKK A;  1M0O A;  3A9Y A;  3NRA A;  3EZS A;  1D7U A;  5F9S A;  2BWN A;  4R5F A;  1AMS A;  1U08 A;  2BKW A;  4F5F A;  2YCN A;  2R0T A;  3AEN A;  3I5T A;  4WLJ A;  4AZK A;  1N31 A;  4PFF A;  4QGR A;  4A0H A;  3EI8 A;  1PG8 A;  1N8P A;  4WXF A;  3NYT A;  3BCA A;  1ART A;  5EQC A;  1ASN A;  1QIS A;  4JE5 A;  3N4X A;  1S07 A;  3JWA A;  2X3L A;  4F5M A;  4E1O A;  1BT4 A;  1UKJ A;  2R5C A;  3AEM A;  4CBR A;  1GBN A;  2VLH A;  1N2T A;  4RAE A;  3PA9 A;  3EI9 A;  1WYV A;  3WKR A;  1GC0 A;  1DGE A;  2EGY A;  1MDZ A;  3W1I A;  3E2F A;  2ZY5 A;  4MQR A;  2VGV A;  3ACZ A;  4OMA A;  3DR4 A;  3NX3 A;  1AX4 A;  4N0W A;  1LC5 A;  2W7G A;  4KAM A;  3DXW A;  2AY9 A;  2YKX A;  4ZDP A;  3NNK A;  1O62 A;  3LVL B;  2VMT A;  4EB7 A;  3DU4 A;  2Z9U A;  3P6K A;  3FKD A;  2CJD A;  2YKV A;  3MC6 C;  4F5J A;  3GWP A;  2WK9 A;  1ELQ A;  1UU1 A;  1ASC A;  2WKA A;  3HVY A;  1TAT A;  4LNJ A;  1BQD A;  4F4E A;  2YKY A;  3B8X A;  3RCH A;  3G8M A;  2QA3 A;  5C6U A;  2BI2 A;  1TOG A;  1ORD A;  2DGK A;  3H7F A;  3MAU A;  5D5S A;  1S0A A;  1PMM A;  3MKJ A;  3TAT A;  4PIW A;  2ZY3 A;  1QJ3 A;  5EFS A;  2AY5 A;  3AEP A;  5EIG A;  2VMP A;  2VGT A;  4ZAH A;  1TAS A;  3A9Z A;  3LV2 A;  4A00 A;  1KAF A;  3CAI A;  3WLX A;  5HHY A;  1BJ4 A;  3K40 A;  1TOJ A;  2CH1 A;  1AJS A;  3B46 A;  2VMS A;  4WB0 A;  1T3I A;  4P3M A;  4ZWM A;  3ZRP A;  2CB1 A;  2D66 A;  3E77 A;  3FZ7 A;  4A0G A;  3E9K A;  2V1P A;  5TF5 A;  3BB8 A;  2JG2 A;  1ARH A;  2AEU A;  3W1H A;  2VGU A;  2HZP A;  3AEO A;  4RIZ A;  5FT6 A;  2CTZ A;  3L44 A;  1TPL A;  1CZC A;  2E7U A;  4AO4 A;  2Z61 A;  2D7Z A;  1GD9 A;  7AAT A;  4GE9 A;  2FYF A;  5EUD A;  2HOZ A; 
#chains in the Genus database with same CATH homology
 1IX8 A;  3FQ7 A;  1CQ8 A;  2HOY A;  4ISY A;  2YCP A;  4AOA A;  1CL2 A;  3PD6 A;  2YHK A;  4ZSY A;  3WY7 A;  4DBC A;  1O69 A;  1W7M A;  3FRK A;  1D2F A;  5LH9 A;  1WKH A;  1G7W A;  5BJ4 A;  2EH6 A;  3VK4 A;  1RV4 A;  3FSL A;  2O7C A;  2VMV A;  5JAY A;  3CQ6 A;  1QZ9 A;  1WYU B;  3FVX A;  3G0T A;  4ZLV A;  3WKS A;  2YRR A;  4XJM A;  3DXV A;  3LVJ A;  1IX6 A;  2GMU A;  1WYT B;  2D5Y A;  5EUE A;  2W7I A;  4B9B A;  4EMY A;  2GB3 A;  4IYO A;  4ZAS A;  