4F5OA

Open ternary complex of r283k dna polymerase beta with a one metal bound dctp analog
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
326
structure length
321
Chain Sequence
b'TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of dNTP Intermediate States during DNA Polymerase Active Site Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 108
structure length 321
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f5oA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4f5oA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4f5oA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4f5oA03
4QW9A 4DF4A 9ICRA 3AU6A 4Q45A 1K1QA 4RQ3A 5IIKA 4QWAA 1ZETA 2BCQA 1Q78A 1RYRA 5KFMA 4WBYA 2J6SA 4GXKA 2ATLA 2ZTCA 4YD1A 4X4QA 4F93B 3GV7B 4I2IA 3GV8B 2ZJAA 5HREA 2PI5A 1L3SA 1KRPA 4NM2A 3RH4A 4E8FA 5DBBA 1TFRA 4NLNA 1JN3A 7ICRA 2W9BA 3H8SA 5DDYA 2XO7A 5IIMA 4JK1A 4UAZA 1U47A 3H38A 4LZDA 4LVSA 3UPSA 5DQGA 2PFOA 2IBKA 5KFBA 5CJ7A 7ICHA 4B9VA 4X4OA 4DQPA 4ECUA 1NK7A 1ZQCA 4C8KA 4B9UA 2OWOA 5BOLA 4ECWA 8ICKA 4QZBA 3B0XA 1RYSA 3C2MA 9ICUA 2ZH8A 4WC1A 1R89A 7ICUA 4FHWA 3OJSA 1SKRA 2ASDA 3JPNA 4ELVA 2ZH1A 4DO9A 5KG6A 2BQ3A 5KFRA 1D9FA 4KTQA 4F4ZA 2UVWA 5J29A 3QEAZ 4LZGA 4P4OA 1B22A 4KLUA 4EBJA 3OVSA 2NRWA 1NKCA 4UBCA 3PV8A 3RB3A 2Y1IA 3QZ8A 4YG2A 4KLDA 2ZUDA 1X9SA 2XCPA 4DS5A 1TV9A 3RRHA 9ICOA 4J9NA 5DB8A 3ZDBA 4R65A 3TANA 1CUKA 2W9MA 5L1LA 5EWGA 5KG0A 5DDMA 4Q44A 4PPXA 3LK9A 4J9QA 1Z00A 3PX0A 1XO1A 1NK4A 1ZQIA 2VA3A 2PXIA 4DOCA 3RJHA 4K4HA 4NY8A 4F4KA 4YD2A 1ZQXA 5JUMA 3G6VA 4FHPA 3TI0A 1BNOA 1ZJMA 2AJQA 1NJXA 2IMWP 4RWOA 1NOMA 2M2VA 4XUSA 4WC3A 5D46A 4GC7A 3RH6A 3T3FA 4F2RA 2BHNA 5L1IA 2C28A 2JEJA 3M9MB 2W8KA 1BPXA 1DOQA 5BPCA 3MDCA 4RWNA 4M2YA 2XY6A 4EYHB 4KLTA 2KFZA 4NM1A 4UBBA 1ZQPA 4ZH4A 2P6RA 8ICMA 4DFPA 4DQIA 7ICMA 4RQ8A 4YP3A 4GXJA 5EOZA 3PO5A 5DB6A 4ECRA 9ICSA 3KHGA 3GIKA 1S9FA 4JV1A 8ICWA 4KLSA 1A77A 5HRGA 4EZ9A 3ISCA 1ZQUA 4RUCA 4C8NA 3PY8A 5CHGA 1OU5A 2XY5A 4O5EA 4QZFA 4RPZA 2I9GA 4KLJA 3JYYA 4QZAA 4F8RA 1ZQLA 4YN4A 4YVZA 5KG3A 2KTQA 2DRAA 4M6WB 8ICEA 4TUPA 4PH5A 3H4BA 2AGPA 2MAXA 4IG8A 2ASJA 1MQ3A 2FPMA 2ZJ8A 4J9LA 2XY7A 1R8CA 3MABA 5J0PA 1MQ2A 2HHUA 4MF8A 2NRTA 4WCWA 4F5NA 4B9TA 8ICSA 4FHYA 1X9MA 2B21A 4R66A 5D4BA 3TAPA 2UVRA 5CA7A 5IINA 3RJFA 4QZIA 2RDJA 2PFPA 3RH5A 3MFIA 5KT6A 5KFSA 5HR9A 3C2LA 1BPZA 3ISDA 2DR5A 5J0UA 2P66A 3GDXA 2F1IA 5KFXA 4P4PA 1WOTA 1T8EA 2O5AA 4TQSA 4M04A 2RFFA 2DR7A 4UB1A 3GIMA 2ISOA 2HHTA 1AROP 8ICVA 3E2EA 1A76A 1ZQNA 4KMUA 8ICYA 2ISPA 2J6TA 4C8OA 3OUYB 5DGAA 1UETA 1ZQBA 2MUTB 4X0BA 4ECVA 1S0OA 8ICPA 3V6HA 1NKBA 3SV4A 4MEYA 1ZQVA 4M9HA 4DOBA 5HRDA 4R64A 1JXEA 4QZGA 4J9KA 1U48A 3UXOA 2ZH2A 5DLGA 3RR8A 1JAJA 2AQ4A 4AT9B 4E80A 4DEZA 3Q8KA 3TFSA 3OSPA 3JZ0A 1ZQDA 1NJWA 2FMSA 5F2VO 1COOA 2DR8A 2I1QA 3H8WA 4J9RA 3PW7A 3T5KA 4EBEA 1L3UA 1S76D 1HUOA 1V9PA 1R8BA 2M9NA 4RQ0A 3MGHA 4DF8A 4KLGA 9ICMA 1BVSA 4IR1A 4RQ6A 3HJ1A 1QSLA 2PBEA 4Z6EA 5J2BA 2BCSA 4FO6A 4JUZA 1R8AA 1MC8A 3PR5B 3MDAA 1TK5A 2PFNA 2R8HA 5KFEA 3ZD8A 1VFGA 4R8UB 2AU0A 2BCVA 4ED1A 5J0OA 3L9DA 5KFTA 1ZQRA 1PZNA 2A1JB 4ECYA 1KLNA 2PI4A 4Q8EA 2KN7A 4O5CA 2W8LA 8ICUA 5DG9A 4J9SA 3SI8A 1UT8A 3NGDA 3V6JA 5KFIA 4HYKA 3RBEA 2BR0A 4DSLA 1RXWA 2FPKA 4UAWA 2BE3A 4XRHA 3BQ2A 2BKEA 3UXPA 4I2CA 1B43A 1S0NA 3HWTA 5DBCA 1ZQYA 3EYZA 2BPFA 1QSSA 4PHDA 5EWEA 3N4MB 4ED0A 2DR9A 1JXLA 5KT4A 2ZJ5A 4QZ8A 5DECA 3G6XA 8ICGA 3Q8RB 1XS9D 2ZH6A 7ICSA 4UD4A 1JX4A 5J0QA 1MSWD 3AU2A 2ZH5A 4IR9A 1EXNA 3AUOA 4I28A 4JWNA 3HW8A 5J2IA 4M6WA 2R8IA 4J9MA 3PW5A 4M9NA 2KFNA 4JWMA 3AQMA 4FH5A 5KFZA 5KFYA 1D8YA 4S3NA 4Z6FA 1Y88A 8ICZA 7ICJA 3PVXA 5KFCA 4UB5A 3K4GA 3RAQA 4F4XA 5DKWA 5J0XA 1ZQKA 2JZBB 4BWMA 4Q8FA 4E7XA 4O3NA 5KFVA 2KZMA 3AQLA 1ZQWA 5KFFA 2BGWA 4X4RA 9ICJA 9ICVA 8ICLA 4QZCA 2LYHA 8ICQA 4RQ5A 1S97A 3ORYA 2UVVA 4EP7A 4XA5A 4YMMA 4DSEA 2PFQA 1RZTA 1S0VA 3RRGA 3OUYA 2HVHA 2BPCA 3H37A 3TFRA 2MUTA 3MBYA 4X4SA 5KFPA 3GILA 1ZQQA 1FA0A 2XCAA 1WCLA 2KZZA 3RTVA 5DGBA 4RU9A 1UT5A 3EW9A 3GIJA 3H4DA 3SYZA 3PW0A 2FMPA 4I2DA 5L9XA 5KG2A 3T5HA 5J0TA 4DWIA 3QZ7A 2BCUA 2O1PA 4RWPA 4AT9A 3GFKB 4QWBA 4F91B 4YR2A 2AGOA 3T5JA 5HRKA 2NRXA 4I2BA 1HJPA 3IHQB 2ASLA 9ICQA 1NZPA 4YFKA 4RUAA 2KP7A 4KN7A 1TKDA 4CCHA 5DEDA 5IIIA 3OHBA 4Q43A 3AQKA 4DL6A 9ICPA 5KT7A 3WFPA 3IM1A 3PMLA 3ZD9A 7ICKA 4P4MA 2WTFA 4X4VA 1SKWA 4E0DA 1N48A 7ICPA 4QWCA 4NLGA 5HRLA 4BXOB 4R8UA 2IHMA 1TAQA 5KTQA 1NK9A 2C22A 3GQCA 3RJJA 1KSPA 1X2IA 9ICWA 3OJUA 2ZH7A 1UEUA 2AQ0A 5F9NA 5J2JA 8ICOA 1KFTA 4NXZA 3C1ZA 1JQRA 5KFAA 4R63A 4ED2A 3WFRE 4KLOA 4DSJA 2A1JA 5DBAA 4F5RA 1KEJA 1SL1A 1D9DA 4ECQA 3C1YA 5HHHA 1U4BA 3WFOA 4F92B 5DB7A 5KFNA 2H5XA 2DFLA 4QZEA 1TK8A 2HHPA 2AGQA 1Z3EB 3K75D 4RNOA 1UEVA 4F5OA 1X9WA 4IRKA 4X5VA 5DB9A 1YLQA 3TARA 2JEGA 2DPJA 8ICCA 5KFLA 3Q8QB 2C2EA 2HHSA 4AT8B 4QW8A 3KTQA 4MFAA 1NK0A 3C18A 3MR2A 4YXJA 4RQ7A 5J2CA 4UAYA 7ICEA 8ICNA 3TQ1A 2V9WA 5HRHA 3EPIA 5KG1A 5CWRA 3Q8PB 3UQ2A 5DQHA 3H39A 5HRIA 5J2AA 4DLEA 4WC0A 5HMLA 4B9SA 2W9CB 2GWSA 1S0MA 1MIYA 1KDHA 4FBUA 4DL5A 7ICVA 5CP2A 3H40A 3JPQA 4NLKA 5KFGA 1RPLA 2ZTEA 2R8JA 4I2JA 4DFMA 4O3QA 2JZBA 5HC9A 1U49A 3B0YA 5IIJA 9ICKA 1F5AA 4DQRA 1SL2A 4WC4A 1DGSA 3M9NB 4Z6CA 1ZQMA 3EWAA 3KHLA 3M9OB 1ZQGA 5KG7A 3ZDAA 4BDPA 7ICGA 2HW3A 4Z6DA 2HHVA 4I2HA 4RPYA 2M2TA 1VJ7A 1JIHA 5J2KA 1NO5A 4X4TA 3EPGA 3KHHA 4X4UA 4M9JA 4JV2A 4IQVA 7ICNA 3LQCB 3NYBA 4B9NA 4KLFA 8ICRA 4FHVA 3OVAA 5HNKA 2VA2A 4M47A 4DQQA 4DSFA 1KFSA 9ICBA 4DL7A 3TAQA 3JPTA 4O3SA 5F9LA 4WC2A 3QEBZ 3RAXA 2ZUBA 4K4GA 3JPSA 2ZH9A 3C5GA 4C8MA 4DOAA 1BPEA 2ALZA 1RXVA 4B9LA 3JPOA 4F2SA 3QE9Y 3H8JA 5KFDA 3PX6A 4WC6A 1U9LA 2FMQA 2R8GA 3RJKA 5J0RA 4MFFA 2ZTDA 4EEYA 1BPDA 5J0SA 1KNYA 1BPYA 1PX5A 4RT2A 3ETLA 1UA1A 9ICXA 3UQ0A 1U45A 4I27A 1BGXT 2Q66A 2BPGA 3EZ5A 4M9LA 4BXOA 4I2AA 2DRBA 1WCNA 4F5QA 3Q8LA 5J2DA 3V7KA 4RQ4A 4RPXA 1XC9A 9ICTA 1ZQZA 8ICJA 3Q8SB 5J0YA 4WC5A 4EBKA 5KFQA 4KLQA 4GLXA 4M5DA 1TFYA 3NTUA 8ICFA 4WBZA 3RJIA 4ELUA 1DK2A 5J0WA 5EWFA 3RB4A 5KG4A 4IQUA 5TZVA 3MR3A 2V4QA 2C2DA 4YR3A 2ZUCA 3C21A 1NK5A 1C7YA 3PO4A 5J2GA 4PHEA 4IRDA 3PW2A 1NKEA 2IA6A 4B9MA 1BNPA 1D8LA 4FBTA 2Q0ZX 1ZQTA 4AT8A 4ED6A 7ICFA 7ICLA 4ATBB 1XU4A 5L1JA 4F50A 1NK8A 1N56A 1LV5A 2JEIA 5J2HA 3ISBA 2V4RA 4ECTA 2HVIA 3BQ0A 3N97B 4MFCA 3PMNA 3MR6A 2VANA 2UVUA 4AT7B 2KZ3A 2F1JA 2XC9A 3HT3A 4FS1A 4QWDA 3RBDA 4IQWA 1ZQEA 1L3TA 4TURA 4DFKA 4KLLA 1KFDA 4EYIB 4QZHA 9ICGA 3HIYA 4YCXA 3OGUA 3GIIA 2W9CA 3SZ2A 4EBDA 5DQIA 3UPQA 2FLNA 4DL3A 4MEXA 3SV3A 2P6UA 4UD5A 1TK0A 4I2EA 8ICHA 3PR4A 2NRVA 3GV5B 2BCRA 1Q79A 4YMOA 3HX0A 4UB3A 4J9OA 2ID1A 4UB4A 4O3RA 1IM4A 4PGXA 4YQWA 4EBCA 1K1SA 4KLMA 4O9MA 4TUSA 4RT3A 3G6YA 1NJYA 2IHNA 4F4YA 4DL4A 3BQ1A 2ZHBA 2FPLA 5KFOA 1ZQJA 4M9GA 4I2FA 7ICIA 3C5FA 2C2RA 4ED7A 3V72A 1XSNA 4DSIA 8ICTA 1KTQA 3H3AA 1TAUA 5CR0A 4YR0A 9ICCA 4UB2A 4F3OA 4ECZA 5HP4A 5HMMA 1SZPA 4YMNA 4DLGA 5HRFA 1CEZA 7ICOA 3HJ4A 1TFWA 1JMSA 5J2EA 3RJEA 1S77D 2M2UA 4I29A 1QSYA 3OSNA 2ZH4A 9ICLA 2XGQA 4KITB 3AQNA 2J6UA 1MIWA 4G3IA 2HHWA 8ICXA 5CB1A 4ED3A 3JPRA 5IILA 3C66A 4DQSA 5KG5A 2W9BB 2NRZA 9ICIA 4DL2A 1XSLA 4F5PA 1ZQSA 4GC6A 9ICNA 3BQTA 3HPOA 5DLFA 5KFJA 4QZDA 5KFUA 5KT2A 5KT3A 2XGPA 1S10A 1ZQFA 4GXIA 4O3PA 3ZDEA 4NLZA 3RB0A 3M8RA 4P2HA 3H7IA 1TVAA 1QLNA 5KT5A 4IQTA 3OV7A 4RNNA 5BOMA 3BJYA 4LT6A 3HP6A 4RNMA 2DPIA 1ZQHA 1XSPA 3M8SA 3LDAA 5L1KA 1L5UA 5C5JA 1ZQAA 3T5LA 3C2KA 1H38A 4PGQA 3OVBA 8ICAA 9ICHA 3ZDDA 1QTMA 9ICAA 3KHRA 2M2WA 4FH3A 4J9PA 1ZJNA 4ELTA 5HHIA 2FLLA 4IRCA 1XWLA 4UQGA 2BQUA 4YXMA 1DK3A 4KLEA 2HHQA 1V4AA 5KFKA 4O0IA 1Z00B 2NRKA 3WFQE 2RDIA 3RR7A 4NKUA 2ZH3A 4TQRA 4TUQA 2F1HA 3FDSA 2BQRA 1ZQOA 3ZDCA 3FYHA 5KFWA 4FHXA 3BDPA 1L3VA 4RQ1A 4ATBA 4KN4A 3V7LA 2HHXA 3THVA 4X4PA 4BWJA 1SKSA 3PW4A 1ZYQA 1NK6A 1UA0A 1SL0A 4PHAA 2W9AA 2R8KA 4FS2A 1MIVA 5D49A 2VA8A 3RJGA 3V7JA 5J2FA 4AT7A 4I2GA 4X4NA 9ICFA 3C23A 1NJZA 2JEFA 4O5KA 5KFHA 1IXRA 1T3NA 4QWEA 3JPPA 4QZ9A 3MFHA 4KLHA 3UXNA 4K4IA 4PGYA 4F4WA 7ICQA 3V6KA 4RWQA 9ICEA 2DVIA 3Q8MA 2BDPA 4ECSA 1LB2B 1HUZA 4O3OA 3RB6A 1BPBA 4MF2A 2ZHAA 5DG8A 5IIOA 5DG7A 3WFSC 4X0AA 4XQ8A 4C8LA 4KLIA 3MR5A 4RZRA 4WC7A 3OHAA 4DFJA 4DS4A 7ICTA 4BGDA 1T4GA 3MGIA 3LWLA 4PHPA 3PNCA 4DSKA 4JV0A 3LWMA 1T7PA 8ICBA 5HRBA 2Y1JA 8ICIA 2FLPA 4NKTA 4ECXA 4EZ6A 3PX4A 4M0AA 4ED8A 4XQ7A 4RQ2A
chains in the Genus database with same CATH superfamily
