4F5OA

Open ternary complex of r283k dna polymerase beta with a one metal bound dctp analog
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
326
structure length
321
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of dNTP Intermediate States during DNA Polymerase Active Site Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 108
structure length 321
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f5oA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4f5oA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4f5oA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4f5oA03
4WC1A 7ICOA 4F93B 3ZDCA 4QZEA 1TK0A 8ICNA 5EWEA 1D8YA 3MGHA 4FBUA 4F91B 4UAYA 4QZBA 3UXPA 5KT4A 3EW9A 4PHPA 5EWFA 2PFQA 2ZUDA 5J2CA 5KFBA 4ED3A 2KP7A 1S10A 4QZ8A 4F4WA 2NRKA 1ZQWA 4WCWA 4ECXA 3PW2A 7ICGA 4QWAA 4DOAA 2OWOA 3C5GA 9ICKA 4X4OA 3H39A 4KLFA 1KTQA 1JIHA 1TFWA 4F4ZA 2ASJA 4WC5A 5CHGA 2ZUCA 4BGDA 2ZH2A 9ICSA 1ZQVA 1L3VA 4M04A 4FS1A 2Y1JA 4DWIA 5DQIA 5J2AA 3RH5A 4EYHB 1T8EA 1S77D 3HJ1A 1U47A 4NY8A 4E7XA 4WC7A 1Q78A 5IIMA 2MUTA 3RAQA 4M2YA 5HRIA 1NJYA 3HT3A 3KHLA 3BQTA 5KG7A 5DDYA 1RYSA 1SKWA 1S0MA 9ICXA 4UB2A 4QZGA 4UB4A 1WOTA 5J2JA 2MUTB 1AROP 1L3SA 3M8SA 2ID1A 5IINA 3FDSA 3UXOA 2XGQA 3T3FA 3PV8A 3UPSA 3MDAA 1D9DA 4EP7A 5KT6A 5J0SA 3C2MA 8ICMA 4RQ3A 5J0WA 1XC9A 4UBBA 2MAXA 8ICSA 4FH3A 3N97B 1XS9D 4XQ8A 4MEXA 1X9WA 4YR0A 4O3RA 1ZETA 2AQ4A 1S9FA 2XO7A 4I2GA 4HYKA 4R8UB 5DLGA 1ZQHA 2M9NA 4RT2A 3WFPA 1ZQXA 1TK8A 9ICCA 4FHYA 3C1YA 4GXJA 5D46A 5KFFA 8ICFA 1Z00A 5KTQA 3Q8KA 1BNPA 2NRTA 3TAQA 3V7LA 5CJ7A 2ATLA 4JK1A 2DPJA 4I2AA 4JWNA 8ICBA 3TI0A 4M9LA 4QZFA 1T4GA 3PMLA 4UD5A 5HMLA 4YQWA 2PXIA 4DFMA 3PW7A 3GIJA 4DL2A 2IBKA 3LDAA 3Q8LA 1MIVA 4ECZA 8ICJA 4M9NA 4O9MA 4WC3A 2C28A 1ZQZA 3HPOA 2VA2A 4I27A 1NJZA 7ICHA 3RTVA 9ICIA 4FH5A 3BJYA 4FHVA 2HHSA 3JPSA 3SZ2A 4J9NA 1ZQNA 1BPBA 1U48A 2J6SA 4TURA 7ICPA 4E80A 4EBCA 3PW0A 8ICKA 4RNMA 4O3NA 4X4TA 5DECA 5J2EA 4I2BA 4LZDA 3EPGA 2BR0A 4RQ0A 3K75D 2R8GA 3AU6A 8ICTA 5KFOA 1NJWA 4EZ6A 2ZTCA 4QW9A 2ZH1A 4DQPA 3GIIA 4K4IA 1JMSA 1BPDA 5KT2A 2HHUA 1WCLA 1ZQTA 1R89A 4PH5A 4RWPA 4X4SA 3Q8PB 2C2DA 2ZH5A 4F50A 4WBYA 3Q8QB 4O3OA 3RJIA 2UVUA 1RZTA 5F2VO 1ZQSA 2ZH7A 4R63A 4F5RA 4JV0A 4PPXA 3AU2A 3JPQA 1ZQOA 4C8NA 1S0VA 4XQ7A 3G6VA 4AT8B 3PVXA 2RDJA 9ICRA 1PX5A 1LB2B 4XRHA 3PW5A 4RPZA 5CR0A 3LWLA 3ISDA 2FMSA 2I9GA 1NZPA 2KTQA 3QE9Y 4TUPA 3BQ2A 5DG8A 1JXLA 5HRHA 2FLPA 5DLFA 1BPEA 4R8UA 7ICEA 4Q44A 5TZVA 2BHNA 3MABA 5KFSA 4R66A 3ZDAA 1NJXA 5KG0A 3ZD9A 5D49A 3ISCA 2JEJA 4JUZA 1MQ2A 1QSSA 4X4QA 3QZ8A 4ATBA 3KHHA 1WCNA 4QZ9A 1X9MA 2BDPA 2M2TA 3OVBA 2ZJ8A 1SL1A 1K1QA 3RR7A 2W9AA 2BPCA 3TANA 1NK4A 2BCSA 4YFKA 3T5LA 5DG7A 2BQUA 7ICVA 5KFHA 1U9LA 1COOA 3HP6A 3HX0A 3V7KA 4WC0A 5KFJA 3KHGA 1X9SA 3NYBA 2ZJ5A 5HREA 5KT3A 4ECRA 3OSNA 1NK7A 1JXEA 2BCUA 2RFFA 4FBTA 4KLLA 5KFEA 4O3SA 2ZH3A 3IHQB 2Q0ZX 4RZRA 4RNNA 3EYZA 4F8RA 2ZHBA 3PO5A 2IHMA 4F5NA 3NGDA 1BPZA 3ZDBA 4RNOA 2FLLA 3PY8A 5DQGA 4G3IA 4BWJA 1D8LA 4GC6A 3SI8A 4RT3A 4RQ4A 3OGUA 4KMUA 3MGIA 4J9KA 3B0YA 1XSPA 1RXWA 4BXOA 4LT6A 2ASDA 2DR7A 5HRBA 1SKRA 4CCHA 4EBEA 4C8LA 3WFRE 5J2HA 4MF8A 3QEAZ 4ED8A 2DR9A 4YD1A 2P66A 5J0TA 4K4HA 2M2WA 4B9LA 2PFPA 2XCPA 3UQ0A 3GFKB 2NRWA 1L3TA 4ECSA 4ECYA 1ZQRA 2A1JA 4NKUA 5IILA 4TQSA 4I2IA 3OVAA 2C2RA 1Y88A 4RQ2A 2F1JA 4KLJA 2HVHA 4EBJA 4WC6A 3C5FA 4NM2A 3BQ0A 1ZQCA 1BNOA 3SYZA 9ICJA 4Z6EA 3GIMA 2HHXA 5HRLA 8ICVA 1LV5A 5KFLA 3TARA 1S97A 2BGWA 8ICOA 4ED7A 2F1HA 8ICLA 4RUCA 3NTUA 1BPXA 1UEVA 3WFSC 2B21A 2KZ3A 2ZH4A 4EEYA 4I28A 4QWBA 3QEBZ 5KG6A 3PX4A 5J2IA 5J2DA 5EOZA 2R8IA 3PX0A 3LK9A 1ZJNA 1S0NA 1KDHA 2VA8A 5J2KA 5DBCA 1XU4A 4P4OA 3V6JA 1QLNA 1MC8A 4YMMA 4YR2A 3G6XA 2XY6A 9ICMA 3C23A 