5FT5 A;  1OHV A;  1M7Y A;  3BCX A;  4JEW A;  1M32 A;  1ZC9 A;  1CZE A;  2ZJG A;  1IJI A;  1LS3 A;  4OCA A;  4U2H A;  3VK2 A;  4A6T A;  2HP1 A;  1YAA A;  2BI3 A;  3NTJ A;  4OBU A;  4F5G A;  4I8A A;  2BI1 A;  2E54 A;  2C44 A;  4XK1 A;  1S09 A;  1DKA A;  4W1X A;  1S08 A;  4JEZ A;  2VIA A;  4CBS A;  1AIC A;  1GC3 A;  1KL2 A;  5HDM A;  3ZZJ A;  1MLY A;  3E2Z A;  1ELU A;  4LC3 A;  1GEX A;  4Q6R A;  3E2Y A;  1V2F A;  4W5K A;  1Z3Z A;  3ELP A;  2O1B A;  5G4J A;  3NDN A;  3USF A;  3PDB A;  1MAQ A;  3FFH A;  2CIN A;  3R9A A;  3TFT A;  1C0N A;  4Q75 A;  2W7L A;  4WXB A;  2BWP A;  1X2A A;  4DQ6 A;  3KGW A;  3FFR A;  3MC6 A;  2W7M A;  3QGU A;  3E6G A;  2CFB A;  3EI7 A;  2JJE A;  3UAK A;  1KMJ A;  1YOO A;  1V72 A;  1OXO A;  2W8T A;  5E5I A;  4R8D A;  3WGC A;  5BJ3 A;  5G4I A;  3BCB A;  4RM1 A;  3FDB A;  4P7Y A;  1FG7 A;  1ASA A;  1TOI A;  3NU7 A;  5D95 A;  2HOR A;  4DGT A;  2VMZ A;  2GSA A;  1D7S A;  2VLF A;  1IAY A;  4KYO A;  5M49 A;  2Z20 A;  3QI6 A;  2CST A;  2ZP7 A;  4MKJ A;  3CQ4 A;  4WLH A;  5F8V A;  3PPL A;  1C7N A;  5M4B A;  2NMP A;  2W8V A;  2AY2 A;  1M0Q A;  4OBV A;  4OYT A;  4EU1 A;  2AY4 A;  4F5I A;  2QMA A;  3W1J A;  1I48 A;  1BJO B;  4MGR A;  2ZC0 A;  4GE7 A;  3JTX A;  4IXO A;  1W7N A;  2TPL A;  2VMO A;  2X8U A;  1FG3 A;  1UU0 A;  2AY3 A;  1ASB A;  3AEN B;  3GET A;  1SPA A;  2WB6 A;  4W8I A;  3UWC A;  1KKP A;  5K8B A;  1ASE A;  2FQ6 A;  2HP2 A;  1RV3 A;  3BC8 A;  1I41 A;  3BN1 A;  3I16 A;  3DYD A;  4Y0I A;  5EUN A;  4OT8 A;  3N4S A;  3UE8 A;  3PJ0 A;  1B9I A;  2VMN A;  1WYV B;  4M2J A;  4Y0H A;  3ZRR A;  3FDD A;  2D63 A;  3AEJ C;  1JS3 A;  1YJY A;  4WYF A;  3JW9 A;  3NUB A;  4RJ0 A;  3AEL A;  1AHF A;  4A0F A;  2PO3 A;  3ATH A;  1TAR A;  1QIT A;  5E4Z A;  1B4X A;  1X0M A;  2C0R A;  2FM1 A;  2OGE A;  2EO5 A;  1CL1 A;  1GC4 A;  2W7J A;  3II0 A;  3AV7 A;  4ZM4 A;  3N4R A;  1JF9 A;  4L0O A;  2JIS A;  2YCT A;  3K7Y A;  2JJH A;  1ZOB A;  3IF2 A;  4ADC A;  1TOK A;  3T32 A;  1BJW A;  3EIA A;  1C4K A;  3BWN C;  3RCH B;  2AAT A;  2D64 A;  4IY7 A;  2C81 A;  4W1V A;  4BMK A;  4A0R A;  3GBX A;  3DC1 A;  2OGA A;  1LK9 A;  1OXP A;  4KXK A;  1D7V A;  9AAT A;  1LC7 A;  1AHY A;  3FVS A;  