4C4RA 4NXXA 5J8YC 1ZETA 1Q78A 1RYRA 4GXKA 3WK4A 4YD1A 3F5EA 4X4QA 1KBUA 1N61A 4EEKA 3H8SA 1UCVA 4UAZA 2ZXHA 1SGGA 7ICHA 2PFOA 3UPSA 4DQPA 4ECUA 1NK7A 1ZQCA 4WQKA 4B9UA 2OWOA 8ICKA 1ED1A 5AIBA 3HRDD 2E8PA 3ZI4A 2ZH8A 1R89A 4UBCA 3PV8A 2Y1IA 4YG2A 4KLDA 2ZUDA 1S8OA 2CXYA 4LEWA 3TANA 3IV6A 5DDMA 1ZQIA 1XO1A 4NY8A 2VA3A 2PXIA 5ALIA 4FHPA 3SEIA 3BZKA 3G6VA 2AJQA 4XJEA 1Z19A 1FO4A 2BHNA 5L1IA 1K5OA 3L4PA 1V38A 4EYHB 2KFZA 8ICMA 4YP3A 1L6NA 4ECRA 3KHGA 3U26A 5HRGA 1ZQUA 4RUCA 5CHGA 4KLJA 3UMCA 3JYYA 4YVZA 3ALRA 2DRAA 1NI3A 4TUPA 2F2AB 2MAXA 2ASJA 3O0FA 2ZJ8A 4Y2JA 4J9LA 3HKZF 4R66A 8ICOA 1MN8A 3MFIA 3C2LA 1IV8A 2P66A 4P4PA 3ERCC 1T8EA 4UB1A 2ISOA 8ICVA 2EAMA 1A76A 2J6TA 4C8OA 1ECWA 3OUYB 1UETA 2ZIUA 4ECVA 2KIVA 1ZQVA 4M9HA 2KKVA 5ALVA 3A0BU 1FFUA 1U48A 4K96A 3RR8A 1JAJA 2AQ4A 4DEZA 3Q8KA 5ALJA 2I1QA 3T5KA 1V9PA 2M9NA 4RQ0A 4DF8A 9ICMA 3CNHA 4RQNA 3HJ1A 2PBEA 5KFEA 3ZD8A 3IRUA 4G9BA 4R8UB 1ZOLA 3AQEA 2BCVA 2KK0A 5J0OA 5KFTA 1ZQRA 4ECYA 2KN7A 4O5CA 2W8LA 4FZNA 3NGDA 1WG8A 4HYKA 2H3FA 2BE3A 3HJ4A 1RXWA 2YMQA 1S0NA 4UARA 2NO5A 5EWEA 3GZFA 5D63A 4UD4A 5J0QA 3WK5A 3H0MB 3AU2A 3M6KA 3AUOA 4JWNA 1S5LU 3PW5A 2FDRA 2Z7JA 5KFZA 2A1AA 2CRXA 4UB8U 4Z6FA 8ICZA 1WWVA 4U6PA 3K4GA 3MCRA 1Z1VA 4O3NA 5KFVA 3AQLA 2OH2A 1RQNA 4QZCA 2F77X 3AQFA 2ZIVB 4RQ5A 3GU3A 3ORYA 2PFQA 1RZTA 2EAPA 2HBLA 3GILA 2F76X 1FA0A 1SXEA 2XCAA 4Y2TA 1ZD5A 3GIJA 3EW9A 3SYZA 3H4DA 4Y2YA 5J0TA 2BCUA 4QWBA 2B0CA 5ALHA 1HJPA 1LKYA 1NZPA 3QU4A 3QU9A 2E8NA 4KN7A 1Q3UA 3NWIA 2GLEA 4WOYA 5IIIA 4Q43A 9ICPA 5KT7A 3R9KA 7ICKA 2WTFA 4E0DA 2G08A 7ICPA 4NLGA 3C28A 3NKUA 2ZH7A 4FO1A 2DL0A 5F9NA 1KFTA 5ALXA 4NXZA 4R63A 4DSJA 3OPXA 1PVRA 1D9DA 3ER8C 3WFOA 2YMPA 5KFNA 1Z3EB 4Y2SA 4RNOA 2VJ4A 4C7ZA 2DPJA 2GO7A 5KFLA 2HHSA 3F2CA 4QW8A 2KNJA 3HJEA 2PMZF 4MFAA 3C18A 8ICNA 4RQ7A 5KG1A 3UQ2A 2EQYA 3A0HU 3DDHA 1X40A 4IL6U 5DQHA 3UM9A 2W9CB 3ICXA 4Y2XA 1S0MA 2AHOB 3QUBA 5KFGA 2R8JA 4K8VA 2O6KA 3F2DA 3ER9B 3EWAA 1OUQA 2HW3A 5KG7A 3ZDAA 2HHVA 2F8LA 4RPYA 3VCBA 4UW9A 4X4TA 4DFDA 3NYBA 4FHVA 5EE9A 2HN1A 1N60A 4WC2A 3QEBZ 2JV3A 3QE9Y 1U9LA 2YB4A 1IIPA 5J0SA 1BPYA 5AKHA 3L5KA 1UA1A 9ICXA 3CP8A 3Q8LA 5J2DA 5J0YA 4WC5A 3PSFA 5KFQA 4PZOA 4ELUA 1SZHA 5EWFA 5GTHU 3C21A 1WUDA 5KL8B 5AKLA 1F5SA 3BQ7A 1D8LA 5AK4A 7ICFA 1XU4A 1LV5A 2RP5A 3SQIA 5CHEA 2UVUA 2WF8A 5AKZA 2ZIWA 2F1JA 3HIYA 3QU5A 4YCXA 2IOHA 3UPQA 4FE3A 1P7DA 4I2EA 1WYGA 2BCRA 1Q3VA 4UB3A 2K8BB 2QB0A 4KLMA 1IM4A 4EBCA 4O9MA 5KAIU 4RT3A 4TUSA 2IHNA 4DL4A 3BQ1A 2W3RA 2OXOA 5T14A 2C2RA 5AI5A 5H2FU 3V72A 3KD3A 1C20A 2OCEA 3H3AA 5HP4A 2JHDA 1CEZA 2E8OA 5J2EA 4KM5A 1QSYA 1QH9A 3OSNA 4P0QB 2HSZA 4N7RA 1MIWA 4LEVA 3C66A 5AHXA 4DL2A 1ZQSA 3BQTA 5KT2A 5AKEA 3PHZA 2LHTA 4O3PA 3K1ZA 5JTIA 2CN1A 3ZDEA 4NLZA 4P2HA 2YY6A 1TVAA 1QLNA 3OV7A 4RNNA 4LT6A 1ZQHA 1ZD2P 1XSPA 2W7PA 5L1KA 3C2KA 4Y2VA 4WJ3B 8ICAA 9ICHA 2OHFA 3NVZA 9ICAA 5CFUA 1ZJNA 4IRCA 1XWLA 4UQGA 2BQUA 4YXMA 4Y2RA 3WFQE 3HKZC 1ZQ1C 2ZH3A 4TUQA 2F1HA 2BQRA 3ED5A 3FYHA 5KFWA 4RQ1A 2HBKA 4KX3A 2LPEA 1UA0A 2W9AA 2R8KA 1MIVA 2BBHA 3RJGA 3V7JA 3C23A 4O5KA 5JU5A 1IG6A 2OM6A 1LKYB 4EX7A 4QWEA 4KLHA 3UXNA 4K4IA 2DVIA 4ECSA 3WFSC 5IIOA 5DG7A 4C8LA 4EEBA 3PSTA 4WC7A 3QXGA 5HR7A 1T4GA 4PHPA 8ICBA 1MA7A 4NKTA 4B6JA 2FLPA 4EZ6A 5F2VO 2NYVA 3BS5A 4Q45A 5IIKA 5AK6A 3KKAA 3B9JA 1TE2A 2ZTCA 2ATLA 4F93B 2PI5A 1V85A 1L3SA 1JALA 2JRZA 3WK9A 4E8FA 3IG8A 7ICRA 2E5SA 5EE3A 3WK6A 2XO7A 3H38A 4LZDA 1QQ5A 5DQGA 5BOLA 3FAHA 3B0XA 1RYSA 1B0XA 9ICUA 3DEEA 3OJSA 1SKRA 2ZH1A 4KTQA 4F4ZA 3NS1A 2UVWA 3BS7A 4EBJA 1NKCA 3NUQA 1KL9A 2VJ5A 5L1LA 5EWGA 4Q44A 4PPXA 4J9QA 3PX0A 2W04A 4YD2A 5AICA 3NVVA 2IMWP 4RWOA 4WC3A 4C80A 5D46A 5FP0A 3T3FA 3M9MB 2W8KA 4RWNA 4M2YA 4KLTA 1QQ6A 4DQIA 7ICMA 4RQ8A 3PO5A 9ICSA 2FJ6A 3EUB2 1S9FA 4EZ9A 1OU5A 4C8NA 4RPZA 2I9GA 1X6IA 1NZBA 4QZAA 5KG3A 2WB1F 4I0UA 3KZXA 4UAUA 4PH5A 4IG8A 2FPMA 5G5GA 5AI6A 8ICSA 4FHYA 1X9MA 2B21A 5D4BA 3TAPA 2KZMA 4O6AA 5IINA 4EP7A 3RH5A 5KT6A 4NV0A 1BPZA 3ISDA 2DR5A 5AM4A 4JLZA 1WOTA 2RFFA 2KMDA 4TQSA 4M04A 3GIMA 2HHTA 8ICYA 5AKXA 5F3XB 2NO4A 5ALDA 2FE9A 1ZQBA 2LM4A 3UMBA 1S0OA 8ICPA 1PUZA 4MEYA 3I28A 3SV4A 5HRDA 2E3TA 4J9KA 4HX0A 4NXVA 1SIJA 3UXOA 3AL0B 5DLGA 5ALLA 4AT9B 1X66A 3OSPA 5ALQA 2DR8A 3AEVA 3H8WA 4P0PB 2K89A 2PMZC 1R8BA 3MGHA 3M6ZA 1BVSA 1J2NA 4MHVA 3PR5B 1VFGA 4C7YA 2BDUA 2MA1A 2DKZA 2H3IA 3L9DA 4CF3A 2GOLA 1PZNA 2A1JB 4Q8EA 5ALWA 8ICUA 3AN1A 5DG9A 4J9SA 3SI8A 3V6JA 2BR0A 4DSLA 2KHVA 4QJFB 3UXPA 2WHEA 2BPFA 1JUDA 3EYZA 1QSSA 2DR9A 2ZJ5A 4QZ8A 2Y0SF 4OJ5A 1XS9D 7ICSA 1O08A 1SV4A 4EEDA 2H3QA 4M6WA 4JWMA 1HEKA 5KFYA 1D8YA 3AM9A 1CI4A 4S3NA 3LYSA 7ICJA 2K8AA 5TISU 5DKWA 5B3QA 1ZQKA 2KOBA 4NXUA 1ZQWA 5KFFA 1D8BA 1NNLA 1OXJA 2LYHA 1S97A 2UVVA 4YMMA 2HVHA 3H37A 5J8YA 2MUTA 2QARB 3MBYA 4X4SA 1ZQQA 1WCLA 2KZZA 5DGBA 1ZD3A 4DWIA 5KG2A 2Y9UA 2KSOA 2XI9A 1YZ6A 2AGOA 3T5JA 2NRXA 3IHQB 2IOFK 4YFKA 5AM3A 1TKDA 3CRXA 2D8CA 2ZG6A 5EE1A 1T94A 3IM1A 5AKJA 1SKWA 4UAVA 2YQEA 2HBJA 1TAQA 1Z1BA 1KSPA 1X2IA 1UEUA 4RQMA 1JQRA 4KLOA 2K8CB 1KEJA 1RM6C 3C1YA 1U4BA 2H5XA 4QZEA 2HHPA 3N7RC 4IRKA 4X5VA 5DB9A 2HOIA 3TARA 2JEGA 3D2NA 4AT8B 4FFDA 5K4LA 4UASA 2IUBA 3IP4B 3KTQA 3MR2A 2E1EA 4UAYA 7ICEA 2V9WA 3EPIA 4JMUA 2EWRA 5HRIA 5J2AA 3PSPA 4WC0A 1MIYA 4FBUA 4OAIZ 4NLKA 2F8KA 1RPLA 2ZTEA 4FZMA 4DFMA 3NRZA 4O3QA 2JZBA 5IIJA 1F5AA 4BX9C 4DQRA 4WC4A 1ZQMA 3M9OB 4BDPA 7ICGA 2LM1A 4I2HA 4US9A 3KHHA 2K4HA 3M1YA 4B9NA 4KLFA 3OVAA 4JLXA 5HNKA 2YMLA 1KFSA 4DL7A 5ALPA 3JPTA 3TAQA 1TAMA 4CE6A 2ZUBA 4C8MA 4DOAA 1BPEA 2KIWA 3JPOA 2OYYA 4WC6A 2I6XA 4MFFA 1BPDA 1KNYA 5ALKA 4RT2A 3ETLA 3QUCA 2Q66A 2ESEA 3WKBA 3EZ5A 4BXOA 4GFJA 2DRBA 4RPXA 3WKCA 1ZQZA 8ICJA 3Q8SB 2EH9A 4EBKA 3NTUA 4HAIA 5ALTA 4CRXA 1KN5A 1DK2A 5J0WA 1GO3F 2G5HB 3MR3A 4IQUA 2C2DA 9ICGA 2ZUCA 2HCFA 4B9MA 4FBTA 1QCKA 3C29A 4ED6A 4ATBB 2RRDA 7ICLA 2V4RA 3BQ0A 3N97B 3PMNA 3MR6A 4AT7B 3HT3A 1O03A 3RBDA 4TURA 4KLLA 1KFDA 4EYIB 5AK5A 3GIIA 4NLBA 5DQIA 2FLNA 4DL3A 3WKEA 1TK0A 4YMOA 3HX0A 2ID1A 4O3RA 1K1SA 2LBOA 2YTUA 5AI9A 1NJYA 4WQLA 2ZHBA 5KFOA 1ZQJA 3C5FA 2RQ5A 1XSNA 2WF5A 8ICTA 1KTQA 5AI0A 9ICCA 4UB2A 4ECZA 1SZPA 5HRFA 2VIXA 7ICOA 2A19A 1TFWA 2EZXA 4KITB 3AQNA 1A0PA 1SV0C 4ED3A 3JPRA 2NRZA 4F71A 3HPOA 5DLFA 4QZDA 5KT3A 4GXIA 4IQTA 5BOMA 2W3SA 3BJYA 2MSNA 3HP6A 2ZXIA 2KVCA 3M8SA 3LDAA 5C5JA 2W55A 3CW2C 5C0YA 1QTMA 2M2WA 3KHRA 2WB1C 5HHIA 2FLLA 4JB3A 2B56A 3WKAA 4CGZA 3BZCA 3FDSA 1L3VA 2HHXA 4X4PA 4BWJA 1SKSA 1NK6A 1NO5A 4FS2A 5D49A 2VA8A 4C0ZA 9ICFA 1T3NA 2DBYA 4PGYA 4F4WA 4RWQA 2L5YA 2JGAA 9ICEA 4EV6A 2BDPA 2HI0A 2ZHAA 1BPBA 3K1RB 3HILA 4XQ8A 3MR5A 2QB1A 4DFJA 7ICTA 3LWLA 4JV0A 3UMGA 2M0NA 1T7PA 4MKPA 8ICIA 4M0AA 4ED8A 8ICQA 5ALOA 4QW9A 4OJLA 1N63A 4DF4A 9ICRA 3AU6A 2I5HA 1L7OA 3J81j 4QWAA 2DGZA 2WAQF 4WBYA 2J6SA 4KB6A 3GV7B 2H3ZA 1KRPA 1B4FA 1JN3A 2W9BA 1URJA 1XO0A 1N5XA 3K7DA 2ZIUB 2IBKA 5CJ7A 4B9VA 4NL9C 1UHUA 5JRTA 4QZBA 4WC1A 4FHWA 3JPNA 5AKIA 4OJPA 1L7NA 3QEAZ 3WKDA 4KLUA 2Y0SC 4KX5A 2ODGA 1X9SA 3RRHA 3JCFA 5KAFU 3ZDBA 1KW4A 5KG0A 2KKPA 1XNSA 1Z00A 4K4HA 1ZQXA 5JUMA 3TI0A 4GIBA 1ZJMA 1PK1A 1X6JA 2W11A 2M2VA 4XUSA 2XICA 3RH6A 3TADC 2C28A 4ICAA 1BPXA 1DOQA 2E8MA 2YB1A 5AIAA 4NM1A 2K4IA 4GXJA 5EOZA 5DB6A 3GIKA 4JV1A 4O5EA 4QZFA 4YN4A 8ICEA 3H4BA 2AGPA 1MQ3A 2XY7A 1R8CA 5J0PA 4WCWA 4MF8A 3N28A 4F5NA 4QZIA 2RDJA 2PFPA 5KFSA 5J0UA 1RDFA 3GDXA 3TKAA 5ALEA 3E2EA 1ZQNA 4KMUA 2JXJA 3WK7A 2YMMA 3NRWA 4LEZA 1JROA 2Y9TA 4X0BA 4QIWF 3V6HA 1NKBA 2LMRA 4DOBA 1JXEA 4QZGA 3LVWA 3SMVA 3TFSA 2KE7A 1ZQDA 3SAHA 1NJWA 2FMSA 1COOA 1L3UA 4J9RA 3PW7A 4EBEA 1PVQA 4IR1A 4RQ6A 2KV2A 5ALFA 2KJ9A 2BCSA 5J2BA 4NXTA 4K98A 4JUZA 1R8AA 2PFNA 2R8HA 5HR6A 2K4PA 3D2QA 4ED1A 3MGVA 2PI4A 4NXWA 4EGWA 1UT8A 2R18A 3BQ2A 4I2CA 1KKXA 5DBCA 4PHDA 3N4MB 5DECA 2KG5A 3G6XA 1ZXIA 3Q8RB 2G06A 1MSWD 2ZH5A 4I28A 4J9MA 2R8IA 4PZNA 4FH5A 3QYPA 4EELA 4EENA 1Y88A 3PVXA 5KFCA 4UB5A 3RAQA 1DRGA 4F4XA 2MRLA 4Q8FA 1LVHA 2BGWA 9ICVA 2KJ5A 5AI8A 3OUYA 3E0FA 3TFRA 3H0RB 3RTVA 1UT5A 1L7PA 2O1PA 3T5HA 2G5IB 4RWPA 4US8A 3GFKB 4O68A 4F91B 3F2BA 3QUQA 2ASLA 9ICQA 1PVPA 2KP7A 4RUAA 3FM9A 2YN4A 4CCHA 4U7CA 3AQKA 4DL6A 3WFPA 1SWWA 3PMLA 3ZD9A 5G5HA 1N48A 4R8UA 5KTQA 1NK9A 3GQCA 3RJJA 3OJUA 5J2JA 2G09A 2DUYA 5KFAA 4ED2A 3D6JA 3F53A 1TK8A 2AGQA 3K75D 1OW5A 1YLQA 1A6SA 3I1YA 2EDUA 3EF2A 4PJ0U 1NK0A 5J2CA 5HRHA 2KVSA 2ZIWB 3TQ1A 5JTGA 5CWRA 5CRXA 3H39A 3N7SC 5HMLA 4B9SA 3IDWA 2GWSA 5AM5A 7ICVA 5AM0A 5CP2A 4PL1A 3H40A 2QB0B 3SENA 1U49A 4AP9A 3B0YA 9ICKA 1SL2A 5D62A 1FIQA 1ZQGA 2ZIVA 4Z6DA 4LEYA 1VJ7A 1JIHA 4IQVA 1HIWA 2W03A 3LQCB 8ICRA 2VA2A 3KBBA 4DQQA 4DSFA 1VDVA 9ICBA 2IHOA 3ONNA 4USAA 4O3SA 3D2SA 4K4GA 2ZH9A 1RXVA 4F2SA 3H8JA 3PX6A 2JH7A 2AXTU 3LVVA 3RJKA 1UQVA 2ZTDA 4EEYA 3CYMA 1PX5A 5AI4A 2K4EA 1U45A 4I27A 1BGXT 2BPGA 4M9LA 1RQLA 1F0MA 2LI6A 2LYBA 4F5QA 3F5AA 3V7KA 4RQ4A 1XC9A 3WK8A 9ICTA 4M5DA 1TFYA 8ICFA 4WBZA 3QNMA 3RB4A 4ACOA 5KG4A 5TZVA 3PO4A 2JR5A 1C7YA 4IRDA 5J2GA 4PHEA 1NKEA 2E1FA 2IA6A 1BNPA 3PSIA 5L1JA 4F50A 1NK8A 2WAQC 3ISBA 2W7OA 2HVIA 4MFCA 2VANA 3H0LB 5ALRA 2PKEA 4IQWA 1Q46A 1L3TA 4DFKA 2W9CA 3SZ2A 4EBDA 3AMZA 3SV3A 4UD5A 2DF4B 8ICHA 3PR4A 2NRVA 1Q79A 3QUTA 5AKKA 4CF5A 2WF7A 4UB4A 4YQWA 3G6YA 4M9GA 4I2FA 7ICIA 1KQQA 2JH1A 1TAUA 2QKQA 5CEHA 5AKGA 5CR0A 4F3OA 3BS5B 3NVOA 2Q4TA 5HMMA 1PK3A 2GA9D 1JMSA 2M2UA 4I29A 2QLTA 2ZH4A 9ICLA 4Y2QA 2J6UA 5E79U 2RLTA 4G3IA 8ICXA 5CB1A 2YX8A 3KOOA 1VJ5A 3MC1A 4F5PA 1XSLA 4GC6A 9ICNA 2DKXA 2XGPA 1S10A 1F44A 2EZYA 3RB0A 2MU2A 5KT5A 2JMGA 3QX7A 2DPIA 3NVWA 3SAGA 3QU7A 2FCLA 1ZQAA 