1KFTA 4ED6A 3LQCB 2JZBB 2DFLA 3RB3A 1QSYA 4F4KA 2HW3A 2KZMA 4YMOA 3HWTA 4DOCA 3MBYA 4I2EA 4RUAA 4FHPA 1PZNA 4RQ5A 3H4BA 1ZQBA 3L9DA 4RQ7A 3OJUA 4KLGA 2VANA 4F5QA 1RYRA 3KTQA 4RQ6A 4DFJA 7ICFA 1U4BA 4UB3A 4PHDA 3BQ1A 2BPGA 3MR6A 1C7YA 1QTMA 4QWCA 7ICQA 5L1LA 3T5KA 9ICHA 4RPXA 1UETA 4BXOB 3OV7A 1A76A 5HC9A 3UQ2A 3ETLA 3EWAA 3RH6A 3ZD8A 1HUZA 3UXNA 3SV4A 3V72A 4JV1A 3ZDDA 4UB5A 5KG4A 1BPYA 2KFZA 3AQMA 2JZBA 4M9GA 2ALZA 1ZQUA 5J2GA 2DR5A 5J2BA 2FMPA 3MR3A 2P6RA 5KFAA 3OVSA 4MEYA 5CWRA 5BOMA 2O1PA 1KLNA 1D9FA 9ICVA 2NRXA 5KFVA 2V4QA 3H4DA 4YG2A 8ICQA 1KEJA 4X5VA 3AQLA 3JYYA 2FPKA 3C2KA 2ZH8A 4F4XA 1KSPA 4X4UA 3RJHA 2ISOA 1XWLA 4DSEA 1ZJMA 3RH4A 4QZCA 1NK9A 4F2SA 5HRFA 5J2FA 2PFNA 3H40A 5J29A 4TUQA 1N48A 2ISPA 4IQVA 1ZQQA 7ICSA 5J0XA 4BWMA 1NK8A 3RR8A 2PI5A 4GXKA 3PR5B 4KLOA 5KFKA 5KFCA 4DSIA 3HIYA 3PO4A 3K4GA 2C2EA 1NKCA 3WFOA 4F4YA 4ATBB 4IRKA 5DB7A 3PMNA 1ZQKA 3PR4A 5DB9A 3C2LA 4ELUA 7ICNA 3MFHA 2RDIA 5J0YA 1H38A 3C66A 3UPQA 9ICLA 1XO1A 5C5JA 2UVVA 4Q43A 9ICWA 3IM1A 3PX6A 2UVRA 2DVIA 4I2FA 3QZ7A 4WC4A 5KG1A 4O5CA 3GV8B 1JX4A 5DB8A 1DGSA 3RB0A 3G6YA 4UB1A 3THVA 1T7PA 4IG8A 1U45A 4Z6DA 3MR5A 3C1ZA 5DQHA 2GWSA 1Z3EB 4M47A 2AGQA 4KITB 1DK2A 3OJSA 4P4MA 4MFAA 1S0OA 1NKEA 9ICAA 4GLXA 7ICMA 3JPPA 4FHXA 3GDXA 2BCRA 4DLGA 1T3NA 3SV3A 1JAJA 3AUOA 4DS5A 3JZ0A 4C8OA 4M9JA 3E2EA 2KFNA 4MFFA 2FPMA 3RAXA 1JQRA 4X4VA 2F1IA 4ECWA 2P6UA 1TK5A 2H5XA 2O5AA 1TFRA 4ECVA 4UBCA 3AQNA 5KFIA 5KFWA 3JPRA 3LWMA 4DQSA 2R8KA 9ICOA 2M2VA 4IR9A 9ICPA 3RRHA 4QZHA 4I2CA 1KRPA 5HP4A 4X0BA 4IRCA 2DR8A 3GIKA 2FMQA 2ZTDA 4YXJA 4J9PA 4XA5A 4Q8FA 4XUSA 1Q79A 4DSFA 4DL3A 5DGBA 5DDMA 2V9WA 4YMNA 4DL6A 5HHHA 1HJPA 4DF8A 2BQ3A 2HHVA 8ICHA 1S76D 3H38A 4PGQA 4GC7A 2AGPA 4M0AA 2C22A 4NLGA 5DKWA 4KN7A 1VJ7A 4RWQA 1Z00B 1TAQA 4F5OA 4DFPA 4KLMA 1NK5A 8ICPA 2DRAA 1ZQFA 8ICZA 2JEFA 1DOQA 2W9BB 4I2HA 4O3PA 2PFOA 5HNKA 2Q66A 2JEIA 2W9BA 2FLNA 2BE3A 2PBEA 2KN7A 1NK0A 1IXRA 4X4RA 3M8RA 4LZGA 2VA3A 4F3OA 5DEDA 2AU0A 3C18A 4KLTA 2ASLA 4EBDA 4PGYA 4DFKA 4UAWA 8ICCA 4QZDA 9ICFA 3GILA 4X4NA 4KLEA 5EWGA 5CA7A 5KG3A 4PGXA 5KG5A 5CB1A 3OHAA 4DSJA 1DK3A 1V4AA 2DPIA 3JPOA 8ICIA 4PHAA 4KTQA 4WC2A 4KN4A 1UA0A 4C8KA 4Z6CA 5L1JA 5KFUA 2J6UA 5KFXA 3T5JA 4IQWA 3MR2A 5HMMA 4M9HA 2HVIA 7ICUA 2ZH9A 1SL0A 4C8MA 4R64A 9ICUA 4QWDA 8ICEA 3RJJA 5KFDA 3HW8A 5KFYA 1SZPA 3JPNA 4J9QA 3RB6A 1HUOA 1ZQGA 4B9UA 4Q8EA 5F9NA 1L5UA 4IR1A 2WTFA 1UT8A 5KFNA 4DL4A 1ZQIA 3GV7B 3H8SA 4MF2A 4QWEA 2J6TA 4NLZA 1ZQMA 2W8LA 1ZQYA 5JUMA 2Y1IA 4DO9A 8ICYA 1FA0A 4O0IA 3EZ5A 4ECTA 4F5PA 3V6KA 9ICNA 5KFTA 1TKDA 5IIOA 2KZZA 4R65A 4M6WB 1R8CA 5DB6A 3OUYB 3Q8RB 4JV2A 1NK6A 4I2JA 4PHEA 2JEGA 1OU5A 1V9PA 2W9CB 2ZJAA 1SL2A 1EXNA 4JWMA 1MSWD 4B9VA 2AQ0A 2HHTA 8ICGA 4LVSA 4ZH4A 5HRDA 4S3NA 3TFSA 4TUSA 4EYIB 2HHQA 4AT7A 5IIKA 3KHRA 2FPLA 2W8KA 1F5AA 4AT8A 1BGXT 4YVZA 2IMWP 4NKTA 4BDPA 4KLIA 3V7JA 4KLSA 2NRZA 1N56A 4FHWA 4DSLA 2DRBA 1XSLA 1QSLA 3H8WA 5D4BA 4B9MA 1YLQA 4ED2A 5KT7A 2XGPA 5L1KA 1ZQAA 4DF4A 4KLDA 4O3QA 2ZTEA 3Q8MA 4AT9A 5KFRA 1MIYA 5IIIA 1VFGA 1ZQPA 9ICGA 3H7IA 4ECQA 1NO5A 1CUKA 4DL5A 1A77A 4KLQA 4DSKA 1JN3A 5DBBA 4P4PA 7ICTA 3M9OB 4E0DA 4P2HA 2A1JB 1B43A 4WBZA 4EBKA 1BVSA 4I2DA 4F92B 3N4MB 1ZQJA 4ELTA 7ICKA 4RQ8A 3H3AA 4DQRA 4IQTA 4ED0A 5DGAA 4O5KA 2M2UA 9ICEA 8ICRA 1B22A 4X4PA 1ZQLA 1NOMA 2AJQA 4RPYA 2R8JA 5L9XA 3WFQE 4KLHA 5J0PA 4FO6A 1XSNA 4I29A 3AQKA 1MQ3A 4KLUA 4K4GA 1RXVA 3Q8SB 3M9MB 3EPIA 2ZHAA 7ICJA 3OHBA 1R8AA 5HR9A 5J0RA 1UT5A 3B0XA 4Z6FA 1U49A 2NRVA 3TQ1A 4AT9B 9ICTA 4RWOA 5J0QA 4J9LA 2BCQA 4F2RA 8ICUA 2XC9A 4J9SA 2IA6A 5BOLA 4IRDA 3FYHA 1CEZA 2I1QA 3RJKA 1X2IA 3T5HA 4YXMA 1TV9A 4YN4A 9ICQA 1TFYA 4RU9A 2PI4A 1ZQEA 3V6HA 4MFCA 3GV5B 1L3UA 4Q45A 3ZDEA 2XCAA 1RPLA 