4F5NA

Open ternary complex of r283k dna polymerase beta with a metal free dctp analog
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
328
structure length
323
Chain Sequence
b'QETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of dNTP Intermediate States during DNA Polymerase Active Site Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 111
structure length 323
sequence length 328
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f5nA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4f5nA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4f5nA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4f5nA03
4C8MA 1CEZA 4PHAA 2MUTA 4KLHA 2DFLA 3LDAA 1NO5A 4RNMA 5BOMA 5KT5A 3G6VA 2Q0ZX 1VJ7A 4QZCA 3OSNA 1T4GA 1WCLA 5KT4A 2I9GA 4PGQA 3KHGA 5KG5A 5DQHA 2ZTEA 2Y1IA 3ISBA 2KTQA 2HW3A 4GC6A 4DQQA 1R8AA 1KTQA 3M8SA 2BQRA 4KLLA 5HRGA 2ZH8A 4EBEA 4IRKA 2JZBA 5D4BA 7ICFA 4J9KA 1JX4A 2KFZA 3HW8A 3NTUA 4G3IA 2P6UA 3KHRA 1SZPA 4NM2A 5KT2A 1Z00A 5DECA 3OGUA 3RB3A 3ORYA 1U47A 4EBJA 4YMNA 2PFOA 1HJPA 3FYHA 2FPKA 3V7JA 2BR0A 5EWEA 3WFRE 1BPYA 4YD1A 1C7YA 2ZJ5A 2ASLA 5DB6A 1ZQBA 3LWLA 2AGPA 1MQ2A 4LVSA 4I28A 1TAUA 9ICUA 5KFGA 5IIKA 1K1SA 2V9WA 4E0DA 1S76D 2HVIA 1XSLA 4LT6A 2ASDA 4RQ6A 1FA0A 3GIIA 7ICNA 3RR8A 4YG2A 2OWOA 4C8LA 4IR9A 4AT7B 4RPZA 4NY8A 5HC9A 4M9GA 1RYRA 7ICJA 4DOBA 5HRBA 1AROP 5J0YA 4PGXA 3Q8MA 5F2VO 3MGHA 2BE3A 5J2HA 1KNYA 4Q8EA 5EWGA 4NXZA 4YFKA 4Q45A 4PH5A 1BVSA 2WTFA 3BQ2A 9ICMA 1MIWA 2IBKA 4X4PA 2JEFA 2J6TA 2BPGA 2ZJAA 1UT8A 4C8NA 3ZDCA 5DBCA 4QWDA 1SL2A 1X9SA 4FHXA 1L3TA 1U4BA 4GLXA 1ZQNA 5TZVA 4PHDA 4DLGA 3QE9Y 4DQIA 3AU6A 3AUOA 2RFFA 1XS9D 1PZNA 1LB2B 4FH5A 3C1YA 1NZPA 2V4RA 4R8UA 4QZBA 5DG7A 3H4DA 2JEJA 9ICNA 1XC9A 8ICHA 3T5JA 1KFDA 2F1IA 3Q8SB 3TAPA 8ICAA 2PI5A 4M9JA 4X4VA 2FPLA 4RQ0A 1QSLA 2UVVA 4B9MA 1K1QA 3RJJA 5HRKA 4I2JA 2HHPA 2XGQA 4F8RA 2O1PA 1NK5A 4QWCA 5CR0A 4RQ5A 1T7PA 3TARA 3HIYA 5KFZA 1TFYA 7ICPA 4ED1A 2XY7A 2ZH2A 4QZ8A 4O0IA 2PI4A 4X4NA 4JV1A 4GC7A 2DR5A 1WCNA 4MF8A 4RT2A 3C5FA 3V6JA 4WC0A 2UVWA 4UBCA 4DS5A 8ICSA 3AQMA 2ZH7A 1ZQYA 3KTQA 4KLQA 4Q8FA 5KFQA 1VFGA 4QZIA 3QEBZ 4DS4A 9ICAA 9ICJA 5BPCA 5KG2A 2ZJ8A 4JWMA 4IQUA 4FHVA 3EPGA 3PMNA 1ZQRA 4FBTA 3WFOA 3K4GA 4YR2A 4DQRA 4PPXA 4KLMA 9ICWA 4XUSA 4EEYA 3HWTA 5KFRA 4YCXA 4UAZA 7ICMA 2JEIA 4RPXA 1NK0A 2AJQA 2BGWA 2DPJA 4XA5A 8ICBA 8ICYA 8ICJA 2NRTA 3WFSC 1D8YA 3T5LA 4I2CA 1XO1A 4ED6A 4M0AA 2LYHA 3TANA 2C2DA 3TI0A 1JMSA 5D49A 5DQGA 7ICUA 3RJIA 2ZHBA 2MAXA 2DVIA 2XCAA 3RH6A 3ETLA 1YLQA 2FPMA 1TKDA 3KHHA 3OUYA 5J2GA 1U48A 5DB8A 7ICTA 2NRKA 2KN7A 3G6YA 4ECRA 1ZQMA 4QW8A 1Z00B 3BDPA 7ICIA 4ZH4A 5DLFA 9ICSA 1DOQA 5HHIA 2KP7A 4DL5A 1R89A 2ZTDA 4DOCA 2DRAA 1ZQZA 3MFIA 1A77A 3T3FA 4F2RA 4O3QA 4ECVA 2XY6A 4Z6DA 5CP2A 4DL7A 5J2KA 3GV5B 4QWAA 3PVXA 9ICHA 4RQ8A 2BPFA 3AQNA 2XCPA 1MIYA 1PX5A 3H8WA 3OJSA 4F5QA 1HUOA 3H37A 5KT3A 3AQLA 5C5JA 2PXIA 4DL4A 9ICCA 4O3RA 3ZDEA 1TV9A 9ICXA 3V7KA 4DFMA 3PX4A 5HR9A 5KFOA 5J29A 4RQ1A 4KLIA 4JUZA 4R65A 4UD4A 3ISDA 3V7LA 4RUCA 2W9CA 3RR7A 1D9FA 3JPOA 5DEDA 4F93B 5KFAA 4RPYA 4R63A 4J9NA 1V4AA 5KFLA 3HJ1A 5KFIA 9ICPA 4FHYA 3OVBA 2ZUBA 1NKEA 4QZEA 4FH3A 5IIMA 4JWNA 3IM1A 4ECXA 5KFMA 2M2TA 5DQIA 5IIOA 5IINA 4MF2A 1U49A 4F4WA 3N4MB 4RZRA 4M9NA 1ZETA 2VANA 3QZ7A 2HHQA 5HRHA 1ZQSA 2FMSA 2HHSA 5KT6A 4JK1A 4O5KA 4P2HA 2M9NA 1RXVA 1BPXA 3C23A 4O5CA 4R8UB 3RRGA 1UEUA 4DL2A 2C2RA 4F2SA 4O3OA 4ELVA 9ICKA 5HRLA 4ED8A 3JPQA 9ICOA 3N97B 5KG3A 5J2CA 4UB2A 2V4QA 4RNNA 3RJGA 5KT7A 4B9VA 5J2IA 5F9NA 2PFNA 8ICEA 3LQCB 3H39A 1OU5A 3GIJA 5CJ7A 1R8CA 3B0YA 3IHQB 2B21A 5KFBA 3JYYA 8ICMA 2KZZA 4KTQA 4KN4A 1BGXT 4YMMA 4UD5A 2ZH1A 4GXJA 4EBCA 3G6XA 4ECTA 5CWRA 4I2AA 2PFQA 5J2BA 4O3NA 4IR1A 4E8FA 3OV7A 3C2MA 8ICGA 4TUQA 4ECWA 4RWQA 4NM1A 5KFFA 1S0VA 4XQ8A 3RJHA 2AU0A 5KFXA 3SI8A 1UA0A 2DPIA 8ICKA 2F1HA 3PR4A 3MR6A 1UETA 2W8LA 5KFTA 3BJYA 4KLGA 9ICBA 1JN3A 2M2UA 5J2FA 3M9MB 2BCUA 4KLEA 3HX0A 5L1JA 3OVAA 1T3NA 8ICLA 2XO7A 5EWFA 1KDHA 4RWOA 3TFSA 3V6KA 4DQPA 3OHAA 9ICIA 2BQ3A 4NLZA 4X4QA 3GFKB 1NK6A 1ZQLA 5DBAA 5DDYA 4I2GA 3RTVA 4RQ2A 2HHWA 4X4RA 4RQ3A 5L9XA 2W8KA 1BPEA 5DG8A 3TFRA 3RH4A 1COOA 3TQ1A 8ICWA 7ICSA 2ZUCA 3C21A 4DF4A 1L3UA 5DGAA 3K75D 3AQKA 2A1JB 2JEGA 4DQSA 2W9BA 5KG1A 4QZAA 1TK8A 4X0BA 2ZH4A 4Q43A 1X2IA 9ICGA 4UB4A 3OUYB 1CUKA 4I29A 1Z3EB 2VA8A 1ZQAA 4J9MA 3H3AA 4IRDA 4FHWA 4WC2A 4DEZA 2ZUDA 2NRXA 2BPCA 2FMPA 5DGBA 1ZJMA 2BCVA 3SZ2A 3PR5B 4EZ9A 2HHTA 2KFNA 4WC3A 2ZH5A 3C2KA 3Q8KA 4WC5A 1QSSA 9ICTA 2BHNA 3WFQE 2XC9A 4RNOA 4EBDA 1S0MA 4I2EA 5J0PA 3PV8A 1B22A 2XY5A 7ICQA 4WBYA 1JXEA 3MFHA 4X4OA 4KN7A 1NK9A 3GIKA 4TQRA 2AQ4A 5DBBA 3C18A 4EYHB 1L3SA 3EYZA 1N56A 2GWSA 2BKEA 2ISPA 4F5NA 1TK0A 1BPBA 4ED3A 2NRWA 5KFNA 3PW0A 4IRCA 2ZHAA 1JXLA 4KLTA 4DSJA 3H7IA 3MABA 3QZ8A 4M2YA 4LZGA 1DK3A 4B9UA 3GV7B 1KFTA 2ZTCA 5CA7A 3AU2A 4I2DA 5DDMA 4IQTA 5J0XA 2M2WA 1ZQCA 4GXIA 2BCRA 2A1JA 4NKTA 1ZQEA 3PX6A 5HREA 1ZQVA 5KFSA 3NGDA 3JPSA 4O5EA 4WC1A 2NRZA 2W9CB 3GQCA 3GDXA 3UQ0A 4DO9A 4KLSA 3RBDA 8ICCA 4WBZA 3UXOA 3UXNA 8ICNA 4UBBA 1N48A 4QZHA 1SL0A 2KZ3A 5IIJA 2P66A 4UB3A 2UVUA 2FLLA 2J6UA 3QEAZ 1KEJA 3HJ4A 4X4TA 5CB1A 4KLJA 4XRHA 1V9PA 4YD2A 5DB9A 1ZQTA 2FLPA 3Q8RB 3MBYA 4J9QA 4I2IA 1S9FA 1L5UA 2AGOA 4F4ZA 1QLNA 1UEVA 4LZDA 5DLGA 2C2EA 3MDAA 4F50A 8ICZA 5KTQA 1KLNA 3ISCA 4DLEA 4K4IA 3HPOA 3RAXA 3NYBA 1TAQA 2VA3A 3T5KA 3M9NB 5J0TA 3THVA 4KLDA 4QWEA 1NK8A 4ECSA 7ICEA 4E7XA 4TQSA 3PY8A 5EOZA 3H4BA 5L1IA 5HRIA 5J0RA 3RH5A 2BQUA 1JQRA 4MEXA 3MR2A 3TAQA 1S77D 4F5OA 7ICHA 4Z6FA 3V6HA 1XSPA 3EWAA 4BDPA 3EW9A 1NKCA 2R8KA 2Y1JA 4TUPA 2W9AA 4ELUA 3OJUA 3M8RA 3KHLA 2ASJA 2NRVA 4O3PA 4DOAA 4ECQA 4J9PA 1ZQUA 4KLFA 4J9LA 1NKBA 1DK2A 4ED0A 2IA6A 4X4SA 4RUAA 3V72A 1ZQPA 4NKUA 4FHPA 2BCSA 3Q8LA 2FLNA 1D9DA 8ICVA 3PO4A 3SV4A 7ICRA 2RDIA 4X4UA 4AT9A 1SKSA 4BWMA 3GILA 4Z6EA 4FS1A 2C28A 4ATBA 4UQGA 4NLGA 1ZQXA 1S0OA 3OHBA 4DSEA 8ICFA 1TFRA 3C1ZA 1TVAA 2R8GA 1T8EA 4DL6A 2ZH9A 3ZDBA 4YP3A 4CCHA 4O3SA 3PO5A 5HMLA 1ZQKA 8ICXA 8ICIA 3WFPA 2DR8A 4P4MA 5HP4A 1RYSA 1S10A 1QSYA 3MDCA 7ICVA 4M6WA 4PHPA 1MQ3A 3UPSA 4K4GA 2RDJA 1KRPA 3T5HA 4TURA 4GXKA 4IQVA 4FS2A 3RBEA 4YN4A 9ICVA 4NLNA 3UXPA 1MIVA 3ZD8A 4ED7A 4YQWA 2W9BB 1SKWA 3PX0A 5KFWA 3MGIA 4X5VA 1ZYQA 4EZ6A 8ICQA 3ZDDA 1ZQWA 1B43A 5J2JA 1SKRA 3GIMA 4YXJA 2AGQA 1KSPA 5KFDA 2C22A 4KITB 5KFPA 5KFEA 1L3VA 7ICLA 1NOMA 4MFCA 4YMOA 1XWLA 5DKWA 3C5GA 3H8SA 1XSNA 3HP6A 3FDSA 5IIIA 4B9SA 1XU4A 3ZD9A 4UB5A 4DF8A 1F5AA 4M9LA 2KZMA 3H40A 4C8KA 3C2LA 3UQ2A 2HHVA 1BNPA 1Q79A 4TUSA 3RB6A 4O9MA 2Q66A 4UAWA 3B0XA 4R64A 3PNCA 5HRDA 3JPNA 5CHGA 3H38A 4HYKA 4EP7A 4BGDA 1U45A 5KG7A 4BXOB 4J9SA 3ZDAA 3UPQA 2HHXA 4DFKA 3OSPA 4AT8B 4IQWA 4KMUA 1NJWA 3PMLA 1MC8A 4B9TA 4WCWA 1ZQGA 3PW2A 2P6RA 3C66A 7ICGA 5DG9A 1RZTA 2BCQA 8ICTA 4F5PA 4QZDA 3JPTA 3M9OB 3BQ0A 4FBUA 3RJFA 1Q78A 4RT3A 4YVZA 3PW5A 1ZQIA 4RQ7A 4F3OA 4X0AA 4J9OA 5KG6A 4IG8A 3BQ1A 2BDPA 4QZ9A 4JV0A 2R8HA 5HHHA 7ICOA 2HHUA 4KLOA 4QW9A 2IHMA 4WC6A 1ZJNA 5J2AA 8ICUA 4EBKA 3JZ0A 1UA1A 4ECYA 2PFPA 3OVSA 1ZQFA 1BPDA 5KG4A 1ZQOA 4RWNA 4DWIA 5KFHA 4E80A 4B9NA 5J2DA 4C8OA 3RRHA 4MFFA 3LWMA 4FO6A 4UAYA 1S0NA 2FMQA 7ICKA 4WC4A 2ZH6A 5KFUA 4B9LA 1JAJA 4PHEA 1ZQJA 4I2HA 4AT7A 1RPLA 5J0WA 4ECUA 3LK9A 5HNKA 4DL3A 1LV5A 5IILA 3E2EA 1ZQDA 9ICEA 9ICLA 2ZH3A 4QWBA 4BXOA 4QZFA 3HT3A 4F4KA 4AT8A 4S3NA 2M2VA 5JUMA 3H8JA 4RWPA 4P4OA 1NJZA 4WC7A 2DR9A 2I1QA 5KFVA 3GV8B 2ALZA 1BPZA 4F91B 3Q8PB 3MR5A 1TFWA 5L1KA 2W9MA 4BWJA 3RB4A 1JIHA 1NK4A 1ZQHA 3RJKA 2ID1A 4I27A 1S97A 2UVRA 4ELTA 1TK5A 1IM4A 1HUZA 4M47A 1QTMA 4JV2A 5HRFA 3RB0A 1U9LA 2IHNA 4Z6CA 5KG0A 3MR3A 3SYZA 3EPIA 4P4PA 5D46A 2H5XA 3JPRA 1A76A 1NK7A 3Q8QB 1UT5A 2ISOA 2AQ0A 4DSKA 5KFJA 3RJEA 4NLKA 2HVHA 4AT9B 4DSFA 4DFJA 8ICPA 1X9WA 4QZGA 5J2EA 5J0OA 1Y88A 1H38A 4M9HA 4J9RA 1ZQQA 2MUTB 5KFYA 4ATBB 2XGPA 2O5AA 5KFCA 4ECZA 1KFSA 5F9LA 4Q44A 2PBEA 4DFPA 1NJXA 2R8JA 4EYIB 2DR7A 9ICRA 1R8BA 8ICOA 9ICQA 2VA2A 4YR3A 2J6SA 4KLUA 2ATLA 4I2BA 4M6WB 2JZBB 3BQTA 3JPPA 4MEYA 2IMWP 5KFKA 4UB1A 4DSIA 3PW4A 4XQ7A 2DRBA 1D8LA 4ED2A 4F4XA 1IXRA 2F1JA 5J0SA 2R8IA 1X9MA 1DGSA 1SL1A 4I2FA 4M04A 8ICRA 3L9DA 4YR0A 4M5DA 5BOLA 1WOTA 1EXNA 9ICFA 3PW7A 4PGYA 4R66A 4F4YA 4RU9A 4RQ4A 3SV3A 4MFAA 1RXWA 5J0UA 4F5RA 1MSWD 1BNOA 5DB7A 5J0QA 3EZ5A 1NJYA 3RAQA 5HMMA 4F92B 4K4HA 4YXMA 4DSLA 5L1LA
chains in the Genus database with same CATH superfamily