2XIDA 1AQ6A 3T5LA 1ZRNA 2HN2A 3ZDDA 1GPJA 4J9PA 1V4AA 4O0IA 2NRKA 2RDIA 3RR7A 3BDPA 3WU2U 5ALMA 4KN4A 3V7LA 1SWVA 3THVA 4PHAA 5ALGA 4AYBF 1NJZA 1IXRA 3MFHA 3L3FX 2D3DA 3V6KA 5B5EU 3Q8MA 1LB2B 4QIWC 4O3OA 4MF2A 5DG8A 4X0AA 4DS4A 3MGIA 4DSKA 4XQ7A 4RQ2A 1J2MA 1K1QA 4RQ3A 2BCQA 5ALSA 5CFSA 5KFMA 3GV8B 4I2IA 5HREA 2ZJAA 4P0QA 1RG6A 4NM2A 3RH4A 2WF9A 5DBBA 1TFRA 4NLNA 5IIMA 5DDYA 2KICA 1U47A 4JK1A 5EE0A 4LVSA 4X4OA 1DGJA 5KFBA 4K9BA 1SXDA 4C8KA 4PL2A 4ECWA 4KMOB 1L8LA 3C2MA 7ICUA 2ASDA 4ELVA 4DO9A 5KG6A 2BQ3A 5KFRA 1D9FA 5CFTA 5J29A 4LZGA 4P4OA 3OVSA 1J97A 2NRWA 4OAHA 3RB3A 3QZ8A 9ICOA 2XCPA 4DS5A 4OJ6A 1TV9A 3RF9A 4J9NA 5DB8A 1FFVA 4R65A 1CUKA 2W9MA 5HRLA 3LK9A 1NK4A 3RJHA 4OO1J 4DOCA 4F4KA 1BNOA 4K97A 1NJXA 1NOMA 4GC7A 4F2RA 2B51A 2JEJA 3M7DA 1Z4NA 5BPCA 3MDCA 2XY6A 1DXSA 4UBBA 1ZQPA 4ZH4A 2P6RA 4DFPA 3CK6A 3FC4A 8ICWA 3IG5A 1A77A 4KLSA 3ISCA 3PY8A 1T3QA 1N2XA 2XY5A 4F8RA 1ZQLA 2KTQA 4M6WB 3MABA 2HHUA 1MQ2A 2NRTA 4B9TA 2N1RA 5ALZA 3RJFA 2UVRA 5CA7A 5HR9A 1X9XA 3ETRA 2F1IA 5KFXA 2O5AA 2DR7A 1AROP 5AM1A 1Q8KA 2ISPA 3DV9A 2HOFA 4NWIA 5DGAA 2MUTB 4OAGA 4C4TA 4R64A 2DQNB 1CRXA 2ZH2A 1SV0A 2KSOB 4E80A 3KZIU 2F44A 3JZ0A 1QQ7A 1S76D 1HUOA 1L7MA 4KLGA 3NASA 1QSLA 4Z6EA 2A3VA 4FO6A 1MC8A 3MDAA 4C4SA 1TK5A 2B6GA 2CPRA 4A8EA 2AU0A 4OAFA 2ZIXA 2HBMA 2LYAA 1RYUA 4UATA 1KLNA 2KHQA 1N62A 5AK3A 5KFIA 3RBEA 2FPKA 4UAWA 4XRHA 2BKEA 1B43A 3HWTA 1ZQYA 4ED0A 1JXLA 5KT4A 1YZ7A 8ICGA 3KFUF 2ZH6A 2IOFA 2G07A 1JX4A 4IR9A 1EXNA 1Z4OA 3SAFA 3HW8A 5J2IA 4M9NA 2KFNA 3AQMA 5KNIA 4K9AA 1VLBA 2KEYA 1WWUA 5J0XA 4CDGA 2JZBB 4BWMA 4E7XA 2WF6A 4X4RA 9ICJA 8ICLA 4XA5A 4DSEA 1S0VA 3RRGA 2BPCA 5D61A 2DWQA 2NV3A 5KFPA 2GH1A 4RU9A 2FMPA 3RJEA 3PW0A 4I2DA 5L9XA 3QZ7A 4AT9A 4YR2A 5HRKA 4I2BA 1JI7A 1SB3C 4P0PA 4NL9A 5DEDA 3VC8A 3OHBA 4P4MA 4X4VA 2EAOA 4QWCA 4BXOB 2P35A 4NLCA 2IHMA 2C22A 2EANA 9ICWA 5ALYA 2AQ0A 4EX6A 3C1ZA 3WFRE 2A1JA 5DBAA 4F5RA 1SL1A 3PZPA 4ECQA 5HHHA 4F92B 5DB7A 2DFLA 1UEVA 4F5OA 1X9WA 8ICCA 3Q8QB 2C2EA 5GTIU 3TADA 4YXJA 2G0AA 2XVTA 2BZFA 3Q8PB 3SR6A 4DLEA 1ZRMA 1KDHA 4DL5A 2AH5A 3JPQA 4O69A 4I2JA 3NVYA 5HC9A 3KKAC 2VKQA 2D6FC 1DGSA 4IS7A 3S6JA 4Z6CA 3M9NB 2B4VA 2HDOA 3KHLA 2KD1A 3OTQA 2M2TA 4BJQA 5J2KA 4X4UA 5ALUA 3EPGA 2QARA 4M9JA 4JV2A 1X42A 7ICNA 4M47A 4O3MA 2RHFA 5L1MA 5F9LA 5B3PA 3RAXA 4UB6U 3JPSA 5B66U 3C5GA 2ALZA 4B9LA 5KFDA 2FMQA 2R8GA 5J0RA 4AYBC 2HOQA 3UQ0A 1ZD4A 4I2AA 1WCNA 2WFAA 4K99A 5A0LA 2ES6A 4KLQA 4GLXA 3RJIA 1NK5A 2V4QA 1B22A 4YR3A 4OCZA 3PW2A 2Q0ZX 1ZQTA 4AT8A 4OJOA 1N56A 2JEIA 5J2HA 4ECTA 5AKYA 2KZ3A 2BBJA 2XC9A 4FS1A 4QWDA 1ZQEA 2W43A 4QZHA 3OGUA 4NJ8A 4MEXA 1COKA 2P6UA 1JRPA 3GV5B 3QU2A 4J9OA 4PGXA 2OEHA 1UPHA 4F4YA 3RFAA 4Y2UA 2FPLA 2ZIXB 4ED7A 4BUGA 4DSIA 2K60A 4YR0A 1L8OA 3OWGA 4YMNA 4DLGA 4WH5A 1S77D 2XGQA 3E58A 2HHWA 5IILA 3I76A 5KG5A 2W9BB 4DQSA 9ICIA 1V97A 4FZLA 5KFJA 3TACB 5KFUA 1ZQFA 3M8RA 3H7IA 2F3NA 5ALNA 2GAFD 4RNMA 1L5UA 2FI1A 2LKYA 4QNLA 1H38A 1FEZA 4PGQA 3OVBA 2H3VA 4J03A 4Y2PA 4FH3A 2KJ8A 5KL1B 3T79A 4ELTA 1N5WA 1DK3A 2HMXA 2W54A 4OD0A 4KLEA 2HHQA 5AM2A 5KFKA 1Z00B 4IC9A 4NKUA 4TQRA 3ZDCA 4FHXA 1ZQOA 4CNQA 4ATBA 1PK1B 3PW4A 1ZYQA 3H8MA 1SL0A 2EZZA 4AT7A 5J2FA 4I2GA 4DCCA 1M6YA 2JEFA 5KFHA 3JPPA 4QZ9A 3IN5A 7ICQA 4O67A 4F72A 3SD7A 1YT3A 1HUZA 3RB6A 4LJXA 4ZOHC 4KLIA 4RZRA 3OHAA 4BGDA 3N7PD 3PNCA 5HRBA 3LWMA 4X4NA 2Y1JA 4ECXA 3PX4A 4CF4A
chains in the Genus database with same CATH topology
4QW9A 4DF4A 9ICRA 3AU6A 4Q45A 1K1QA 4RQ3A 5IIKA 4QWAA 1ZETA 2BCQA 1Q78A 1RYRA 5KFMA 4WBYA 2J6SA 4GXKA 2ATLA 2ZTCA 4YD1A 4X4QA 4F93B 3GV7B 4I2IA 3GV8B 2ZJAA 5HREA 2PI5A 1L3SA 1KRPA 4NM2A 3RH4A 4E8FA 5DBBA 1TFRA 4NLNA 1JN3A 7ICRA 2W9BA 3H8SA 5DDYA 2XO7A 5IIMA 4JK1A 4UAZA 1U47A 3H38A 4LZDA 4LVSA 3UPSA 5DQGA 2PFOA 2IBKA 5KFBA 5CJ7A 7ICHA 4B9VA 4X4OA 4DQPA 4ECUA 1NK7A 1ZQCA 4C8KA 4B9UA 2OWOA 5BOLA 4ECWA 8ICKA 4QZBA 3B0XA 1RYSA 3C2MA 9ICUA 2ZH8A 4WC1A 1R89A 7ICUA 4FHWA 3OJSA 1SKRA 2ASDA 3JPNA 4ELVA 2ZH1A 4DO9A 5KG6A 2BQ3A 5KFRA 1D9FA 4KTQA 4F4ZA 2UVWA 5J29A 3QEAZ 4LZGA 4P4OA 1B22A 4KLUA 4EBJA 3OVSA 2NRWA 1NKCA 4UBCA 3PV8A 3RB3A 2Y1IA 3QZ8A 4YG2A 4KLDA 2ZUDA 1X9SA 2XCPA 4DS5A 1TV9A 3RRHA 9ICOA 4J9NA 5DB8A 3ZDBA 4R65A 3TANA 1CUKA 2W9MA 5L1LA 5EWGA 5KG0A 5DDMA 4Q44A 4PPXA 3LK9A 4J9QA 1Z00A 3PX0A 1XO1A 1NK4A 1ZQIA 2VA3A 2PXIA 4DOCA 3RJHA 4K4HA 4NY8A 4F4KA 4YD2A 1ZQXA 5JUMA 3G6VA 4FHPA 3TI0A 1BNOA 1ZJMA 2AJQA 1NJXA 2IMWP 4RWOA 1NOMA 2M2VA 4XUSA 4WC3A 5D46A 4GC7A 3RH6A 3T3FA 4F2RA 2BHNA 5L1IA 2C28A 2JEJA 3M9MB 2W8KA 1BPXA 1DOQA 5BPCA 3MDCA 4RWNA 4M2YA 2XY6A 4EYHB 4KLTA 2KFZA 4NM1A 4UBBA 1ZQPA 4ZH4A 2P6RA 8ICMA 4DFPA 4DQIA 7ICMA 4RQ8A 4YP3A 4GXJA 5EOZA 3PO5A 5DB6A 4ECRA 9ICSA 3KHGA 3GIKA 1S9FA 4JV1A 8ICWA 4KLSA 1A77A 5HRGA 4EZ9A 3ISCA 1ZQUA 4RUCA 4C8NA 3PY8A 5CHGA 1OU5A 2XY5A 4O5EA 4QZFA 4RPZA 2I9GA 4KLJA 3JYYA 4QZAA 4F8RA 1ZQLA 4YN4A 4YVZA 5KG3A 2KTQA 2DRAA 4M6WB 8ICEA 4TUPA 4PH5A 3H4BA 2AGPA 2MAXA 4IG8A 2ASJA 1MQ3A 2FPMA 2ZJ8A 4J9LA 2XY7A 1R8CA 3MABA 5J0PA 1MQ2A 2HHUA 4MF8A 2NRTA 4WCWA 4F5NA 4B9TA 8ICSA 4FHYA 1X9MA 2B21A 4R66A 5D4BA 3TAPA 2UVRA 5CA7A 5IINA 3RJFA 4QZIA 2RDJA 2PFPA 3RH5A 3MFIA 5KT6A 5KFSA 5HR9A 3C2LA 1BPZA 3ISDA 2DR5A 5J0UA 2P66A 3GDXA 2F1IA 5KFXA 4P4PA 1WOTA 1T8EA 2O5AA 4TQSA 4M04A 2RFFA 2DR7A 4UB1A 3GIMA 2ISOA 2HHTA 1AROP 8ICVA 3E2EA 1A76A 1ZQNA 4KMUA 8ICYA 2ISPA 2J6TA 4C8OA 3OUYB 5DGAA 1UETA 1ZQBA 2MUTB 4X0BA 4ECVA 1S0OA 8ICPA 3V6HA 1NKBA 3SV4A 4MEYA 1ZQVA 4M9HA 4DOBA 5HRDA 4R64A 1JXEA 4QZGA 4J9KA 1U48A 3UXOA 2ZH2A 5DLGA 3RR8A 1JAJA 2AQ4A 4AT9B 4E80A 4DEZA 3Q8KA 3TFSA 3OSPA 3JZ0A 1ZQDA 1NJWA 2FMSA 5F2VO 1COOA 2DR8A 2I1QA 3H8WA 4J9RA 3PW7A 3T5KA 4EBEA 1L3UA 1S76D 1HUOA 1V9PA 1R8BA 2M9NA 4RQ0A 3MGHA 4DF8A 4KLGA 9ICMA 1BVSA 4IR1A 4RQ6A 3HJ1A 1QSLA 2PBEA 4Z6EA 5J2BA 2BCSA 4FO6A 4JUZA 1R8AA 1MC8A 3PR5B 3MDAA 1TK5A 2PFNA 2R8HA 5KFEA 3ZD8A 1VFGA 4R8UB 2AU0A 2BCVA 4ED1A 5J0OA 3L9DA 5KFTA 1ZQRA 1PZNA 2A1JB 4ECYA 1KLNA 2PI4A 4Q8EA 2KN7A 4O5CA 2W8LA 8ICUA 5DG9A 4J9SA 3SI8A 1UT8A 3NGDA 3V6JA 5KFIA 4HYKA 3RBEA 2BR0A 4DSLA 1RXWA 2FPKA 4UAWA 2BE3A 4XRHA 3BQ2A 2BKEA 3UXPA 4I2CA 1B43A 1S0NA 3HWTA 5DBCA 1ZQYA 3EYZA 2BPFA 1QSSA 4PHDA 5EWEA 3N4MB 4ED0A 2DR9A 1JXLA 5KT4A 2ZJ5A 4QZ8A 5DECA 3G6XA 8ICGA 3Q8RB 1XS9D 2ZH6A 7ICSA 4UD4A 1JX4A 5J0QA 1MSWD 3AU2A 2ZH5A 4IR9A 1EXNA 3AUOA 4I28A 4JWNA 3HW8A 5J2IA 4M6WA 2R8IA 4J9MA 3PW5A 4M9NA 2KFNA 4JWMA 3AQMA 4FH5A 5KFZA 5KFYA 1D8YA 4S3NA 4Z6FA 1Y88A 8ICZA 7ICJA 3PVXA 5KFCA 4UB5A 3K4GA 3RAQA 4F4XA 5DKWA 5J0XA 1ZQKA 2JZBB 4BWMA 4Q8FA 4E7XA 4O3NA 5KFVA 2KZMA 3AQLA 1ZQWA 5KFFA 2BGWA 4X4RA 9ICJA 9ICVA 8ICLA 4QZCA 2LYHA 8ICQA 4RQ5A 1S97A 3ORYA 2UVVA 4EP7A 4XA5A 4YMMA 4DSEA 2PFQA 1RZTA 1S0VA 3RRGA 3OUYA 2HVHA 2BPCA 3H37A 3TFRA 2MUTA 3MBYA 4X4SA 5KFPA 3GILA 1ZQQA 1FA0A 2XCAA 1WCLA 2KZZA 3RTVA 5DGBA 4RU9A 1UT5A 3EW9A 3GIJA 3H4DA 3SYZA 3PW0A 2FMPA 4I2DA 5L9XA 5KG2A 3T5HA 5J0TA 4DWIA 3QZ7A 2BCUA 2O1PA 4RWPA 4AT9A 3GFKB 4QWBA 4F91B 4YR2A 2AGOA 3T5JA 5HRKA 2NRXA 4I2BA 1HJPA 3IHQB 2ASLA 9ICQA 1NZPA 4YFKA 4RUAA 2KP7A 4KN7A 1TKDA 4CCHA 5DEDA 5IIIA 3OHBA 4Q43A 3AQKA 4DL6A 9ICPA 5KT7A 3WFPA 3IM1A 3PMLA 3ZD9A 7ICKA 4P4MA 2WTFA 4X4VA 1SKWA 4E0DA 1N48A 7ICPA 4QWCA 4NLGA 5HRLA 4BXOB 4R8UA 2IHMA 1TAQA 5KTQA 1NK9A 2C22A 3GQCA 3RJJA 1KSPA 1X2IA 9ICWA 3OJUA 2ZH7A 1UEUA 2AQ0A 5F9NA 5J2JA 8ICOA 1KFTA 4NXZA 3C1ZA 1JQRA 5KFAA 4R63A 4ED2A 3WFRE 4KLOA 4DSJA 2A1JA 5DBAA 4F5RA 1KEJA 1SL1A 1D9DA 4ECQA 3C1YA 5HHHA 1U4BA 3WFOA 4F92B 5DB7A 5KFNA 2H5XA 2DFLA 4QZEA 1TK8A 2HHPA 2AGQA 1Z3EB 3K75D 4RNOA 1UEVA 4F5OA 1X9WA 4IRKA 4X5VA 5DB9A 1YLQA 3TARA 2JEGA 2DPJA 8ICCA 5KFLA 3Q8QB 2C2EA 2HHSA 4AT8B 4QW8A 3KTQA 4MFAA 1NK0A 3C18A 3MR2A 4YXJA 4RQ7A 5J2CA 4UAYA 7ICEA 8ICNA 3TQ1A 2V9WA 5HRHA 3EPIA 5KG1A 5CWRA 3Q8PB 3UQ2A 5DQHA 3H39A 5HRIA 5J2AA 4DLEA 4WC0A 5HMLA 4B9SA 2W9CB 2GWSA 1S0MA 1MIYA 1KDHA 4FBUA 4DL5A 7ICVA 5CP2A 3H40A 3JPQA 4NLKA 5KFGA 1RPLA 2ZTEA 2R8JA 4I2JA 4DFMA 4O3QA 2JZBA 5HC9A 1U49A 3B0YA 5IIJA 9ICKA 1F5AA 4DQRA 1SL2A 4WC4A 1DGSA 3M9NB 4Z6CA 1ZQMA 3EWAA 3KHLA 3M9OB 1ZQGA 5KG7A 3ZDAA 4BDPA 7ICGA 2HW3A 4Z6DA 2HHVA 4I2HA 4RPYA 2M2TA 1VJ7A 1JIHA 5J2KA 1NO5A 4X4TA 3EPGA 3KHHA 4X4UA 4M9JA 4JV2A 4IQVA 7ICNA 3LQCB 3NYBA 4B9NA 4KLFA 8ICRA 4FHVA 3OVAA 5HNKA 2VA2A 4M47A 4DQQA 4DSFA 1KFSA 9ICBA 4DL7A 3TAQA 3JPTA 4O3SA 5F9LA 4WC2A 3QEBZ 3RAXA 2ZUBA 4K4GA 3JPSA 2ZH9A 3C5GA 4C8MA 4DOAA 1BPEA 2ALZA 1RXVA 4B9LA 3JPOA 4F2SA 3QE9Y 3H8JA 5KFDA 3PX6A 4WC6A 1U9LA 2FMQA 2R8GA 3RJKA 5J0RA 4MFFA 2ZTDA 4EEYA 1BPDA 5J0SA 1KNYA 1BPYA 1PX5A 4RT2A 3ETLA 1UA1A 9ICXA 3UQ0A 1U45A 4I27A 1BGXT 2Q66A 2BPGA 3EZ5A 4M9LA 4BXOA 4I2AA 2DRBA 1WCNA 4F5QA 3Q8LA 5J2DA 3V7KA 4RQ4A 4RPXA 1XC9A 9ICTA 1ZQZA 8ICJA 3Q8SB 5J0YA 4WC5A 4EBKA 5KFQA 4KLQA 4GLXA 4M5DA 1TFYA 3NTUA 8ICFA 4WBZA 3RJIA 4ELUA 1DK2A 5J0WA 5EWFA 3RB4A 5KG4A 4IQUA 5TZVA 3MR3A 2V4QA 2C2DA 4YR3A 2ZUCA 3C21A 1NK5A 1C7YA 3PO4A 5J2GA 4PHEA 4IRDA 3PW2A 1NKEA 2IA6A 4B9MA 1BNPA 1D8LA 4FBTA 