2BKEA 5KFQA 2V4RA 5KT5A 4AT7B 5DG9A 4DEZA 5KFZA 4DL7A 4B9SA 8ICXA 4E8FA 5HRKA 5HRGA 4ED1A 2BPFA 1TVAA 2W9CA 2W9MA 2ZUBA 3PW4A 2IHNA 4YCXA 5J0OA 3HJ4A 2XY5A 8ICAA 4UD4A 5KFPA 3JPTA 4DOBA 4QW8A 3MDCA 1UA1A 2BCVA 2UVWA 1TAUA 9ICBA 3OUYA 5KG2A 4M6WA 3RJEA 4NLNA 1MIWA 4RWNA 3H37A 4J9RA 7ICLA 1NKBA 4RQ1A 4GXIA 2XY7A 3RB4A 2BQRA 1KFDA 3GQCA 4DQQA 1K1SA 3RJFA 4M5DA 3PNCA 4FS2A 4UQGA 4DLEA 5J0UA 4NM1A 4NLKA 4UAZA 5CP2A 4YD2A 5F9LA 1IM4A 2LYHA 4QZIA 3TFRA 3ORYA 4EZ9A 1ZYQA 4TQRA 4X0AA 3M9NB 3ISBA 3C21A 4NXZA 1ZQDA 4QZAA 5KFGA 4O5EA 3RRGA 5IIJA 4YR3A 2HHWA 4J9MA 3RJGA 1UEUA 3BDPA 5L1IA 2HHPA 3OSPA 3H8JA 4ELVA 2AGOA 8ICWA 1KNYA 1SKSA 5BPCA 4B9NA 7ICIA 4B9TA 1R8BA 3MFIA 5HHIA 4DS4A 3TAPA 1KFSA 3RBEA 7ICRA 3RBDA 4ECUA 4IQUA 2R8HA 5KFMA 4DQIA 4J9OA 5DBAA 4YP3A 2ZH6A
chains in the Genus database with same CATH superfamily
1A0PA 4QZEA 3EW9A 2ZUDA 5J2CA 4ED3A 1S10A 4QZ8A 2NRKA 3PW2A 7ICGA 2HOFA 4X4OA 4F4ZA 1COKA 4WC5A 1YZ7A 4M04A 2KJ9A 5AKJA 4DWIA 3HJ1A 4NLCA 5IIMA 2MUTA 2GH1A 4M2YA 1FIQA 3BQTA 5DDYA 4UB2A 4QZGA 1WOTA 2ID1A 2E3TA 3MDAA 1D9DA 1JRPA 3CK6A 4UBBA 8ICSA 4MEXA 4O3RA 2KJ5A 5AKZA 4YR0A 1ZETA 5AKIA 9ICCA 3C1YA 3Q8KA 4I2AA 4JWNA 4M9LA 2DL0A 4UD5A 3PMLA 1PVPA 3N7PD 4YQWA 3PW7A 1WYGA 3LDAA 1MIVA 5ALNA 1Q3UA 2N1RA 4M9NA 5HR7A 2C28A 1ZQZA 4WC3A 3BJYA 1ZRNA 3BZCA 3JPSA 1ZQNA 1BPBA 2JV3A 7ICPA 4PL1A 2KV2A 1XO0A 5C0YA 2KVCA 8ICKA 3EPGA 4RQ0A 8ICTA 2PMZF 2ZTCA 4OAGA 1JMSA 5KT2A 4X4SA 2LYAA 2RP5A 4F50A 5ALOA 5F2VO 4R63A 4F5RA 4PPXA 3JPQA 4C8NA 2HI0A 3G6VA 1MN8A 3SR6A 2B0CA 1PX5A 4RPZA 2WF8A 2DUYA 2I9GA 1IG6A 3QE9Y 4TUPA 3BQ2A 5AM1A 2FLPA 4XQ7A 3MABA 3ZDAA 3F5EA 1NJXA 5D49A 2AXTU 1MQ2A 5CFSA 3QUBA 3QZ8A 1WCNA 3OVBA 2M2TA 2W54A 2VJ5A 2WHEA 2XI9A 2BCSA 4YFKA 2ZIVB 2KD1A 5DG7A 3V7KA 5KFJA 3NYBA 2PMZC 2RFFA 3S6JA 3IHQB 2Q0ZX 3QXGA 3EYZA 4F8RA 3PO5A 2ZHBA 1BPZA 5DQGA 3NVWA 4RT3A 3OGUA 4LT6A 2DR7A 2ASDA 3BQ7A 1SKRA 4EBEA 3QEAZ 2P66A 2YY6A 5EE9A 4JMUA 4PZOA 4RQ2A 4WC6A 3BQ0A 3IG5A 3GIMA 1FFVA 8ICVA 1LV5A 5ALPA 3I28A 5T14A 2KZ3A 2E1FA 4I28A 3QEBZ 1J2NA 2R8IA 2OXOA 3LK9A 4P4OA 5J2KA 1QLNA 2BZFA 4EENA 3C23A 2F3NA 1QSYA 4F4KA 3RB3A 1Q3VA 2KZMA 5AK4A 4DOCA 1PZNA 3SQIA 3KZIU 4NL9A 1ZQBA 4RQ7A 5ALVA 4QIWC 3D2QA 3E58A 4UB3A 3BQ1A 7ICQA 4QWCA 2K8AA 2A1AA 4RPXA 2FDRA 5HC9A 3AEVA 3UXNA 4CF4A 4UB5A 2DKXA 1KN5A 2DR5A 5KFAA 4QIWF 3CRXA 3H4DA 4YG2A 8ICQA 3JYYA 2K4HA 5ALFA 4X4UA 2LYBA 1XWLA 1ZJMA 1NK9A 3RH4A 4QZCA 5HRFA 3SD7A 2PFNA 3H40A 2VIXA 3LVWA 3BZKA 4IQVA 4BWMA 1NK8A 1X42A 3PR5B 3HIYA 3PO4A 3NVVA 5EE3A 1RG6A 4F4YA 5DB7A 3PMNA 5DB9A 7ICNA 5J0YA 1VLBA 1XO1A 2VJ4A 3IM1A 3QYPA 3HKZC 2DWQA 2G08A 2IHOA 3G6YA 4UB1A 3THVA 4Z6DA 1Z3EB 1DK2A 2RQ5A 4KITB 4GLXA 3JPPA 4FHXA 3F2DA 3SV3A 1JAJA 4O3MA 4C0ZA 4Y2RA 4DS5A 1JQRA 1RYUA 2FPMA 4X4VA 5ALQA 1SWWA 4KX3A 1VDVA 4ECWA 5KFWA 2M2VA 9ICOA 4NLBA 4IR9A 3E0FA 3WK6A 1KRPA 4X0BA 1Q79A 4XUSA 3F2BA 4DSFA 4YMNA 5HHHA 3CNHA 2BQ3A 1S76D 4PGQA 4M0AA 3C29A 2AGPA 4RWQA 5DKWA 2EZZA 1VJ7A 1TAQA 4F5OA 4DFPA 4KLMA 2DRAA 1ZQFA 2B51A 2F8LA 4BX9C 2KN7A 1NK0A 4X4RA 4KLTA 2KSOA 4DFKA 4PGYA 4UAWA 5EWGA 2DGZA 5KG3A 1DK3A 5AI6A 4OJLA 5KG5A 3OHAA 1V38A 3JPOA 2HOQA 4KN4A 1UA0A 5AK5A 4Z6CA 5KFXA 3T5JA 4M9HA 1KW4A 1SL0A 4QWDA 8ICEA 3RJJA 1SZPA 4B9UA 2QB0A 3QU2A 5F9NA 4MF2A 1SV0A 3I1YA 4NLZA 1ZQYA 4DO9A 3F2CA 4ECTA 3EZ5A 1ZD5A 3V6KA 5KFTA 1Z1BA 3OPXA 3WK5A 2BDUA 3WKAA 4JV2A 2YB4A 3QNMA 2JEGA 1V9PA 5AKKA 5ALLA 1SL2A 1EXNA 1MSWD 4B9VA 2AQ0A 3WKCA 3N7SC 2FCLA 4TUSA 2KEYA 5CFUA 1BGXT 2IMWP 2G5IB 4AP9A 4FHWA 4DSLA 2DRBA 1XSLA 1QSLA 2O6KA 3H8WA 2KNJA 5D4BA 4ED2A 2XGPA 2ESEA 2H3IA 5L1KA 2ZTEA 3Q8MA 4AT9A 5IIIA 1VJ5A 3SEIA 4DSKA 4P2HA 1B43A 4WBZA 3T79A 4I2DA 7ICKA 2KG5A 4ED0A 9ICEA 8ICRA 3KFUF 2F76X 5J0PA 1MQ3A 