4C8MA 4KLHA 2DFLA 2Q0ZX 3QXGA 4QZCA 1ZXIA 2HW3A 1ECWA 4DQQA 1GO3F 1R8AA 2ZH8A 4EBEA 2K4IA 4J9KA 3UMBA 2P6UA 1Z00A 4EBJA 3ORYA 2PFOA 1HJPA 3V7JA 2BR0A 4YD1A 1RQLA 1C7YA 2ASLA 4LVSA 4E0DA 1XSLA 2ASDA 1FA0A 5AK3A 3RR8A 2OWOA 4AT7B 3F2CA 7ICJA 1RYRA 4Y2RA 1ZD5A 1AROP 3SR6A 2IHOA 3Q8MA 5F2VO 4BUGA 3NVZA 1KNYA 5EWGA 2WTFA 4Q45A 4DCCA 2ZJAA 1UT8A 2KHQA 4C8NA 1COKA 3DEEA 1SL2A 1VDVA 4GLXA 3AU6A 1KQQA 1PZNA 3C1YA 5DG7A 3H4DA 3Q8SB 2EAOA 4X4VA 2UVVA 4B9MA 1K1QA 2XGQA 2A19A 4F8RA 3M1YA 4QWCA 3HIYA 1T7PA 7ICPA 2XVTA 4ED1A 4O0IA 4C7ZA 4JV1A 3NVYA 4EGWA 4OJLA 3C5FA 8ICSA 2YMMA 3KTQA 4LEYA 4KLQA 4C4RA 1VFGA 3WK4A 9ICJA 5KG2A 2F44A 2OHFA 2G07A 3N7SC 3EUB2 3PMNA 3WFOA 3K4GA 4YR2A 9ICWA 4XUSA 3HWTA 2FDRA 2DPJA 8ICBA 3N7PD 4I2CA 1XO1A 5JTGA 2VKQA 2JV3A 5DQGA 2E3TA 1YLQA 2FPMA 1TKDA 3KHHA 4QIWC 3OUYA 1U48A 5DB8A 2HN1A 4ECRA 3HKZF 2ZTDA 1ZQZA 2KKPA 1DRGA 4UAUA 4ECVA 1J97A 4Z6DA 5CP2A 5J2KA 4RQ8A 2BPFA 3OJSA 3H37A 2KIVA 2PXIA 4O3RA 3ZDEA 9ICXA 5AM1A 1SV0C 4KLIA 1JUDA 4JMUA 3TADA 4AYBC 3V7LA 2W9CA 3JPOA 5DEDA 2LBOA 1IIPA 3BS5B 5KFAA 4J9NA 4R63A 4PL2A 4EX7A 1V4AA 1PUZA 5KFIA 4ECXA 5KFMA 5DQIA 5IINA 4JLXA 4MF2A 2KMDA 4M9NA 1ZETA 2YX8A 1JI7A 2HHSA 5KT6A 1NI3A 2G09A 4P2HA 3OWGA 1UEUA 4DL2A 2V4QA 4PZOA 5KT7A 1O08A 3H39A 5KAIU 1OU5A 5KFBA 2B21A 1S8OA 8ICMA 4GXJA 3LVWA 5ALUA 3G6XA 4EBCA 4WQLA 4LEZA 4E8FA 3OV7A 5JRTA 8ICGA 1RM6C 3ONNA 4NM1A 3RJHA 2AU0A 2ES6A 2H3IA 2W8LA 3BJYA 4KLGA 4EEDA 3HX0A 3V6KA 3OHAA 4NLZA 2LM4A 3D2QA 3PZPA 5L9XA 5DG8A 8ICWA 3TQ1A 7ICSA 3NKUA 1QCKA 3QYPA 2A1JB 1QH9A 1WG8A 3CNHA 4X0BA 1TK8A 4P0PA 2Q4TA 4HX0A 4I29A 3MCRA 2VA8A 4J9MA 3H3AA 4DEZA 1IV8A 2FMPA 4EZ9A 1NNLA 4WC5A 2DKXA 2BHNA 3WFQE 5J0PA 3PV8A 7ICQA 2JRZA 2AQ4A 2I5HA 3M6KA 2EWRA 2GWSA 2ISPA 2ZHAA 4F5NA 1TK0A 2NRWA 2YY6A 3PW0A 4DSJA 1DK3A 3KBBA 1FFVA 3GV7B 1N5WA 2ZTCA 2W7PA 4I2DA 2JGAA 3QNMA 2BCRA 4NKTA 1N61A 3JPSA 8ICCA 4DO9A 4QJFB 1Q3VA 3WU2U 3UXNA 3QU9A 1N48A 1SL0A 2P66A 5IIJA 4UB3A 2J6UA 4UAVA 5CB1A 4XRHA 5DB9A 1ZQTA 3MBYA 1QQ7A 2HBLA 1L5UA 2HMXA 1UEVA 1KLNA 3ISCA 4DLEA 3HPOA 5ALYA 2VJ5A 4QIWF 4KLDA 2Y9UA 4ECSA 5EOZA 5HRIA 5J0RA 4PJ0U 1S77D 4F5OA 4BDPA 1F5SA 4KMOB 4TUPA 2W9AA 2ASJA 2AXTU 5KNIA 2IA6A 5CHEA 1ZQPA 2DUYA 4AT9A 1RG6A 4BWMA 4Z6EA 4AYBF 8ICFA 2YN4A 4DFDA 2R8GA 1Q3UA 3OPXA 3ZDBA 8ICXA 2MSNA 3WFPA 4AP9A 5HP4A 2ZIUB 3UPSA 4M6WA 4PHPA 2LKYA 3T5HA 5C0YA 4GXKA 4IQVA 3RBEA 9ICVA 3WKEA 3D2SA 1MIVA 4ED7A 4YQWA 2KSOB 1ZYQA 1B43A 1SKRA 4YXJA 1TAMA 1A0PA 2C22A 2F77X 1NOMA 4EENA 3H8SA 3FDSA 5IIIA 4UB5A 1Z4OA 2KZMA 1FIQA 4C8KA 3C2LA 1Z1VA 5ALZA 1YT3A 4R64A 3PNCA 2KVSA 5AM5A 3SMVA 4Y2TA 2HHXA 2CPRA 2DF4B 1ZQGA 2P6RA 3KKAA 4QZDA 1Q78A 1ZQIA 4RQ7A 2YMLA 4OAFA 5CFSA 3BQ1A 5HHHA 7ICOA 2HHUA 2A1AA 2IHMA 3IRUA 1ZJNA 1XO0A 5J2AA 4WC6A 1X66A 3JZ0A 5ALLA 3OVSA 2W03A 4E80A 4UAYA 4B9LA 3M6ZA 4FO1A 5EE0A 2HOQA 2OCEA 3AQFA 4CNQA 4F91B 1TFWA 2MRLA 2DR7A 2LPEA 2ID1A 4I27A 4JV2A 4NL9C 2IHNA 3CP8A 5KG0A 3MR3A 5D46A 2H5XA 1TAUA 1A76A 4RWQA 1UT5A 4DSKA 2HVHA 3UMGA 4DSFA 4QZGA 4ATBB 4B6JA 2XGPA 4N7RA 5KFCA 3NUQA 2JH1A 3PSIA 4NLBA 4Q44A 4DFPA 1NJXA 9ICQA 2VA2A 2J6SA 4KLUA 4I2BA 4UB1A 2OH2A 2R8IA 4M04A 4IL6U 4MFAA 1MSWD 2O6KA 5DB7A 3EZ5A 4WOYA 4NXXA 4PHAA 2MUTA 3G6VA 5KT5A 2W11A 3VCBA 2W43A 3IDWA 3QUQA 2ZTEA 2Y1IA 2H3ZA 3ISBA 2BQRA 4IRKA 5HR6A 3KHRA 4NM2A 2NV3A 3OGUA 1PVQA 4YMNA 3FYHA 2FPKA 5B5EU 3WFRE 1BPYA 4OAGA 1ZQBA 3LWLA 1MQ2A 4UW9A 3QUBA 1VJ5A 5KFGA 1K1SA 2VJ4A 3ERCC 2V9WA 1P7DA 2XI9A 3F2DA 2HVIA 4LT6A 5CEHA 1ZRNA 2KOBA 4YG2A 2G0AA 1NZBA 4C8LA 2LM1A 1KN5A 4RPZA 4NY8A 5HRBA 5J2HA 4O3MA 3J81j 3QU5A 4EELA 2IOFA 1LVHA 3BQ2A 4PH5A 9ICMA 2IBKA 2JEFA 2ZIXB 2YB4A 3ZDCA 3HILA 1WUDA 1L3TA 4DQIA 3AUOA 5ALMA 2V4RA 4R8UA 3N7RC 1XC9A 8ICHA 1ZD4A 1SWWA 3NASA 4RQ0A 5ALVA 2AHOB 2YTUA 1V38A 5KL1B 1NK5A 3TARA 5KFZA 2ZIWA 5AI0A 2ZH2A 1XNSA 1B4FA 4OCZA 5EE1A 3V6JA 2DVIA 1ZQYA 5ALXA 3UMCA 5KFQA 2WF6A 4EX6A 4DS4A 2B0CA 5BPCA 2ZJ8A 4JWMA 4IQUA 1CRXA 2F8KA 3EPGA 4EEYA 4UAZA 4RPXA 2AJQA 4NXWA 2F76X 1RQNA 1D8YA 4M0AA 5KL8B 3RFAA 3TANA 1Z19A 3RJIA 4PZNA 5ALEA 3G6YA 5J8YC 4QW8A 2K8BB 3BDPA 4K8VA 4FE3A 9ICSA 2LHTA 1DOQA 4Y2UA 2KP7A 5HHIA 4DOCA 3VC8A 3AQNA 1YZ6A 9ICHA 2XCPA 1PVPA 2KV2A 3H0MB 2EQYA 4PL1A 5C5JA 4DL4A 3SD7A 4NWIA 5KFOA 2WF9A 3ISDA 1M6YA 2I6XA 5ALKA 4RUCA 1ZQ1C 1D9FA 1HIWA 4F93B 2WB1C 4FHYA 3GZFA 3IN5A 2LYBA 3IM1A 4K9AA 4F4WA 3NWIA 2FE9A 5ALQA 3QZ7A 4JK1A 3ALRA 2M9NA 4KB6A 1UQVA 3N28A 4F2SA 3WK9A 5HRLA 3JPQA 9ICOA 3E0FA 4FZLA 2IOHA 3JYYA 2VIXA 3IHQB 4KN4A 4P0PB 5AI9A 4I2AA 2PFQA 5J2BA 4IR1A 2B6GA 4TUQA 4ECWA 2NYVA 5KFXA 3M7DA 1UA0A 4NXVA 2F1HA 5KFTA 9ICBA 3M9MB 5AIBA 4KLEA 5L1JA 3F53A 1KDHA 4JLZA 1X42A 2EAPA 4DQPA 9ICIA 1KW4A 1NK6A 4K96A 4I2GA 2R18A 2CN1A 2ZUCA 3C21A 1L3UA 1SV4A 5AM3A 3K75D 3AQKA 2JEGA 5ALHA 4Q43A 4O67A 1X2IA 1CUKA 2RQ5A 2NO4A 1ZQAA 1UHUA 2HOFA 1PVRA 5DGBA 2BCVA 2HHTA 5AK5A 3C2KA 5AM0A 2RLTA 4EBDA 1S0MA 3KD3A 1JXEA 3F5EA 1NK9A 2ZIVB 3GIKA 1HEKA 4C7YA 1L3SA 2A3VA 4FZNA 2BKEA 4IRCA 3FM9A 2HBMA 4KLTA 3MABA 2Y0SC 5CA7A 5DDMA 4O69A 1LKYB 1WWVA 3PSFA 3PX6A 4O68A 4WC1A 3GDXA 3IP4B 4WBZA 3UXOA 2QB0A 5B66U 2KK0A 3QEAZ 2GO7A 1L6NA 4EEKA 2OYYA 4YD2A 4J9QA 1QLNA 4F50A 8ICZA 5KTQA 2XICA 3THVA 3SAFA 5L1IA 3KOOA 3DDHA 3RH5A 4BJQA 3IG5A 4MEXA 3V6HA 2Y9TA 3O0FA 1NKCA 2R8KA 3OJUA 1Q46A 2DBYA 4KLFA 1DK2A 5AKGA 4ED0A 4P0QB 4FHPA 7ICRA 1SKSA 2HCFA 3GILA 5ALJA 4C4SA 4FS1A 4NLGA 1S0OA 3OHBA 4CGZA 1TFRA 4CCHA 2WB1F 3PO5A 2IOFK 4P4MA 1A6SA 1RYSA 1S10A 7ICVA 3MDCA 3WKBA 1MQ3A 4NLCA 3LYSA 2KG5A 4NLNA 2W9BB 4C80A 5AKZA 4EZ6A 1SV0A 3NVVA 5J2JA 3GIMA 2K4EA 2ODGA 5KFEA 1L3VA 4K98A 4MFCA 5DKWA 3C5GA 5AK4A 2YMPA 1XU4A 3ZD9A 2KEYA 2ZG6A 2Q66A 4I0UA 2N1RA 3H8MA 5CHGA 4HYKA 4BGDA 3UPQA 1NJWA 2EZZA 1ZRMA 4B9TA 2K4PA 4CDGA 1RZTA 2BCQA 7ICGA 8ICTA 3ER8C 2K89A 4F5PA 3M9OB 3JPTA 3PSTA 4RT3A 3QU7A 4Y2QA 2KE7A 4F3OA 4X0AA 4J9OA 3NVWA 2BDPA 3WK5A 2H3VA 4EBKA 4LEWA 2PFPA 4DWIA 4K9BA 1X6IA 4C8OA 5J2DA 3AL0B 3RRHA 4MFFA 2W04A 4FO6A 2ESEA 1S0NA 1L7OA 2ZH6A 1JAJA 4I2HA 4AT7A 1RPLA 3UM9A 1LV5A 3E2EA 1ZQDA 2BBHA 4QWBA 4F4KA 4RWPA 4P4OA 2I1QA 5KFVA 3GV8B 2ALZA 2NO5A 2XIDA 3AQEA 5AM4A 3Q8PB 2GLEA 5L1KA 3RB4A 1NK4A 3ZI4A 1JIHA 1UPHA 3RJKA 2UVRA 4ELTA 1TK5A 1HUZA 2ZXIA 3RB0A 2D6FC 2MA1A 1PK1A 8ICPA 4KX3A 1Y88A 2Y0SF 4J9RA 1ZQQA 2MUTB 5F9LA 3EF2A 2WF7A 2W55A 9ICRA 8ICOA 2ATLA 3JPPA 5AI5A 5KFKA 3PW4A 2DRBA 1D8LA 3WK6A 1IXRA 5J0SA 4F4YA 4RQ4A 3SV3A 2PMZC 2FPLA 4DSLA 1NO5A 4RNMA 5BOMA 2DWQA 3OSNA 1VJ7A 1WCLA 1L7NA 2I9GA 2LYAA 2KTQA 5DQHA 1KTQA 3M8SA 4K97A 5D4BA 2DGZA 3CW2C 3NTUA 5KT2A 4UASA 4WQKA 1X40A 2EH9A 5F3XB 4I28A 9ICUA 2AH5A 3AEVA 3H0RB 3BQ7A 4RQ6A 3AN1A 3GIIA 3IG8A 4IR9A 5HC9A 4DOBA 5J0YA 5TISU 3SAHA 2K4HA 2ZIWB 5CFTA 3BS5A 1DXSA 4NXZA 1BVSA 1MIWA 1YZ7A 3QUCA 2BPGA 5AK6A 4FFDA 5AKYA 1X9SA 1U4BA 5ALNA 1ZQNA 5TZVA 4DLGA 2RP5A 2RFFA 4FH5A 1NZPA 2D8CA 2KICA 4F72A 3T5JA 1KFDA 3TAPA 8ICAA 2Z7JA 2CRXA 4M9JA 4OJOA 1QSLA 4C0ZA 2O1PA 5HRKA 4I2JA 3H0LB 2HHPA 5CR0A 2XY7A 4CF5A 2JHDA 1WCNA 4MF8A 4K99A 4RT2A 4BX9C 2ZH7A 2UVWA 3AQMA 1SXDA 3S6JA 3C29A 9ICAA 2WF8A 4FHVA 4FBTA 2HBKA 2F3NA 4DQRA 4PPXA 5AICA 2JEIA 7ICMA 8ICYA 4Y2YA 5AKEA 8ICJA 4FZMA 2NRTA 2KHVA 1L8OA 4Y2SA 3T5LA 2G5HB 2LYHA 2C2DA 3TI0A 1N62A 7ICUA 2MAXA 4OD0A 1QQ5A 3RH6A 3ETLA 5J2GA 1QQ6A 2NRKA 3ER9B 4RQNA 1Z00B 3MGVA 7ICIA 5DLFA 3TACB 4DL5A 3T3FA 4LJXA 4DL7A 2EANA 5KAFU 3KZXA 4NL9A 1MIYA 1PX5A 2FJ6A 2GH1A 4US8A 3PX4A 5HR9A 2H3QA 4R65A 4UD4A 4MHVA 5CRXA 3SQIA 3RR7A 2PMZF 4RPYA 2KNJA 3HJ1A 5KFLA 1Q8KA 3OVBA 2ZUBA 4QZEA 5IIMA 5IIOA 1U49A 2E8NA 3TKAA 3N4MB 2VANA 2HHQA 5HRHA 4NJ8A 4IC9A 4UB8U 1BPXA 3C23A 3RRGA 2C2RA 4NV0A 4O3OA 4ELVA 9ICKA 3T79A 4ED8A 3N97B 3L4PA 5KG3A 4UB2A 3RJGA 4RNNA 8ICEA 4B9VA 5F9NA 4F71A 3GIJA 1R8CA 4KTQA 2DQNB 1BGXT 3F2BA 4ECTA 2JXJA 2FCLA 4JB3A 1URJA 5KFFA 1S0VA 4XQ8A 3SI8A 8ICKA 2DPIA 3MR6A 2E8OA 2M2UA 1JN3A 5GTIU 2BCUA 1V85A 5ALRA 2XO7A 2BQ3A 5ALSA 1IG6A 5DBAA 3NRWA 5DDYA 4RQ2A 2ZIUA 4GIBA 1FO4A 3TFRA 5B3PA 2OM6A 4DF4A 5DGAA 3KFUF 3QUTA 4QZAA 2ZH4A 3OUYB 2QB0B 4WC2A 4NXTA 2F8LA 5B3QA 2G08A 2KFNA 2GA9D 2ZH5A 5ALOA 3Q8KA 1QSSA 9ICTA 4RNOA 4I2EA 2XY5A 4WBYA 5HR7A 4TQRA 4EYHB 3EYZA 1N56A 3CK6A 4B9UA 2L5YA 5CFUA 3DV9A 5ALTA 1KFTA 4UB6U 1ZQCA 1ZQEA 1ED1A 5KFSA 2NRZA 2W9CB 3UQ0A 2LMRA 3AMZA 3WKCA 1C20A 8ICNA 4UBBA 4O5CA 4QZHA 4CF3A 2IUBA 1FFUA 1F44A 1KEJA 4X4TA 1V9PA 3Q8RB 1S9FA 2YMQA 5DLGA 5EE9A 2W3RA 4K4IA 3RAXA 3NYBA 2VA3A 3T5KA 5ALIA 5J0TA 2W7OA 4TQSA 3PY8A 1MN8A 3H4BA 4USAA 1JQRA 1AQ6A 3TAQA 7ICHA 2QARA 1XSPA 3EWAA 3EW9A 2Y1JA 1RYUA 3AM9A 3M8RA 4CRXA 4O3PA 4DOAA 4ECQA 1N63A 1ZQUA 3IV6A 4J9LA 4WH5A 3QU2A 4X4SA 2FLNA 3SV4A 2RDIA 4U6PA 5AKJA 5J8YA 4ATBA 4ZOHC 4UQGA 2CXYA 4DSEA 1T8EA 4DL6A 4YP3A 5HMLA 8ICIA 2DR8A 1T3QA 1VLBA 2F2AB 4K4GA 1KRPA 4TURA 2PKEA 2K8CB 3UXPA 3SEIA 3ZD8A 1SKWA 3MGIA 4X5VA 8ICQA 1TE2A 1ZQWA 3ETRA 2AGQA 5KFDA 4KITB 2BDUA 1KBUA 1XWLA 1XSNA 2KIWA 3HP6A 1J2NA 4DF8A 1B0XA 1N2XA 2KJ8A 3UQ2A 1BNPA 1Q79A 3RB6A 4UAWA 5HRDA 3H38A 5AI8A 4J9SA 3ZDAA 4DFKA 3OSPA 1MC8A 2B4VA 3C66A 5DG9A 2GAFD 4IS7A 3BQ0A 1SXEA 4YVZA 1X9XA 5KG6A 3WK8A 4JV0A 1OXJA 5H2FU 4KLOA 8ICUA 1UA1A 2HI0A 4ECYA 1RDFA 1ZQFA 1BPDA 1PK1B 1ZQOA 3HJEA 3PHZA 4B9NA 3LWMA 7ICKA 5KFUA 1S5LU 1L7PA 5J0WA 4ECUA 9ICEA 3MC1A 5HNKA 9ICLA 5AKLA 4UATA 2ZH3A 5L1MA 4BXOA 4AT8A 4S3NA 3H8JA 2EZXA 1NJZA 1K5OA 1BPZA 2E5SA 5T14A 1S97A 2ZIXA 1IM4A 1QTMA 3FC4A 5D63A 4Z6CA 3SYZA 4RQMA 3JPRA 3Q8QB 4NLKA 5EE3A 4AT9B 3TADC 1X9WA 5J2EA 5J0OA 1H38A 2JMGA 4US9A 4MKPA 4EYIB 2JH7A 1KKXA 4YR3A 2HBJA 4M6WB 3BQTA 4MEYA 