2Q0ZX 1ZQTA 4AT8A 4ED6A 7ICFA 7ICLA 4ATBB 1XU4A 5L1JA 4F50A 1NK8A 1N56A 1LV5A 2JEIA 5J2HA 3ISBA 2V4RA 4ECTA 2HVIA 3BQ0A 3N97B 4MFCA 3PMNA 3MR6A 2VANA 2UVUA 4AT7B 2KZ3A 2F1JA 2XC9A 3HT3A 4FS1A 4QWDA 3RBDA 4IQWA 1ZQEA 1L3TA 4TURA 4DFKA 4KLLA 1KFDA 4EYIB 4QZHA 9ICGA 3HIYA 4YCXA 3OGUA 3GIIA 2W9CA 3SZ2A 4EBDA 5DQIA 3UPQA 2FLNA 4DL3A 4MEXA 3SV3A 2P6UA 4UD5A 1TK0A 4I2EA 8ICHA 3PR4A 2NRVA 3GV5B 2BCRA 1Q79A 4YMOA 3HX0A 4UB3A 4J9OA 2ID1A 4UB4A 4O3RA 1IM4A 4PGXA 4YQWA 4EBCA 1K1SA 4KLMA 4O9MA 4TUSA 4RT3A 3G6YA 1NJYA 2IHNA 4F4YA 4DL4A 3BQ1A 2ZHBA 2FPLA 5KFOA 1ZQJA 4M9GA 4I2FA 7ICIA 3C5FA 2C2RA 4ED7A 3V72A 1XSNA 4DSIA 8ICTA 1KTQA 3H3AA 1TAUA 5CR0A 4YR0A 9ICCA 4UB2A 4F3OA 4ECZA 5HP4A 5HMMA 1SZPA 4YMNA 4DLGA 5HRFA 1CEZA 7ICOA 3HJ4A 1TFWA 1JMSA 5J2EA 3RJEA 1S77D 2M2UA 4I29A 1QSYA 3OSNA 2ZH4A 9ICLA 2XGQA 4KITB 3AQNA 2J6UA 1MIWA 4G3IA 2HHWA 8ICXA 5CB1A 4ED3A 3JPRA 5IILA 3C66A 4DQSA 5KG5A 2W9BB 2NRZA 9ICIA 4DL2A 1XSLA 4F5PA 1ZQSA 4GC6A 9ICNA 3BQTA 3HPOA 5DLFA 5KFJA 4QZDA 5KFUA 5KT2A 5KT3A 2XGPA 1S10A 1ZQFA 4GXIA 4O3PA 3ZDEA 4NLZA 3RB0A 3M8RA 4P2HA 3H7IA 1TVAA 1QLNA 5KT5A 4IQTA 3OV7A 4RNNA 5BOMA 3BJYA 4LT6A 3HP6A 4RNMA 2DPIA 1ZQHA 1XSPA 3M8SA 3LDAA 5L1KA 1L5UA 5C5JA 1ZQAA 3T5LA 3C2KA 1H38A 4PGQA 3OVBA 8ICAA 9ICHA 3ZDDA 1QTMA 9ICAA 3KHRA 2M2WA 4FH3A 4J9PA 1ZJNA 4ELTA 5HHIA 2FLLA 4IRCA 1XWLA 4UQGA 2BQUA 4YXMA 1DK3A 4KLEA 2HHQA 1V4AA 5KFKA 4O0IA 1Z00B 2NRKA 3WFQE 2RDIA 3RR7A 4NKUA 2ZH3A 4TQRA 4TUQA 2F1HA 3FDSA 2BQRA 1ZQOA 3ZDCA 3FYHA 5KFWA 4FHXA 3BDPA 1L3VA 4RQ1A 4ATBA 4KN4A 3V7LA 2HHXA 3THVA 4X4PA 4BWJA 1SKSA 3PW4A 1ZYQA 1NK6A 1UA0A 1SL0A 4PHAA 2W9AA 2R8KA 4FS2A 1MIVA 5D49A 2VA8A 3RJGA 3V7JA 5J2FA 4AT7A 4I2GA 4X4NA 9ICFA 3C23A 1NJZA 2JEFA 4O5KA 5KFHA 1IXRA 1T3NA 4QWEA 3JPPA 4QZ9A 3MFHA 4KLHA 3UXNA 4K4IA 4PGYA 4F4WA 7ICQA 3V6KA 4RWQA 9ICEA 2DVIA 3Q8MA 2BDPA 4ECSA 1LB2B 1HUZA 4O3OA 3RB6A 1BPBA 4MF2A 2ZHAA 5DG8A 5IIOA 5DG7A 3WFSC 4X0AA 4XQ8A 4C8LA 4KLIA 3MR5A 4RZRA 4WC7A 3OHAA 4DFJA 4DS4A 7ICTA 4BGDA 1T4GA 3MGIA 3LWLA 4PHPA 3PNCA 4DSKA 4JV0A 3LWMA 1T7PA 8ICBA 5HRBA 2Y1JA 8ICIA 2FLPA 4NKTA 4ECXA 4EZ6A 3PX4A 4M0AA 4ED8A 4XQ7A 4RQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QW9 A;  4DF4 A;  9ICR A;  3AU6 A;  4Q45 A;  1K1Q A;  4RQ3 A;  5IIK A;  4QWA A;  1ZET A;  2BCQ A;  1Q78 A;  1RYR A;  5KFM A;  4WBY A;  2J6S A;  4GXK A;  2ATL A;  2ZTC A;  4YD1 A;  4X4Q A;  4F93 B;  3GV7 B;  4I2I A;  3GV8 B;  2ZJA A;  5HRE A;  2PI5 A;  1L3S A;  1KRP A;  4NM2 A;  3RH4 A;  4E8F A;  5DBB A;  1TFR A;  4NLN A;  1JN3 A;  7ICR A;  2W9B A;  3H8S A;  5DDY A;  2XO7 A;  5IIM A;  4JK1 A;  4UAZ A;  1U47 A;  3H38 A;  4LZD A;  4LVS A;  3UPS A;  5DQG A;  2PFO A;  2IBK A;  5KFB A;  5CJ7 A;  7ICH A;  4B9V A;  4X4O A;  4DQP A;  4ECU A;  1NK7 A;  1ZQC A;  4C8K A;  4B9U A;  2OWO A;  5BOL A;  4ECW A;  8ICK A;  4QZB A;  3B0X A;  1RYS A;  3C2M A;  9ICU A;  2ZH8 A;  4WC1 A;  1R89 A;  7ICU A;  4FHW A;  3OJS A;  1SKR A;  2ASD A;  3JPN A;  4ELV A;  2ZH1 A;  4DO9 A;  5KG6 A;  2BQ3 A;  5KFR A;  1D9F A;  4KTQ A;  4F4Z A;  2UVW A;  5J29 A;  3QEA Z;  4LZG A;  4P4O A;  1B22 A;  4KLU A;  4EBJ A;  3OVS A;  2NRW A;  1NKC A;  4UBC A;  3PV8 A;  3RB3 A;  2Y1I A;  3QZ8 A;  4YG2 A;  4KLD A;  2ZUD A;  1X9S A;  2XCP A;  4DS5 A;  1TV9 A;  3RRH A;  9ICO A;  4J9N A;  5DB8 A;  3ZDB A;  4R65 A;  3TAN A;  1CUK A;  2W9M A;  5L1L A;  5EWG A;  5KG0 A;  5DDM A;  4Q44 A;  4PPX A;  3LK9 A;  4J9Q A;  1Z00 A;  3PX0 A;  1XO1 A;  1NK4 A;  1ZQI A;  2VA3 A;  2PXI A;  4DOC A;  3RJH A;  4K4H A;  4NY8 A;  4F4K A;  4YD2 A;  1ZQX A;  5JUM A;  3G6V A;  4FHP A;  3TI0 A;  1BNO A;  1ZJM A;  2AJQ A;  1NJX A;  2IMW P;  4RWO A;  1NOM A;  2M2V A;  4XUS A;  4WC3 A;  5D46 A;  4GC7 A;  3RH6 A;  3T3F A;  4F2R A;  2BHN A;  5L1I A;  2C28 A;  2JEJ A;  3M9M B;  2W8K A;  1BPX A;  1DOQ A;  5BPC A;  3MDC A;  4RWN A;  4M2Y A;  2XY6 A;  4EYH B;  4KLT A;  2KFZ A;  4NM1 A;  4UBB A;  1ZQP A;  4ZH4 A;  2P6R A;  8ICM A;  4DFP A;  4DQI A;  7ICM A;  4RQ8 A;  4YP3 A;  4GXJ A;  5EOZ A;  3PO5 A;  5DB6 A;  4ECR A;  9ICS A;  3KHG A;  3GIK A;  1S9F A;  4JV1 A;  8ICW A;  4KLS A;  1A77 A;  5HRG A;  4EZ9 A;  3ISC A;  1ZQU A;  4RUC A;  4C8N A;  3PY8 A;  5CHG A;  1OU5 A;  2XY5 A;  4O5E A;  4QZF A;  4RPZ A;  2I9G A;  4KLJ A;  3JYY A;  4QZA A;  4F8R A;  1ZQL A;  4YN4 A;  4YVZ A;  5KG3 A;  2KTQ A;  2DRA A;  4M6W B;  8ICE A;  4TUP A;  4PH5 A;  3H4B A;  2AGP A;  2MAX A;  4IG8 A;  2ASJ A;  1MQ3 A;  2FPM A;  2ZJ8 A;  4J9L A;  2XY7 A;  1R8C A;  3MAB A;  5J0P A;  1MQ2 A;  2HHU A;  4MF8 A;  2NRT A;  4WCW A;  4F5N A;  4B9T A;  8ICS A;  4FHY A;  1X9M A;  2B21 A;  4R66 A;  5D4B A;  3TAP A;  2UVR A;  5CA7 A;  5IIN A;  3RJF A;  4QZI A;  2RDJ A;  2PFP A;  3RH5 A;  3MFI A;  5KT6 A;  5KFS A;  5HR9 A;  3C2L A;  1BPZ A;  3ISD A;  2DR5 A;  5J0U A;  2P66 A;  3GDX A;  2F1I A;  5KFX A;  4P4P A;  1WOT A;  1T8E A;  2O5A A;  4TQS A;  4M04 A;  2RFF A;  2DR7 A;  4UB1 A;  3GIM A;  2ISO A;  2HHT A;  1ARO P;  8ICV A;  3E2E A;  1A76 A;  1ZQN A;  4KMU A;  8ICY A;  2ISP A;  2J6T A;  4C8O A;  3OUY B;  5DGA A;  1UET A;  1ZQB A;  2MUT B;  4X0B A;  4ECV A;  1S0O A;  8ICP A;  3V6H A;  1NKB A;  3SV4 A;  4MEY A;  1ZQV A;  4M9H A;  4DOB A;  5HRD A;  4R64 A;  1JXE A;  4QZG A;  4J9K A;  1U48 A;  3UXO A;  2ZH2 A;  5DLG A;  3RR8 A;  1JAJ A;  2AQ4 A;  4AT9 B;  4E80 A;  4DEZ A;  3Q8K A;  3TFS A;  3OSP A;  3JZ0 A;  1ZQD A;  1NJW A;  2FMS A;  5F2V O;  1COO A;  2DR8 A;  2I1Q A;  3H8W A;  4J9R A;  3PW7 A;  3T5K A;  4EBE A;  1L3U A;  1S76 D;  1HUO A;  1V9P A;  1R8B A;  2M9N A;  4RQ0 A;  3MGH A;  4DF8 A;  4KLG A;  9ICM A;  1BVS A;  4IR1 A;  4RQ6 A;  3HJ1 A;  1QSL A;  2PBE A;  4Z6E A;  5J2B A;  2BCS A;  4FO6 A;  4JUZ A;  1R8A A;  1MC8 A;  3PR5 B;  3MDA A;  1TK5 A;  2PFN A;  2R8H A;  5KFE A;  3ZD8 A;  1VFG A;  4R8U B;  2AU0 A;  2BCV A;  4ED1 A;  5J0O A;  3L9D A;  5KFT A;  1ZQR A;  1PZN A;  2A1J B;  4ECY A;  1KLN A;  2PI4 A;  4Q8E A;  2KN7 A;  4O5C A;  2W8L A;  8ICU A;  5DG9 A;  4J9S A;  3SI8 A;  1UT8 A;  3NGD A;  3V6J A;  5KFI A;  4HYK A;  3RBE A;  2BR0 A;  4DSL A;  1RXW A;  2FPK A;  4UAW A;  2BE3 A;  4XRH A;  3BQ2 A;  2BKE A;  3UXP A;  4I2C A;  1B43 A;  1S0N A;  3HWT A;  5DBC A;  1ZQY A;  3EYZ A;  2BPF A;  1QSS A;  4PHD A;  5EWE A;  3N4M B;  4ED0 A;  2DR9 A;  1JXL A;  5KT4 A;  2ZJ5 A;  4QZ8 A;  5DEC A;  3G6X A;  8ICG A;  3Q8R B;  1XS9 D;  2ZH6 A;  7ICS A;  4UD4 A;  1JX4 A;  5J0Q A;  1MSW D;  3AU2 A;  2ZH5 A;  4IR9 A;  1EXN A;  3AUO A;  4I28 A;  4JWN A;  3HW8 A;  5J2I A;  4M6W A;  2R8I A;  4J9M A;  3PW5 A;  4M9N A;  2KFN A;  4JWM A;  3AQM A;  4FH5 A;  5KFZ A;  5KFY A;  1D8Y A;  4S3N A;  4Z6F A;  1Y88 A;  8ICZ A;  7ICJ A;  3PVX A;  5KFC A;  4UB5 A;  3K4G A;  3RAQ A;  4F4X A;  5DKW A;  5J0X A;  1ZQK A;  2JZB B;  4BWM A;  4Q8F A;  4E7X A;  4O3N A;  5KFV A;  2KZM A;  3AQL A;  1ZQW A;  5KFF A;  2BGW A;  4X4R A;  9ICJ A;  9ICV A;  8ICL A;  4QZC A;  2LYH A;  8ICQ A;  4RQ5 A;  1S97 A;  3ORY A;  2UVV A;  4EP7 A;  4XA5 A;  4YMM A;  4DSE A;  2PFQ A;  1RZT A;  1S0V A;  3RRG A;  3OUY A;  2HVH A;  2BPC A;  3H37 A;  3TFR A;  2MUT A;  3MBY A;  4X4S A;  5KFP A;  3GIL A;  1ZQQ A;  1FA0 A;  2XCA A;  1WCL A;  2KZZ A;  3RTV A;  5DGB A;  4RU9 A;  1UT5 A;  3EW9 A;  3GIJ A;  3H4D A;  3SYZ A;  3PW0 A;  2FMP A;  4I2D A;  5L9X A;  5KG2 A;  3T5H A;  5J0T A;  4DWI A;  3QZ7 A;  2BCU A;  2O1P A;  4RWP A;  4AT9 A;  3GFK B;  4QWB A;  4F91 B;  4YR2 A;  2AGO A;  3T5J A;  5HRK A;  2NRX A;  4I2B A;  1HJP A;  3IHQ B;  2ASL A;  9ICQ A;  1NZP A;  4YFK A;  4RUA A;  2KP7 A;  4KN7 A;  1TKD A;  4CCH A;  5DED A;  5III A;  3OHB A;  4Q43 A;  3AQK A;  4DL6 A;  9ICP A;  5KT7 A;  3WFP A;  3IM1 A;  3PML A;  3ZD9 A;  7ICK A;  4P4M A;  2WTF A;  4X4V A;  1SKW A;  4E0D A;  1N48 A;  7ICP A;  4QWC A;  4NLG A;  5HRL A;  4BXO B;  4R8U A;  2IHM A;  1TAQ A;  5KTQ A;  1NK9 A;  2C22 A;  3GQC A;  3RJJ A;  1KSP A;  1X2I A;  9ICW A;  3OJU A;  2ZH7 A;  1UEU A;  2AQ0 A;  5F9N A;  5J2J A;  8ICO A;  1KFT A;  4NXZ A;  3C1Z A;  1JQR A;  5KFA A;  4R63 A;  4ED2 A;  3WFR E;  4KLO A;  4DSJ A;  2A1J A;  5DBA A;  4F5R A;  1KEJ A;  1SL1 A;  1D9D A;  4ECQ A;  3C1Y A;  5HHH A;  1U4B A;  3WFO A;  4F92 B;  5DB7 A;  5KFN A;  2H5X A;  2DFL A;  4QZE A;  1TK8 A;  2HHP A;  2AGQ A;  1Z3E B;  3K75 D;  4RNO A;  1UEV A;  4F5O A;  1X9W A;  4IRK A;  4X5V A;  5DB9 A;  1YLQ A;  3TAR A;  2JEG A;  2DPJ A;  8ICC A;  5KFL A;  3Q8Q B;  2C2E A;  2HHS A;  4AT8 B;  4QW8 A;  3KTQ A;  4MFA A;  1NK0 A;  3C18 A;  3MR2 A;  4YXJ A;  4RQ7 A;  5J2C A;  4UAY A;  7ICE A;  8ICN A;  3TQ1 A;  2V9W A;  5HRH A;  3EPI A;  5KG1 A;  5CWR A;  3Q8P B;  3UQ2 A;  5DQH A;  3H39 A;  5HRI A;  5J2A A;  4DLE A;  4WC0 A;  5HML A;  4B9S A;  2W9C B;  2GWS A;  1S0M A;  1MIY A;  1KDH A;  4FBU A;  4DL5 A;  7ICV A;  5CP2 A;  3H40 A;  3JPQ A;  4NLK A;  5KFG A;  1RPL A;  2ZTE A;  2R8J A;  4I2J A;  4DFM A;  4O3Q A;  