3BS5A 3OHBA 2HSZA 5J0RA 1UT5A 3B0XA 4RWOA 4F71A 2XC9A 4C7YA 1CEZA 2Y0SF 4OJ5A 2W03A 3JCFA 1L7MA 3GV5B 1L3UA 5A0LA 2XCAA 4AT7B 2YTUA 4DEZA 5DG9A 4B9SA 4JLXA 4E8FA 2KHQA 1TVAA 2W9CA 3PW4A 2ZUBA 2IHNA 3TKAA 4DOBA 2BCVA 4QW8A 3MDCA 2UVWA 9ICBA 2K4PA 3RJEA 4MKPA 4DQQA 3TADA 4OAHA 4NM1A 2KHVA 4UAZA 5F9LA 1IM4A 2LYHA 4EZ9A 4OJOA 3ORYA 1O08A 1RQLA 2ZXIA 4TQRA 3ISBA 3C21A 1ZQDA 4QZAA 5KFGA 2K60A 2E8MA 3RF9A 4YR3A 2HHPA 4ELVA 2AGOA 7ICIA 7ICRA 1IV8A 3RBDA 4ECUA 2R8HA 5DBAA 4ECXA 4RQ5A 4YP3A 3NKUA 4WC1A 5ALWA 5AI8A 7ICOA 4F93B 1T94A 3MGHA 4FBUA 4F91B 3UXPA 4WQLA 1T3QA 1UPHA 4OAIZ 2PFQA 2KP7A 3AQFA 5KNIA 4QWAA 4DOAA 2OWOA 1TFWA 2ASJA 2ZUCA 2HCFA 2LM1A 3ER9B 9ICSA 1ZQVA 1X9XA 3NVYA 5ALDA 1S77D 4K96A 4E7XA 1Z1VA 2IUBA 1HIWA 2KJ8A 4CF5A 3AMZA 3KZXA 5F3XB 5IINA 1KL9A 1ZOLA 4IC9A 5AM2A 8ICMA 4RQ3A 1XC9A 4FH3A 1XS9D 5ALJA 1X9WA 4F72A 2AQ4A 4R8UB 5DLGA 2M9NA 1ZQXA 2CPRA 8ICFA 3V7LA 5CJ7A 2ATLA 4JK1A 2YMQA 3TI0A 4UW9A 2E8NA 1T4GA 4QZFA 5HMLA 4DL2A 3Q8LA 4GFJA 4O9MA 2VA2A 3NWIA 2E8PA 4EBCA 5JU5A 5AK3A 3PW0A 2NO4A 4O3NA 5ALUA 4X4TA 5J2EA 4I2BA 1FO4A 4CF3A 4DQPA 5ALXA 3GIIA 2HHUA 2K89A 3PHZA 4PH5A 2YQEA 4K9AA 4WBYA 1V85A 1CI4A 3Q8QB 4O3OA 2D6FC 3F53A 2UVUA 3SAHA 1PK1A 2ZH7A 1SWVA 5ALRA 1ZQOA 3IV6A 1F5SA 2BBHA 2NYVA 1LB2B 5CR0A 3LWLA 3ISDA 1NZPA 1PUZA 5HRHA 3WK4A 1WWVA 4R8UA 5KFSA 5JRTA 8ICPA 5CFTA 1TFYA 1Z4NA 2JEJA 4JUZA 4ATBA 1X9MA 1O03A 4QZ9A 1F44A 4Y2UA 1JROA 3RR7A 2W9AA 3TANA 1NK4A 4OJPA 1UCVA 1U9LA 4UB8U 4EEKA 5KFHA 2ZJ5A 3F5AA 5B5EU 3OSNA 4USAA 5KFEA 4NXXA 2EH9A 4F5NA 3NGDA 3PY8A 4RNOA 4G3IA 4BWJA 4GC6A 5KL1B 3MGIA 1X6IA 3NRWA 1XSPA 1RXWA 3QU4A 4M5DA 4C8LA 1X6JA 4ED8A 4US9A 4K4HA 3GFKB 2NRWA 4MHVA 3AN1A 4I2IA 4P0PB 4NM2A 2F2AB 1ZQCA 9ICJA 5HRLA 1UEVA 3PX4A 5J2IA 5J2DA 1S0NA 2VA8A 5DBCA 9ICMA 4YMMA 1N5WA 3LQCB 4ED6A 2JZBB 2DFLA 1IIPA 1PK1B 3K1ZA 3HWTA 3L9DA 3OJUA 4OJ6A 3C28A 3QUQA 4RQ6A 5E79U 7ICFA 3IN5A 1QTMA 3D2SA 2KIWA 3T5KA 4BXOB 3UQ2A 3ETLA 2ZIWA 3RH6A 3ZD8A 4JV1A 3V72A 1BPYA 3AQMA 4AYBF 2ALZA 1ZQUA 5J2GA 1Q46A 5ALEA 2QLTA 3OVSA 2D3DA 1KLNA 9ICVA 1KEJA 3IRUA 4KX5A 4F4XA 1KSPA 3RJHA 5AM0A 2FJ6A 5J2FA 4U7CA 5J29A 1F0MA 2EAPA 4ICAA 4GXKA 4DSIA 3NASA 3K4GA 4ATBB 4WH5A 1X40A 4ELUA 2RDIA 3C66A 5C5JA 2EAMA 2UVVA 3PX6A 3QZ7A 5KG1A 2EQYA 4O5CA 3GV8B 2LMRA 1JX4A 1DGSA 3RB0A 2KSOB 2DBYA 1T7PA 2WAQF 2HDOA 4M47A 3OJSA 4MFAA 1S0OA 1WG8A 4DLGA 4IS7A 2ZIXA 3JZ0A 3E2EA 4MFFA 2F1IA 2P6UA 4UATA 2H5XA 2KIVA 4ECVA 2O5AA 4UBCA 3MCRA 3LWMA 9ICPA 4QZHA 2K8CB 4YXJA 4Q8FA 4XA5A 4Y2XA 1DGJA 1UQVA 2ZXHA 2WF5A 4GC7A 4KN7A 3H0RB 2W9BB 5HNKA 2Q66A 5J8YA 4P0QB 3M8RA 5DEDA 1KKXA 8ICCA 4QZDA 3UMBA 1ZD3A 5CB1A 1NNLA 4C4SA 4PHAA 1SXEA 5AIAA 4IQWA 3MR2A 5HMMA 3HILA 2YB1A 4C8MA 3PZPA 9ICUA 4GIBA 2Z7JA 5KFYA 3JPNA 1ZQGA 5KAFU 4Q8EA 1L5UA 2WTFA 1ZQIA 3GV7B 4OO1J 1JUDA 2YMPA 2ZIUB 2W8LA 8ICYA 2Q4TA 1FA0A 4O0IA 9ICNA 1PK3A 5IIOA 3PSFA 5DB6A 1NK6A 1N2XA 4I2JA 2W9CB 1DRGA 5TISU 5HRDA 2HHQA 2D8CA 1LVHA 5IIKA 2Y9UA 3QX7A 2E8OA 4KLSA 2NRZA 1N56A 2CXYA 4B9MA 2WFAA 2H3VA 4DF4A 4KLDA 4O3QA 1VFGA 1ZQPA 9ICGA 2KVSA 5AM4A 4KLQA 1URJA 3H0MB 4EBKA 2A1JB 4ELTA 2DKZA 4OAFA 1KBUA 2NV3A 4IQTA 4O5KA 1NOMA 2M0NA 3WFQE 4FO6A 1Z19A 4I29A 4KLUA 4K4GA 5AICA 4O69A 4A8EA 1U49A 3TQ1A 1GO3F 9ICTA 5J0QA 2BCQA 8ICUA 2IA6A 4IRDA 2I1QA 3RJKA 4YXMA 9ICQA 2EZXA 1SZHA 3ZDEA 2BKEA 5KFQA 2V4RA 3M6KA 2BPFA 4YCXA 5J0OA 5KFPA 1UA1A 2QARA 4OD0A 5KG2A 5ALKA 2EDUA 1MIWA 4RWNA 3OTQA 3H37A 1NKBA 4RQ1A 2YN4A 4GXIA 2XY7A 3RJFA 1K1SA 1QQ6A 4FS2A 4DLEA 5J0UA 2DQNB 4YD2A 3TFRA 3SAGA 4X0AA 4EX7A 2W7OA 2W11A 4C4TA 3RRGA 2HHWA 3RJGA 3NS1A 3BDPA 1PVQA 3H8JA 5BPCA 3HRDD 1YT3A 3MFIA 3ALRA 1B0XA 4IQUA 5KFMA 4DQIA 1DXSA 1NI3A 3ZDCA 8ICNA 5EWEA 1D8YA 2P35A 4UAYA 4PHPA 5ALMA 