3D2NA 4XQ7A 4F4XA 1DGSA 1SL1A 8ICRA 4M5DA 5BOLA 1EXNA 5AKHA 3PW7A 4PGYA 1JALA 4RU9A 1RXWA 4F5RA 1NJYA 2EZYA 3RAQA 4F92B 5K4LA 3SAGA 4K4HA 4YXMA 5L1LA 1CEZA 3LDAA 2FI1A 1T4GA 5KT4A 2EDUA 4PGQA 3KHGA 5KG5A 4GC6A 2KVCA 3BS7A 5HRGA 4KLLA 2JZBA 7ICFA 1JX4A 2KFZA 3HW8A 4G3IA 1SZPA 1SZHA 5DECA 3RB3A 1U47A 3QU4A 2QKQA 3K7DA 5EWEA 2ZJ5A 5DB6A 4Y2JA 2AGPA 2RRDA 5IIKA 1S76D 1OW5A 7ICNA 1SGGA 2OXOA 3CRXA 4M9GA 3GU3A 3PSPA 4PGXA 3MGHA 2BE3A 2WFAA 4LEVA 2E8PA 4OO1J 4OAHA 5ALGA 4Q8EA 3F5AA 4YFKA 4X4PA 2J6TA 4WJ3B 1Z4NA 5DBCA 4QWDA 4FHXA 4PHDA 3QE9Y 1XS9D 1LB2B 4QZBA 4XJEA 5D62A 3LVVA 2JEJA 9ICNA 2F1IA 3CYMA 1L7MA 2PI5A 2E8MA 5G5GA 3ED5A 3RJJA 3NS1A 3R9KA 4RQ5A 1TFYA 4QZ8A 4X4NA 2PI4A 4GC7A 2DR5A 4WC0A 5AI6A 4UBCA 4DS5A 5FP0A 1GPJA 1T94A 4Q8FA 3A0BU 1N60A 4QZIA 3QEBZ 3I76A 2WAQC 1ZQRA 4KLMA 5KFRA 4YCXA 3NVOA 4OJPA 1SB3C 5AI4A 1NK0A 2BGWA 4XA5A 3WFSC 3E58A 4ED6A 1X6JA 2YQEA 1JMSA 5D49A 2QB1A 2ZHBA 3L5KA 2XCAA 4KM5A 3K1RB 7ICTA 2KN7A 1ZQMA 4ZH4A 1J2MA 1R89A 4J03A 2DRAA 3MFIA 1A77A 4F2RA 4O3QA 2XY6A 3GV5B 4QWAA 3PVXA 2ZIVA 3H8WA 4F5QA 1HUOA 5KT3A 3AQLA 9ICCA 1TV9A 3V7KA 4DFMA 2KJ9A 5J29A 4RQ1A 1V97A 1LKYA 4JUZA 1KL9A 1PK3A 5D61A 3C28A 3A0HU 9ICPA 1WYGA 1NKEA 4FH3A 4JWNA 1DGJA 2M2TA 5AKIA 4Y2XA 2K8AA 4RZRA 4Y2PA 4O6AA 1ZQSA 2FMSA 4OJ6A 4O5KA 1RXVA 2QLTA 3KKAC 4R8UB 4KX5A 2W54A 5J2CA 3HJ4A 3LQCB 3JCFA 5J2IA 2PFNA 5CJ7A 3B0YA 2KZZA 4UD5A 4YMMA 2ZH1A 5CWRA 5ALPA 5JTIA 4O3NA 4P0QA 3C2MA 2OEHA 1CI4A 2MU2A 3PR4A 1UETA 5AKKA 5J2FA 2B56A 3OVAA 1T3NA 8ICLA 5EWFA 4RWOA 3TFSA 2YB1A 4X4QA 3GFKB 1ZQLA 3BZCA 3RTVA 2HHWA 1JROA 5E79U 4X4RA 4RQ3A 2KD1A 2W8KA 1BPEA 3RH4A 1COOA 1SWVA 2DKZA 4DQSA 2W9BA 5KG1A 2ZXHA 4A8EA 2WF5A 3BZKA 4CF4A 9ICGA 4UB4A 1Z3EB 2G06A 2BBJA 4FHWA 4IRDA 3OTQA 2ZUDA 2NRXA 2BPCA 3I1YA 8ICVA 1ZJMA 3WKDA 3PR5B 3SZ2A 4WC3A 2JR5A 2BZFA 2XC9A 3I28A 1SIJA 1B22A 2W3SA 5AM2A 3MFHA 4X4OA 4KN7A 3C18A 5ALWA 5DBBA 4EV6A 1MA7A 1BPBA 4ED3A 5KFNA 1JXLA 3H7IA 3QZ8A 4M2YA 4LZGA 1ZD2P 2QARB 3AU2A 4IQTA 5J0XA 2B51A 1UCVA 2M2WA 2M0NA 4GXIA 2A1JA 5HREA 1ZQVA 3NGDA 4O5EA 3WK7A 3GQCA 2WAQF 4HAIA 4KLSA 3RBDA 5G5HA 2H3FA 2KZ3A 2UVUA 2FLLA 5AIAA 4KLJA 2FLPA 4I2IA 2AGOA 4F4ZA 3KZIU 4LZDA 2C2EA 3HRDD 3MDAA 2DL0A 1TAQA 3M9NB 4E7XA 4QWEA 1NK8A 7ICEA 1O03A 2BQUA 3MR2A 4Z6FA 4ELUA 2KKVA 4OAIZ 4ICAA 3KHLA 2NRVA 4J9PA 1NKBA 2P35A 4RUAA 3V72A 4NKUA 2BCSA 3Q8LA 3K1ZA 1D9DA 3PO4A 4X4UA 3QX7A 2C28A 1OUQA 2RHFA 1ZQXA 3L3FX 3C1ZA 1TVAA 2ZH9A 4O3SA 1L8LA 1ZQKA 2WHEA 1QSYA 2HDOA 2RDJA 2HSZA 4FS2A 4YN4A 2E1FA 3PX0A 5KFWA 3NRZA 3ZDDA 4NXUA 1KSPA 5KFPA 7ICLA 4YMOA 4B9SA 2HOIA 1F5AA 1Z1BA 1FEZA 4M9LA 3H40A 2HHVA 4TUSA 4O9MA 3B0XA 4ACOA 3JPNA 4OJ5A 4EP7A 1U45A 5KG7A 4BXOB 4AT8B 4IQWA 4KMUA 3PMLA 4WCWA 3FAHA 5GTHU 3PW2A 4FBUA 3RJFA 3PW5A 2K60A 2KSOA 3RF9A 4IG8A 4QZ9A 2R8HA 4QW9A 4U7CA 1WWUA 5KG4A 4RWNA 5KFHA 2D3DA 2KJ5A 2FMQA 4WC4A 1N5XA 4PHEA 1ZQJA 3LK9A 4DL3A 2LI6A 5IILA 4QZFA 3HT3A 4Y2VA 2M2VA 3SENA 5JUMA 4UARA 2DR9A 4WC7A 3MR5A 2HN2A 2W9MA 4BWJA 1ZQHA 3U26A 4M47A 4CE6A 5HRFA 1U9LA 1ZOLA 4C4TA 5A0LA 3EPIA 1ZD3A 2EAMA 4P4PA 1NK7A 2ISOA 1D8BA 2G5IB 2AQ0A 4GFJA 5KFJA 3RJEA 1JRPA 4DFJA 3HKZC 4M9HA 2E1EA 2GOLA 5KFYA 2O5AA 4ECZA 1KFSA 4G9BA 2PBEA 2R8JA 3WKAA 1R8BA 1F0MA 4EEBA 2JZBB 3D6JA 2IMWP 4QNLA 5ALDA 5AHXA 3ICXA 4DSIA 4ED2A 1X9MA 2F1JA 4I2FA 3B9JA 3L9DA 5ALFA 5JU5A 4YR0A 1WOTA 9ICFA 4R66A 1BNOA 5J0UA 5J0QA 5AKXA 5HMMA
chains in the Genus database with same CATH topology
4C8MA 1CEZA 4PHAA 2MUTA 4KLHA 2DFLA 3LDAA 1NO5A 4RNMA 5BOMA 5KT5A 3G6VA 2Q0ZX 1VJ7A 4QZCA 3OSNA 1T4GA 1WCLA 5KT4A 2I9GA 4PGQA 3KHGA 5KG5A 5DQHA 2ZTEA 2Y1IA 3ISBA 2KTQA 2HW3A 4GC6A 4DQQA 1R8AA 1KTQA 3M8SA 2BQRA 4KLLA 5HRGA 2ZH8A 4EBEA 4IRKA 2JZBA 5D4BA 7ICFA 4J9KA 1JX4A 2KFZA 3HW8A 3NTUA 4G3IA 2P6UA 3KHRA 1SZPA 4NM2A 5KT2A 1Z00A 5DECA 3OGUA 3RB3A 3ORYA 1U47A 4EBJA 4YMNA 2PFOA 1HJPA 3FYHA 2FPKA 3V7JA 2BR0A 5EWEA 3WFRE 1BPYA 4YD1A 1C7YA 2ZJ5A 2ASLA 5DB6A 1ZQBA 3LWLA 2AGPA 1MQ2A 4LVSA 4I28A 1TAUA 9ICUA 5KFGA 5IIKA 1K1SA 2V9WA 4E0DA 1S76D 2HVIA 1XSLA 4LT6A 2ASDA 4RQ6A 1FA0A 3GIIA 7ICNA 3RR8A 4YG2A 2OWOA 4C8LA 4IR9A 4AT7B 4RPZA 4NY8A 5HC9A 4M9GA 1RYRA 7ICJA 4DOBA 5HRBA 1AROP 5J0YA 4PGXA 3Q8MA 5F2VO 3MGHA 2BE3A 5J2HA 1KNYA 4Q8EA 5EWGA 4NXZA 4YFKA 4Q45A 4PH5A 1BVSA 2WTFA 3BQ2A 9ICMA 1MIWA 2IBKA 4X4PA 2JEFA 2J6TA 2BPGA 2ZJAA 1UT8A 4C8NA 3ZDCA 5DBCA 4QWDA 1SL2A 1X9SA 4FHXA 1L3TA 1U4BA 4GLXA 1ZQNA 5TZVA 4PHDA 4DLGA 3QE9Y 4DQIA 3AU6A 3AUOA 2RFFA 1XS9D 1PZNA 1LB2B 4FH5A 3C1YA 1NZPA 2V4RA 4R8UA 4QZBA 5DG7A 3H4DA 2JEJA 9ICNA 1XC9A 8ICHA 3T5JA 1KFDA 2F1IA 3Q8SB 3TAPA 8ICAA 2PI5A 4M9JA 4X4VA 2FPLA 4RQ0A 1QSLA 2UVVA 4B9MA 1K1QA 3RJJA 5HRKA 4I2JA 2HHPA 2XGQA 4F8RA 2O1PA 1NK5A 4QWCA 5CR0A 4RQ5A 1T7PA 3TARA 3HIYA 5KFZA 1TFYA 7ICPA 4ED1A 2XY7A 2ZH2A 4QZ8A 4O0IA 2PI4A 4X4NA 4JV1A 4GC7A 2DR5A 1WCNA 4MF8A 4RT2A 3C5FA 3V6JA 4WC0A 2UVWA 4UBCA 4DS5A 8ICSA 3AQMA 2ZH7A 1ZQYA 3KTQA 4KLQA 4Q8FA 5KFQA 1VFGA 4QZIA 3QEBZ 4DS4A 9ICAA 9ICJA 5BPCA 5KG2A 2ZJ8A 4JWMA 4IQUA 4FHVA 3EPGA 3PMNA 1ZQRA 4FBTA 3WFOA 3K4GA 4YR2A 4DQRA 4PPXA 4KLMA 9ICWA 4XUSA 4EEYA 3HWTA 5KFRA 4YCXA 4UAZA 7ICMA 2JEIA 4RPXA 1NK0A 2AJQA 2BGWA 2DPJA 4XA5A 8ICBA 8ICYA 8ICJA 2NRTA 3WFSC 1D8YA 3T5LA 4I2CA 1XO1A 4ED6A 4M0AA 2LYHA 3TANA 2C2DA 3TI0A 1JMSA 5D49A 5DQGA 7ICUA 3RJIA 2ZHBA 2MAXA 2DVIA 2XCAA 3RH6A 3ETLA 1YLQA 2FPMA 1TKDA 3KHHA 3OUYA 5J2GA 1U48A 5DB8A 7ICTA 2NRKA 2KN7A 3G6YA 4ECRA 1ZQMA 4QW8A 1Z00B 3BDPA 7ICIA 4ZH4A 5DLFA 9ICSA 1DOQA 5HHIA 2KP7A 4DL5A 1R89A 2ZTDA 4DOCA 2DRAA 1ZQZA 3MFIA 1A77A 3T3FA 4F2RA 4O3QA 4ECVA 2XY6A 4Z6DA 5CP2A 4DL7A 5J2KA 3GV5B 4QWAA 3PVXA 9ICHA 4RQ8A 2BPFA 3AQNA 2XCPA 1MIYA 1PX5A 3H8WA 3OJSA 4F5QA 1HUOA 3H37A 5KT3A 3AQLA 5C5JA 2PXIA 4DL4A 9ICCA 4O3RA 3ZDEA 1TV9A 9ICXA 3V7KA 4DFMA 3PX4A 5HR9A 5KFOA 5J29A 4RQ1A 4KLIA 4JUZA 4R65A 4UD4A 3ISDA 3V7LA 4RUCA 2W9CA 3RR7A 1D9FA 3JPOA 5DEDA 4F93B 5KFAA 4RPYA 4R63A 4J9NA 1V4AA 5KFLA 3HJ1A 5KFIA 9ICPA 4FHYA 3OVBA 2ZUBA 1NKEA 4QZEA 4FH3A 5IIMA 4JWNA 3IM1A 4ECXA 5KFMA 2M2TA 5DQIA 5IIOA 5IINA 4MF2A 1U49A 4F4WA 3N4MB 4RZRA 4M9NA 1ZETA 2VANA 3QZ7A 2HHQA 5HRHA 1ZQSA 2FMSA 2HHSA 5KT6A 4JK1A 4O5KA 4P2HA 2M9NA 1RXVA 1BPXA 3C23A 4O5CA 4R8UB 3RRGA 1UEUA 4DL2A 2C2RA 4F2SA 4O3OA 4ELVA 9ICKA 5HRLA 4ED8A 3JPQA 9ICOA 3N97B 5KG3A 5J2CA 4UB2A 2V4QA 4RNNA 3RJGA 5KT7A 4B9VA 5J2IA 5F9NA 2PFNA 8ICEA 3LQCB 3H39A 1OU5A 3GIJA 5CJ7A 1R8CA 3B0YA 3IHQB 2B21A 5KFBA 3JYYA 8ICMA 2KZZA 4KTQA 4KN4A 1BGXT 4YMMA 4UD5A 2ZH1A 4GXJA 4EBCA 3G6XA 4ECTA 5CWRA 4I2AA 2PFQA 5J2BA 4O3NA 4IR1A 4E8FA 3OV7A 3C2MA 8ICGA 4TUQA 4ECWA 4RWQA 4NM1A 5KFFA 1S0VA 4XQ8A 3RJHA 2AU0A 5KFXA 3SI8A 1UA0A 2DPIA 8ICKA 2F1HA 3PR4A 3MR6A 1UETA 2W8LA 5KFTA 3BJYA 4KLGA 9ICBA 1JN3A 2M2UA 5J2FA 3M9MB 2BCUA 4KLEA 3HX0A 5L1JA 3OVAA 1T3NA 8ICLA 2XO7A 5EWFA 1KDHA 4RWOA 3TFSA 3V6KA 4DQPA 3OHAA 9ICIA 2BQ3A 4NLZA 4X4QA 3GFKB 1NK6A 1ZQLA 5DBAA 5DDYA 4I2GA 3RTVA 4RQ2A 2HHWA 4X4RA 4RQ3A 5L9XA 2W8KA 1BPEA 5DG8A 3TFRA 3RH4A 1COOA 3TQ1A 8ICWA 7ICSA 2ZUCA 3C21A 4DF4A 1L3UA 5DGAA 3K75D 3AQKA 2A1JB 2JEGA 4DQSA 2W9BA 5KG1A 4QZAA 1TK8A 4X0BA 2ZH4A 4Q43A 1X2IA 9ICGA 4UB4A 3OUYB 1CUKA 4I29A 1Z3EB 2VA8A 1ZQAA 4J9MA 3H3AA 4IRDA 4FHWA 4WC2A 4DEZA 2ZUDA 2NRXA 2BPCA 2FMPA 5DGBA 1ZJMA 2BCVA 3SZ2A 3PR5B 4EZ9A 2HHTA 2KFNA 4WC3A 2ZH5A 3C2KA 3Q8KA 4WC5A 1QSSA 9ICTA 2BHNA 3WFQE 2XC9A 4RNOA 4EBDA 1S0MA 4I2EA 5J0PA 3PV8A 1B22A 2XY5A 7ICQA 4WBYA 1JXEA 3MFHA 4X4OA 4KN7A 1NK9A 3GIKA 4TQRA 2AQ4A 5DBBA 3C18A 4EYHB 1L3SA 3EYZA 1N56A 2GWSA 2BKEA 2ISPA 4F5NA 1TK0A 1BPBA 4ED3A 2NRWA 5KFNA 3PW0A 4IRCA 2ZHAA 1JXLA 4KLTA 4DSJA 3H7IA 3MABA 3QZ8A 4M2YA 4LZGA 1DK3A 4B9UA 3GV7B 1KFTA 2ZTCA 5CA7A 3AU2A 4I2DA 5DDMA 4IQTA 5J0XA 2M2WA 1ZQCA 4GXIA 2BCRA 2A1JA 4NKTA 1ZQEA 3PX6A 5HREA 1ZQVA 5KFSA 3NGDA 3JPSA 4O5EA 4WC1A 2NRZA 2W9CB 3GQCA 3GDXA 3UQ0A 4DO9A 4KLSA 3RBDA 8ICCA 4WBZA 3UXOA 3UXNA 8ICNA 4UBBA 1N48A 4QZHA 1SL0A 2KZ3A 5IIJA 2P66A 4UB3A 2UVUA 2FLLA 2J6UA 3QEAZ 1KEJA 3HJ4A 4X4TA 5CB1A 4KLJA 4XRHA 1V9PA 4YD2A 5DB9A 1ZQTA 2FLPA 3Q8RB 3MBYA 4J9QA 4I2IA 1S9FA 1L5UA 2AGOA 4F4ZA 1QLNA 1UEVA 4LZDA 5DLGA 2C2EA 3MDAA 4F50A 8ICZA 5KTQA 1KLNA 3ISCA 4DLEA 4K4IA 3HPOA 3RAXA 3NYBA 1TAQA 2VA3A 3T5KA 3M9NB 5J0TA 3THVA 4KLDA 4QWEA 1NK8A 4ECSA 7ICEA 4E7XA 4TQSA 3PY8A 5EOZA 3H4BA 5L1IA 5HRIA 5J0RA 3RH5A 2BQUA 1JQRA 4MEXA 3MR2A 3TAQA 1S77D 4F5OA 7ICHA 4Z6FA 3V6HA 1XSPA 3EWAA 4BDPA 3EW9A 1NKCA 2R8KA 2Y1JA 4TUPA 2W9AA 4ELUA 3OJUA 3M8RA 3KHLA 2ASJA 2NRVA 4O3PA 4DOAA 4ECQA 4J9PA 1ZQUA 4KLFA 4J9LA 1NKBA 1DK2A 4ED0A 2IA6A 4X4SA 4RUAA 3V72A 1ZQPA 4NKUA 4FHPA 2BCSA 3Q8LA 2FLNA 1D9DA 8ICVA 3PO4A 3SV4A 7ICRA 2RDIA 4X4UA 4AT9A 1SKSA 4BWMA 3GILA 4Z6EA 4FS1A 2C28A 4ATBA 4UQGA 4NLGA 1ZQXA 1S0OA 3OHBA 4DSEA 8ICFA 1TFRA 3C1ZA 1TVAA 2R8GA 1T8EA 4DL6A 2ZH9A 3ZDBA 4YP3A 4CCHA 4O3SA 3PO5A 5HMLA 1ZQKA 8ICXA 8ICIA 3WFPA 2DR8A 4P4MA 5HP4A 1RYSA 1S10A 1QSYA 3MDCA 7ICVA 4M6WA 4PHPA 1MQ3A 3UPSA 4K4GA 2RDJA 1KRPA 3T5HA 4TURA 4GXKA 4IQVA 4FS2A 3RBEA 