2JZB A;  5HC9 A;  1U49 A;  3B0Y A;  5IIJ A;  9ICK A;  1F5A A;  4DQR A;  1SL2 A;  4WC4 A;  1DGS A;  3M9N B;  4Z6C A;  1ZQM A;  3EWA A;  3KHL A;  3M9O B;  1ZQG A;  5KG7 A;  3ZDA A;  4BDP A;  7ICG A;  2HW3 A;  4Z6D A;  2HHV A;  4I2H A;  4RPY A;  2M2T A;  1VJ7 A;  1JIH A;  5J2K A;  1NO5 A;  4X4T A;  3EPG A;  3KHH A;  4X4U A;  4M9J A;  4JV2 A;  4IQV A;  7ICN A;  3LQC B;  3NYB A;  4B9N A;  4KLF A;  8ICR A;  4FHV A;  3OVA A;  5HNK A;  2VA2 A;  4M47 A;  4DQQ A;  4DSF A;  1KFS A;  9ICB A;  4DL7 A;  3TAQ A;  3JPT A;  4O3S A;  5F9L A;  4WC2 A;  3QEB Z;  3RAX A;  2ZUB A;  4K4G A;  3JPS A;  2ZH9 A;  3C5G A;  4C8M A;  4DOA A;  1BPE A;  2ALZ A;  1RXV A;  4B9L A;  3JPO A;  4F2S A;  3QE9 Y;  3H8J A;  5KFD A;  3PX6 A;  4WC6 A;  1U9L A;  2FMQ A;  2R8G A;  3RJK A;  5J0R A;  4MFF A;  2ZTD A;  4EEY A;  1BPD A;  5J0S A;  1KNY A;  1BPY A;  1PX5 A;  4RT2 A;  3ETL A;  1UA1 A;  9ICX A;  3UQ0 A;  1U45 A;  4I27 A;  1BGX T;  2Q66 A;  2BPG A;  3EZ5 A;  4M9L A;  4BXO A;  4I2A A;  2DRB A;  1WCN A;  4F5Q A;  3Q8L A;  5J2D A;  3V7K A;  4RQ4 A;  4RPX A;  1XC9 A;  9ICT A;  1ZQZ A;  8ICJ A;  3Q8S B;  5J0Y A;  4WC5 A;  4EBK A;  5KFQ A;  4KLQ A;  4GLX A;  4M5D A;  1TFY A;  3NTU A;  8ICF A;  4WBZ A;  3RJI A;  4ELU A;  1DK2 A;  5J0W A;  5EWF A;  3RB4 A;  5KG4 A;  4IQU A;  5TZV A;  3MR3 A;  2V4Q A;  2C2D A;  4YR3 A;  2ZUC A;  3C21 A;  1NK5 A;  1C7Y A;  3PO4 A;  5J2G A;  4PHE A;  4IRD A;  3PW2 A;  1NKE A;  2IA6 A;  4B9M A;  1BNP A;  1D8L A;  4FBT A;  2Q0Z X;  1ZQT A;  4AT8 A;  4ED6 A;  7ICF A;  7ICL A;  4ATB B;  1XU4 A;  5L1J A;  4F50 A;  1NK8 A;  1N56 A;  1LV5 A;  2JEI A;  5J2H A;  3ISB A;  2V4R A;  4ECT A;  2HVI A;  3BQ0 A;  3N97 B;  4MFC A;  3PMN A;  3MR6 A;  2VAN A;  2UVU A;  4AT7 B;  2KZ3 A;  2F1J A;  2XC9 A;  3HT3 A;  4FS1 A;  4QWD A;  3RBD A;  4IQW A;  1ZQE A;  1L3T A;  4TUR A;  4DFK A;  4KLL A;  1KFD A;  4EYI B;  4QZH A;  9ICG A;  3HIY A;  4YCX A;  3OGU A;  3GII A;  2W9C A;  3SZ2 A;  4EBD A;  5DQI A;  3UPQ A;  2FLN A;  4DL3 A;  4MEX A;  3SV3 A;  2P6U A;  4UD5 A;  1TK0 A;  4I2E A;  8ICH A;  3PR4 A;  2NRV A;  3GV5 B;  2BCR A;  1Q79 A;  4YMO A;  3HX0 A;  4UB3 A;  4J9O A;  2ID1 A;  4UB4 A;  4O3R A;  1IM4 A;  4PGX A;  4YQW A;  4EBC A;  1K1S A;  4KLM A;  4O9M A;  4TUS A;  4RT3 A;  3G6Y A;  1NJY A;  2IHN A;  4F4Y A;  4DL4 A;  3BQ1 A;  2ZHB A;  2FPL A;  5KFO A;  1ZQJ A;  4M9G A;  4I2F A;  7ICI A;  3C5F A;  2C2R A;  4ED7 A;  3V72 A;  1XSN A;  4DSI A;  8ICT A;  1KTQ A;  3H3A A;  1TAU A;  5CR0 A;  4YR0 A;  9ICC A;  4UB2 A;  4F3O A;  4ECZ A;  5HP4 A;  5HMM A;  1SZP A;  4YMN A;  4DLG A;  5HRF A;  1CEZ A;  7ICO A;  3HJ4 A;  1TFW A;  1JMS A;  5J2E A;  3RJE A;  1S77 D;  2M2U A;  4I29 A;  1QSY A;  3OSN A;  2ZH4 A;  9ICL A;  2XGQ A;  4KIT B;  3AQN A;  2J6U A;  1MIW A;  4G3I A;  2HHW A;  8ICX A;  5CB1 A;  4ED3 A;  3JPR A;  5IIL A;  3C66 A;  4DQS A;  5KG5 A;  2W9B B;  2NRZ A;  9ICI A;  4DL2 A;  1XSL A;  4F5P A;  1ZQS A;  4GC6 A;  9ICN A;  3BQT A;  3HPO A;  5DLF A;  5KFJ A;  4QZD A;  5KFU A;  5KT2 A;  5KT3 A;  2XGP A;  1S10 A;  1ZQF A;  4GXI A;  4O3P A;  3ZDE A;  4NLZ A;  3RB0 A;  3M8R A;  4P2H A;  3H7I A;  1TVA A;  1QLN A;  5KT5 A;  4IQT A;  3OV7 A;  4RNN A;  5BOM A;  3BJY A;  4LT6 A;  3HP6 A;  4RNM A;  2DPI A;  1ZQH A;  1XSP A;  3M8S A;  3LDA A;  5L1K A;  1L5U A;  5C5J A;  1ZQA A;  3T5L A;  3C2K A;  1H38 A;  4PGQ A;  3OVB A;  8ICA A;  9ICH A;  3ZDD A;  1QTM A;  9ICA A;  3KHR A;  2M2W A;  4FH3 A;  4J9P A;  1ZJN A;  4ELT A;  5HHI A;  2FLL A;  4IRC A;  1XWL A;  4UQG A;  2BQU A;  4YXM A;  1DK3 A;  4KLE A;  2HHQ A;  1V4A A;  5KFK A;  4O0I A;  1Z00 B;  2NRK A;  3WFQ E;  2RDI A;  3RR7 A;  4NKU A;  2ZH3 A;  4TQR A;  4TUQ A;  2F1H A;  3FDS A;  2BQR A;  1ZQO A;  3ZDC A;  3FYH A;  5KFW A;  4FHX A;  3BDP A;  1L3V A;  4RQ1 A;  4ATB A;  4KN4 A;  3V7L A;  2HHX A;  3THV A;  4X4P A;  4BWJ A;  1SKS A;  3PW4 A;  1ZYQ A;  1NK6 A;  1UA0 A;  1SL0 A;  4PHA A;  2W9A A;  2R8K A;  4FS2 A;  1MIV A;  5D49 A;  2VA8 A;  3RJG A;  3V7J A;  5J2F A;  4AT7 A;  4I2G A;  4X4N A;  9ICF A;  3C23 A;  1NJZ A;  2JEF A;  4O5K A;  5KFH A;  1IXR A;  1T3N A;  4QWE A;  3JPP A;  4QZ9 A;  3MFH A;  4KLH A;  3UXN A;  4K4I A;  4PGY A;  4F4W A;  7ICQ A;  3V6K A;  4RWQ A;  9ICE A;  2DVI A;  3Q8M A;  2BDP A;  4ECS A;  1LB2 B;  1HUZ A;  4O3O A;  3RB6 A;  1BPB A;  4MF2 A;  2ZHA A;  5DG8 A;  5IIO A;  5DG7 A;  3WFS C;  4X0A A;  4XQ8 A;  4C8L A;  4KLI A;  3MR5 A;  4RZR A;  4WC7 A;  3OHA A;  4DFJ A;  4DS4 A;  7ICT A;  4BGD A;  1T4G A;  3MGI A;  3LWL A;  4PHP A;  3PNC A;  4DSK A;  4JV0 A;  3LWM A;  1T7P A;  8ICB A;  5HRB A;  2Y1J A;  8ICI A;  2FLP A;  4NKT A;  4ECX A;  4EZ6 A;  3PX4 A;  4M0A A;  4ED8 A;  4XQ7 A;  4RQ2 A; 
#chains in the Genus database with same CATH topology
 4C4R A;  4NXX A;  5J8Y C;  1ZET A;  1Q78 A;  1RYR A;  4GXK A;  3WK4 A;  4YD1 A;  3F5E A;  4X4Q A;  1KBU A;  1N61 A;  4EEK A;  3H8S A;  1UCV A;  4UAZ A;  2ZXH A;  1SGG A;  7ICH A;  2PFO A;  3UPS A;  4DQP A;  4ECU A;  1NK7 A;  1ZQC A;  4WQK A;  4B9U A;  2OWO A;  8ICK A;  1ED1 A;  5AIB A;  3HRD D;  2E8P A;  3ZI4 A;  2ZH8 A;  1R89 A;  4UBC A;  3PV8 A;  2Y1I A;  4YG2 A;  4KLD A;  2ZUD A;  1S8O A;  2CXY A;  4LEW A;  3TAN A;  3IV6 A;  5DDM A;  1ZQI A;  1XO1 A;  4NY8 A;  2VA3 A;  2PXI A;  5ALI A;  4FHP A;  3SEI A;  3BZK A;  3G6V A;  2AJQ A;  4XJE A;  1Z19 A;  1FO4 A;  2BHN A;  5L1I A;  1K5O A;  3L4P A;  1V38 A;  4EYH B;  2KFZ A;  8ICM A;  4YP3 A;  1L6N A;  4ECR A;  3KHG A;  3U26 A;  5HRG A;  1ZQU A;  4RUC A;  5CHG A;  4KLJ A;  3UMC A;  3JYY A;  4YVZ A;  3ALR A;  2DRA A;  1NI3 A;  4TUP A;  2F2A B;  2MAX A;  2ASJ A;  3O0F A;  2ZJ8 A;  4Y2J A;  4J9L A;  3HKZ F;  4R66 A;  8ICO A;  1MN8 A;  3MFI A;  3C2L A;  1IV8 A;  2P66 A;  4P4P A;  3ERC C;  1T8E A;  4UB1 A;  2ISO A;  8ICV A;  2EAM A;  1A76 A;  2J6T A;  4C8O A;  1ECW A;  3OUY B;  1UET A;  2ZIU A;  4ECV A;  2KIV A;  1ZQV A;  4M9H A;  2KKV A;  5ALV A;  3A0B U;  1FFU A;  1U48 A;  4K96 A;  3RR8 A;  1JAJ A;  2AQ4 A;  4DEZ A;  3Q8K A;  5ALJ A;  2I1Q A;  3T5K A;  1V9P A;  2M9N A;  4RQ0 A;  4DF8 A;  9ICM A;  3CNH A;  4RQN A;  3HJ1 A;  2PBE A;  5KFE A;  3ZD8 A;  3IRU A;  4G9B A;  4R8U B;  1ZOL A;  3AQE A;  2BCV A;  2KK0 A;  5J0O A;  5KFT A;  1ZQR A;  4ECY A;  2KN7 A;  4O5C A;  2W8L A;  4FZN A;  3NGD A;  1WG8 A;  4HYK A;  2H3F A;  2BE3 A;  3HJ4 A;  1RXW A;  2YMQ A;  1S0N A;  4UAR A;  2NO5 A;  5EWE A;  3GZF A;  5D63 A;  4UD4 A;  5J0Q A;  3WK5 A;  3H0M B;  3AU2 A;  3M6K A;  3AUO A;  4JWN A;  1S5L U;  3PW5 A;  2FDR A;  2Z7J A;  5KFZ A;  2A1A A;  2CRX A;  4UB8 U;  4Z6F A;  8ICZ A;  1WWV A;  4U6P A;  3K4G A;  3MCR A;  1Z1V A;  4O3N A;  5KFV A;  3AQL A;  2OH2 A;  1RQN A;  4QZC A;  2F77 X;  3AQF A;  2ZIV B;  4RQ5 A;  3GU3 A;  3ORY A;  2PFQ A;  1RZT A;  2EAP A;  2HBL A;  3GIL A;  2F76 X;  1FA0 A;  1SXE A;  2XCA A;  4Y2T A;  1ZD5 A;  3GIJ A;  3EW9 A;  3SYZ A;  3H4D A;  4Y2Y A;  5J0T A;  2BCU A;  4QWB A;  2B0C A;  5ALH A;  1HJP A;  1LKY A;  1NZP A;  3QU4 A;  3QU9 A;  2E8N A;  4KN7 A;  1Q3U A;  3NWI A;  2GLE A;  4WOY A;  5III A;  4Q43 A;  9ICP A;  5KT7 A;  3R9K A;  7ICK A;  2WTF A;  4E0D A;  2G08 A;  7ICP A;  4NLG A;  3C28 A;  3NKU A;  2ZH7 A;  4FO1 A;  2DL0 A;  5F9N A;  1KFT A;  5ALX A;  4NXZ A;  4R63 A;  4DSJ A;  3OPX A;  1PVR A;  1D9D A;  3ER8 C;  3WFO A;  2YMP A;  5KFN A;  1Z3E B;  4Y2S A;  4RNO A;  2VJ4 A;  4C7Z A;  2DPJ A;  2GO7 A;  5KFL A;  2HHS A;  3F2C A;  4QW8 A;  2KNJ A;  3HJE A;  2PMZ F;  4MFA A;  3C18 A;  8ICN A;  4RQ7 A;  5KG1 A;  3UQ2 A;  2EQY A;  3A0H U;  3DDH A;  1X40 A;  4IL6 U;  5DQH A;  3UM9 A;  2W9C B;  3ICX A;  4Y2X A;  1S0M A;  2AHO B;  3QUB A;  5KFG A;  2R8J A;  4K8V A;  2O6K A;  3F2D A;  3ER9 B;  3EWA A;  1OUQ A;  2HW3 A;  5KG7 A;  3ZDA A;  2HHV A;  2F8L A;  4RPY A;  3VCB A;  4UW9 A;  4X4T A;  4DFD A;  3NYB A;  4FHV A;  5EE9 A;  2HN1 A;  1N60 A;  4WC2 A;  3QEB Z;  2JV3 A;  3QE9 Y;  1U9L A;  2YB4 A;  1IIP A;  5J0S A;  1BPY A;  5AKH A;  3L5K A;  1UA1 A;  9ICX A;  3CP8 A;  3Q8L A;  5J2D A;  5J0Y A;  4WC5 A;  3PSF A;  5KFQ A;  4PZO A;  4ELU A;  1SZH A;  5EWF A;  5GTH U;  3C21 A;  1WUD A;  5KL8 B;  5AKL A;  1F5S A;  3BQ7 A;  1D8L A;  5AK4 A;  7ICF A;  1XU4 A;  1LV5 A;  2RP5 A;  3SQI A;  5CHE A;  2UVU A;  2WF8 A;  5AKZ A;  2ZIW A;  2F1J A;  3HIY A;  3QU5 A;  4YCX A;  2IOH A;  3UPQ A;  4FE3 A;  1P7D A;  4I2E A;  1WYG A;  2BCR A;  1Q3V A;  4UB3 A;  2K8B B;  2QB0 A;  4KLM A;  1IM4 A;  4EBC A;  4O9M A;  5KAI U;  4RT3 A;  4TUS A;  2IHN A;  4DL4 A;  3BQ1 A;  2W3R A;  2OXO A;  5T14 A;  2C2R A;  5AI5 A;  5H2F U;  3V72 A;  3KD3 A;  1C20 A;  2OCE A;  3H3A A;  5HP4 A;  2JHD A;  1CEZ A;  2E8O A;  5J2E A;  4KM5 A;  1QSY A;  1QH9 A;  3OSN A;  4P0Q B;  2HSZ A;  4N7R A;  1MIW A;  4LEV A;  3C66 A;  5AHX A;  4DL2 A;  1ZQS A;  3BQT A;  5KT2 A;  5AKE A;  3PHZ A;  2LHT A;  4O3P A;  3K1Z A;  5JTI A;  2CN1 A;  3ZDE