4J8L A;  3WX9 A;  4E3R A;  3PGY A;  2BI9 A;  1B8G A;  1JS6 A;  4W91 A;  1C9C A;  4MSO A;  4AO9 A;  4ATP A;  2BHX A;  2CH2 A;  1AJS B;  4XAU A;  5I92 A;  1KL1 A;  3QHX A;  4BHD A;  2FN6 A;  3GR9 A;  3FZ8 A;  1VP4 A;  2BYJ A;  2R2N A;  2D61 A;  1LC8 A;  4WBT A;  2WK8 A;  4PFN A;  2W8J A;  1J04 A;  5KTB A;  1UU2 A;  2OQX A;  1ASM A;  2X5F A;  4Q31 A;  1AKC A;  1ZOD A;  1AIA A;  1AY8 A;  4H51 A;  1AKB A;  1EJI A;  3VOM A;  1WYU A;  1YJS A;  1I29 A;  1DJ9 A;  4CVQ A;  5G0A A;  4F5K A;  2HOX A;  3PD6 B;  1AHG A;  1MDX A;  4M2K A;  4Q76 A;  5J8Q A;  4IXZ A;  4CXR A;  2OKJ A;  4UHM A;  3ASA A;  2QLR A;  2G7J A;  1W23 A;  3N7N A;  1BQA A;  1C7G A;  4K2I A;  2E7J A;  2CY8 A;  2AEV A;  3MEB A;  3DR7 A;  1BKG A;  5HXX A;  3CBF A;  3RBL A;  3HDO A;  2DKB A;  4J5U A;  1G4X A;  5AX8 A;  1YIY A;  1DFO A;  1PMO A;  3TFU A;  2HUI A;  3A9X A;  4R5Z A;  5FT8 A;  3FZ6 A;  4JEV A;  3RI6 A;  2CJG A;  3H9X A;  4FL0 A;  3B1D A;  3COG A;  1QIR A;  1FC4 A;  4JF1 A;  5EAA A;  2VMQ A;  1S06 A;  3BWO A;  1X29 A;  2DR1 A;  3TCM A;  2BYL A;  4IYO B;  2QSR A;  3EIB A;  3JU7 A;  3FVU A;  2ZSM A;  2W7F A;  1VEF A;  4XJO A;  3GZD C;  2FKI A;  2ZSL A;  3TQX A;  1GEW A;  1MLZ A;  4AZJ A;  5DJ1 A;  4WYE A;  1AJR A;  3L8A A;  4LNL A;  4ZSW A;  1CQ6 A;  3WGB A;  1AHE A;  4E3Q A;  4R2N A;  2VMY A;  1M0P A;  1Z7D A;  4ATQ A;  2BWO A;  3K28 A;  3F9T A;  3ZZK A;  1YNU A;  4N0B A;  3HL2 A;  3AEJ A;  3MAF B;  1TOE A;  1W3U A;  1MAP A;  3F0H A;  1ECX A;  4MQP A;  1RVY A;  3N75 A;  2QB2 A;  1YIZ A;  4JE5 D;  1J32 A;  4ADD A;  2O0R A;  3M5U A;  3PDX A;  8AAT A;  1IBJ A;  2W7K A;  3MBB A;  1I43 A;  1GDE A;  3PAA A;  2OAT A;  3FTB A;  2Z1Y A;  1ASD A;  1EG5 A;  1OAT A;  2W7H A;  3KGX A;  2ZY4 A;  2YKU A;  1LW5 A;  2Q7W A;  4OTL A;  5FT4 A;  1YJZ A;  2BIA A;  3AOV A;  2DGM A;  2XH1 A;  1ARI A;  1B5O A;  3Q8N A;  1IAX A;  4LW4 A;  4XJP A;  4EB5 A;  3VP6 A;  4E77 A;  4H63 Q;  3NYS A;  3B1E A;  3HLM A;  4A72 A;  1BJO A;  1GC2 A;  4W1W A;  3BWN A;  4NOG A;  2Z1Z A;  4ZWV A;  3A8U X;  3CQ5 A;  4WP0 A;  3A2B A;  1CS1 A;  3JZL A;  3LG0 A;  4RLG A;  1WST A;  1AMA A;  4ZM3 A;  4GRX A;  3NYU A;  1WKG A;  1V2D A;  2JJF A;  2VMX