4YN4A 9ICVA 4NLNA 3UXPA 1MIVA 3ZD8A 4ED7A 4YQWA 2W9BB 1SKWA 3PX0A 5KFWA 3MGIA 4X5VA 1ZYQA 4EZ6A 8ICQA 3ZDDA 1ZQWA 1B43A 5J2JA 1SKRA 3GIMA 4YXJA 2AGQA 1KSPA 5KFDA 2C22A 4KITB 5KFPA 5KFEA 1L3VA 7ICLA 1NOMA 4MFCA 4YMOA 1XWLA 5DKWA 3C5GA 3H8SA 1XSNA 3HP6A 3FDSA 5IIIA 4B9SA 1XU4A 3ZD9A 4UB5A 4DF8A 1F5AA 4M9LA 2KZMA 3H40A 4C8KA 3C2LA 3UQ2A 2HHVA 1BNPA 1Q79A 4TUSA 3RB6A 4O9MA 2Q66A 4UAWA 3B0XA 4R64A 3PNCA 5HRDA 3JPNA 5CHGA 3H38A 4HYKA 4EP7A 4BGDA 1U45A 5KG7A 4BXOB 4J9SA 3ZDAA 3UPQA 2HHXA 4DFKA 3OSPA 4AT8B 4IQWA 4KMUA 1NJWA 3PMLA 1MC8A 4B9TA 4WCWA 1ZQGA 3PW2A 2P6RA 3C66A 7ICGA 5DG9A 1RZTA 2BCQA 8ICTA 4F5PA 4QZDA 3JPTA 3M9OB 3BQ0A 4FBUA 3RJFA 1Q78A 4RT3A 4YVZA 3PW5A 1ZQIA 4RQ7A 4F3OA 4X0AA 4J9OA 5KG6A 4IG8A 3BQ1A 2BDPA 4QZ9A 4JV0A 2R8HA 5HHHA 7ICOA 2HHUA 4KLOA 4QW9A 2IHMA 4WC6A 1ZJNA 5J2AA 8ICUA 4EBKA 3JZ0A 1UA1A 4ECYA 2PFPA 3OVSA 1ZQFA 1BPDA 5KG4A 1ZQOA 4RWNA 4DWIA 5KFHA 4E80A 4B9NA 5J2DA 4C8OA 3RRHA 4MFFA 3LWMA 4FO6A 4UAYA 1S0NA 2FMQA 7ICKA 4WC4A 2ZH6A 5KFUA 4B9LA 1JAJA 4PHEA 1ZQJA 4I2HA 4AT7A 1RPLA 5J0WA 4ECUA 3LK9A 5HNKA 4DL3A 1LV5A 5IILA 3E2EA 1ZQDA 9ICEA 9ICLA 2ZH3A 4QWBA 4BXOA 4QZFA 3HT3A 4F4KA 4AT8A 4S3NA 2M2VA 5JUMA 3H8JA 4RWPA 4P4OA 1NJZA 4WC7A 2DR9A 2I1QA 5KFVA 3GV8B 2ALZA 1BPZA 4F91B 3Q8PB 3MR5A 1TFWA 5L1KA 2W9MA 4BWJA 3RB4A 1JIHA 1NK4A 1ZQHA 3RJKA 2ID1A 4I27A 1S97A 2UVRA 4ELTA 1TK5A 1IM4A 1HUZA 4M47A 1QTMA 4JV2A 5HRFA 3RB0A 1U9LA 2IHNA 4Z6CA 5KG0A 3MR3A 3SYZA 3EPIA 4P4PA 5D46A 2H5XA 3JPRA 1A76A 1NK7A 3Q8QB 1UT5A 2ISOA 2AQ0A 4DSKA 5KFJA 3RJEA 4NLKA 2HVHA 4AT9B 4DSFA 4DFJA 8ICPA 1X9WA 4QZGA 5J2EA 5J0OA 1Y88A 1H38A 4M9HA 4J9RA 1ZQQA 2MUTB 5KFYA 4ATBB 2XGPA 2O5AA 5KFCA 4ECZA 1KFSA 5F9LA 4Q44A 2PBEA 4DFPA 1NJXA 2R8JA 4EYIB 2DR7A 9ICRA 1R8BA 8ICOA 9ICQA 2VA2A 4YR3A 2J6SA 4KLUA 2ATLA 4I2BA 4M6WB 2JZBB 3BQTA 3JPPA 4MEYA 2IMWP 5KFKA 4UB1A 4DSIA 3PW4A 4XQ7A 2DRBA 1D8LA 4ED2A 4F4XA 1IXRA 2F1JA 5J0SA 2R8IA 1X9MA 1DGSA 1SL1A 4I2FA 4M04A 8ICRA 3L9DA 4YR0A 4M5DA 5BOLA 1WOTA 1EXNA 9ICFA 3PW7A 4PGYA 4R66A 4F4YA 4RU9A 4RQ4A 3SV3A 4MFAA 1RXWA 5J0UA 4F5RA 1MSWD 1BNOA 5DB7A 5J0QA 3EZ5A 1NJYA 3RAQA 5HMMA 4F92B 4K4HA 4YXMA 4DSLA 5L1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8M A;  1CEZ A;  4PHA A;  2MUT A;  4KLH A;  2DFL A;  3LDA A;  1NO5 A;  4RNM A;  5BOM A;  5KT5 A;  3G6V A;  2Q0Z X;  1VJ7 A;  4QZC A;  3OSN A;  1T4G A;  1WCL A;  5KT4 A;  2I9G A;  4PGQ A;  3KHG A;  5KG5 A;  5DQH A;  2ZTE A;  2Y1I A;  3ISB A;  2KTQ A;  2HW3 A;  4GC6 A;  4DQQ A;  1R8A A;  1KTQ A;  3M8S A;  2BQR A;  4KLL A;  5HRG A;  2ZH8 A;  4EBE A;  4IRK A;  2JZB A;  5D4B A;  7ICF A;  4J9K A;  1JX4 A;  2KFZ A;  3HW8 A;  3NTU A;  4G3I A;  2P6U A;  3KHR A;  1SZP A;  4NM2 A;  5KT2 A;  1Z00 A;  5DEC A;  3OGU A;  3RB3 A;  3ORY A;  1U47 A;  4EBJ A;  4YMN A;  2PFO A;  1HJP A;  3FYH A;  2FPK A;  3V7J A;  2BR0 A;  5EWE A;  3WFR E;  1BPY A;  4YD1 A;  1C7Y A;  2ZJ5 A;  2ASL A;  5DB6 A;  1ZQB A;  3LWL A;  2AGP A;  1MQ2 A;  4LVS A;  4I28 A;  1TAU A;  9ICU A;  5KFG A;  5IIK A;  1K1S A;  2V9W A;  4E0D A;  1S76 D;  2HVI A;  1XSL A;  4LT6 A;  2ASD A;  4RQ6 A;  1FA0 A;  3GII A;  7ICN A;  3RR8 A;  4YG2 A;  2OWO A;  4C8L A;  4IR9 A;  4AT7 B;  4RPZ A;  4NY8 A;  5HC9 A;  4M9G A;  1RYR A;  7ICJ A;  4DOB A;  5HRB A;  1ARO P;  5J0Y A;  4PGX A;  3Q8M A;  5F2V O;  3MGH A;  2BE3 A;  5J2H A;  1KNY A;  4Q8E A;  5EWG A;  4NXZ A;  4YFK A;  4Q45 A;  4PH5 A;  1BVS A;  2WTF A;  3BQ2 A;  9ICM A;  1MIW A;  2IBK A;  4X4P A;  2JEF A;  2J6T A;  2BPG A;  2ZJA A;  1UT8 A;  4C8N A;  3ZDC A;  5DBC A;  4QWD A;  1SL2 A;  1X9S A;  4FHX A;  1L3T A;  1U4B A;  4GLX A;  1ZQN A;  5TZV A;  4PHD A;  4DLG A;  3QE9 Y;  4DQI A;  3AU6 A;  3AUO A;  2RFF A;  1XS9 D;  1PZN A;  1LB2 B;  4FH5 A;  3C1Y A;  1NZP A;  2V4R A;  4R8U A;  4QZB A;  5DG7 A;  3H4D A;  2JEJ A;  9ICN A;  1XC9 A;  8ICH A;  3T5J A;  1KFD A;  2F1I A;  3Q8S B;  3TAP A;  8ICA A;  2PI5 A;  4M9J A;  4X4V A;  2FPL A;  4RQ0 A;  1QSL A;  2UVV A;  4B9M A;  1K1Q A;  3RJJ A;  5HRK A;  4I2J A;  2HHP A;  2XGQ A;  4F8R A;  2O1P A;  1NK5 A;  4QWC A;  5CR0 A;  4RQ5 A;  1T7P A;  3TAR A;  3HIY A;  5KFZ A;  1TFY A;  7ICP A;  4ED1 A;  2XY7 A;  2ZH2 A;  4QZ8 A;  4O0I A;  2PI4 A;  4X4N A;  4JV1 A;  4GC7 A;  2DR5 A;  1WCN A;  4MF8 A;  4RT2 A;  3C5F A;  3V6J A;  4WC0 A;  2UVW A;  4UBC A;  4DS5 A;  8ICS A;  3AQM A;  2ZH7 A;  1ZQY A;  3KTQ A;  4KLQ A;  4Q8F A;  5KFQ A;  1VFG A;  4QZI A;  3QEB Z;  4DS4 A;  9ICA A;  9ICJ A;  5BPC A;  5KG2 A;  2ZJ8 A;  4JWM A;  4IQU A;  4FHV A;  3EPG A;  3PMN A;  1ZQR A;  4FBT A;  3WFO A;  3K4G A;  4YR2 A;  4DQR A;  4PPX A;  4KLM A;  9ICW A;  4XUS A;  4EEY A;  3HWT A;  5KFR A;  4YCX A;  4UAZ A;  7ICM A;  2JEI A;  4RPX A;  1NK0 A;  2AJQ A;  2BGW A;  2DPJ A;  4XA5 A;  8ICB A;  8ICY A;  8ICJ A;  2NRT A;  3WFS C;  1D8Y A;  3T5L A;  4I2C A;  1XO1 A;  4ED6 A;  4M0A A;  2LYH A;  3TAN A;  2C2D A;  3TI0 A;  1JMS A;  5D49 A;  5DQG A;  7ICU A;  3RJI A;  2ZHB A;  2MAX A;  2DVI A;  2XCA A;  3RH6 A;  3ETL A;  1YLQ A;  2FPM A;  1TKD A;  3KHH A;  3OUY A;  5J2G A;  1U48 A;  5DB8 A;  7ICT A;  2NRK A;  2KN7 A;  3G6Y A;  4ECR A;  1ZQM A;  4QW8 A;  1Z00 B;  3BDP A;  7ICI A;  4ZH4 A;  5DLF A;  9ICS A;  1DOQ A;  5HHI A;  2KP7 A;  4DL5 A;  1R89 A;  2ZTD A;  4DOC A;  2DRA A;  1ZQZ A;  3MFI A;  1A77 A;  3T3F A;  4F2R A;  4O3Q A;  4ECV A;  2XY6 A;  4Z6D A;  5CP2 A;  4DL7 A;  5J2K A;  3GV5 B;  4QWA A;  3PVX A;  9ICH A;  4RQ8 A;  2BPF A;  3AQN A;  2XCP A;  1MIY A;  1PX5 A;  3H8W A;  3OJS A;  4F5Q A;  1HUO A;  3H37 A;  5KT3 A;  3AQL A;  5C5J A;  2PXI A;  4DL4 A;  9ICC A;  4O3R A;  3ZDE A;  1TV9 A;  9ICX A;  3V7K A;  4DFM A;  3PX4 A;  5HR9 A;  5KFO A;  5J29 A;  4RQ1 A;  4KLI A;  4JUZ A;  4R65 A;  4UD4 A;  3ISD A;  3V7L A;  4RUC A;  2W9C A;  3RR7 A;  1D9F A;  3JPO A;  5DED A;  4F93 B;  5KFA A;  4RPY A;  4R63 A;  4J9N A;  1V4A A;  5KFL A;  3HJ1 A;  5KFI A;  9ICP A;  4FHY A;  3OVB A;  2ZUB A;  1NKE A;  4QZE A;  4FH3 A;  5IIM A;  4JWN A;  3IM1 A;  4ECX A;  5KFM A;  2M2T A;  5DQI A;  5IIO A;  5IIN A;  4MF2 A;  1U49 A;  4F4W A;  3N4M B;  4RZR A;  4M9N A;  1ZET A;  2VAN A;  3QZ7 A;  2HHQ A;  5HRH A;  1ZQS A;  2FMS A;  2HHS A;  5KT6 A;  4JK1 A;  4O5K A;  4P2H A;  2M9N A;  1RXV A;  1BPX A;  3C23 A;  4O5C A;  4R8U B;  3RRG A;  1UEU A;  4DL2 A;  2C2R A;  4F2S A;  4O3O A;  4ELV A;  9ICK A;  5HRL A;  4ED8 A;  3JPQ A;  9ICO A;  3N97 B;  5KG3 A;  5J2C A;  4UB2 A;  2V4Q A;  4RNN A;  3RJG A;  5KT7 A;  4B9V A;  5J2I A;  5F9N A;  2PFN A;  8ICE A;  3LQC B;  3H39 A;  1OU5 A;  3GIJ A;  5CJ7 A;  1R8C A;  3B0Y A;  3IHQ B;  2B21 A;  5KFB A;  3JYY A;  8ICM A;  2KZZ A;  4KTQ A;  4KN4 A;  1BGX T;  4YMM A;  4UD5 A;  2ZH1 A;  4GXJ A;  4EBC A;  3G6X A;  4ECT A;  5CWR A;  4I2A A;  2PFQ A;  5J2B A;  4O3N A;  4IR1 A;  4E8F A;  3OV7 A;  3C2M A;  8ICG A;  4TUQ A;  4ECW A;  4RWQ A;  4NM1 A;  5KFF A;  1S0V A;  4XQ8 A;  3RJH A;  2AU0 A;  5KFX A;  3SI8 A;  1UA0 A;  2DPI A;  8ICK A;  2F1H A;  3PR4 A;  3MR6 A;  1UET A;  2W8L A;  5KFT A;  3BJY A;  4KLG A;  9ICB A;  1JN3 A;  2M2U A;  5J2F A;  3M9M B;  2BCU A;  4KLE A;  3HX0 A;  5L1J A;  3OVA A;  1T3N A;  8ICL A;  2XO7 A;  5EWF A;  1KDH A;  4RWO A;  3TFS A;  3V6K A;  4DQP A;  3OHA A;  9ICI A;  2BQ3 A;  4NLZ A;  4X4Q A;  3GFK B;  1NK6 A;  1ZQL A;  5DBA A;  5DDY A;  4I2G A;  3RTV A;  4RQ2 A;  2HHW A;  4X4R A;  4RQ3 A;  5L9X A;  2W8K A;  1BPE A;  5DG8 A;  3TFR A;  3RH4 A;  1COO A;  3TQ1 A;  8ICW A;  7ICS A;  2ZUC A;  3C21 A;  4DF4 A;  1L3U A;  5DGA A;  3K75 D;  3AQK A;  2A1J B;  2JEG A;  4DQS A;  2W9B A;  5KG1 A;  4QZA A;  1TK8 A;  4X0B A;  2ZH4 A;  4Q43 A;  1X2I A;  9ICG A;  4UB4 A;  3OUY B;  1CUK A;  4I29 A;  1Z3E B;  2VA8 A;  1ZQA A;  4J9M A;  3H3A A;  4IRD A;  4FHW A;  4WC2 A;  4DEZ A;  2ZUD A;  2NRX A;  2BPC A;  2FMP A;  5DGB A;  1ZJM A;  2BCV A;  3SZ2 A;  3PR5 B;  4EZ9 A;  2HHT A;  2KFN A;  4WC3 A;  2ZH5 A;  3C2K A;  3Q8K A;  4WC5 A;  1QSS A;  9ICT A;  2BHN A;  3WFQ E;  2XC9 A;  4RNO A;  4EBD A;  1S0M A;  4I2E A;  5J0P A;  3PV8 A;  1B22 A;  2XY5 A;  7ICQ A;  4WBY A;  1JXE A;  3MFH A;  4X4O A;  4KN7 A;  1NK9 A;  3GIK A;  4TQR A;  2AQ4 A;  5DBB A;  3C18 A;  4EYH B;  1L3S A;  3EYZ A;  1N56 A;  2GWS A;  2BKE A;  2ISP A;  4F5N A;  1TK0 A;  1BPB A;  4ED3 A;  2NRW A;  5KFN A;  3PW0 A;  4IRC A;  2ZHA A;  1JXL A;  4KLT A;  4DSJ A;  3H7I A;  3MAB A;  3QZ8 A;  4M2Y A;  4LZG A;  1DK3 A;  4B9U A;  3GV7 B;  1KFT A;  2ZTC A;  5CA7 A;  3AU2 A;  4I2D A;  5DDM A;  4IQT A;  5J0X A;  2M2W A;  1ZQC A;  4GXI A;  2BCR A;  2A1J A;  4NKT A;  1ZQE A;  3PX6 A;  5HRE A;  1ZQV A;  5KFS A;  3NGD A;  3JPS A;  4O5E A;  4WC1 A;  2NRZ A;  2W9C B;  3GQC A;  3GDX A;  3UQ0 A;  4DO9 A;  4KLS A;  3RBD A;  8ICC A;  4WBZ A;  3UXO A;  3UXN A;  8ICN A;  4UBB A;  1N48 A;  4QZH A;  1SL0 A;  2KZ3 A;  5IIJ A;  2P66 A;  4UB3 A;  2UVU A;  2FLL A;  2J6U A;  3QEA Z;  1KEJ A;  3HJ4 A;  4X4T