A;  4NLZ A;  4P2H A;  2YY6 A;  1TVA A;  1QLN A;  3OV7 A;  4RNN A;  4LT6 A;  1ZQH A;  1ZD2 P;  1XSP A;  2W7P A;  5L1K A;  3C2K A;  4Y2V A;  4WJ3 B;  8ICA A;  9ICH A;  2OHF A;  3NVZ A;  9ICA A;  5CFU A;  1ZJN A;  4IRC A;  1XWL A;  4UQG A;  2BQU A;  4YXM A;  4Y2R A;  3WFQ E;  3HKZ C;  1ZQ1 C;  2ZH3 A;  4TUQ A;  2F1H A;  2BQR A;  3ED5 A;  3FYH A;  5KFW A;  4RQ1 A;  2HBK A;  4KX3 A;  2LPE A;  1UA0 A;  2W9A A;  2R8K A;  1MIV A;  2BBH A;  3RJG A;  3V7J A;  3C23 A;  4O5K A;  5JU5 A;  1IG6 A;  2OM6 A;  1LKY B;  4EX7 A;  4QWE A;  4KLH A;  3UXN A;  4K4I A;  2DVI A;  4ECS A;  3WFS C;  5IIO A;  5DG7 A;  4C8L A;  4EEB A;  3PST A;  4WC7 A;  3QXG A;  5HR7 A;  1T4G A;  4PHP A;  8ICB A;  1MA7 A;  4NKT A;  4B6J A;  2FLP A;  4EZ6 A;  5F2V O;  2NYV A;  3BS5 A;  4Q45 A;  5IIK A;  5AK6 A;  3KKA A;  3B9J A;  1TE2 A;  2ZTC A;  2ATL A;  4F93 B;  2PI5 A;  1V85 A;  1L3S A;  1JAL A;  2JRZ A;  3WK9 A;  4E8F A;  3IG8 A;  7ICR A;  2E5S A;  5EE3 A;  3WK6 A;  2XO7 A;  3H38 A;  4LZD A;  1QQ5 A;  5DQG A;  5BOL A;  3FAH A;  3B0X A;  1RYS A;  1B0X A;  9ICU A;  3DEE A;  3OJS A;  1SKR A;  2ZH1 A;  4KTQ A;  4F4Z A;  3NS1 A;  2UVW A;  3BS7 A;  4EBJ A;  1NKC A;  3NUQ A;  1KL9 A;  2VJ5 A;  5L1L A;  5EWG A;  4Q44 A;  4PPX A;  4J9Q A;  3PX0 A;  2W04 A;  4YD2 A;  5AIC A;  3NVV A;  2IMW P;  4RWO A;  4WC3 A;  4C80 A;  5D46 A;  5FP0 A;  3T3F A;  3M9M B;  2W8K A;  4RWN A;  4M2Y A;  4KLT A;  1QQ6 A;  4DQI A;  7ICM A;  4RQ8 A;  3PO5 A;  9ICS A;  2FJ6 A;  3EUB 2;  1S9F A;  4EZ9 A;  1OU5 A;  4C8N A;  4RPZ A;  2I9G A;  1X6I A;  1NZB A;  4QZA A;  5KG3 A;  2WB1 F;  4I0U A;  3KZX A;  4UAU A;  4PH5 A;  4IG8 A;  2FPM A;  5G5G A;  5AI6 A;  8ICS A;  4FHY A;  1X9M A;  2B21 A;  5D4B A;  3TAP A;  2KZM A;  4O6A A;  5IIN A;  4EP7 A;  3RH5 A;  5KT6 A;  4NV0 A;  1BPZ A;  3ISD A;  2DR5 A;  5AM4 A;  4JLZ A;  1WOT A;  2RFF A;  2KMD A;  4TQS A;  4M04 A;  3GIM A;  2HHT A;  8ICY A;  5AKX A;  5F3X B;  2NO4 A;  5ALD A;  2FE9 A;  1ZQB A;  2LM4 A;  3UMB A;  1S0O A;  8ICP A;  1PUZ A;  4MEY A;  3I28 A;  3SV4 A;  5HRD A;  2E3T A;  4J9K A;  4HX0 A;  4NXV A;  1SIJ A;  3UXO A;  3AL0 B;  5DLG A;  5ALL A;  4AT9 B;  1X66 A;  3OSP A;  5ALQ A;  2DR8 A;  3AEV A;  3H8W A;  4P0P B;  2K89 A;  2PMZ C;  1R8B A;  3MGH A;  3M6Z A;  1BVS A;  1J2N A;  4MHV A;  3PR5 B;  1VFG A;  4C7Y A;  2BDU A;  2MA1 A;  2DKZ A;  2H3I A;  3L9D A;  4CF3 A;  2GOL A;  1PZN A;  2A1J B;  4Q8E A;  5ALW A;  8ICU A;  3AN1 A;  5DG9 A;  4J9S A;  3SI8 A;  3V6J A;  2BR0 A;  4DSL A;  2KHV A;  4QJF B;  3UXP A;  2WHE A;  2BPF A;  1JUD A;  3EYZ A;  1QSS A;  2DR9 A;  2ZJ5 A;  4QZ8 A;  2Y0S F;  4OJ5 A;  1XS9 D;  7ICS A;  1O08 A;  1SV4 A;  4EED A;  2H3Q A;  4M6W A;  4JWM A;  1HEK A;  5KFY A;  1D8Y A;  3AM9 A;  1CI4 A;  4S3N A;  3LYS A;  7ICJ A;  2K8A A;  5TIS U;  5DKW A;  5B3Q A;  1ZQK A;  2KOB A;  4NXU A;  1ZQW A;  5KFF A;  1D8B A;  1NNL A;  1OXJ A;  2LYH A;  1S97 A;  2UVV A;  4YMM A;  2HVH A;  3H37 A;  5J8Y A;  2MUT A;  2QAR B;  3MBY A;  4X4S A;  1ZQQ A;  1WCL A;  2KZZ A;  5DGB A;  1ZD3 A;  4DWI A;  5KG2 A;  2Y9U A;  2KSO A;  2XI9 A;  1YZ6 A;  2AGO A;  3T5J A;  2NRX A;  3IHQ B;  2IOF K;  4YFK A;  5AM3 A;  1TKD A;  3CRX A;  2D8C A;  2ZG6 A;  5EE1 A;  1T94 A;  3IM1 A;  5AKJ A;  1SKW A;  4UAV A;  2YQE A;  2HBJ A;  1TAQ A;  1Z1B A;  1KSP A;  1X2I A;  1UEU A;  4RQM A;  1JQR A;  4KLO A;  2K8C B;  1KEJ A;  1RM6 C;  3C1Y A;  1U4B A;  2H5X A;  4QZE A;  2HHP A;  3N7R C;  4IRK A;  4X5V A;  5DB9 A;  2HOI A;  3TAR A;  2JEG A;  3D2N A;  4AT8 B;  4FFD A;  5K4L A;  4UAS A;  2IUB A;  3IP4 B;  3KTQ A;  3MR2 A;  2E1E A;  4UAY A;  7ICE A;  2V9W A;  3EPI A;  4JMU A;  2EWR A;  5HRI A;  5J2A A;  3PSP A;  4WC0 A;  1MIY A;  4FBU A;  4OAI Z;  4NLK A;  2F8K A;  1RPL A;  2ZTE A;  4FZM A;  4DFM A;  3NRZ A;  4O3Q A;  2JZB A;  5IIJ A;  1F5A A;  4BX9 C;  4DQR A;  4WC4 A;  1ZQM A;  3M9O B;  4BDP A;  7ICG A;  2LM1 A;  4I2H A;  4US9 A;  3KHH A;  2K4H A;  3M1Y A;  4B9N A;  4KLF A;  3OVA A;  4JLX A;  5HNK A;  2YML A;  1KFS A;  4DL7 A;  5ALP A;  3JPT A;  3TAQ A;  1TAM A;  4CE6 A;  2ZUB A;  4C8M A;  4DOA A;  1BPE A;  2KIW A;  3JPO A;  2OYY A;  4WC6 A;  2I6X A;  4MFF A;  1BPD A;  1KNY A;  5ALK A;  4RT2 A;  3ETL A;  3QUC A;  2Q66 A;  2ESE A;  3WKB A;  3EZ5 A;  4BXO A;  4GFJ A;  2DRB A;  4RPX A;  3WKC A;  1ZQZ A;  8ICJ A;  3Q8S B;  2EH9 A;  4EBK A;  3NTU A;  4HAI A;  5ALT A;  4CRX A;  1KN5 A;  1DK2 A;  5J0W A;  1GO3 F;  2G5H B;  3MR3 A;  4IQU A;  2C2D A;  9ICG A;  2ZUC A;  2HCF A;  4B9M A;  4FBT A;  1QCK A;  3C29 A;  4ED6 A;  4ATB B;  2RRD A;  7ICL A;  2V4R A;  3BQ0 A;  3N97 B;  3PMN A;  3MR6 A;  4AT7 B;  3HT3 A;  1O03 A;  3RBD A;  4TUR A;  4KLL A;  1KFD A;  4EYI B;  5AK5 A;  3GII A;  4NLB A;  5DQI A;  2FLN A;  4DL3 A;  3WKE A;  1TK0 A;  4YMO A;  3HX0 A;  2ID1 A;  4O3R A;  1K1S A;  2LBO A;  2YTU A;  5AI9 A;  1NJY A;  4WQL A;  2ZHB A;  5KFO A;  1ZQJ A;  3C5F A;  2RQ5 A;  1XSN A;  2WF5 A;  8ICT A;  1KTQ A;  5AI0 A;  9ICC A;  4UB2 A;  4ECZ A;  1SZP A;  5HRF A;  2VIX A;  7ICO A;  2A19 A;  1TFW A;  2EZX A;  4KIT B;  3AQN A;  1A0P A;  1SV0 C;  4ED3 A;  3JPR A;  2NRZ A;  4F71 A;  3HPO A;  5DLF A;  4QZD A;  5KT3 A;  4GXI A;  4IQT A;  5BOM A;  2W3S A;  3BJY A;  2MSN A;  3HP6 A;  2ZXI A;  2KVC A;  3M8S A;  3LDA A;  5C5J A;  2W55 A;  3CW2 C;  5C0Y A;  1QTM A;  2M2W A;  3KHR A;  2WB1 C;  5HHI A;  2FLL A;  4JB3 A;  2B56 A;  3WKA A;  4CGZ A;  3BZC A;  3FDS A;  1L3V A;  2HHX A;  4X4P A;  4BWJ A;  1SKS A;  1NK6 A;  1NO5 A;  4FS2 A;  5D49 A;  2VA8 A;  4C0Z A;  9ICF A;  1T3N A;  2DBY A;  4PGY A;  4F4W A;  4RWQ A;  2L5Y A;  2JGA A;  9ICE A;  4EV6 A;  2BDP A;  2HI0 A;  2ZHA A;  1BPB A;  3K1R B;  3HIL A;  4XQ8 A;  3MR5 A;  2QB1 A;  4DFJ A;  7ICT A;  3LWL A;  4JV0 A;  3UMG A;  2M0N A;  1T7P A;  4MKP A;  8ICI A;  4M0A A;  4ED8 A;  8ICQ A;  5ALO A;  4QW9 A;  4OJL A;  1N63 A;  4DF4 A;  9ICR A;  3AU6 A;  2I5H A;  1L7O A;  3J81 j;  4QWA A;  2DGZ A;  2WAQ F;  4WBY A;  2J6S A;  4KB6 A;  3GV7 B;  2H3Z A;  1KRP A;  1B4F A;  1JN3 A;  2W9B A;  1URJ A;  1XO0 A;  1N5X A;  3K7D A;  2ZIU B;  2IBK A;  5CJ7 A;  4B9V A;  4NL9 C;  1UHU A;  5JRT A;  4QZB A;  4WC1 A;  4FHW A;  3JPN A;  5AKI A;  4OJP A;  1L7N A;  3QEA Z;  3WKD A;  4KLU A;  2Y0S C;  4KX5 A;  2ODG A;  1X9S A;  3RRH A;  3JCF A;  5KAF U;  3ZDB A;  1KW4 A;  5KG0 A;  2KKP A;  1XNS A;  1Z00 A;  4K4H A;  1ZQX A;  5JUM A;  3TI0 A;  4GIB A;  1ZJM A;  1PK1 A;  1X6J A;  2W11 A;  2M2V A;  4XUS A;  2XIC A;  3RH6 A;  3TAD C;  2C28 A;  4ICA A;  1BPX A;  1DOQ A;  2E8M A;  2YB1 A;  5AIA A;  4NM1 A;  2K4I A;  4GXJ A;  5EOZ A;  5DB6 A;  3GIK A;  4JV1 A;  4O5E A;  4QZF A;  4YN4 A;  8ICE A;  3H4B A;  2AGP A;  1MQ3 A;  2XY7 A;  1R8C A;  5J0P A;  4WCW A;  4MF8 A;  3N28 A;  4F5N A;  4QZI A;  2RDJ A;  2PFP A;  5KFS A;  5J0U A;  1RDF A;  3GDX A;  3TKA A;  5ALE A;  3E2E A;  1ZQN A;  4KMU A;  2JXJ A;  3WK7 A;  2YMM A;  3NRW A;  4LEZ A;  1JRO A;  2Y9T A;  4X0B A;  4QIW F;  3V6H A;  1NKB A;  2LMR A;  4DOB A;  1JXE A;  4QZG A;  3LVW A;  3SMV A;  3TFS A;  2KE7 A;  1ZQD A;  3SAH A;  1NJW A;  2FMS A;  1COO A;  1L3U A;  4J9R A;  3PW7 A;  4EBE A;  1PVQ A;  4IR1 A;  4RQ6 A;  2KV2 A;  5ALF A;  2KJ9 A;  2BCS A;  5J2B A;  4NXT A;  4K98 A;  4JUZ A;  1R8A A;  2PFN A;  2R8H A;  5HR6 A;  2K4P A;  3D2Q A;  4ED1 A;  3MGV A;  2PI4 A;  4NXW A;  4EGW A;  1UT8 A;  2R18 A;  3BQ2 A;  4I2C A;  1KKX A;  5DBC A;  4PHD A;  3N4M B;  5DEC A;  2KG5 A;  3G6X A;  1ZXI A;  3Q8R B;  2G06 A;  1MSW D;  2ZH5 A;  4I28 A;  4J9M A;  2R8I A;  4PZN A;  4FH5 A;  3QYP A;  4EEL A;  4EEN A;  1Y88 A;  3PVX A;  5KFC A;  4UB5 A;  3RAQ A;  1DRG A;  4F4X A;  2MRL A;  4Q8F A;  1LVH A;  2BGW A;  9ICV A;  2KJ5 A;  5AI8 A;  3OUY A;  3E0F A;  3TFR A;  3H0R B;  3RTV A;  1UT5 A;  1L7P A;  2O1P A;  3T5H A;  2G5I B;  4RWP A;  4US8 A;  3GFK B;  4O68 A;  4F91 B;  3F2B A;  3QUQ A;  2ASL A;  9ICQ A;  1PVP A;  2KP7 A;  4RUA A;  3FM9 A;  2YN4 A;  4CCH A;  4U7C A;  3AQK A;  4DL6 A;  3WFP A;  1SWW A;  3PML A;  3ZD9 A;  5G5H A;  1N48 A;  4R8U A;  5KTQ A;  1NK9 A;  3GQC A;  3RJJ A;  3OJU A;  5J2J A;  2G09 A;  2DUY A;  5KFA A;  4ED2 A;  3D6J A;  3F53 A;  1TK8 A;  2AGQ A;  3K75 D;  1OW5 A;  1YLQ A;  1A6S A;  3I1Y A;  2EDU A;  3EF2 A;  4PJ0 U;  1NK0 A;  5J2C A;  5HRH A;  2KVS A;  2ZIW B;  3TQ1 A;  5JTG A;  5CWR A;  5CRX A;  3H39 A;  3N7S C;  5HML A;  4B9S A;  3IDW A;  2GWS A;  5AM5 A;  7ICV A;  5AM0 A;  5CP2 A;  4PL1 A;  3H40 A;  2QB0 B;  3SEN A;  1U49 A;  4AP9 A;  3B0Y A;  9ICK A;  1SL2 A;  5D62 A;  1FIQ A;  1ZQG A;  2ZIV A;  4Z6D A;  4LEY A;  1VJ7 A;  1JIH A;  4IQV A;  1HIW A;  2W03 A;  3LQC B;  8ICR A;  2VA2 A;  3KBB A;  4DQQ A;  4DSF A;  1VDV A;  9ICB A;  2IHO A;  3ONN A;  4USA A;  4O3S A;  3D2S A;  4K4G A;  2ZH9 A;  1RXV A;  4F2S A;  3H8J A;  3PX6 A;  2JH7 A;  2AXT U;  3LVV A;  3RJK A;  1UQV A;  2ZTD A;  4EEY A;  3CYM A;  1PX5 A;  