5EWFA 4WCWA 5KFBA 1JALA 4F4WA 4WOYA 1N5XA 3C5GA 3H39A 4KLFA 1JIHA 5CHGA 4BGDA 4N7RA 2VKQA 2E1EA 4FS1A 5DQIA 3EF2A 1T8EA 3CYMA 4EYHB 1U47A 4NY8A 3LYSA 4WC7A 1Q78A 3UM9A 3L5KA 3DEEA 3KHLA 1RYSA 1SKWA 1S0MA 9ICXA 4UB4A 2JH1A 5J2JA 1AROP 2EZYA 3FDSA 3UXOA 2XGQA 5AK6A 2GAFD 5KT6A 2A3VA 1L8LA 2MAXA 3N97B 4XQ8A 1S9FA 2XO7A 4HYKA 2HMXA 4RT2A 3WFPA 4FHYA 5ALSA 5KTQA 2JR5A 1BNPA 2OHFA 4PZNA 2DPJA 2CRXA 5D63A 2IBKA 3GIJA 5AM5A 4EELA 4NXUA 1SXDA 8ICJA 7ICHA 4I27A 1NJZA 3LVVA 3RTVA 9ICIA 4FH5A 2EANA 2J6SA 1U48A 4E80A 4TURA 4O67A 2I5HA 4RNMA 1A6SA 4LZDA 3AU6A 1NJWA 5JTIA 4HX0A 4QW9A 1BPDA 1R89A 1WCLA 2ZH5A 3RJIA 1RZTA 1ZQSA 4JV0A 2WF7A 3AU2A 4EV6A 2RDJA 9ICRA 4XRHA 2KTQA 1JXLA 3J81j 7ICEA 2BHNA 1X66A 4AYBC 1OW5A 4R66A 5KG0A 3ZD9A 3ISCA 1QSSA 5L1MA 3KHHA 4UAUA 2ZJ8A 1K1QA 3WK7A 2HBKA 3DDHA 3HJEA 5K4LA 2QKQA 2BQUA 7ICVA 3M1YA 1COOA 3HP6A 4CGZA 4WC0A 1X9SA 2MA1A 4LEWA 5HREA 5KT3A 4ECRA 1NK7A 1JXEA 2F77X 1TE2A 4RNNA 4RZRA 3RFAA 3ZDBA 2FLLA 4RQ4A 4KMUA 3B0YA 3VC8A 5ALYA 4BXOA 2HN1A 4EGWA 5HRBA 2CN1A 4CCHA 3WFRE 5J2HA 4MF8A 4CE6A 2RRDA 4P0PA 2DR9A 5J0TA 2M2WA 2PFPA 1L3TA 3UQ0A 1ZQRA 4FZMA 3OVAA 2C2RA 2F1JA 5CEHA 2HVHA 4EBJA 3C5FA 3SYZA 4Z6EA 2HHXA 1S97A 2BGWA 8ICOA 2LI6A 8ICLA 2FE9A 3WFSC 3NTUA 3DV9A 4LJXA 4EEYA 1CRXA 4QWBA 1ZJNA 5ALZA 5EOZA 3FAHA 3PX0A 3V6JA 1XU4A 1MC8A 4YR2A 2IOHA 5AM3A 3G6XA 1KFTA 3NRZA 2LHTA 4YMOA 3MBYA 4I2EA 2HOIA 3FC4A 3H4BA 4FHPA 4F5QA 1RYRA 5GTIU 4DFJA 4Y2PA 3B9JA 2LPEA 1U4BA 3MR6A 5AKYA 1L7PA 9ICHA 2DF4B 1UETA 1N61A 1SB3C 3SV4A 5KG4A 2KFZA 4M9GA 3CW2C 5J2BA 2FMPA 3MR3A 4UB6U 5BOMA 2NRXA 2MSNA 5KFVA 2V4QA 3AQLA 4O6AA 2FPKA 2ZH8A 4F2SA 5EE1A 1ZD2P 2ISPA 2ZIUA 5J0XA 3RR8A 2PI5A 2OEHA 5KFKA 1ED1A 2C2EA 2FI1A 3WKDA 1ZQKA 4LEVA 3PR4A 3C2LA 9ICLA 1K5OA 1JI7A 4C4RA 4Q43A 9ICWA 2IOFA 2UVRA 4I2FA 1J97A 4KB6A 1OUQA 4Y2JA 5DB8A 5DQHA 2GWSA 2AGQA 2H3FA 2WF9A 1NKEA 7ICMA 1FFUA 2BCRA 4UAVA 3WU2U 1T3NA 1ZRMA 4C8OA 2OH2A 4M9JA 2KFNA 1ZQ1C 3AQNA 5KFIA 2ODGA 4I2CA 1ECWA 1WUDA 3GIKA 2FMQA 2ZTDA 4DL3A 4DL6A 4DF8A 2HHVA 2I6XA 4NLGA 4ZOHC 2F8KA 4UASA 1DOQA 4I2HA 4O3PA 2QB0B 2K4IA 2FLNA 2BE3A 2L5YA 5G5GA 4CRXA 4LZGA 3PSIA 2VA3A 2ASLA 4PGXA 4PL2A 5CA7A 8ICIA 4BUGA 4C8KA 5KFUA 2RHFA 2ZH9A 4JB3A 4LEYA 4R64A 5KFDA 3SAFA 4J9QA 3RB6A 2LM4A 1XNSA 3FM9A 2J6TA 1ZQMA 2Y1IA 4DFDA 4US8A 4F5PA 1TKDA 2KZZA 4R65A 2Y0SC 3ETRA 3Q8RB 4NL9C 2PKEA 1OU5A 1FEZA 2HHTA 4LVSA 4ZH4A 4S3NA 3TFSA 4EYIB 4QJFB 3KHRA 2FPLA 2W8KA 1F5AA 4AT8A 4YVZA 4NKTA 2JMGA 2RLTA 4BJQA 1QQ7A 2QB1A 1YLQA 5KT7A 5KFRA 5ALHA 3WKEA 3H7IA 4ECQA 1NO5A 1CUKA 1A77A 5DBBA 5ALGA 4F92B 5AHXA 1ZQJA 5CHEA 1OXJA 2G06A 4DQRA 4J03A 5KL8B 4NXWA 4X4PA 4RPYA 5L9XA 2G07A 1XSNA 3AQKA 4CDGA 3Q8SB 2ZHAA 1R8AA 2AHOB 2MRLA 4KM5A 2NRVA 4J9LA 4J9SA 5BOLA 2ES6A 2ZIXB 1D8BA 1TV9A 1SGGA 4YN4A 1ZQEA 3V6HA 3PSPA 4MFCA 5B3QA 4Q45A 8ICXA 2IOFK 4ED1A 1KQQA 3HJ4A 5B3PA 4UD4A 2XY5A 8ICAA 3OV7A 3JPTA 3KD3A 4NLNA 3ERCC 3QU9A 4J9RA 7ICLA 1SV4A 3RB4A 2BQRA 1KFDA 3GQCA 4FZNA 3KKAC 5H2FU 5CP2A 4FO1A 3UMGA 5KAIU 2JXJA 4QZIA 1ZYQA 3M9NB 4NXZA 3GZFA 1UHUA 1SIJA 4J9MA 1HEKA 4JLZA 5L1IA 3OSPA 8ICWA 1KNYA 2B6GA 1Z4OA 1KFSA 3L4PA 2ZH6A 4O68A 1C20A 1TK0A 4P0QA 2OM6A 3R9KA 4QZBA 2EAOA 5KT4A 4WQKA 4C80A 1ZQWA 9ICKA 1KTQA 2F44A 3QU7A 1L3VA 2Y1JA 5J2AA 3RH5A 1N63A 4EEDA 3RAQA 5HRIA 1NJYA 2QARB 3HT3A 5KG7A 4HAIA 4G9BA 2MUTB 5ALIA 1L3SA 4EEBA 3M8SA 3T3FA 3PV8A 3UPSA 4EP7A 2XICA 5AI9A 2OCEA 4NJ8A 5J0SA 3C2MA 5J0WA 1GPJA 2JGAA 4I2GA 1ZQHA 3WKBA 3OWGA 3IDWA 1TK8A 4GXJA 5D46A 5KFFA 3CP8A 3AL0B 1Z00A 1QCKA 1N60A 2NRTA 3TAQA 8ICBA 2PXIA 4DFMA 5AIBA 4ECZA 1YZ6A 3HPOA 4KMOB 4FHVA 3IG8A 2HHSA 1PVRA 3SZ2A 4J9NA 2A19A 2WB1F 5G5HA 5B66U 5DECA 2BR0A 3K75D 2R8GA 1S5LU 5KFOA 1WWUA 4EZ6A 2ZH1A 4K98A 4K4IA 