A;  5CB1 A;  4KLJ A;  4XRH A;  1V9P A;  4YD2 A;  5DB9 A;  1ZQT A;  2FLP A;  3Q8R B;  3MBY A;  4J9Q A;  4I2I A;  1S9F A;  1L5U A;  2AGO A;  4F4Z A;  1QLN A;  1UEV A;  4LZD A;  5DLG A;  2C2E A;  3MDA A;  4F50 A;  8ICZ A;  5KTQ A;  1KLN A;  3ISC A;  4DLE A;  4K4I A;  3HPO A;  3RAX A;  3NYB A;  1TAQ A;  2VA3 A;  3T5K A;  3M9N B;  5J0T A;  3THV A;  4KLD A;  4QWE A;  1NK8 A;  4ECS A;  7ICE A;  4E7X A;  4TQS A;  3PY8 A;  5EOZ A;  3H4B A;  5L1I A;  5HRI A;  5J0R A;  3RH5 A;  2BQU A;  1JQR A;  4MEX A;  3MR2 A;  3TAQ A;  1S77 D;  4F5O A;  7ICH A;  4Z6F A;  3V6H A;  1XSP A;  3EWA A;  4BDP A;  3EW9 A;  1NKC A;  2R8K A;  2Y1J A;  4TUP A;  2W9A A;  4ELU A;  3OJU A;  3M8R A;  3KHL A;  2ASJ A;  2NRV A;  4O3P A;  4DOA A;  4ECQ A;  4J9P A;  1ZQU A;  4KLF A;  4J9L A;  1NKB A;  1DK2 A;  4ED0 A;  2IA6 A;  4X4S A;  4RUA A;  3V72 A;  1ZQP A;  4NKU A;  4FHP A;  2BCS A;  3Q8L A;  2FLN A;  1D9D A;  8ICV A;  3PO4 A;  3SV4 A;  7ICR A;  2RDI A;  4X4U A;  4AT9 A;  1SKS A;  4BWM A;  3GIL A;  4Z6E A;  4FS1 A;  2C28 A;  4ATB A;  4UQG A;  4NLG A;  1ZQX A;  1S0O A;  3OHB A;  4DSE A;  8ICF A;  1TFR A;  3C1Z A;  1TVA A;  2R8G A;  1T8E A;  4DL6 A;  2ZH9 A;  3ZDB A;  4YP3 A;  4CCH A;  4O3S A;  3PO5 A;  5HML A;  1ZQK A;  8ICX A;  8ICI A;  3WFP A;  2DR8 A;  4P4M A;  5HP4 A;  1RYS A;  1S10 A;  1QSY A;  3MDC A;  7ICV A;  4M6W A;  4PHP A;  1MQ3 A;  3UPS A;  4K4G A;  2RDJ A;  1KRP A;  3T5H A;  4TUR A;  4GXK A;  4IQV A;  4FS2 A;  3RBE A;  4YN4 A;  9ICV A;  4NLN A;  3UXP A;  1MIV A;  3ZD8 A;  4ED7 A;  4YQW A;  2W9B B;  1SKW A;  3PX0 A;  5KFW A;  3MGI A;  4X5V A;  1ZYQ A;  4EZ6 A;  8ICQ A;  3ZDD A;  1ZQW A;  1B43 A;  5J2J A;  1SKR A;  3GIM A;  4YXJ A;  2AGQ A;  1KSP A;  5KFD A;  2C22 A;  4KIT B;  5KFP A;  5KFE A;  1L3V A;  7ICL A;  1NOM A;  4MFC A;  4YMO A;  1XWL A;  5DKW A;  3C5G A;  3H8S A;  1XSN A;  3HP6 A;  3FDS A;  5III A;  4B9S A;  1XU4 A;  3ZD9 A;  4UB5 A;  4DF8 A;  1F5A A;  4M9L A;  2KZM A;  3H40 A;  4C8K A;  3C2L A;  3UQ2 A;  2HHV A;  1BNP A;  1Q79 A;  4TUS A;  3RB6 A;  4O9M A;  2Q66 A;  4UAW A;  3B0X A;  4R64 A;  3PNC A;  5HRD A;  3JPN A;  5CHG A;  3H38 A;  4HYK A;  4EP7 A;  4BGD A;  1U45 A;  5KG7 A;  4BXO B;  4J9S A;  3ZDA A;  3UPQ A;  2HHX A;  4DFK A;  3OSP A;  4AT8 B;  4IQW A;  4KMU A;  1NJW A;  3PML A;  1MC8 A;  4B9T A;  4WCW A;  1ZQG A;  3PW2 A;  2P6R A;  3C66 A;  7ICG A;  5DG9 A;  1RZT A;  2BCQ A;  8ICT A;  4F5P A;  4QZD A;  3JPT A;  3M9O B;  3BQ0 A;  4FBU A;  3RJF A;  1Q78 A;  4RT3 A;  4YVZ A;  3PW5 A;  1ZQI A;  4RQ7 A;  4F3O A;  4X0A A;  4J9O A;  5KG6 A;  4IG8 A;  3BQ1 A;  2BDP A;  4QZ9 A;  4JV0 A;  2R8H A;  5HHH A;  7ICO A;  2HHU A;  4KLO A;  4QW9 A;  2IHM A;  4WC6 A;  1ZJN A;  5J2A A;  8ICU A;  4EBK A;  3JZ0 A;  1UA1 A;  4ECY A;  2PFP A;  3OVS A;  1ZQF A;  1BPD A;  5KG4 A;  1ZQO A;  4RWN A;  4DWI A;  5KFH A;  4E80 A;  4B9N A;  5J2D A;  4C8O A;  3RRH A;  4MFF A;  3LWM A;  4FO6 A;  4UAY A;  1S0N A;  2FMQ A;  7ICK A;  4WC4 A;  2ZH6 A;  5KFU A;  4B9L A;  1JAJ A;  4PHE A;  1ZQJ A;  4I2H A;  4AT7 A;  1RPL A;  5J0W A;  4ECU A;  3LK9 A;  5HNK A;  4DL3 A;  1LV5 A;  5IIL A;  3E2E A;  1ZQD A;  9ICE A;  9ICL A;  2ZH3 A;  4QWB A;  4BXO A;  4QZF A;  3HT3 A;  4F4K A;  4AT8 A;  4S3N A;  2M2V A;  5JUM A;  3H8J A;  4RWP A;  4P4O A;  1NJZ A;  4WC7 A;  2DR9 A;  2I1Q A;  5KFV A;  3GV8 B;  2ALZ A;  1BPZ A;  4F91 B;  3Q8P B;  3MR5 A;  1TFW A;  5L1K A;  2W9M A;  4BWJ A;  3RB4 A;  1JIH A;  1NK4 A;  1ZQH A;  3RJK A;  2ID1 A;  4I27 A;  1S97 A;  2UVR A;  4ELT A;  1TK5 A;  1IM4 A;  1HUZ A;  4M47 A;  1QTM A;  4JV2 A;  5HRF A;  3RB0 A;  1U9L A;  2IHN A;  4Z6C A;  5KG0 A;  3MR3 A;  3SYZ A;  3EPI A;  4P4P A;  5D46 A;  2H5X A;  3JPR A;  1A76 A;  1NK7 A;  3Q8Q B;  1UT5 A;  2ISO A;  2AQ0 A;  4DSK A;  5KFJ A;  3RJE A;  4NLK A;  2HVH A;  4AT9 B;  4DSF A;  4DFJ A;  8ICP A;  1X9W A;  4QZG A;  5J2E A;  5J0O A;  1Y88 A;  1H38 A;  4M9H A;  4J9R A;  1ZQQ A;  2MUT B;  5KFY A;  4ATB B;  2XGP A;  2O5A A;  5KFC A;  4ECZ A;  1KFS A;  5F9L A;  4Q44 A;  2PBE A;  4DFP A;  1NJX A;  2R8J A;  4EYI B;  2DR7 A;  9ICR A;  1R8B A;  8ICO A;  9ICQ A;  2VA2 A;  4YR3 A;  2J6S A;  4KLU A;  2ATL A;  4I2B A;  4M6W B;  2JZB B;  3BQT A;  3JPP A;  4MEY A;  2IMW P;  5KFK A;  4UB1 A;  4DSI A;  3PW4 A;  4XQ7 A;  2DRB A;  1D8L A;  4ED2 A;  4F4X A;  1IXR A;  2F1J A;  5J0S A;  2R8I A;  1X9M A;  1DGS A;  1SL1 A;  4I2F A;  4M04 A;  8ICR A;  3L9D A;  4YR0 A;  4M5D A;  5BOL A;  1WOT A;  1EXN A;  9ICF A;  3PW7 A;  4PGY A;  4R66 A;  4F4Y A;  4RU9 A;  4RQ4 A;  3SV3 A;  4MFA A;  1RXW A;  5J0U A;  4F5R A;  1MSW D;  1BNO A;  5DB7 A;  5J0Q A;  3EZ5 A;  1NJY A;  3RAQ A;  5HMM A;  4F92 B;  4K4H A;  4YXM A;  4DSL A;  5L1L A; 
#chains in the Genus database with same CATH topology
 4C8M A;  4KLH A;  2DFL A;  2Q0Z X;  3QXG A;  4QZC A;  1ZXI A;  2HW3 A;  1ECW A;  4DQQ A;  1GO3 F;  1R8A A;  2ZH8 A;  4EBE A;  2K4I A;  4J9K A;  3UMB A;  2P6U A;  1Z00 A;  4EBJ A;  3ORY A;  2PFO A;  1HJP A;  3V7J A;  2BR0 A;  4YD1 A;  1RQL A;  1C7Y A;  2ASL A;  4LVS A;  4E0D A;  1XSL A;  2ASD A;  1FA0 A;  5AK3 A;  3RR8 A;  2OWO A;  4AT7 B;  3F2C A;  7ICJ A;  1RYR A;  4Y2R A;  1ZD5 A;  1ARO P;  3SR6 A;  2IHO A;  3Q8M A;  5F2V O;  4BUG A;  3NVZ A;  1KNY A;  5EWG A;  2WTF A;  4Q45 A;  4DCC A;  2ZJA A;  1UT8 A;  2KHQ A;  4C8N A;  1COK A;  3DEE A;  1SL2 A;  1VDV A;  4GLX A;  3AU6 A;  1KQQ A;  1PZN A;  3C1Y A;  5DG7 A;  3H4D A;  3Q8S B;  2EAO A;  4X4V A;  2UVV A;  4B9M A;  1K1Q A;  2XGQ A;  2A19 A;  4F8R A;  3M1Y A;  4QWC A;  3HIY A;  1T7P A;  7ICP A;  2XVT A;  4ED1 A;  4O0I A;  4C7Z A;  4JV1 A;  3NVY A;  4EGW A;  4OJL A;  3C5F A;  8ICS A;  2YMM A;  3KTQ A;  4LEY A;  4KLQ A;  4C4R A;  1VFG A;  3WK4 A;  9ICJ A;  5KG2 A;  2F44 A;  2OHF A;  2G07 A;  3N7S C;  3EUB 2;  3PMN A;  3WFO A;  3K4G A;  4YR2 A;  9ICW A;  4XUS A;  3HWT A;  2FDR A;  2DPJ A;  8ICB A;  3N7P D;  4I2C A;  1XO1 A;  5JTG A;  2VKQ A;  2JV3 A;  5DQG A;  2E3T A;  1YLQ A;  2FPM A;  1TKD A;  3KHH A;  4QIW C;  3OUY A;  1U48 A;  5DB8 A;  2HN1 A;  4ECR A;  3HKZ F;  2ZTD A;  1ZQZ A;  2KKP A;  1DRG A;  4UAU A;  4ECV A;  1J97 A;  4Z6D A;  5CP2 A;  5J2K A;  4RQ8 A;  2BPF A;  3OJS A;  3H37 A;  2KIV A;  2PXI A;  4O3R A;  3ZDE A;  9ICX A;  5AM1 A;  1SV0 C;  4KLI A;  1JUD A;  4JMU A;  3TAD A;  4AYB C;  3V7L A;  2W9C A;  3JPO A;  5DED A;  2LBO A;  1IIP A;  3BS5 B;  5KFA A;  4J9N A;  4R63 A;  4PL2 A;  4EX7 A;  1V4A A;  1PUZ A;  5KFI A;  4ECX A;  5KFM A;  5DQI A;  5IIN A;  4JLX A;  4MF2 A;  2KMD A;  4M9N A;  1ZET A;  2YX8 A;  1JI7 A;  2HHS A;  5KT6 A;  1NI3 A;  2G09 A;  4P2H A;  3OWG A;  1UEU A;  4DL2 A;  2V4Q A;  4PZO A;  5KT7 A;  1O08 A;  3H39 A;  5KAI U;  1OU5 A;  5KFB A;  2B21 A;  1S8O A;  8ICM A;  4GXJ A;  3LVW A;  5ALU A;  3G6X A;  4EBC A;  4WQL A;  4LEZ A;  4E8F A;  3OV7 A;  5JRT A;  8ICG A;  1RM6 C;  3ONN A;  4NM1 A;  3RJH A;  2AU0 A;  2ES6 A;  2H3I A;  2W8L A;  3BJY A;  4KLG A;  4EED A;  3HX0 A;  3V6K A;  3OHA A;  4NLZ A;  2LM4 A;  3D2Q A;  3PZP A;  5L9X A;  5DG8 A;  8ICW A;  3TQ1 A;  7ICS A;  3NKU A;  1QCK A;  3QYP A;  2A1J B;  1QH9 A;  1WG8 A;  3CNH A;  4X0B A;  1TK8 A;  4P0P A;  2Q4T A;  4HX0 A;  4I29 A;  3MCR A;  2VA8 A;  4J9M A;  3H3A A;  4DEZ A;  1IV8 A;  2FMP A;  4EZ9 A;  1NNL A;  4WC5 A;  2DKX A;  2BHN A;  3WFQ E;  5J0P A;  3PV8 A;  7ICQ A;  2JRZ A;  2AQ4 A;  2I5H A;  3M6K A;  2EWR A;  2GWS A;  2ISP A;  2ZHA A;  4F5N A;  1TK0 A;  2NRW A;  2YY6 A;  3PW0 A;  4DSJ A;  1DK3 A;  3KBB A;  1FFV A;  3GV7 B;  1N5W A;  2ZTC A;  2W7P A;  4I2D A;  2JGA A;  3QNM A;  2BCR A;  4NKT A;  1N61 A;  3JPS A;  8ICC A;  4DO9 A;  4QJF B;  1Q3V A;  3WU2 U;  3UXN A;  3QU9 A;  1N48 A;  1SL0 A;  2P66 A;  5IIJ A;  4UB3 A;  2J6U A;  4UAV A;  5CB1 A;  4XRH A;  5DB9 A;  1ZQT A;  3MBY A;  1QQ7 A;  2HBL A;  1L5U A;  2HMX A;  1UEV A;  1KLN A;  3ISC A;  4DLE A;  3HPO A;  5ALY A;  2VJ5 A;  4QIW F;  4KLD A;  2Y9U A;  4ECS A;  5EOZ A;  5HRI A;  5J0R A;  4PJ0 U;  1S77 D;  4F5O A;  4BDP A;  1F5S A;  4KMO B;  4TUP A;  2W9A A;  2ASJ A;  2AXT U;  5KNI A;  2IA6 A;  5CHE A;  1ZQP A;  2DUY A;  4AT9 A;  1RG6 A;  4BWM A;  4Z6E A;  4AYB F;  8ICF A;  2YN4 A;  4DFD A;  2R8G A;  1Q3U A;  3OPX A;  3ZDB A;  8ICX A;  2MSN A;  3WFP A;  4AP9 A;  5HP4 A;  2ZIU B;  3UPS A;  4M6W A;  4PHP A;  2LKY A;  3T5H A;  5C0Y A;  4GXK A;  4IQV A;  3RBE A;  9ICV A;  3WKE A;  3D2S A;  1MIV A;  4ED7 A;  4YQW A;  2KSO B;  1ZYQ A;  1B43 A;  1SKR A;  4YXJ A;  1TAM A;  1A0P A;  2C22 A;  2F77 X;  1NOM A;  4EEN A;  3H8S A;  3FDS A;  5III A;  4UB5 A;  1Z4O A;  2KZM A;  1FIQ A;  4C8K A;  3C2L A;  1Z1V A;  5ALZ A;  1YT3 A;  4R64 A;  3PNC A;  2KVS A;  5AM5 A;  3SMV A;  4Y2T A;  2HHX A;  2CPR A;  2DF4 B;  1ZQG A;  2P6R A;  3KKA A;  4QZD A;  1Q78 A;  1ZQI A;  4RQ7 A;  2YML A;  4OAF A;  5CFS A;  3BQ1 A;  5HHH A;  7ICO A;  2HHU A;  2A1A A;  2IHM A;  3IRU A;  