5AI4 A;  2K4E A;  1U45 A;  4I27 A;  1BGX T;  2BPG A;  4M9L A;  1RQL A;  1F0M A;  2LI6 A;  2LYB A;  4F5Q A;  3F5A A;  3V7K A;  4RQ4 A;  1XC9 A;  3WK8 A;  9ICT A;  4M5D A;  1TFY A;  8ICF A;  4WBZ A;  3QNM A;  3RB4 A;  4ACO A;  5KG4 A;  5TZV A;  3PO4 A;  2JR5 A;  1C7Y A;  4IRD A;  5J2G A;  4PHE A;  1NKE A;  2E1F A;  2IA6 A;  1BNP A;  3PSI A;  5L1J A;  4F50 A;  1NK8 A;  2WAQ C;  3ISB A;  2W7O A;  2HVI A;  4MFC A;  2VAN A;  3H0L B;  5ALR A;  2PKE A;  4IQW A;  1Q46 A;  1L3T A;  4DFK A;  2W9C A;  3SZ2 A;  4EBD A;  3AMZ A;  3SV3 A;  4UD5 A;  2DF4 B;  8ICH A;  3PR4 A;  2NRV A;  1Q79 A;  3QUT A;  5AKK A;  4CF5 A;  2WF7 A;  4UB4 A;  4YQW A;  3G6Y A;  4M9G A;  4I2F A;  7ICI A;  1KQQ A;  2JH1 A;  1TAU A;  2QKQ A;  5CEH A;  5AKG A;  5CR0 A;  4F3O A;  3BS5 B;  3NVO A;  2Q4T A;  5HMM A;  1PK3 A;  2GA9 D;  1JMS A;  2M2U A;  4I29 A;  2QLT A;  2ZH4 A;  9ICL A;  4Y2Q A;  2J6U A;  5E79 U;  2RLT A;  4G3I A;  8ICX A;  5CB1 A;  2YX8 A;  3KOO A;  1VJ5 A;  3MC1 A;  4F5P A;  1XSL A;  4GC6 A;  9ICN A;  2DKX A;  2XGP A;  1S10 A;  1F44 A;  2EZY A;  3RB0 A;  2MU2 A;  5KT5 A;  2JMG A;  3QX7 A;  2DPI A;  3NVW A;  3SAG A;  3QU7 A;  2FCL A;  1ZQA A;  2XID A;  1AQ6 A;  3T5L A;  1ZRN A;  2HN2 A;  3ZDD A;  1GPJ A;  4J9P A;  1V4A A;  4O0I A;  2NRK A;  2RDI A;  3RR7 A;  3BDP A;  3WU2 U;  5ALM A;  4KN4 A;  3V7L A;  1SWV A;  3THV A;  4PHA A;  5ALG A;  4AYB F;  1NJZ A;  1IXR A;  3MFH A;  3L3F X;  2D3D A;  3V6K A;  5B5E U;  3Q8M A;  1LB2 B;  4QIW C;  4O3O A;  4MF2 A;  5DG8 A;  4X0A A;  4DS4 A;  3MGI A;  4DSK A;  4XQ7 A;  4RQ2 A;  1J2M A;  1K1Q A;  4RQ3 A;  2BCQ A;  5ALS A;  5CFS A;  5KFM A;  3GV8 B;  4I2I A;  5HRE A;  2ZJA A;  4P0Q A;  1RG6 A;  4NM2 A;  3RH4 A;  2WF9 A;  5DBB A;  1TFR A;  4NLN A;  5IIM A;  5DDY A;  2KIC A;  1U47 A;  4JK1 A;  5EE0 A;  4LVS A;  4X4O A;  1DGJ A;  5KFB A;  4K9B A;  1SXD A;  4C8K A;  4PL2 A;  4ECW A;  4KMO B;  1L8L A;  3C2M A;  7ICU A;  2ASD A;  4ELV A;  4DO9 A;  5KG6 A;  2BQ3 A;  5KFR A;  1D9F A;  5CFT A;  5J29 A;  4LZG A;  4P4O A;  3OVS A;  1J97 A;  2NRW A;  4OAH A;  3RB3 A;  3QZ8 A;  9ICO A;  2XCP A;  4DS5 A;  4OJ6 A;  1TV9 A;  3RF9 A;  4J9N A;  5DB8 A;  1FFV A;  4R65 A;  1CUK A;  2W9M A;  5HRL A;  3LK9 A;  1NK4 A;  3RJH A;  4OO1 J;  4DOC A;  4F4K A;  1BNO A;  4K97 A;  1NJX A;  1NOM A;  4GC7 A;  4F2R A;  2B51 A;  2JEJ A;  3M7D A;  1Z4N A;  5BPC A;  3MDC A;  2XY6 A;  1DXS A;  4UBB A;  1ZQP A;  4ZH4 A;  2P6R A;  4DFP A;  3CK6 A;  3FC4 A;  8ICW A;  3IG5 A;  1A77 A;  4KLS A;  3ISC A;  3PY8 A;  1T3Q A;  1N2X A;  2XY5 A;  4F8R A;  1ZQL A;  2KTQ A;  4M6W B;  3MAB A;  2HHU A;  1MQ2 A;  2NRT A;  4B9T A;  2N1R A;  5ALZ A;  3RJF A;  2UVR A;  5CA7 A;  5HR9 A;  1X9X A;  3ETR A;  2F1I A;  5KFX A;  2O5A A;  2DR7 A;  1ARO P;  5AM1 A;  1Q8K A;  2ISP A;  3DV9 A;  2HOF A;  4NWI A;  5DGA A;  2MUT B;  4OAG A;  4C4T A;  4R64 A;  2DQN B;  1CRX A;  2ZH2 A;  1SV0 A;  2KSO B;  4E80 A;  3KZI U;  2F44 A;  3JZ0 A;  1QQ7 A;  1S76 D;  1HUO A;  1L7M A;  4KLG A;  3NAS A;  1QSL A;  4Z6E A;  2A3V A;  4FO6 A;  1MC8 A;  3MDA A;  4C4S A;  1TK5 A;  2B6G A;  2CPR A;  4A8E A;  2AU0 A;  4OAF A;  2ZIX A;  2HBM A;  2LYA A;  1RYU A;  4UAT A;  1KLN A;  2KHQ A;  1N62 A;  5AK3 A;  5KFI A;  3RBE A;  2FPK A;  4UAW A;  4XRH A;  2BKE A;  1B43 A;  3HWT A;  1ZQY A;  4ED0 A;  1JXL A;  5KT4 A;  1YZ7 A;  8ICG A;  3KFU F;  2ZH6 A;  2IOF A;  2G07 A;  1JX4 A;  4IR9 A;  1EXN A;  1Z4O A;  3SAF A;  3HW8 A;  5J2I A;  4M9N A;  2KFN A;  3AQM A;  5KNI A;  4K9A A;  1VLB A;  2KEY A;  1WWU A;  5J0X A;  4CDG A;  2JZB B;  4BWM A;  4E7X A;  2WF6 A;  4X4R A;  9ICJ A;  8ICL A;  4XA5 A;  4DSE A;  1S0V A;  3RRG A;  2BPC A;  5D61 A;  2DWQ A;  2NV3 A;  5KFP A;  2GH1 A;  4RU9 A;  2FMP A;  3RJE A;  3PW0 A;  4I2D A;  5L9X A;  3QZ7 A;  4AT9 A;  4YR2 A;  5HRK A;  4I2B A;  1JI7 A;  1SB3 C;  4P0P A;  4NL9 A;  5DED A;  3VC8 A;  3OHB A;  4P4M A;  4X4V A;  2EAO A;  4QWC A;  4BXO B;  2P35 A;  4NLC A;  2IHM A;  2C22 A;  2EAN A;  9ICW A;  5ALY A;  2AQ0 A;  4EX6 A;  3C1Z A;  3WFR E;  2A1J A;  5DBA A;  4F5R A;  1SL1 A;  3PZP A;  4ECQ A;  5HHH A;  4F92 B;  5DB7 A;  2DFL A;  1UEV A;  4F5O A;  1X9W A;  8ICC A;  3Q8Q B;  2C2E A;  5GTI U;  3TAD A;  4YXJ A;  2G0A A;  2XVT A;  2BZF A;  3Q8P B;  3SR6 A;  4DLE A;  1ZRM A;  1KDH A;  4DL5 A;  2AH5 A;  3JPQ A;  4O69 A;  4I2J A;  3NVY A;  5HC9 A;  3KKA C;  2VKQ A;  2D6F C;  1DGS A;  4IS7 A;  3S6J A;  4Z6C A;  3M9N B;  2B4V A;  2HDO A;  3KHL A;  2KD1 A;  3OTQ A;  2M2T A;  4BJQ A;  5J2K A;  4X4U A;  5ALU A;  3EPG A;  2QAR A;  4M9J A;  4JV2 A;  1X42 A;  7ICN A;  4M47 A;  4O3M A;  2RHF A;  5L1M A;  5F9L A;  5B3P A;  3RAX A;  4UB6 U;  3JPS A;  5B66 U;  3C5G A;  2ALZ A;  4B9L A;  5KFD A;  2FMQ A;  2R8G A;  5J0R A;  4AYB C;  2HOQ A;  3UQ0 A;  1ZD4 A;  4I2A A;  1WCN A;  2WFA A;  4K99 A;  5A0L A;  2ES6 A;  4KLQ A;  4GLX A;  3RJI A;  1NK5 A;  2V4Q A;  1B22 A;  4YR3 A;  4OCZ A;  3PW2 A;  2Q0Z X;  1ZQT A;  4AT8 A;  4OJO A;  1N56 A;  2JEI A;  5J2H A;  4ECT A;  5AKY A;  2KZ3 A;  2BBJ A;  2XC9 A;  4FS1 A;  4QWD A;  1ZQE A;  2W43 A;  4QZH A;  3OGU A;  4NJ8 A;  4MEX A;  1COK A;  2P6U A;  1JRP A;  3GV5 B;  3QU2 A;  4J9O A;  4PGX A;  2OEH A;  1UPH A;  4F4Y A;  3RFA A;  4Y2U A;  2FPL A;  2ZIX B;  4ED7 A;  4BUG A;  4DSI A;  2K60 A;  4YR0 A;  1L8O A;  3OWG A;  4YMN A;  4DLG A;  4WH5 A;  1S77 D;  2XGQ A;  3E58 A;  2HHW A;  5IIL A;  3I76 A;  5KG5 A;  2W9B B;  4DQS A;  9ICI A;  1V97 A;  4FZL A;  5KFJ A;  3TAC B;  5KFU A;  1ZQF A;  3M8R A;  3H7I A;  2F3N A;  5ALN A;  2GAF D;  4RNM A;  1L5U A;  2FI1 A;  2LKY A;  4QNL A;  1H38 A;  1FEZ A;  4PGQ A;  3OVB A;  2H3V A;  4J03 A;  4Y2P A;  4FH3 A;  2KJ8 A;  5KL1 B;  3T79 A;  4ELT A;  1N5W A;  1DK3 A;  2HMX A;  2W54 A;  4OD0 A;  4KLE A;  2HHQ A;  5AM2 A;  5KFK A;  1Z00 B;  4IC9 A;  4NKU A;  4TQR A;  3ZDC A;  4FHX A;  1ZQO A;  4CNQ A;  4ATB A;  1PK1 B;  3PW4 A;  1ZYQ A;  3H8M A;  1SL0 A;  2EZZ A;  4AT7 A;  5J2F A;  4I2G A;  4DCC A;  1M6Y A;  2JEF A;  5KFH A;  3JPP A;  4QZ9 A;  3IN5 A;  7ICQ A;  4O67 A;  4F72 A;  3SD7 A;  1YT3 A;  1HUZ A;  3RB6 A;  4LJX A;  4ZOH C;  4KLI A;  4RZR A;  3OHA A;  4BGD A;  3N7P D;  3PNC A;  5HRB A;  3LWM A;  4X4N A;  2Y1J A;  4ECX A;  3PX4 A;  4CF4 A; 
#chains in the Genus database with same CATH homology
 4QW9 A;  4DF4 A;  9ICR A;  3AU6 A;  4Q45 A;  1K1Q A;  4RQ3 A;  5IIK A;  4QWA A;  1ZET A;  2BCQ A;  1Q78 A;  1RYR A;  5KFM A;  4WBY A;  2J6S A;  4GXK A;  2ATL A;  2ZTC A;  4YD1 A;  4X4Q A;  4F93 B;  3GV7 B;  4I2I A;  3GV8 B;  2ZJA A;  5HRE A;  2PI5 A;  1L3S A;  1KRP A;  4NM2 A;  3RH4 A;  4E8F A;  5DBB A;  1TFR A;  4NLN A;  1JN3 A;  7ICR A;  2W9B A;  3H8S A;  5DDY A;  2XO7 A;  5IIM A;  4JK1 A;  4UAZ A;  1U47 A;  3H38 A;  4LZD A;  4LVS A;  3UPS A;  5DQG A;  2PFO A;  2IBK A;  5KFB A;  5CJ7 A;  7ICH A;  4B9V A;  4X4O A;  4DQP A;  4ECU A;  1NK7 A;  1ZQC A;  4C8K A;  4B9U A;  2OWO A;  5BOL A;  4ECW A;  8ICK A;  4QZB A;  3B0X A;  1RYS A;  3C2M A;  9ICU A;  2ZH8 A;  4WC1 A;  1R89 A;  7ICU A;  4FHW A;  3OJS A;  1SKR A;  2ASD A;  3JPN A;  4ELV A;  2ZH1 A;  4DO9 A;  5KG6 A;  2BQ3 A;  5KFR A;  1D9F A;  4KTQ A;  4F4Z A;  2UVW A;  5J29 A;  3QEA Z;  4LZG A;  4P4O A;  1B22 A;  4KLU A;  4EBJ A;  3OVS A;  2NRW A;  1NKC A;  4UBC A;  3PV8 A;  3RB3 A;  2Y1I A;  3QZ8 A;  4YG2 A;  4KLD A;  2ZUD A;  1X9S A;  2XCP A;  4DS5 A;  1TV9 A;  3RRH A;  9ICO A;  4J9N A;  5DB8 A;  3ZDB A;  4R65 A;  3TAN A;  1CUK A;  2W9M A;  5L1L A;  5EWG A;  5KG0 A;  5DDM A;  4Q44 A;  4PPX A;  3LK9 A;  4J9Q A;  1Z00 A;  3PX0 A;  1XO1 A;  1NK4 A;  1ZQI A;  2VA3 A;  2PXI A;  4DOC A;  3RJH A;  4K4H A;  4NY8 A;  4F4K A;  4YD2 A;  1ZQX A;  5JUM A;  3G6V A;  4FHP A;  3TI0 A;  1BNO A;  1ZJM A;  2AJQ A;  1NJX A;  2IMW P;  4RWO A;  1NOM A;  2M2V A;  4XUS A;  4WC3 A;  5D46 A;  4GC7 A;  3RH6 A;  3T3F A;  4F2R A;  2BHN A;  5L1I A;  2C28 A;  2JEJ A;  3M9M B;  2W8K A;  1BPX A;  1DOQ A;  5BPC A;  3MDC A;  4RWN A;  4M2Y A;  2XY6 A;  4EYH B;  4KLT A;  2KFZ A;  4NM1 A;  4UBB A;  1ZQP A;  4ZH4 A;  2P6R A;  8ICM A;  4DFP A;  4DQI A;  7ICM A;  4RQ8 A;  4YP3 A;  4GXJ A;  5EOZ A;  3PO5 A;  5DB6 A;  4ECR A;  9ICS A;  3KHG A;  3GIK A;  1S9F A;  4JV1 A;  8ICW A;  4KLS A;  1A77 A;  5HRG A;  4EZ9 A;  3ISC A;  1ZQU A;  4RUC A;  4C8N A;  3PY8 A;  5CHG A;  1OU5 A;  2XY5 A;  4O5E A;  4QZF A;  4RPZ A;  2I9G A;  4KLJ A;  3JYY A;  4QZA A;  4F8R A;  1ZQL A;  4YN4 A;  4YVZ A;  5KG3 A;  2KTQ A;  2DRA A;  4M6W B;  8ICE A;  4TUP A;  4PH5 A;  3H4B A;  2AGP A;  2MAX A;  4IG8 A;  2ASJ A;  1MQ3 A;  2FPM A;  2ZJ8 A;  4J9L A;  2XY7 A;  1R8C A;  3MAB A;  5J0P A;  1MQ2 A;  2HHU A;  4MF8 A;  2NRT A;  4WCW A;  4F5N A;  4B9T A;  8ICS A;  4FHY A;  1X9M A;  2B21 A;  4R66 A;  5D4B A;  3TAP A;  2UVR A;  5CA7 A;  5IIN A;  3RJF A;  4QZI A;  2RDJ A;  2PFP A;  3RH5 A;  3MFI A;  5KT6 A;  5KFS A;  5HR9 A;  3C2L A;  