2AH5A 1ZQTA 2WAQC 4RWPA 3Q8PB 1L8OA 2C2DA 4B6JA 1J2MA 1S0VA 4K99A 4AT8B 3PVXA 3PW5A 2FMSA 5D61A 5DG8A 5DLFA 1BPEA 4Q44A 5TZVA 4NXVA 2JHDA 4X4QA 5AKEA 4NV0A 2BDPA 1SL1A 2BPCA 3ONNA 3T5LA 4NWIA 3HX0A 3KHGA 2BCUA 3BS7A 4FBTA 4KLLA 3MC1A 4O3SA 2ZH3A 5AKLA 2KMDA 3O0FA 2IHMA 3SI8A 1D8LA 4J9KA 3NVOA 4YD1A 1L7OA 4B9LA 2XCPA 4ECSA 4ECYA 2A1JA 4NKUA 5IILA 1S8OA 4TQSA 2KOBA 1Y88A 4KLJA 1BNOA 3TADC 5KFLA 3TARA 1ZXIA 4ED7A 2F1HA 4RUCA 1BPXA 3U26A 2B21A 3AQEA 2ZH4A 5KG6A 1TAMA 3IP4B 1KDHA 3H8MA 2XY6A 4Y2TA 2HW3A 4RUAA 3WK8A 4KLGA 2VANA 1L7NA 3KTQA 2HBLA 2W3SA 4PHDA 2BPGA 1C7YA 5L1LA 4FZLA 1SV0C 1A76A 2GOLA 4OCZA 5AI0A 3EWAA 1HUZA 3ZDDA 2BBJA 2JZBA 5AI4A 3D2NA 3AM9A 2YX8A 2W43A 2P6RA 2MU2A 4MEYA 5CWRA 2O1PA 1D9FA 2LKYA 4X5VA 4WJ3B 3C2KA 3A0BU 2EWRA 2ISOA 4DSEA 4TUQA 1ZQQA 7ICSA 2ZG6A 3K1RB 4RQNA 4KLOA 5KFCA 4PJ0U 1V97A 1NKCA 4DCCA 3WFOA 4IRKA 4I0UA 5AKGA 1NZBA 3MFHA 1H38A 1P7DA 2K8BB 3QUTA 3UPQA 3KBBA 1L6NA 2DVIA 4WC4A 4K9BA 3GU3A 1QQ5A 3L3FX 4IG8A 1U45A 3MR5A 3C1ZA 4P4MA 9ICAA 3I76A 3GDXA 3AUOA 1MA7A 2HBMA 4CNQA 4NXTA 2KICA 3RAXA 2H3QA 2ZH2A 1TK5A 1M6YA 1TFRA 3JPRA 4DQSA 1N62A 2R8KA 1QH9A 3N28A 3RRHA 1AQ6A 5HP4A 2NO5A 4IRCA 4Y2YA 2DR8A 4K97A 4J9PA 1RM6C 4XJEA 2OYYA 5DGBA 5DDMA 5JTGA 2V9WA 1HJPA 4FE3A 8ICHA 1RDFA 2C22A 1Z00B 5AKXA 2G0AA 1NK5A 8ICZA 5D62A 5FP0A 2JEFA 3SMVA 2PFOA 2JEIA 2W9BA 2JRZA 2PBEA 1IXRA 4F3OA 2KKVA 2AU0A 3KKAA 3C18A 4EBDA 9ICFA 4X4NA 3GILA 4KLEA 1V4AA 4DSJA 1B4FA 2DPIA 4KTQA 4WC2A 5L1JA 2J6UA 2W3RA 2YMMA 2Y9TA 2HVIA 7ICUA 1ZD4A 3M6ZA 4K8VA 3HW8A 1HUOA 3QUCA 4IR1A 1UT8A 5KFNA 3MGVA 4DL4A 1LKYB 3H8SA 2B56A 4QWEA 5JUMA 4IL6U 3A0HU 2G5HB 2HN2A 4ACOA 4M6WB 1R8CA 4LEZA 3OUYB 4Y2VA 4PHEA 4JWMA 2ZJAA 3TACB 2H3ZA 8ICGA 4U6PA 4AT7A 2R18A 3UMCA 4UARA 4RQMA 3QU5A 4BDPA 1Q8KA 2KKPA 4KLIA 3V7JA 2WF6A 3K7DA 3NUQA 3KOOA 3M7DA 1ZQAA 2W7PA 1LKYA 1MIYA 3ICXA 2B4VA 2W04A 4DL5A 3EUB2 1JN3A 4P4PA 7ICTA 3BS5B 3M9OB 4E0DA 2YMLA 1BVSA 3N4MB 4RQ8A 3H3AA 5DGAA 2KK0A 2WB1C 2M2UA 3ED5A 3N7RC 1B22A 1ZQLA 3ER8C 2AJQA 5AI5A 2R8JA 3PSTA 4KLHA 2W55A 3VCBA 3NVZA 1RXVA 3M9MB 3EPIA 7ICJA 3SENA 5HR9A 4Z6FA 4AT9B 2GO7A 2GA9D 3H0LB 4F2RA 2ZIVA 3FYHA 4FFDA 1X2IA 3T5HA 2HBJA 4RU9A 2PI4A 2JH7A 4Y2QA 1RPLA 2XVTA 2GLEA 5AKHA 4C7ZA 5KT5A 4DL7A 5KFZA 5HRKA 5HRGA 2KE7A 2W9MA 2ZIWB 1TAUA 3OUYA 2XIDA 4M6WA 3ZI4A 5J8YC 3HKZF 5ALTA 3PNCA 4QNLA 4UQGA 4NLKA 1RQNA 3D6JA 2E5SA 2LBOA 2G09A 4O5EA 5HR6A 5IIJA 5GTHU 4EX6A 2K4EA 1UEUA 5EE0A 3WK9A 1SKSA 4B9NA 4Y2SA 4B9TA 1R8BA 4DS4A 5HHIA 3TAPA 5CRXA 3RBEA 1N48A 4J9OA 3H38A
chains in the Genus database with same CATH topology
4WC1A 7ICOA 4F93B 3ZDCA 4QZEA 1TK0A 8ICNA 5EWEA 1D8YA 3MGHA 4FBUA 4F91B 4UAYA 4QZBA 3UXPA 5KT4A 3EW9A 4PHPA 5EWFA 2PFQA 2ZUDA 5J2CA 5KFBA 4ED3A 2KP7A 1S10A 4QZ8A 4F4WA 2NRKA 1ZQWA 4WCWA 4ECXA 3PW2A 7ICGA 4QWAA 4DOAA 2OWOA 3C5GA 9ICKA 4X4OA 3H39A 4KLFA 1KTQA 1JIHA 1TFWA 4F4ZA 2ASJA 4WC5A 5CHGA 2ZUCA 4BGDA 2ZH2A 9ICSA 1ZQVA 1L3VA 4M04A 4FS1A 2Y1JA 4DWIA 5DQIA 5J2AA 3RH5A 4EYHB 1T8EA 1S77D 3HJ1A 1U47A 4NY8A 4E7XA 4WC7A 1Q78A 5IIMA 2MUTA 3RAQA 4M2YA 5HRIA 1NJYA 3HT3A 3KHLA 3BQTA 5KG7A 5DDYA 1RYSA 1SKWA 1S0MA 9ICXA 4UB2A 4QZGA 4UB4A 1WOTA 5J2JA 2MUTB 1AROP 1L3SA 3M8SA 2ID1A 5IINA 3FDSA 3UXOA 2XGQA 3T3FA 3PV8A 3UPSA 3MDAA 1D9DA 4EP7A 5KT6A 5J0SA 3C2MA 8ICMA 4RQ3A 5J0WA 1XC9A 4UBBA 2MAXA 8ICSA 4FH3A 3N97B 1XS9D 4XQ8A 4MEXA 1X9WA 4YR0A 4O3RA 1ZETA 2AQ4A 1S9FA 2XO7A 4I2GA 4HYKA 4R8UB 5DLGA 1ZQHA 2M9NA 4RT2A 3WFPA 1ZQXA 1TK8A 9ICCA 4FHYA 3C1YA 4GXJA 5D46A 5KFFA 8ICFA 1Z00A 5KTQA 3Q8KA 1BNPA 2NRTA 3TAQA 3V7LA 5CJ7A 2ATLA 4JK1A 2DPJA 4I2AA 4JWNA 8ICBA 3TI0A 4M9LA 4QZFA 1T4GA 3PMLA 4UD5A 5HMLA 4YQWA 2PXIA 4DFMA 3PW7A 3GIJA 4DL2A 2IBKA 3LDAA 3Q8LA 1MIVA 4ECZA 8ICJA 