1ZJN A;  1XO0 A;  5J2A A;  4WC6 A;  1X66 A;  3JZ0 A;  5ALL A;  3OVS A;  2W03 A;  4E80 A;  4UAY A;  4B9L A;  3M6Z A;  4FO1 A;  5EE0 A;  2HOQ A;  2OCE A;  3AQF A;  4CNQ A;  4F91 B;  1TFW A;  2MRL A;  2DR7 A;  2LPE A;  2ID1 A;  4I27 A;  4JV2 A;  4NL9 C;  2IHN A;  3CP8 A;  5KG0 A;  3MR3 A;  5D46 A;  2H5X A;  1TAU A;  1A76 A;  4RWQ A;  1UT5 A;  4DSK A;  2HVH A;  3UMG A;  4DSF A;  4QZG A;  4ATB B;  4B6J A;  2XGP A;  4N7R A;  5KFC A;  3NUQ A;  2JH1 A;  3PSI A;  4NLB A;  4Q44 A;  4DFP A;  1NJX A;  9ICQ A;  2VA2 A;  2J6S A;  4KLU A;  4I2B A;  4UB1 A;  2OH2 A;  2R8I A;  4M04 A;  4IL6 U;  4MFA A;  1MSW D;  2O6K A;  5DB7 A;  3EZ5 A;  4WOY A;  4NXX A;  4PHA A;  2MUT A;  3G6V A;  5KT5 A;  2W11 A;  3VCB A;  2W43 A;  3IDW A;  3QUQ A;  2ZTE A;  2Y1I A;  2H3Z A;  3ISB A;  2BQR A;  4IRK A;  5HR6 A;  3KHR A;  4NM2 A;  2NV3 A;  3OGU A;  1PVQ A;  4YMN A;  3FYH A;  2FPK A;  5B5E U;  3WFR E;  1BPY A;  4OAG A;  1ZQB A;  3LWL A;  1MQ2 A;  4UW9 A;  3QUB A;  1VJ5 A;  5KFG A;  1K1S A;  2VJ4 A;  3ERC C;  2V9W A;  1P7D A;  2XI9 A;  3F2D A;  2HVI A;  4LT6 A;  5CEH A;  1ZRN A;  2KOB A;  4YG2 A;  2G0A A;  1NZB A;  4C8L A;  2LM1 A;  1KN5 A;  4RPZ A;  4NY8 A;  5HRB A;  5J2H A;  4O3M A;  3J81 j;  3QU5 A;  4EEL A;  2IOF A;  1LVH A;  3BQ2 A;  4PH5 A;  9ICM A;  2IBK A;  2JEF A;  2ZIX B;  2YB4 A;  3ZDC A;  3HIL A;  1WUD A;  1L3T A;  4DQI A;  3AUO A;  5ALM A;  2V4R A;  4R8U A;  3N7R C;  1XC9 A;  8ICH A;  1ZD4 A;  1SWW A;  3NAS A;  4RQ0 A;  5ALV A;  2AHO B;  2YTU A;  1V38 A;  5KL1 B;  1NK5 A;  3TAR A;  5KFZ A;  2ZIW A;  5AI0 A;  2ZH2 A;  1XNS A;  1B4F A;  4OCZ A;  5EE1 A;  3V6J A;  2DVI A;  1ZQY A;  5ALX A;  3UMC A;  5KFQ A;  2WF6 A;  4EX6 A;  4DS4 A;  2B0C A;  5BPC A;  2ZJ8 A;  4JWM A;  4IQU A;  1CRX A;  2F8K A;  3EPG A;  4EEY A;  4UAZ A;  4RPX A;  2AJQ A;  4NXW A;  2F76 X;  1RQN A;  1D8Y A;  4M0A A;  5KL8 B;  3RFA A;  3TAN A;  1Z19 A;  3RJI A;  4PZN A;  5ALE A;  3G6Y A;  5J8Y C;  4QW8 A;  2K8B B;  3BDP A;  4K8V A;  4FE3 A;  9ICS A;  2LHT A;  1DOQ A;  4Y2U A;  2KP7 A;  5HHI A;  4DOC A;  3VC8 A;  3AQN A;  1YZ6 A;  9ICH A;  2XCP A;  1PVP A;  2KV2 A;  3H0M B;  2EQY A;  4PL1 A;  5C5J A;  4DL4 A;  3SD7 A;  4NWI A;  5KFO A;  2WF9 A;  3ISD A;  1M6Y A;  2I6X A;  5ALK A;  4RUC A;  1ZQ1 C;  1D9F A;  1HIW A;  4F93 B;  2WB1 C;  4FHY A;  3GZF A;  3IN5 A;  2LYB A;  3IM1 A;  4K9A A;  4F4W A;  3NWI A;  2FE9 A;  5ALQ A;  3QZ7 A;  4JK1 A;  3ALR A;  2M9N A;  4KB6 A;  1UQV A;  3N28 A;  4F2S A;  3WK9 A;  5HRL A;  3JPQ A;  9ICO A;  3E0F A;  4FZL A;  2IOH A;  3JYY A;  2VIX A;  3IHQ B;  4KN4 A;  4P0P B;  5AI9 A;  4I2A A;  2PFQ A;  5J2B A;  4IR1 A;  2B6G A;  4TUQ A;  4ECW A;  2NYV A;  5KFX A;  3M7D A;  1UA0 A;  4NXV A;  2F1H A;  5KFT A;  9ICB A;  3M9M B;  5AIB A;  4KLE A;  5L1J A;  3F53 A;  1KDH A;  4JLZ A;  1X42 A;  2EAP A;  4DQP A;  9ICI A;  1KW4 A;  1NK6 A;  4K96 A;  4I2G A;  2R18 A;  2CN1 A;  2ZUC A;  3C21 A;  1L3U A;  1SV4 A;  5AM3 A;  3K75 D;  3AQK A;  2JEG A;  5ALH A;  4Q43 A;  4O67 A;  1X2I A;  1CUK A;  2RQ5 A;  2NO4 A;  1ZQA A;  1UHU A;  2HOF A;  1PVR A;  5DGB A;  2BCV A;  2HHT A;  5AK5 A;  3C2K A;  5AM0 A;  2RLT A;  4EBD A;  1S0M A;  3KD3 A;  1JXE A;  3F5E A;  1NK9 A;  2ZIV B;  3GIK A;  1HEK A;  4C7Y A;  1L3S A;  2A3V A;  4FZN A;  2BKE A;  4IRC A;  3FM9 A;  2HBM A;  4KLT A;  3MAB A;  2Y0S C;  5CA7 A;  5DDM A;  4O69 A;  1LKY B;  1WWV A;  3PSF A;  3PX6 A;  4O68 A;  4WC1 A;  3GDX A;  3IP4 B;  4WBZ A;  3UXO A;  2QB0 A;  5B66 U;  2KK0 A;  3QEA Z;  2GO7 A;  1L6N A;  4EEK A;  2OYY A;  4YD2 A;  4J9Q A;  1QLN A;  4F50 A;  8ICZ A;  5KTQ A;  2XIC A;  3THV A;  3SAF A;  5L1I A;  3KOO A;  3DDH A;  3RH5 A;  4BJQ A;  3IG5 A;  4MEX A;  3V6H A;  2Y9T A;  3O0F A;  1NKC A;  2R8K A;  3OJU A;  1Q46 A;  2DBY A;  4KLF A;  1DK2 A;  5AKG A;  4ED0 A;  4P0Q B;  4FHP A;  7ICR A;  1SKS A;  2HCF A;  3GIL A;  5ALJ A;  4C4S A;  4FS1 A;  4NLG A;  1S0O A;  3OHB A;  4CGZ A;  1TFR A;  4CCH A;  2WB1 F;  3PO5 A;  2IOF K;  4P4M A;  1A6S A;  1RYS A;  1S10 A;  7ICV A;  3MDC A;  3WKB A;  1MQ3 A;  4NLC A;  3LYS A;  2KG5 A;  4NLN A;  2W9B B;  4C80 A;  5AKZ A;  4EZ6 A;  1SV0 A;  3NVV A;  5J2J A;  3GIM A;  2K4E A;  2ODG A;  5KFE A;  1L3V A;  4K98 A;  4MFC A;  5DKW A;  3C5G A;  5AK4 A;  2YMP A;  1XU4 A;  3ZD9 A;  2KEY A;  2ZG6 A;  2Q66 A;  4I0U A;  2N1R A;  3H8M A;  5CHG A;  4HYK A;  4BGD A;  3UPQ A;  1NJW A;  2EZZ A;  1ZRM A;  4B9T A;  2K4P A;  4CDG A;  1RZT A;  2BCQ A;  7ICG A;  8ICT A;  3ER8 C;  2K89 A;  4F5P A;  3M9O B;  3JPT A;  3PST A;  4RT3 A;  3QU7 A;  4Y2Q A;  2KE7 A;  4F3O A;  4X0A A;  4J9O A;  3NVW A;  2BDP A;  3WK5 A;  2H3V A;  4EBK A;  4LEW A;  2PFP A;  4DWI A;  4K9B A;  1X6I A;  4C8O A;  5J2D A;  3AL0 B;  3RRH A;  4MFF A;  2W04 A;  4FO6 A;  2ESE A;  1S0N A;  1L7O A;  2ZH6 A;  1JAJ A;  4I2H A;  4AT7 A;  1RPL A;  3UM9 A;  1LV5 A;  3E2E A;  1ZQD A;  2BBH A;  4QWB A;  4F4K A;  4RWP A;  4P4O A;  2I1Q A;  5KFV A;  3GV8 B;  2ALZ A;  2NO5 A;  2XID A;  3AQE A;  5AM4 A;  3Q8P B;  2GLE A;  5L1K A;  3RB4 A;  1NK4 A;  3ZI4 A;  1JIH A;  1UPH A;  3RJK A;  2UVR A;  4ELT A;  1TK5 A;  1HUZ A;  2ZXI A;  3RB0 A;  2D6F C;  2MA1 A;  1PK1 A;  8ICP A;  4KX3 A;  1Y88 A;  2Y0S F;  4J9R A;  1ZQQ A;  2MUT B;  5F9L A;  3EF2 A;  2WF7 A;  2W55 A;  9ICR A;  8ICO A;  2ATL A;  3JPP A;  5AI5 A;  5KFK A;  3PW4 A;  2DRB A;  1D8L A;  3WK6 A;  1IXR A;  5J0S A;  4F4Y A;  4RQ4 A;  3SV3 A;  2PMZ C;  2FPL A;  4DSL A;  1NO5 A;  4RNM A;  5BOM A;  2DWQ A;  3OSN A;  1VJ7 A;  1WCL A;  1L7N A;  2I9G A;  2LYA A;  2KTQ A;  5DQH A;  1KTQ A;  3M8S A;  4K97 A;  5D4B A;  2DGZ A;  3CW2 C;  3NTU A;  5KT2 A;  4UAS A;  4WQK A;  1X40 A;  2EH9 A;  5F3X B;  4I28 A;  9ICU A;  2AH5 A;  3AEV A;  3H0R B;  3BQ7 A;  4RQ6 A;  3AN1 A;  3GII A;  3IG8 A;  4IR9 A;  5HC9 A;  4DOB A;  5J0Y A;  5TIS U;  3SAH A;  2K4H A;  2ZIW B;  5CFT A;  3BS5 A;  1DXS A;  4NXZ A;  1BVS A;  1MIW A;  1YZ7 A;  3QUC A;  2BPG A;  5AK6 A;  4FFD A;  5AKY A;  1X9S A;  1U4B A;  5ALN A;  1ZQN A;  5TZV A;  4DLG A;  2RP5 A;  2RFF A;  4FH5 A;  1NZP A;  2D8C A;  2KIC A;  4F72 A;  3T5J A;  1KFD A;  3TAP A;  8ICA A;  2Z7J A;  2CRX A;  4M9J A;  4OJO A;  1QSL A;  4C0Z A;  2O1P A;  5HRK A;  4I2J A;  3H0L B;  2HHP A;  5CR0 A;  2XY7 A;  4CF5 A;  2JHD A;  1WCN A;  4MF8 A;  4K99 A;  4RT2 A;  4BX9 C;  2ZH7 A;  2UVW A;  3AQM A;  1SXD A;  3S6J A;  3C29 A;  9ICA A;  2WF8 A;  4FHV A;  4FBT A;  2HBK A;  2F3N A;  4DQR A;  4PPX A;  5AIC A;  2JEI A;  7ICM A;  8ICY A;  4Y2Y A;  5AKE A;  8ICJ A;  4FZM A;  2NRT A;  2KHV A;  1L8O A;  4Y2S A;  3T5L A;  2G5H B;  2LYH A;  2C2D A;  3TI0 A;  1N62 A;  7ICU A;  2MAX A;  4OD0 A;  1QQ5 A;  3RH6 A;  3ETL A;  5J2G A;  1QQ6 A;  2NRK A;  3ER9 B;  4RQN A;  1Z00 B;  3MGV A;  7ICI A;  5DLF A;  3TAC B;  4DL5 A;  3T3F A;  4LJX A;  4DL7 A;  2EAN A;  5KAF U;  3KZX A;  4NL9 A;  1MIY A;  1PX5 A;  2FJ6 A;  2GH1 A;  4US8 A;  3PX4 A;  5HR9 A;  2H3Q A;  4R65 A;  4UD4 A;  4MHV A;  5CRX A;  3SQI A;  3RR7 A;  2PMZ F;  4RPY A;  2KNJ A;  3HJ1 A;  5KFL A;  1Q8K A;  3OVB A;  2ZUB A;  4QZE A;  5IIM A;  5IIO A;  1U49 A;  2E8N A;  3TKA A;  3N4M B;  2VAN A;  2HHQ A;  5HRH A;  4NJ8 A;  4IC9 A;  4UB8 U;  1BPX A;  3C23 A;  3RRG A;  2C2R A;  4NV0 A;  4O3O A;  4ELV A;  9ICK A;  3T79 A;  4ED8 A;  3N97 B;  3L4P A;  5KG3 A;  4UB2 A;  3RJG A;  4RNN A;  8ICE A;  4B9V A;  5F9N A;  4F71 A;  3GIJ A;  1R8C A;  4KTQ A;  2DQN B;  1BGX T;  3F2B A;  4ECT A;  2JXJ A;  2FCL A;  4JB3 A;  1URJ A;  5KFF A;  1S0V A;  4XQ8 A;  3SI8 A;  8ICK A;  2DPI A;  3MR6 A;  2E8O A;  2M2U A;  1JN3 A;  5GTI U;  2BCU A;  1V85 A;  5ALR A;  2XO7 A;  2BQ3 A;  5ALS A;  1IG6 A;  5DBA A;  3NRW A;  5DDY A;  4RQ2 A;  2ZIU A;  4GIB A;  1FO4 A;  3TFR A;  5B3P A;  2OM6 A;  4DF4 A;  5DGA A;  3KFU F;  3QUT A;  4QZA A;  2ZH4 A;  3OUY B;  2QB0 B;  4WC2 A;  4NXT A;  2F8L A;  5B3Q A;  2G08 A;  2KFN A;  2GA9 D;  2ZH5 A;  5ALO A;  3Q8K A;  1QSS A;  9ICT A;  4RNO A;  4I2E A;  2XY5 A;  4WBY A;  5HR7 A;  4TQR A;  4EYH B;  3EYZ A;  1N56 A;  3CK6 A;  4B9U A;  2L5Y A;  5CFU A;  3DV9 A;  5ALT A;  1KFT A;  4UB6 U;  1ZQC A;  1ZQE A;  1ED1 A;  5KFS A;  2NRZ A;  2W9C B;  3UQ0 A;  2LMR A;  3AMZ A;  3WKC A;  1C20 A;  8ICN A;  4UBB A;  4O5C A;  4QZH A;  4CF3 A;  2IUB A;  1FFU A;  1F44 A;  1KEJ A;  4X4T A;  1V9P A;  3Q8R B;  1S9F A;  2YMQ A;  5DLG A;  5EE9 A;  2W3R A;  4K4I A;  3RAX A;  3NYB A;  2VA3 A;  3T5K A;  5ALI A;  5J0T A;  2W7O A;  4TQS A;  3PY8 A;  1MN8 A;  3H4B A;  4USA A;  1JQR A;  1AQ6 A;  3TAQ A;  7ICH A;  2QAR A;  1XSP A;  3EWA A;  3EW9 A;  2Y1J A;  1RYU A;  3AM9 A;  3M8R A;  4CRX A;  4O3P A;  4DOA A;  4ECQ A;  1N63 A;  1ZQU A;  3IV6 A;  4J9L A;  4WH5 A;  3QU2 A;  4X4S A;  2FLN A;  3SV4 A;  2RDI A;  4U6P A;  5AKJ A;  5J8Y A;  4ATB A;  4ZOH C;  4UQG A;  2CXY A;  4DSE A;  1T8E A;  4DL6 A;  4YP3 A;  5HML A;  8ICI A;  2DR8 A;  1T3Q A;  1VLB A;  2F2A