1BPZ A;  3ISD A;  2DR5 A;  5J0U A;  2P66 A;  3GDX A;  2F1I A;  5KFX A;  4P4P A;  1WOT A;  1T8E A;  2O5A A;  4TQS A;  4M04 A;  2RFF A;  2DR7 A;  4UB1 A;  3GIM A;  2ISO A;  2HHT A;  1ARO P;  8ICV A;  3E2E A;  1A76 A;  1ZQN A;  4KMU A;  8ICY A;  2ISP A;  2J6T A;  4C8O A;  3OUY B;  5DGA A;  1UET A;  1ZQB A;  2MUT B;  4X0B A;  4ECV A;  1S0O A;  8ICP A;  3V6H A;  1NKB A;  3SV4 A;  4MEY A;  1ZQV A;  4M9H A;  4DOB A;  5HRD A;  4R64 A;  1JXE A;  4QZG A;  4J9K A;  1U48 A;  3UXO A;  2ZH2 A;  5DLG A;  3RR8 A;  1JAJ A;  2AQ4 A;  4AT9 B;  4E80 A;  4DEZ A;  3Q8K A;  3TFS A;  3OSP A;  3JZ0 A;  1ZQD A;  1NJW A;  2FMS A;  5F2V O;  1COO A;  2DR8 A;  2I1Q A;  3H8W A;  4J9R A;  3PW7 A;  3T5K A;  4EBE A;  1L3U A;  1S76 D;  1HUO A;  1V9P A;  1R8B A;  2M9N A;  4RQ0 A;  3MGH A;  4DF8 A;  4KLG A;  9ICM A;  1BVS A;  4IR1 A;  4RQ6 A;  3HJ1 A;  1QSL A;  2PBE A;  4Z6E A;  5J2B A;  2BCS A;  4FO6 A;  4JUZ A;  1R8A A;  1MC8 A;  3PR5 B;  3MDA A;  1TK5 A;  2PFN A;  2R8H A;  5KFE A;  3ZD8 A;  1VFG A;  4R8U B;  2AU0 A;  2BCV A;  4ED1 A;  5J0O A;  3L9D A;  5KFT A;  1ZQR A;  1PZN A;  2A1J B;  4ECY A;  1KLN A;  2PI4 A;  4Q8E A;  2KN7 A;  4O5C A;  2W8L A;  8ICU A;  5DG9 A;  4J9S A;  3SI8 A;  1UT8 A;  3NGD A;  3V6J A;  5KFI A;  4HYK A;  3RBE A;  2BR0 A;  4DSL A;  1RXW A;  2FPK A;  4UAW A;  2BE3 A;  4XRH A;  3BQ2 A;  2BKE A;  3UXP A;  4I2C A;  1B43 A;  1S0N A;  3HWT A;  5DBC A;  1ZQY A;  3EYZ A;  2BPF A;  1QSS A;  4PHD A;  5EWE A;  3N4M B;  4ED0 A;  2DR9 A;  1JXL A;  5KT4 A;  2ZJ5 A;  4QZ8 A;  5DEC A;  3G6X A;  8ICG A;  3Q8R B;  1XS9 D;  2ZH6 A;  7ICS A;  4UD4 A;  1JX4 A;  5J0Q A;  1MSW D;  3AU2 A;  2ZH5 A;  4IR9 A;  1EXN A;  3AUO A;  4I28 A;  4JWN A;  3HW8 A;  5J2I A;  4M6W A;  2R8I A;  4J9M A;  3PW5 A;  4M9N A;  2KFN A;  4JWM A;  3AQM A;  4FH5 A;  5KFZ A;  5KFY A;  1D8Y A;  4S3N A;  4Z6F A;  1Y88 A;  8ICZ A;  7ICJ A;  3PVX A;  5KFC A;  4UB5 A;  3K4G A;  3RAQ A;  4F4X A;  5DKW A;  5J0X A;  1ZQK A;  2JZB B;  4BWM A;  4Q8F A;  4E7X A;  4O3N A;  5KFV A;  2KZM A;  3AQL A;  1ZQW A;  5KFF A;  2BGW A;  4X4R A;  9ICJ A;  9ICV A;  8ICL A;  4QZC A;  2LYH A;  8ICQ A;  4RQ5 A;  1S97 A;  3ORY A;  2UVV A;  4EP7 A;  4XA5 A;  4YMM A;  4DSE A;  2PFQ A;  1RZT A;  1S0V A;  3RRG A;  3OUY A;  2HVH A;  2BPC A;  3H37 A;  3TFR A;  2MUT A;  3MBY A;  4X4S A;  5KFP A;  3GIL A;  1ZQQ A;  1FA0 A;  2XCA A;  1WCL A;  2KZZ A;  3RTV A;  5DGB A;  4RU9 A;  1UT5 A;  3EW9 A;  3GIJ A;  3H4D A;  3SYZ A;  3PW0 A;  2FMP A;  4I2D A;  5L9X A;  5KG2 A;  3T5H A;  5J0T A;  4DWI A;  3QZ7 A;  2BCU A;  2O1P A;  4RWP A;  4AT9 A;  3GFK B;  4QWB A;  4F91 B;  4YR2 A;  2AGO A;  3T5J A;  5HRK A;  2NRX A;  4I2B A;  1HJP A;  3IHQ B;  2ASL A;  9ICQ A;  1NZP A;  4YFK A;  4RUA A;  2KP7 A;  4KN7 A;  1TKD A;  4CCH A;  5DED A;  5III A;  3OHB A;  4Q43 A;  3AQK A;  4DL6 A;  9ICP A;  5KT7 A;  3WFP A;  3IM1 A;  3PML A;  3ZD9 A;  7ICK A;  4P4M A;  2WTF A;  4X4V A;  1SKW A;  4E0D A;  1N48 A;  7ICP A;  4QWC A;  4NLG A;  5HRL A;  4BXO B;  4R8U A;  2IHM A;  1TAQ A;  5KTQ A;  1NK9 A;  2C22 A;  3GQC A;  3RJJ A;  1KSP A;  1X2I A;  9ICW A;  3OJU A;  2ZH7 A;  1UEU A;  2AQ0 A;  5F9N A;  5J2J A;  8ICO A;  1KFT A;  4NXZ A;  3C1Z A;  1JQR A;  5KFA A;  4R63 A;  4ED2 A;  3WFR E;  4KLO A;  4DSJ A;  2A1J A;  5DBA A;  4F5R A;  1KEJ A;  1SL1 A;  1D9D A;  4ECQ A;  3C1Y A;  5HHH A;  1U4B A;  3WFO A;  4F92 B;  5DB7 A;  5KFN A;  2H5X A;  2DFL A;  4QZE A;  1TK8 A;  2HHP A;  2AGQ A;  1Z3E B;  3K75 D;  4RNO A;  1UEV A;  4F5O A;  1X9W A;  4IRK A;  4X5V A;  5DB9 A;  1YLQ A;  3TAR A;  2JEG A;  2DPJ A;  8ICC A;  5KFL A;  3Q8Q B;  2C2E A;  2HHS A;  4AT8 B;  4QW8 A;  3KTQ A;  4MFA A;  1NK0 A;  3C18 A;  3MR2 A;  4YXJ A;  4RQ7 A;  5J2C A;  4UAY A;  7ICE A;  8ICN A;  3TQ1 A;  2V9W A;  5HRH A;  3EPI A;  5KG1 A;  5CWR A;  3Q8P B;  3UQ2 A;  5DQH A;  3H39 A;  5HRI A;  5J2A A;  4DLE A;  4WC0 A;  5HML A;  4B9S A;  2W9C B;  2GWS A;  1S0M A;  1MIY A;  1KDH A;  4FBU A;  4DL5 A;  7ICV A;  5CP2 A;  3H40 A;  3JPQ A;  4NLK A;  5KFG A;  1RPL A;  2ZTE A;  2R8J A;  4I2J A;  4DFM A;  4O3Q A;  2JZB A;  5HC9 A;  1U49 A;  3B0Y A;  5IIJ A;  9ICK A;  1F5A A;  4DQR A;  1SL2 A;  4WC4 A;  1DGS A;  3M9N B;  4Z6C A;  1ZQM A;  3EWA A;  3KHL A;  3M9O B;  1ZQG A;  5KG7 A;  3ZDA A;  4BDP A;  7ICG A;  2HW3 A;  4Z6D A;  2HHV A;  4I2H A;  4RPY A;  2M2T A;  1VJ7 A;  1JIH A;  5J2K A;  1NO5 A;  4X4T A;  3EPG A;  3KHH A;  4X4U A;  4M9J A;  4JV2 A;  4IQV A;  7ICN A;  3LQC B;  3NYB A;  4B9N A;  4KLF A;  8ICR A;  4FHV A;  3OVA A;  5HNK A;  2VA2 A;  4M47 A;  4DQQ A;  4DSF A;  1KFS A;  9ICB A;  4DL7 A;  3TAQ A;  3JPT A;  4O3S A;  5F9L A;  4WC2 A;  3QEB Z;  3RAX A;  2ZUB A;  4K4G A;  3JPS A;  2ZH9 A;  3C5G A;  4C8M A;  4DOA A;  1BPE A;  2ALZ A;  1RXV A;  4B9L A;  3JPO A;  4F2S A;  3QE9 Y;  3H8J A;  5KFD A;  3PX6 A;  4WC6 A;  1U9L A;  2FMQ A;  2R8G A;  3RJK A;  5J0R A;  4MFF A;  2ZTD A;  4EEY A;  1BPD A;  5J0S A;  1KNY A;  1BPY A;  1PX5 A;  4RT2 A;  3ETL A;  1UA1 A;  9ICX A;  3UQ0 A;  1U45 A;  4I27 A;  1BGX T;  2Q66 A;  2BPG A;  3EZ5 A;  4M9L A;  4BXO A;  4I2A A;  2DRB A;  1WCN A;  4F5Q A;  3Q8L A;  5J2D A;  3V7K A;  4RQ4 A;  4RPX A;  1XC9 A;  9ICT A;  1ZQZ A;  8ICJ A;  3Q8S B;  5J0Y A;  4WC5 A;  4EBK A;  5KFQ A;  4KLQ A;  4GLX A;  4M5D A;  1TFY A;  3NTU A;  8ICF A;  4WBZ A;  3RJI A;  4ELU A;  1DK2 A;  5J0W A;  5EWF A;  3RB4 A;  5KG4 A;  4IQU A;  5TZV A;  3MR3 A;  2V4Q A;  2C2D A;  4YR3 A;  2ZUC A;  3C21 A;  1NK5 A;  1C7Y A;  3PO4 A;  5J2G A;  4PHE A;  4IRD A;  3PW2 A;  1NKE A;  2IA6 A;  4B9M A;  1BNP A;  1D8L A;  4FBT A;  2Q0Z X;  1ZQT A;  4AT8 A;  4ED6 A;  7ICF A;  7ICL A;  4ATB B;  1XU4 A;  5L1J A;  4F50 A;  1NK8 A;  1N56 A;  1LV5 A;  2JEI A;  5J2H A;  3ISB A;  2V4R A;  4ECT A;  2HVI A;  3BQ0 A;  3N97 B;  4MFC A;  3PMN A;  3MR6 A;  2VAN A;  2UVU A;  4AT7 B;  2KZ3 A;  2F1J A;  2XC9 A;  3HT3 A;  4FS1 A;  4QWD A;  3RBD A;  4IQW A;  1ZQE A;  1L3T A;  4TUR A;  4DFK A;  4KLL A;  1KFD A;  4EYI B;  4QZH A;  9ICG A;  3HIY A;  4YCX A;  3OGU A;  3GII A;  2W9C A;  3SZ2 A;  4EBD A;  5DQI A;  3UPQ A;  2FLN A;  4DL3 A;  4MEX A;  3SV3 A;  2P6U A;  4UD5 A;  1TK0 A;  4I2E A;  8ICH A;  3PR4 A;  2NRV A;  3GV5 B;  2BCR A;  1Q79 A;  4YMO A;  3HX0 A;  4UB3 A;  4J9O A;  2ID1 A;  4UB4 A;  4O3R A;  1IM4 A;  4PGX A;  4YQW A;  4EBC A;  1K1S A;  4KLM A;  4O9M A;  4TUS A;  4RT3 A;  3G6Y A;  1NJY A;  2IHN A;  4F4Y A;  4DL4 A;  3BQ1 A;  2ZHB A;  2FPL A;  5KFO A;  1ZQJ A;  4M9G A;  4I2F A;  7ICI A;  3C5F A;  2C2R A;  4ED7 A;  3V72 A;  1XSN A;  4DSI A;  8ICT A;  1KTQ A;  3H3A A;  1TAU A;  5CR0 A;  4YR0 A;  9ICC A;  4UB2 A;  4F3O A;  4ECZ A;  5HP4 A;  5HMM A;  1SZP A;  4YMN A;  4DLG A;  5HRF A;  1CEZ A;  7ICO A;  3HJ4 A;  1TFW A;  1JMS A;  5J2E A;  3RJE A;  1S77 D;  2M2U A;  4I29 A;  1QSY A;  3OSN A;  2ZH4 A;  9ICL A;  2XGQ A;  4KIT B;  3AQN A;  2J6U A;  1MIW A;  4G3I A;  2HHW A;  8ICX A;  5CB1 A;  4ED3 A;  3JPR A;  5IIL A;  3C66 A;  4DQS A;  5KG5 A;  2W9B B;  2NRZ A;  9ICI A;  4DL2 A;  1XSL A;  4F5P A;  1ZQS A;  4GC6 A;  9ICN A;  3BQT A;  3HPO A;  5DLF A;  5KFJ A;  4QZD A;  5KFU A;  5KT2 A;  5KT3 A;  2XGP A;  1S10 A;  1ZQF A;  4GXI A;  4O3P A;  3ZDE A;  4NLZ A;  3RB0 A;  3M8R A;  4P2H A;  3H7I A;  1TVA A;  1QLN A;  5KT5 A;  4IQT A;  3OV7 A;  4RNN A;  5BOM A;  3BJY A;  4LT6 A;  3HP6 A;  4RNM A;  2DPI A;  1ZQH A;  1XSP A;  3M8S A;  3LDA A;  5L1K A;  1L5U A;  5C5J A;  1ZQA A;  3T5L A;  3C2K A;  1H38 A;  4PGQ A;  3OVB A;  8ICA A;  9ICH A;  3ZDD A;  1QTM A;  9ICA A;  3KHR A;  2M2W A;  4FH3 A;  4J9P A;  1ZJN A;  4ELT A;  5HHI A;  2FLL A;  4IRC A;  1XWL A;  4UQG A;  2BQU A;  4YXM A;  1DK3 A;  4KLE A;  2HHQ A;  1V4A A;  5KFK A;  4O0I A;  1Z00 B;  2NRK A;  3WFQ E;  2RDI A;  3RR7 A;  4NKU A;  2ZH3 A;  4TQR A;  4TUQ A;  2F1H A;  3FDS A;  2BQR A;  1ZQO A;  3ZDC A;  3FYH A;  5KFW A;  4FHX A;  3BDP A;  1L3V A;  4RQ1 A;  4ATB A;  4KN4 A;  3V7L A;  2HHX A;  3THV A;  4X4P A;  4BWJ A;  1SKS A;  3PW4 A;  1ZYQ A;  1NK6 A;  1UA0 A;  1SL0 A;  4PHA A;  2W9A A;  2R8K A;  4FS2 A;  1MIV A;  5D49 A;  2VA8 A;  3RJG A;  3V7J A;  5J2F A;  4AT7 A;  4I2G A;  4X4N A;  9ICF A;  3C23 A;  1NJZ A;  2JEF A;  4O5K A;  5KFH A;  1IXR A;  1T3N A;  4QWE A;  3JPP A;  4QZ9 A;  3MFH A;  4KLH A;  3UXN A;  4K4I A;  4PGY A;  4F4W A;  7ICQ A;  3V6K A;  4RWQ A;  9ICE A;  2DVI A;  3Q8M A;  2BDP A;  4ECS A;  1LB2 B;  1HUZ A;  4O3O A;  3RB6 A;  1BPB A;  4MF2 A;  2ZHA A;  5DG8 A;  5IIO A;  5DG7 A;  3WFS C;  4X0A A;  4XQ8 A;  4C8L A;  4KLI A;  3MR5 A;  4RZR A;  4WC7 A;  3OHA A;  4DFJ A;  4DS4 A;  7ICT A;  4BGD A;  1T4G A;  3MGI A;  3LWL A;  4PHP A;  3PNC A;  4DSK A;  4JV0 A;  3LWM A;  1T7P A;  8ICB A;  5HRB A;  2Y1J A;  8ICI A;  2FLP A;  4NKT A;  4ECX A;  4EZ6 A;  3PX4 A;  4M0A A;  4ED8 A;  4XQ7 A;  4RQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...