4M9NA 4O9MA 4WC3A 2C28A 1ZQZA 3HPOA 2VA2A 4I27A 1NJZA 7ICHA 3RTVA 9ICIA 4FH5A 3BJYA 4FHVA 2HHSA 3JPSA 3SZ2A 4J9NA 1ZQNA 1BPBA 1U48A 2J6SA 4TURA 7ICPA 4E80A 4EBCA 3PW0A 8ICKA 4RNMA 4O3NA 4X4TA 5DECA 5J2EA 4I2BA 4LZDA 3EPGA 2BR0A 4RQ0A 3K75D 2R8GA 3AU6A 8ICTA 5KFOA 1NJWA 4EZ6A 2ZTCA 4QW9A 2ZH1A 4DQPA 3GIIA 4K4IA 1JMSA 1BPDA 5KT2A 2HHUA 1WCLA 1ZQTA 1R89A 4PH5A 4RWPA 4X4SA 3Q8PB 2C2DA 2ZH5A 4F50A 4WBYA 3Q8QB 4O3OA 3RJIA 2UVUA 1RZTA 5F2VO 1ZQSA 2ZH7A 4R63A 4F5RA 4JV0A 4PPXA 3AU2A 3JPQA 1ZQOA 4C8NA 1S0VA 4XQ7A 3G6VA 4AT8B 3PVXA 2RDJA 9ICRA 1PX5A 1LB2B 4XRHA 3PW5A 4RPZA 5CR0A 3LWLA 3ISDA 2FMSA 2I9GA 1NZPA 2KTQA 3QE9Y 4TUPA 3BQ2A 5DG8A 1JXLA 5HRHA 2FLPA 5DLFA 1BPEA 4R8UA 7ICEA 4Q44A 5TZVA 2BHNA 3MABA 5KFSA 4R66A 3ZDAA 1NJXA 5KG0A 3ZD9A 5D49A 3ISCA 2JEJA 4JUZA 1MQ2A 1QSSA 4X4QA 3QZ8A 4ATBA 3KHHA 1WCNA 4QZ9A 1X9MA 2BDPA 2M2TA 3OVBA 2ZJ8A 1SL1A 1K1QA 3RR7A 2W9AA 2BPCA 3TANA 1NK4A 2BCSA 4YFKA 3T5LA 5DG7A 2BQUA 7ICVA 5KFHA 1U9LA 1COOA 3HP6A 3HX0A 3V7KA 4WC0A 5KFJA 3KHGA 1X9SA 3NYBA 2ZJ5A 5HREA 5KT3A 4ECRA 3OSNA 1NK7A 1JXEA 2BCUA 2RFFA 4FBTA 4KLLA 5KFEA 4O3SA 2ZH3A 3IHQB 2Q0ZX 4RZRA 4RNNA 3EYZA 4F8RA 2ZHBA 3PO5A 2IHMA 4F5NA 3NGDA 1BPZA 3ZDBA 4RNOA 2FLLA 3PY8A 5DQGA 4G3IA 4BWJA 1D8LA 4GC6A 3SI8A 4RT3A 4RQ4A 3OGUA 4KMUA 3MGIA 4J9KA 3B0YA 1XSPA 1RXWA 4BXOA 4LT6A 2ASDA 2DR7A 5HRBA 1SKRA 4CCHA 4EBEA 4C8LA 3WFRE 5J2HA 4MF8A 3QEAZ 4ED8A 2DR9A 4YD1A 2P66A 5J0TA 4K4HA 2M2WA 4B9LA 2PFPA 2XCPA 3UQ0A 3GFKB 2NRWA 1L3TA 4ECSA 4ECYA 1ZQRA 2A1JA 4NKUA 5IILA 4TQSA 4I2IA 3OVAA 2C2RA 1Y88A 4RQ2A 2F1JA 4KLJA 2HVHA 4EBJA 4WC6A 3C5FA 4NM2A 3BQ0A 1ZQCA 1BNOA 3SYZA 9ICJA 4Z6EA 3GIMA 2HHXA 5HRLA 8ICVA 1LV5A 5KFLA 3TARA 1S97A 2BGWA 8ICOA 4ED7A 2F1HA 8ICLA 4RUCA 3NTUA 1BPXA 1UEVA 3WFSC 2B21A 2KZ3A 2ZH4A 4EEYA 4I28A 4QWBA 3QEBZ 5KG6A 3PX4A 5J2IA 5J2DA 5EOZA 2R8IA 3PX0A 3LK9A 1ZJNA 1S0NA 1KDHA 2VA8A 5J2KA 5DBCA 1XU4A 4P4OA 3V6JA 1QLNA 1MC8A 4YMMA 4YR2A 3G6XA 2XY6A 9ICMA 3C23A 1KFTA 4ED6A 3LQCB 2JZBB 2DFLA 3RB3A 1QSYA 4F4KA 2HW3A 2KZMA 4YMOA 3HWTA 4DOCA 3MBYA 4I2EA 4RUAA 4FHPA 1PZNA 4RQ5A 3H4BA 1ZQBA 3L9DA 4RQ7A 3OJUA 4KLGA 2VANA 4F5QA 1RYRA 3KTQA 4RQ6A 4DFJA 7ICFA 1U4BA 4UB3A 4PHDA 3BQ1A 2BPGA 3MR6A 1C7YA 1QTMA 4QWCA 7ICQA 5L1LA 3T5KA 9ICHA 4RPXA 1UETA 4BXOB 3OV7A 1A76A 5HC9A 3UQ2A 3ETLA 3EWAA 3RH6A 3ZD8A 1HUZA 3UXNA 3SV4A 3V72A 4JV1A 3ZDDA 4UB5A 5KG4A 1BPYA 2KFZA 3AQMA 2JZBA 4M9GA 2ALZA 1ZQUA 5J2GA 2DR5A 5J2BA 2FMPA 3MR3A 2P6RA 5KFAA 3OVSA 4MEYA 5CWRA 5BOMA 2O1PA 1KLNA 1D9FA 9ICVA 2NRXA 5KFVA 2V4QA 3H4DA 4YG2A 8ICQA 1KEJA 4X5VA 3AQLA 3JYYA 2FPKA 3C2KA 2ZH8A 4F4XA 1KSPA 4X4UA 3RJHA 2ISOA 1XWLA 4DSEA 1ZJMA 3RH4A 4QZCA 1NK9A 4F2SA 5HRFA 5J2FA 2PFNA 3H40A 5J29A 4TUQA 1N48A 2ISPA 4IQVA 1ZQQA 7ICSA 5J0XA 4BWMA 1NK8A 3RR8A 2PI5A 4GXKA 3PR5B 4KLOA 5KFKA 5KFCA 4DSIA 3HIYA 3PO4A 3K4GA 2C2EA 1NKCA 3WFOA 4F4YA 4ATBB 4IRKA 5DB7A 3PMNA 1ZQKA 3PR4A 5DB9A 3C2LA 4ELUA 7ICNA 3MFHA 2RDIA 5J0YA 1H38A 3C66A 3UPQA 9ICLA 1XO1A 5C5JA 2UVVA 4Q43A 9ICWA 3IM1A 3PX6A 2UVRA 2DVIA 4I2FA 3QZ7A 4WC4A 5KG1A 4O5CA 3GV8B 1JX4A 5DB8A 1DGSA 3RB0A 3G6YA 4UB1A 3THVA 1T7PA 4IG8A 1U45A 4Z6DA 3MR5A 3C1ZA 5DQHA 2GWSA 1Z3EB 4M47A 2AGQA 4KITB 1DK2A 3OJSA 4P4MA 4MFAA 1S0OA 1NKEA 9ICAA 4GLXA 7ICMA 3JPPA 4FHXA 3GDXA 2BCRA 4DLGA 1T3NA 3SV3A 1JAJA 3AUOA 4DS5A 3JZ0A 4C8OA 4M9JA 3E2EA 2KFNA 4MFFA 2FPMA 3RAXA 1JQRA 4X4VA 2F1IA 4ECWA 2P6UA 1TK5A 2H5XA 2O5AA 1TFRA 4ECVA 4UBCA 3AQNA 5KFIA 5KFWA 3JPRA 3LWMA 4DQSA 2R8KA 9ICOA 2M2VA 4IR9A 9ICPA 3RRHA 4QZHA 4I2CA 1KRPA 5HP4A 4X0BA 4IRCA 2DR8A 3GIKA 2FMQA 2ZTDA 4YXJA 4J9PA 4XA5A 4Q8FA 4XUSA 1Q79A 4DSFA 4DL3A 5DGBA 5DDMA 2V9WA 4YMNA 4DL6A 5HHHA 1HJPA 4DF8A 2BQ3A 2HHVA 8ICHA 1S76D 3H38A 4PGQA 4GC7A 2AGPA 4M0AA 2C22A 4NLGA 