B;  4K4G A;  1KRP A;  4TUR A;  2PKE A;  2K8C B;  3UXP A;  3SEI A;  3ZD8 A;  1SKW A;  3MGI A;  4X5V A;  8ICQ A;  1TE2 A;  1ZQW A;  3ETR A;  2AGQ A;  5KFD A;  4KIT B;  2BDU A;  1KBU A;  1XWL A;  1XSN A;  2KIW A;  3HP6 A;  1J2N A;  4DF8 A;  1B0X A;  1N2X A;  2KJ8 A;  3UQ2 A;  1BNP A;  1Q79 A;  3RB6 A;  4UAW A;  5HRD A;  3H38 A;  5AI8 A;  4J9S A;  3ZDA A;  4DFK A;  3OSP A;  1MC8 A;  2B4V A;  3C66 A;  5DG9 A;  2GAF D;  4IS7 A;  3BQ0 A;  1SXE A;  4YVZ A;  1X9X A;  5KG6 A;  3WK8 A;  4JV0 A;  1OXJ A;  5H2F U;  4KLO A;  8ICU A;  1UA1 A;  2HI0 A;  4ECY A;  1RDF A;  1ZQF A;  1BPD A;  1PK1 B;  1ZQO A;  3HJE A;  3PHZ A;  4B9N A;  3LWM A;  7ICK A;  5KFU A;  1S5L U;  1L7P A;  5J0W A;  4ECU A;  9ICE A;  3MC1 A;  5HNK A;  9ICL A;  5AKL A;  4UAT A;  2ZH3 A;  5L1M A;  4BXO A;  4AT8 A;  4S3N A;  3H8J A;  2EZX A;  1NJZ A;  1K5O A;  1BPZ A;  2E5S A;  5T14 A;  1S97 A;  2ZIX A;  1IM4 A;  1QTM A;  3FC4 A;  5D63 A;  4Z6C A;  3SYZ A;  4RQM A;  3JPR A;  3Q8Q B;  4NLK A;  5EE3 A;  4AT9 B;  3TAD C;  1X9W A;  5J2E A;  5J0O A;  1H38 A;  2JMG A;  4US9 A;  4MKP A;  4EYI B;  2JH7 A;  1KKX A;  4YR3 A;  2HBJ A;  4M6W B;  3BQT A;  4MEY A;  3D2N A;  4XQ7 A;  4F4X A;  1DGS A;  1SL1 A;  8ICR A;  4M5D A;  5BOL A;  1EXN A;  5AKH A;  3PW7 A;  4PGY A;  1JAL A;  4RU9 A;  1RXW A;  4F5R A;  1NJY A;  2EZY A;  3RAQ A;  4F92 B;  5K4L A;  3SAG A;  4K4H A;  4YXM A;  5L1L A;  1CEZ A;  3LDA A;  2FI1 A;  1T4G A;  5KT4 A;  2EDU A;  4PGQ A;  3KHG A;  5KG5 A;  4GC6 A;  2KVC A;  3BS7 A;  5HRG A;  4KLL A;  2JZB A;  7ICF A;  1JX4 A;  2KFZ A;  3HW8 A;  4G3I A;  1SZP A;  1SZH A;  5DEC A;  3RB3 A;  1U47 A;  3QU4 A;  2QKQ A;  3K7D A;  5EWE A;  2ZJ5 A;  5DB6 A;  4Y2J A;  2AGP A;  2RRD A;  5IIK A;  1S76 D;  1OW5 A;  7ICN A;  1SGG A;  2OXO A;  3CRX A;  4M9G A;  3GU3 A;  3PSP A;  4PGX A;  3MGH A;  2BE3 A;  2WFA A;  4LEV A;  2E8P A;  4OO1 J;  4OAH A;  5ALG A;  4Q8E A;  3F5A A;  4YFK A;  4X4P A;  2J6T A;  4WJ3 B;  1Z4N A;  5DBC A;  4QWD A;  4FHX A;  4PHD A;  3QE9 Y;  1XS9 D;  1LB2 B;  4QZB A;  4XJE A;  5D62 A;  3LVV A;  2JEJ A;  9ICN A;  2F1I A;  3CYM A;  1L7M A;  2PI5 A;  2E8M A;  5G5G A;  3ED5 A;  3RJJ A;  3NS1 A;  3R9K A;  4RQ5 A;  1TFY A;  4QZ8 A;  4X4N A;  2PI4 A;  4GC7 A;  2DR5 A;  4WC0 A;  5AI6 A;  4UBC A;  4DS5 A;  5FP0 A;  1GPJ A;  1T94 A;  4Q8F A;  3A0B U;  1N60 A;  4QZI A;  3QEB Z;  3I76 A;  2WAQ C;  1ZQR A;  4KLM A;  5KFR A;  4YCX A;  3NVO A;  4OJP A;  1SB3 C;  5AI4 A;  1NK0 A;  2BGW A;  4XA5 A;  3WFS C;  3E58 A;  4ED6 A;  1X6J A;  2YQE A;  1JMS A;  5D49 A;  2QB1 A;  2ZHB A;  3L5K A;  2XCA A;  4KM5 A;  3K1R B;  7ICT A;  2KN7 A;  1ZQM A;  4ZH4 A;  1J2M A;  1R89 A;  4J03 A;  2DRA A;  3MFI A;  1A77 A;  4F2R A;  4O3Q A;  2XY6 A;  3GV5 B;  4QWA A;  3PVX A;  2ZIV A;  3H8W A;  4F5Q A;  1HUO A;  5KT3 A;  3AQL A;  9ICC A;  1TV9 A;  3V7K A;  4DFM A;  2KJ9 A;  5J29 A;  4RQ1 A;  1V97 A;  1LKY A;  4JUZ A;  1KL9 A;  1PK3 A;  5D61 A;  3C28 A;  3A0H U;  9ICP A;  1WYG A;  1NKE A;  4FH3 A;  4JWN A;  1DGJ A;  2M2T A;  5AKI A;  4Y2X A;  2K8A A;  4RZR A;  4Y2P A;  4O6A A;  1ZQS A;  2FMS A;  4OJ6 A;  4O5K A;  1RXV A;  2QLT A;  3KKA C;  4R8U B;  4KX5 A;  2W54 A;  5J2C A;  3HJ4 A;  3LQC B;  3JCF A;  5J2I A;  2PFN A;  5CJ7 A;  3B0Y A;  2KZZ A;  4UD5 A;  4YMM A;  2ZH1 A;  5CWR A;  5ALP A;  5JTI A;  4O3N A;  4P0Q A;  3C2M A;  2OEH A;  1CI4 A;  2MU2 A;  3PR4 A;  1UET A;  5AKK A;  5J2F A;  2B56 A;  3OVA A;  1T3N A;  8ICL A;  5EWF A;  4RWO A;  3TFS A;  2YB1 A;  4X4Q A;  3GFK B;  1ZQL A;  3BZC A;  3RTV A;  2HHW A;  1JRO A;  5E79 U;  4X4R A;  4RQ3 A;  2KD1 A;  2W8K A;  1BPE A;  3RH4 A;  1COO A;  1SWV A;  2DKZ A;  4DQS A;  2W9B A;  5KG1 A;  2ZXH A;  4A8E A;  2WF5 A;  3BZK A;  4CF4 A;  9ICG A;  4UB4 A;  1Z3E B;  2G06 A;  2BBJ A;  4FHW A;  4IRD A;  3OTQ A;  2ZUD A;  2NRX A;  2BPC A;  3I1Y A;  8ICV A;  1ZJM A;  3WKD A;  3PR5 B;  3SZ2 A;  4WC3 A;  2JR5 A;  2BZF A;  2XC9 A;  3I28 A;  1SIJ A;  1B22 A;  2W3S A;  5AM2 A;  3MFH A;  4X4O A;  4KN7 A;  3C18 A;  5ALW A;  5DBB A;  4EV6 A;  1MA7 A;  1BPB A;  4ED3 A;  5KFN A;  1JXL A;  3H7I A;  3QZ8 A;  4M2Y A;  4LZG A;  1ZD2 P;  2QAR B;  3AU2 A;  4IQT A;  5J0X A;  2B51 A;  1UCV A;  2M2W A;  2M0N A;  4GXI A;  2A1J A;  5HRE A;  1ZQV A;  3NGD A;  4O5E A;  3WK7 A;  3GQC A;  2WAQ F;  4HAI A;  4KLS A;  3RBD A;  5G5H A;  2H3F A;  2KZ3 A;  2UVU A;  2FLL A;  5AIA A;  4KLJ A;  2FLP A;  4I2I A;  2AGO A;  4F4Z A;  3KZI U;  4LZD A;  2C2E A;  3HRD D;  3MDA A;  2DL0 A;  1TAQ A;  3M9N B;  4E7X A;  4QWE A;  1NK8 A;  7ICE A;  1O03 A;  2BQU A;  3MR2 A;  4Z6F A;  4ELU A;  2KKV A;  4OAI Z;  4ICA A;  3KHL A;  2NRV A;  4J9P A;  1NKB A;  2P35 A;  4RUA A;  3V72 A;  4NKU A;  2BCS A;  3Q8L A;  3K1Z A;  1D9D A;  3PO4 A;  4X4U A;  3QX7 A;  2C28 A;  1OUQ A;  2RHF A;  1ZQX A;  3L3F X;  3C1Z A;  1TVA A;  2ZH9 A;  4O3S A;  1L8L A;  1ZQK A;  2WHE A;  1QSY A;  2HDO A;  2RDJ A;  2HSZ A;  4FS2 A;  4YN4 A;  2E1F A;  3PX0 A;  5KFW A;  3NRZ A;  3ZDD A;  4NXU A;  1KSP A;  5KFP A;  7ICL A;  4YMO A;  4B9S A;  2HOI A;  1F5A A;  1Z1B A;  1FEZ A;  4M9L A;  3H40 A;  2HHV A;  4TUS A;  4O9M A;  3B0X A;  4ACO A;  3JPN A;  4OJ5 A;  4EP7 A;  1U45 A;  5KG7 A;  4BXO B;  4AT8 B;  4IQW A;  4KMU A;  3PML A;  4WCW A;  3FAH A;  5GTH U;  3PW2 A;  4FBU A;  3RJF A;  3PW5 A;  2K60 A;  2KSO A;  3RF9 A;  4IG8 A;  4QZ9 A;  2R8H A;  4QW9 A;  4U7C A;  1WWU A;  5KG4 A;  4RWN A;  5KFH A;  2D3D A;  2KJ5 A;  2FMQ A;  4WC4 A;  1N5X A;  4PHE A;  1ZQJ A;  3LK9 A;  4DL3 A;  2LI6 A;  5IIL A;  4QZF A;  3HT3 A;  4Y2V A;  2M2V A;  3SEN A;  5JUM A;  4UAR A;  2DR9 A;  4WC7 A;  3MR5 A;  2HN2 A;  2W9M A;  4BWJ A;  1ZQH A;  3U26 A;  4M47 A;  4CE6 A;  5HRF A;  1U9L A;  1ZOL A;  4C4T A;  5A0L A;  3EPI A;  1ZD3 A;  2EAM A;  4P4P A;  1NK7 A;  2ISO A;  1D8B A;  2G5I B;  2AQ0 A;  4GFJ A;  5KFJ A;  3RJE A;  1JRP A;  4DFJ A;  3HKZ C;  4M9H A;  2E1E A;  2GOL A;  5KFY A;  2O5A A;  4ECZ A;  1KFS A;  4G9B A;  2PBE A;  2R8J A;  3WKA A;  1R8B A;  1F0M A;  4EEB A;  2JZB B;  3D6J A;  2IMW P;  4QNL A;  5ALD A;  5AHX A;  3ICX A;  4DSI A;  4ED2 A;  1X9M A;  2F1J A;  4I2F A;  3B9J A;  3L9D A;  5ALF A;  5JU5 A;  4YR0 A;  1WOT A;  9ICF A;  4R66 A;  1BNO A;  5J0U A;  5J0Q A;  5AKX A;  5HMM A; 
#chains in the Genus database with same CATH homology
 4C8M A;  1CEZ A;  4PHA A;  2MUT A;  4KLH A;  2DFL A;  3LDA A;  1NO5 A;  4RNM A;  5BOM A;  5KT5 A;  3G6V A;  2Q0Z X;  1VJ7 A;  4QZC A;  3OSN A;  1T4G A;  1WCL A;  5KT4 A;  2I9G A;  4PGQ A;  3KHG A;  5KG5 A;  5DQH A;  2ZTE A;  2Y1I A;  3ISB A;  2KTQ A;  2HW3 A;  4GC6 A;  4DQQ A;  1R8A A;  1KTQ A;  3M8S A;  2BQR A;  4KLL A;  5HRG A;  2ZH8 A;  4EBE A;  4IRK A;  2JZB A;  5D4B A;  7ICF A;  4J9K A;  1JX4 A;  2KFZ A;  3HW8 A;  3NTU A;  4G3I A;  2P6U A;  3KHR A;  1SZP A;  4NM2 A;  5KT2 A;  1Z00 A;  5DEC A;  3OGU A;  3RB3 A;  3ORY A;  1U47 A;  4EBJ A;  4YMN A;  2PFO A;  1HJP A;  3FYH A;  2FPK A;  3V7J A;  2BR0 A;  5EWE A;  3WFR E;  1BPY A;  4YD1 A;  1C7Y A;  2ZJ5 A;  2ASL A;  5DB6 A;  1ZQB A;  3LWL A;  2AGP A;  1MQ2 A;  4LVS A;  4I28 A;  1TAU A;  9ICU A;  5KFG A;  5IIK A;  1K1S A;  2V9W A;  4E0D A;  1S76 D;  2HVI A;  1XSL A;  4LT6 A;  2ASD A;  4RQ6 A;  1FA0 A;  3GII A;  7ICN A;  3RR8 A;  4YG2 A;  2OWO A;  4C8L A;  4IR9 A;  4AT7 B;  4RPZ A;  4NY8 A;  5HC9 A;  4M9G A;  1RYR A;  7ICJ A;  4DOB A;  5HRB A;  1ARO P;  5J0Y A;  4PGX A;  3Q8M A;  5F2V O;  3MGH A;  2BE3 A;  5J2H A;  1KNY A;  4Q8E A;  5EWG A;  4NXZ A;  4YFK A;  4Q45 A;  4PH5 A;  1BVS A;  2WTF A;  3BQ2 A;  9ICM A;  1MIW A;  2IBK A;  4X4P A;  2JEF A;  2J6T A;  2BPG A;  2ZJA A;  1UT8 A;  4C8N A;  3ZDC A;  5DBC A;  4QWD A;  1SL2 A;  1X9S A;  4FHX A;  1L3T A;  1U4B A;  4GLX A;  1ZQN A;  5TZV A;  4PHD A;  4DLG A;  3QE9 Y;  4DQI A;  3AU6 A;  3AUO A;  2RFF A;  1XS9 D;  1PZN A;  1LB2 B;  4FH5 A;  3C1Y A;  1NZP A;  2V4R A;  4R8U A;  4QZB A;  5DG7 A;  3H4D A;  2JEJ A;  9ICN A;  1XC9 A;  8ICH A;  3T5J A;  1KFD A;  2F1I A;  3Q8S B;  3TAP A;  8ICA A;  2PI5 A;  4M9J A;  4X4V A;  2FPL A;  4RQ0 A;  1QSL A;  2UVV A;  4B9M A;  1K1Q A;  3RJJ A;  5HRK A;  4I2J A;  2HHP A;  2XGQ A;  4F8R A;  2O1P A;  1NK5 A;  4QWC A;  5CR0 A;  4RQ5 A;  1T7P A;  3TAR A;  3HIY A;  5KFZ A;  1TFY A;  7ICP A;  4ED1 A;  2XY7 A;  2ZH2 A;  4QZ8 A;  4O0I A;  2PI4 A;  4X4N A;  4JV1 A;  4GC7 A;  2DR5 A;  1WCN A;  4MF8 A;  4RT2 A;  3C5F A;  3V6J A;  4WC0 A;  2UVW A;  4UBC A;  4DS5 A;  8ICS A;  3AQM A;  2ZH7 A;  1ZQY A;  3KTQ A;  4KLQ A;  4Q8F A;  5KFQ A;  1VFG A;  4QZI A;  3QEB Z;  4DS4 A;  9ICA A;  9ICJ A;  5BPC A;  5KG2 A;  2ZJ8 A;  4JWM A;  4IQU A;  4FHV A;  3EPG A;  3PMN A;  1ZQR A;  4FBT A;  3WFO A;  3K4G A;  4YR2 A;  4DQR A;  4PPX A;  4KLM A;  9ICW A;  4XUS A;  4EEY A;  3HWT A;  5KFR A;  4YCX A;  4UAZ A;  7ICM A;  2JEI A;  4RPX A;  1NK0 A;  2AJQ A;  2BGW A;  2DPJ A;  4XA5 A;  8ICB A;  8ICY A;  8ICJ A;  