A;  3MAD A;  2R5C B;  2W7E A;  4TN4 A;  3VK3 A;  1DGD A;  5LHA A;  2WK7 A;  3D6K A;  1G7X A;  1QGN A;  4XJL A;  1C7O A;  2FNU A;  1AHX A;  2OKK A;  2W7D A;  2VYC A;  1IVR A;  1KMK A;  4F5H A;  4UQV A;  2KFP A;  4WD2 A;  2A1V A;  3BV0 A;  3GZC A;  4A6U A;  1E5E A;  2YRI A;  2ORD A;  1AAM A;  4F5L A;  1H1C A;  3FQ8 A;  2G6W A;  5M46 A;  4B98 A;  4WYD A;  3ELE A;  1AMR A;  1AY5 A;  1BS0 A;  4GSA A;  2VMU A;  3LVM A;  1SFF A;  1JG8 A;  3I4J A;  1AKA A;  1XEY A;  1DJU A;  1AAW A;  2D7Y A;  3VAX A;  4HF8 A;  1CQ7 A;  3ISL A;  4AH3 A;  1SZK A;  2QB3 A;  1W7L A;  3B1C A;  4RIT A;  1LKC A;  3KE3 A;  3DOD A;  2ZY2 A;  1ASF A;  3ZRQ A;  4WYC A;  3ASB A;  3ECD A;  3QPG A;  3OP7 A;  5E3K A;  1SZU A;  1MGV A;  2GMS A;  1AIB A;  4OC9 A;  4IW7 A;  5EIG B;  2EZ1 A;  1IUG A;  3NUI A;  2AY7 A;  3BS8 A;  1M0N A;  1GEY A;  3FD0 A;  4UOY A;  3AEM C;  2CAN A;  2VGZ A;  4WB0 B;  4K05 A;  3AAT A;  3KKI A;  2VMW A;  4GEB A;  4WXG A;  4BA5 A;  3GSB A;  4M2M A;  4K2B A;  2EZ2 A;  2PB2 A;  1IX7 A;  1CJ0 A;  1DTY A;  3NU8 A;  3RUY A;  4K2M A;  3WCN A;  4IXS A;  3DRD A;  4PVF A;  1OHY A;  2D65 A;  4MQQ A;  4LNM A;  3GZD A;  1D7R A;  2X5D A;  3QBO A;  3HQT A;  1DJE A;  2VI8 A;  4BA4 A;  4UHN A;  2DKJ A;  2FNI A;  5M4D A;  1MDO A;  2VMR A;  4CXQ A;  4HVK A;  2W8W A;  3RBF A;  4ADB A;  3HT4 A;  2QBT A;  4A6R A;  4O6Z A;  3F6T A;  3N0L A;  1Y4I A;  5DX5 A;  4ZDL A;  4EFF A;  1ARS A;  2JGT A;  4MY5 A;  4TMR A;  1WYT A;  1PFF A;  1G4V A;  1M4N A;  2PB0 A;  4U1T A;  2Z9X A;  1O4S A;  3G7Q A;  4ADE A;  3P1T A;  3PIU A;  3QN6 A;  3HBX A;  3N5M A;  2DOU A;  3GJU A;  3JWB A;  5DJ9 A;  1X28 A;  3EI6 A;  3R4T A;  4XQ2 A;  1EQB A;  4Y0D A;  3WZF A;  3LY1 A;  4JEX A;  2E7I A;  4WYA A;  1ASL A;  2F8J A;  3HMU A;  2VGS A;  4RKC A;  2CJH A;  1ASG A;  1M6S A;  5EAV A;  1VJO A;  4LW2 A;  1E5F A;  3AOW A;  2VIB A;  1B5P A;  2GQN A;  4ITG A;  2V0Y A;  3LWS A;  5G09 A;  4WYG A;  5G2P A;  2Z9V A;  4FFC A;  3WCO A;  2HUU A;  2VGW A;  4ITX A;  2Z9W A;  1GCK A;  1H0C A;  2EPJ A;  2XBN A;  3DZZ A;  3IHJ A;  4TV7 A;  3EI5 A;  3RQ1 A;  1AMQ A;  3H14 A;  3FQA A;  2AY1 A;  1ARG A;  1BW0 A;  3E2Z B;  2EYQ A;  2DGL A;  1AY4 A;  2BIG