2NRT A;  3WFS C;  1D8Y A;  3T5L A;  4I2C A;  1XO1 A;  4ED6 A;  4M0A A;  2LYH A;  3TAN A;  2C2D A;  3TI0 A;  1JMS A;  5D49 A;  5DQG A;  7ICU A;  3RJI A;  2ZHB A;  2MAX A;  2DVI A;  2XCA A;  3RH6 A;  3ETL A;  1YLQ A;  2FPM A;  1TKD A;  3KHH A;  3OUY A;  5J2G A;  1U48 A;  5DB8 A;  7ICT A;  2NRK A;  2KN7 A;  3G6Y A;  4ECR A;  1ZQM A;  4QW8 A;  1Z00 B;  3BDP A;  7ICI A;  4ZH4 A;  5DLF A;  9ICS A;  1DOQ A;  5HHI A;  2KP7 A;  4DL5 A;  1R89 A;  2ZTD A;  4DOC A;  2DRA A;  1ZQZ A;  3MFI A;  1A77 A;  3T3F A;  4F2R A;  4O3Q A;  4ECV A;  2XY6 A;  4Z6D A;  5CP2 A;  4DL7 A;  5J2K A;  3GV5 B;  4QWA A;  3PVX A;  9ICH A;  4RQ8 A;  2BPF A;  3AQN A;  2XCP A;  1MIY A;  1PX5 A;  3H8W A;  3OJS A;  4F5Q A;  1HUO A;  3H37 A;  5KT3 A;  3AQL A;  5C5J A;  2PXI A;  4DL4 A;  9ICC A;  4O3R A;  3ZDE A;  1TV9 A;  9ICX A;  3V7K A;  4DFM A;  3PX4 A;  5HR9 A;  5KFO A;  5J29 A;  4RQ1 A;  4KLI A;  4JUZ A;  4R65 A;  4UD4 A;  3ISD A;  3V7L A;  4RUC A;  2W9C A;  3RR7 A;  1D9F A;  3JPO A;  5DED A;  4F93 B;  5KFA A;  4RPY A;  4R63 A;  4J9N A;  1V4A A;  5KFL A;  3HJ1 A;  5KFI A;  9ICP A;  4FHY A;  3OVB A;  2ZUB A;  1NKE A;  4QZE A;  4FH3 A;  5IIM A;  4JWN A;  3IM1 A;  4ECX A;  5KFM A;  2M2T A;  5DQI A;  5IIO A;  5IIN A;  4MF2 A;  1U49 A;  4F4W A;  3N4M B;  4RZR A;  4M9N A;  1ZET A;  2VAN A;  3QZ7 A;  2HHQ A;  5HRH A;  1ZQS A;  2FMS A;  2HHS A;  5KT6 A;  4JK1 A;  4O5K A;  4P2H A;  2M9N A;  1RXV A;  1BPX A;  3C23 A;  4O5C A;  4R8U B;  3RRG A;  1UEU A;  4DL2 A;  2C2R A;  4F2S A;  4O3O A;  4ELV A;  9ICK A;  5HRL A;  4ED8 A;  3JPQ A;  9ICO A;  3N97 B;  5KG3 A;  5J2C A;  4UB2 A;  2V4Q A;  4RNN A;  3RJG A;  5KT7 A;  4B9V A;  5J2I A;  5F9N A;  2PFN A;  8ICE A;  3LQC B;  3H39 A;  1OU5 A;  3GIJ A;  5CJ7 A;  1R8C A;  3B0Y A;  3IHQ B;  2B21 A;  5KFB A;  3JYY A;  8ICM A;  2KZZ A;  4KTQ A;  4KN4 A;  1BGX T;  4YMM A;  4UD5 A;  2ZH1 A;  4GXJ A;  4EBC A;  3G6X A;  4ECT A;  5CWR A;  4I2A A;  2PFQ A;  5J2B A;  4O3N A;  4IR1 A;  4E8F A;  3OV7 A;  3C2M A;  8ICG A;  4TUQ A;  4ECW A;  4RWQ A;  4NM1 A;  5KFF A;  1S0V A;  4XQ8 A;  3RJH A;  2AU0 A;  5KFX A;  3SI8 A;  1UA0 A;  2DPI A;  8ICK A;  2F1H A;  3PR4 A;  3MR6 A;  1UET A;  2W8L A;  5KFT A;  3BJY A;  4KLG A;  9ICB A;  1JN3 A;  2M2U A;  5J2F A;  3M9M B;  2BCU A;  4KLE A;  3HX0 A;  5L1J A;  3OVA A;  1T3N A;  8ICL A;  2XO7 A;  5EWF A;  1KDH A;  4RWO A;  3TFS A;  3V6K A;  4DQP A;  3OHA A;  9ICI A;  2BQ3 A;  4NLZ A;  4X4Q A;  3GFK B;  1NK6 A;  1ZQL A;  5DBA A;  5DDY A;  4I2G A;  3RTV A;  4RQ2 A;  2HHW A;  4X4R A;  4RQ3 A;  5L9X A;  2W8K A;  1BPE A;  5DG8 A;  3TFR A;  3RH4 A;  1COO A;  3TQ1 A;  8ICW A;  7ICS A;  2ZUC A;  3C21 A;  4DF4 A;  1L3U A;  5DGA A;  3K75 D;  3AQK A;  2A1J B;  2JEG A;  4DQS A;  2W9B A;  5KG1 A;  4QZA A;  1TK8 A;  4X0B A;  2ZH4 A;  4Q43 A;  1X2I A;  9ICG A;  4UB4 A;  3OUY B;  1CUK A;  4I29 A;  1Z3E B;  2VA8 A;  1ZQA A;  4J9M A;  3H3A A;  4IRD A;  4FHW A;  4WC2 A;  4DEZ A;  2ZUD A;  2NRX A;  2BPC A;  2FMP A;  5DGB A;  1ZJM A;  2BCV A;  3SZ2 A;  3PR5 B;  4EZ9 A;  2HHT A;  2KFN A;  4WC3 A;  2ZH5 A;  3C2K A;  3Q8K A;  4WC5 A;  1QSS A;  9ICT A;  2BHN A;  3WFQ E;  2XC9 A;  4RNO A;  4EBD A;  1S0M A;  4I2E A;  5J0P A;  3PV8 A;  1B22 A;  2XY5 A;  7ICQ A;  4WBY A;  1JXE A;  3MFH A;  4X4O A;  4KN7 A;  1NK9 A;  3GIK A;  4TQR A;  2AQ4 A;  5DBB A;  3C18 A;  4EYH B;  1L3S A;  3EYZ A;  1N56 A;  2GWS A;  2BKE A;  2ISP A;  4F5N A;  1TK0 A;  1BPB A;  4ED3 A;  2NRW A;  5KFN A;  3PW0 A;  4IRC A;  2ZHA A;  1JXL A;  4KLT A;  4DSJ A;  3H7I A;  3MAB A;  3QZ8 A;  4M2Y A;  4LZG A;  1DK3 A;  4B9U A;  3GV7 B;  1KFT A;  2ZTC A;  5CA7 A;  3AU2 A;  4I2D A;  5DDM A;  4IQT A;  5J0X A;  2M2W A;  1ZQC A;  4GXI A;  2BCR A;  2A1J A;  4NKT A;  1ZQE A;  3PX6 A;  5HRE A;  1ZQV A;  5KFS A;  3NGD A;  3JPS A;  4O5E A;  4WC1 A;  2NRZ A;  2W9C B;  3GQC A;  3GDX A;  3UQ0 A;  4DO9 A;  4KLS A;  3RBD A;  8ICC A;  4WBZ A;  3UXO A;  3UXN A;  8ICN A;  4UBB A;  1N48 A;  4QZH A;  1SL0 A;  2KZ3 A;  5IIJ A;  2P66 A;  4UB3 A;  2UVU A;  2FLL A;  2J6U A;  3QEA Z;  1KEJ A;  3HJ4 A;  4X4T A;  5CB1 A;  4KLJ A;  4XRH A;  1V9P A;  4YD2 A;  5DB9 A;  1ZQT A;  2FLP A;  3Q8R B;  3MBY A;  4J9Q A;  4I2I A;  1S9F A;  1L5U A;  2AGO A;  4F4Z A;  1QLN A;  1UEV A;  4LZD A;  5DLG A;  2C2E A;  3MDA A;  4F50 A;  8ICZ A;  5KTQ A;  1KLN A;  3ISC A;  4DLE A;  4K4I A;  3HPO A;  3RAX A;  3NYB A;  1TAQ A;  2VA3 A;  3T5K A;  3M9N B;  5J0T A;  3THV A;  4KLD A;  4QWE A;  1NK8 A;  4ECS A;  7ICE A;  4E7X A;  4TQS A;  3PY8 A;  5EOZ A;  3H4B A;  5L1I A;  5HRI A;  5J0R A;  3RH5 A;  2BQU A;  1JQR A;  4MEX A;  3MR2 A;  3TAQ A;  1S77 D;  4F5O A;  7ICH A;  4Z6F A;  3V6H A;  1XSP A;  3EWA A;  4BDP A;  3EW9 A;  1NKC A;  2R8K A;  2Y1J A;  4TUP A;  2W9A A;  4ELU A;  3OJU A;  3M8R A;  3KHL A;  2ASJ A;  2NRV A;  4O3P A;  4DOA A;  4ECQ A;  4J9P A;  1ZQU A;  4KLF A;  4J9L A;  1NKB A;  1DK2 A;  4ED0 A;  2IA6 A;  4X4S A;  4RUA A;  3V72 A;  1ZQP A;  4NKU A;  4FHP A;  2BCS A;  3Q8L A;  2FLN A;  1D9D A;  8ICV A;  3PO4 A;  3SV4 A;  7ICR A;  2RDI A;  4X4U A;  4AT9 A;  1SKS A;  4BWM A;  3GIL A;  4Z6E A;  4FS1 A;  2C28 A;  4ATB A;  4UQG A;  4NLG A;  1ZQX A;  1S0O A;  3OHB A;  4DSE A;  8ICF A;  1TFR A;  3C1Z A;  1TVA A;  2R8G A;  1T8E A;  4DL6 A;  2ZH9 A;  3ZDB A;  4YP3 A;  4CCH A;  4O3S A;  3PO5 A;  5HML A;  1ZQK A;  8ICX A;  8ICI A;  3WFP A;  2DR8 A;  4P4M A;  5HP4 A;  1RYS A;  1S10 A;  1QSY A;  3MDC A;  7ICV A;  4M6W A;  4PHP A;  1MQ3 A;  3UPS A;  4K4G A;  2RDJ A;  1KRP A;  3T5H A;  4TUR A;  4GXK A;  4IQV A;  4FS2 A;  3RBE A;  4YN4 A;  9ICV A;  4NLN A;  3UXP A;  1MIV A;  3ZD8 A;  4ED7 A;  4YQW A;  2W9B B;  1SKW A;  3PX0 A;  5KFW A;  3MGI A;  4X5V A;  1ZYQ A;  4EZ6 A;  8ICQ A;  3ZDD A;  1ZQW A;  1B43 A;  5J2J A;  1SKR A;  3GIM A;  4YXJ A;  2AGQ A;  1KSP A;  5KFD A;  2C22 A;  4KIT B;  5KFP A;  5KFE A;  1L3V A;  7ICL A;  1NOM A;  4MFC A;  4YMO A;  1XWL A;  5DKW A;  3C5G A;  3H8S A;  1XSN A;  3HP6 A;  3FDS A;  5III A;  4B9S A;  1XU4 A;  3ZD9 A;  4UB5 A;  4DF8 A;  1F5A A;  4M9L A;  2KZM A;  3H40 A;  4C8K A;  3C2L A;  3UQ2 A;  2HHV A;  1BNP A;  1Q79 A;  4TUS A;  3RB6 A;  4O9M A;  2Q66 A;  4UAW A;  3B0X A;  4R64 A;  3PNC A;  5HRD A;  3JPN A;  5CHG A;  3H38 A;  4HYK A;  4EP7 A;  4BGD A;  1U45 A;  5KG7 A;  4BXO B;  4J9S A;  3ZDA A;  3UPQ A;  2HHX A;  4DFK A;  3OSP A;  4AT8 B;  4IQW A;  4KMU A;  1NJW A;  3PML A;  1MC8 A;  4B9T A;  4WCW A;  1ZQG A;  3PW2 A;  2P6R A;  3C66 A;  7ICG A;  5DG9 A;  1RZT A;  2BCQ A;  8ICT A;  4F5P A;  4QZD A;  3JPT A;  3M9O B;  3BQ0 A;  4FBU A;  3RJF A;  1Q78 A;  4RT3 A;  4YVZ A;  3PW5 A;  1ZQI A;  4RQ7 A;  4F3O A;  4X0A A;  4J9O A;  5KG6 A;  4IG8 A;  3BQ1 A;  2BDP A;  4QZ9 A;  4JV0 A;  2R8H A;  5HHH A;  7ICO A;  2HHU A;  4KLO A;  4QW9 A;  2IHM A;  4WC6 A;  1ZJN A;  5J2A A;  8ICU A;  4EBK A;  3JZ0 A;  1UA1 A;  4ECY A;  2PFP A;  3OVS A;  1ZQF A;  1BPD A;  5KG4 A;  1ZQO A;  4RWN A;  4DWI A;  5KFH A;  4E80 A;  4B9N A;  5J2D A;  4C8O A;  3RRH A;  4MFF A;  3LWM A;  4FO6 A;  4UAY A;  1S0N A;  2FMQ A;  7ICK A;  4WC4 A;  2ZH6 A;  5KFU A;  4B9L A;  1JAJ A;  4PHE A;  1ZQJ A;  4I2H A;  4AT7 A;  1RPL A;  5J0W A;  4ECU A;  3LK9 A;  5HNK A;  4DL3 A;  1LV5 A;  5IIL A;  3E2E A;  1ZQD A;  9ICE A;  9ICL A;  2ZH3 A;  4QWB A;  4BXO A;  4QZF A;  3HT3 A;  4F4K A;  4AT8 A;  4S3N A;  2M2V A;  5JUM A;  3H8J A;  4RWP A;  4P4O A;  1NJZ A;  4WC7 A;  2DR9 A;  2I1Q A;  5KFV A;  3GV8 B;  2ALZ A;  1BPZ A;  4F91 B;  3Q8P B;  3MR5 A;  1TFW A;  5L1K A;  2W9M A;  4BWJ A;  3RB4 A;  1JIH A;  1NK4 A;  1ZQH A;  3RJK A;  2ID1 A;  4I27 A;  1S97 A;  2UVR A;  4ELT A;  1TK5 A;  1IM4 A;  1HUZ A;  4M47 A;  1QTM A;  4JV2 A;  5HRF A;  3RB0 A;  1U9L A;  2IHN A;  4Z6C A;  5KG0 A;  3MR3 A;  3SYZ A;  3EPI A;  4P4P A;  5D46 A;  2H5X A;  3JPR A;  1A76 A;  1NK7 A;  3Q8Q B;  1UT5 A;  2ISO A;  2AQ0 A;  4DSK A;  5KFJ A;  3RJE A;  4NLK A;  2HVH A;  4AT9 B;  4DSF A;  4DFJ A;  8ICP A;  1X9W A;  4QZG A;  5J2E A;  5J0O A;  1Y88 A;  1H38 A;  4M9H A;  4J9R A;  1ZQQ A;  2MUT B;  5KFY A;  4ATB B;  2XGP A;  2O5A A;  5KFC A;  4ECZ A;  1KFS A;  5F9L A;  4Q44 A;  2PBE A;  4DFP A;  1NJX A;  2R8J A;  4EYI B;  2DR7 A;  9ICR A;  1R8B A;  8ICO A;  9ICQ A;  2VA2 A;  4YR3 A;  2J6S A;  4KLU A;  2ATL A;  4I2B A;  4M6W B;  2JZB B;  3BQT A;  3JPP A;  4MEY A;  2IMW P;  5KFK A;  4UB1 A;  4DSI A;  3PW4 A;  4XQ7 A;  2DRB A;  1D8L A;  4ED2 A;  4F4X A;  1IXR A;  2F1J A;  5J0S A;  2R8I A;  1X9M A;  1DGS A;  1SL1 A;  4I2F A;  4M04 A;  8ICR A;  3L9D A;  4YR0 A;  4M5D A;  5BOL A;  1WOT A;  1EXN A;  9ICF A;  3PW7 A;  4PGY A;  4R66 A;  4F4Y A;  4RU9 A;  4RQ4 A;  3SV3 A;  4MFA A;  1RXW A;  5J0U A;  4F5R A;  1MSW D;  1BNO A;  5DB7 A;  5J0Q A;  3EZ5 A;  1NJY A;  3RAQ A;  5HMM A;  4F92 B;  4K4H A;  4YXM A;  4DSL A;  5L1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...