A;  2AY8 A;  4GE4 A;  1XI9 A;  1BJN A;  1QJ5 A;  1SF2 A;  2ZUK A;  4RJY A;  2JJG A;  3PDB B;  3FCR A;  2BI5 A;  3MAF A;  3QM2 A;  4BQ0 A;  3LVK A;  4JF0 A;  2Z67 A;  4XEW A;  1O61 A;  2YOB A;  2ZYJ A;  3OKS A;  1RVU A;  1P3W A;  2BIE A;  2W8U A;  1KKJ A;  3EZ1 A;  1B9H A;  1V2E A;  2AY6 A;  1LW4 A;  2RFV A;  4UHO A;  5DB5 A;  4RKD A;  5G2Q A;  4IX8 A;  5IWQ A;  2R5E A;  3EUC A;  2C7T A;  1OHW A;  4JEY A;  2HUF A;  1SVV A;  1SZS A;  2VI9 A;  4GDY A;  4ZDO A;  4MKK A;  1M0O A;  3A9Y A;  3NRA A;  3EZS A;  1D7U A;  5F9S A;  2BWN A;  4R5F A;  1AMS A;  1U08 A;  2BKW A;  4F5F A;  2YCN A;  2R0T A;  3AEN A;  3I5T A;  4WLJ A;  4AZK A;  1N31 A;  4PFF A;  4QGR A;  4A0H A;  3EI8 A;  1PG8 A;  1N8P A;  4WXF A;  3NYT A;  3BCA A;  1ART A;  5EQC A;  1ASN A;  1QIS A;  4JE5 A;  3N4X A;  1S07 A;  3JWA A;  2X3L A;  4F5M A;  4E1O A;  1BT4 A;  1UKJ A;  2R5C A;  3AEM A;  4CBR A;  1GBN A;  2VLH A;  1N2T A;  4RAE A;  3PA9 A;  3EI9 A;  1WYV A;  3WKR A;  1GC0 A;  1DGE A;  2EGY A;  1MDZ A;  3W1I A;  3E2F A;  2ZY5 A;  4MQR A;  2VGV A;  3ACZ A;  4OMA A;  3DR4 A;  3NX3 A;  1AX4 A;  4N0W A;  1LC5 A;  2W7G A;  4KAM A;  3DXW A;  2AY9 A;  2YKX A;  4ZDP A;  3NNK A;  1O62 A;  3LVL B;  2VMT A;  4EB7 A;  3DU4 A;  2Z9U A;  3P6K A;  3FKD A;  2CJD A;  2YKV A;  3MC6 C;  4F5J A;  3GWP A;  2WK9 A;  1ELQ A;  1UU1 A;  1ASC A;  2WKA A;  3HVY A;  1TAT A;  4LNJ A;  1BQD A;  4F4E A;  2YKY A;  3B8X A;  3RCH A;  3G8M A;  2QA3 A;  5C6U A;  2BI2 A;  1TOG A;  1ORD A;  2DGK A;  3H7F A;  3MAU A;  5D5S A;  1S0A A;  1PMM A;  3MKJ A;  3TAT A;  4PIW A;  2ZY3 A;  1QJ3 A;  5EFS A;  2AY5 A;  3AEP A;  5EIG A;  2VMP A;  2VGT A;  4ZAH A;  1TAS A;  3A9Z A;  3LV2 A;  4A00 A;  3CAI A;  3WLX A;  5HHY A;  1BJ4 A;  3K40 A;  1TOJ A;  2CH1 A;  1AJS A;  3B46 A;  2VMS A;  4WB0 A;  1T3I A;  4P3M A;  4ZWM A;  3ZRP A;  2CB1 A;  2D66 A;  3E77 A;  3FZ7 A;  4A0G A;  3E9K A;  2V1P A;  5TF5 A;  3BB8 A;  2JG2 A;  1ARH A;  2AEU A;  3W1H A;  2VGU A;  2HZP A;  3AEO A;  4RIZ A;  5FT6 A;  2CTZ A;  3L44 A;  1TPL A;  1CZC A;  2E7U A;  4AO4 A;  2Z61 A;  2D7Z A;  1GD9 A;  7AAT A;  4GE9 A;  2FYF A;  5EUD A;  2HOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...