5DKWA 4KN7A 1VJ7A 4RWQA 1Z00B 1TAQA 4F5OA 4DFPA 4KLMA 1NK5A 8ICPA 2DRAA 1ZQFA 8ICZA 2JEFA 1DOQA 2W9BB 4I2HA 4O3PA 2PFOA 5HNKA 2Q66A 2JEIA 2W9BA 2FLNA 2BE3A 2PBEA 2KN7A 1NK0A 1IXRA 4X4RA 3M8RA 4LZGA 2VA3A 4F3OA 5DEDA 2AU0A 3C18A 4KLTA 2ASLA 4EBDA 4PGYA 4DFKA 4UAWA 8ICCA 4QZDA 9ICFA 3GILA 4X4NA 4KLEA 5EWGA 5CA7A 5KG3A 4PGXA 5KG5A 5CB1A 3OHAA 4DSJA 1DK3A 1V4AA 2DPIA 3JPOA 8ICIA 4PHAA 4KTQA 4WC2A 4KN4A 1UA0A 4C8KA 4Z6CA 5L1JA 5KFUA 2J6UA 5KFXA 3T5JA 4IQWA 3MR2A 5HMMA 4M9HA 2HVIA 7ICUA 2ZH9A 1SL0A 4C8MA 4R64A 9ICUA 4QWDA 8ICEA 3RJJA 5KFDA 3HW8A 5KFYA 1SZPA 3JPNA 4J9QA 3RB6A 1HUOA 1ZQGA 4B9UA 4Q8EA 5F9NA 1L5UA 4IR1A 2WTFA 1UT8A 5KFNA 4DL4A 1ZQIA 3GV7B 3H8SA 4MF2A 4QWEA 2J6TA 4NLZA 1ZQMA 2W8LA 1ZQYA 5JUMA 2Y1IA 4DO9A 8ICYA 1FA0A 4O0IA 3EZ5A 4ECTA 4F5PA 3V6KA 9ICNA 5KFTA 1TKDA 5IIOA 2KZZA 4R65A 4M6WB 1R8CA 5DB6A 3OUYB 3Q8RB 4JV2A 1NK6A 4I2JA 4PHEA 2JEGA 1OU5A 1V9PA 2W9CB 2ZJAA 1SL2A 1EXNA 4JWMA 1MSWD 4B9VA 2AQ0A 2HHTA 8ICGA 4LVSA 4ZH4A 5HRDA 4S3NA 3TFSA 4TUSA 4EYIB 2HHQA 4AT7A 5IIKA 3KHRA 2FPLA 2W8KA 1F5AA 4AT8A 1BGXT 4YVZA 2IMWP 4NKTA 4BDPA 4KLIA 3V7JA 4KLSA 2NRZA 1N56A 4FHWA 4DSLA 2DRBA 1XSLA 1QSLA 3H8WA 5D4BA 4B9MA 1YLQA 4ED2A 5KT7A 2XGPA 5L1KA 1ZQAA 4DF4A 4KLDA 4O3QA 2ZTEA 3Q8MA 4AT9A 5KFRA 1MIYA 5IIIA 1VFGA 1ZQPA 9ICGA 3H7IA 4ECQA 1NO5A 1CUKA 4DL5A 1A77A 4KLQA 4DSKA 1JN3A 5DBBA 4P4PA 7ICTA 3M9OB 4E0DA 4P2HA 2A1JB 1B43A 4WBZA 4EBKA 1BVSA 4I2DA 4F92B 3N4MB 1ZQJA 4ELTA 7ICKA 4RQ8A 3H3AA 4DQRA 4IQTA 4ED0A 5DGAA 4O5KA 2M2UA 9ICEA 8ICRA 1B22A 4X4PA 1ZQLA 1NOMA 2AJQA 4RPYA 2R8JA 5L9XA 3WFQE 4KLHA 5J0PA 4FO6A 1XSNA 4I29A 3AQKA 1MQ3A 4KLUA 4K4GA 1RXVA 3Q8SB 3M9MB 3EPIA 2ZHAA 7ICJA 3OHBA 1R8AA 5HR9A 5J0RA 1UT5A 3B0XA 4Z6FA 1U49A 2NRVA 3TQ1A 4AT9B 9ICTA 4RWOA 5J0QA 4J9LA 2BCQA 4F2RA 8ICUA 2XC9A 4J9SA 2IA6A 5BOLA 4IRDA 3FYHA 1CEZA 2I1QA 3RJKA 1X2IA 3T5HA 4YXMA 1TV9A 4YN4A 9ICQA 1TFYA 4RU9A 2PI4A 1ZQEA 3V6HA 4MFCA 3GV5B 1L3UA 4Q45A 3ZDEA 2XCAA 1RPLA 2BKEA 5KFQA 2V4RA 5KT5A 4AT7B 5DG9A 4DEZA 5KFZA 4DL7A 4B9SA 8ICXA 4E8FA 5HRKA 5HRGA 4ED1A 2BPFA 1TVAA 2W9CA 2W9MA 2ZUBA 3PW4A 2IHNA 4YCXA 5J0OA 3HJ4A 2XY5A 8ICAA 4UD4A 5KFPA 3JPTA 4DOBA 4QW8A 3MDCA 1UA1A 2BCVA 2UVWA 1TAUA 9ICBA 3OUYA 5KG2A 4M6WA 3RJEA 4NLNA 1MIWA 4RWNA 3H37A 4J9RA 7ICLA 1NKBA 4RQ1A 4GXIA 2XY7A 3RB4A 2BQRA 1KFDA 3GQCA 4DQQA 1K1SA 3RJFA 4M5DA 3PNCA 4FS2A 4UQGA 4DLEA 5J0UA 4NM1A 4NLKA 4UAZA 5CP2A 4YD2A 5F9LA 1IM4A 2LYHA 4QZIA 3TFRA 3ORYA 4EZ9A 1ZYQA 4TQRA 4X0AA 3M9NB 3ISBA 3C21A 4NXZA 1ZQDA 4QZAA 5KFGA 4O5EA 3RRGA 5IIJA 4YR3A 2HHWA 4J9MA 3RJGA 1UEUA 3BDPA 5L1IA 2HHPA 3OSPA 3H8JA 4ELVA 2AGOA 8ICWA 1KNYA 1SKSA 5BPCA 4B9NA 7ICIA 4B9TA 1R8BA 3MFIA 5HHIA 4DS4A 3TAPA 1KFSA 3RBEA 7ICRA 3RBDA 4ECUA 4IQUA 2R8HA 5KFMA 4DQIA 4J9OA 5DBAA 4YP3A 2ZH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WC1 A;  7ICO A;  4F93 B;  3ZDC A;  4QZE A;  1TK0 A;  8ICN A;  5EWE A;  1D8Y A;  3MGH A;  4FBU A;  4F91 B;  4UAY A;  4QZB A;  3UXP A;  5KT4 A;  3EW9 A;  4PHP A;  5EWF A;  2PFQ A;  2ZUD A;  5J2C A;  5KFB A;  4ED3 A;  2KP7 A;  1S10 A;  4QZ8 A;  4F4W A;  2NRK A;  1ZQW A;  4WCW A;  4ECX A;  3PW2 A;  7ICG A;  4QWA A;  4DOA A;  2OWO A;  3C5G A;  9ICK A;  4X4O A;  3H39 A;  4KLF A;  1KTQ A;  1JIH A;  1TFW A;  4F4Z A;  2ASJ A;  4WC5 A;  5CHG A;  2ZUC A;  4BGD A;  2ZH2 A;  9ICS A;  1ZQV A;  1L3V A;  4M04 A;  4FS1 A;  2Y1J A;  4DWI A;  5DQI A;  5J2A A;  3RH5 A;  4EYH B;  1T8E A;  1S77 D;  3HJ1 A;  1U47 A;  4NY8 A;  4E7X A;  4WC7 A;  1Q78 A;  5IIM A;  2MUT A;  3RAQ A;  4M2Y A;  5HRI A;  1NJY A;  3HT3 A;  3KHL A;  3BQT A;  5KG7 A;  5DDY A;  1RYS A;  1SKW A;  1S0M A;  9ICX A;  4UB2 A;  4QZG A;  4UB4 A;  1WOT A;  5J2J A;  2MUT B;  1ARO P;  1L3S A;  3M8S A;  2ID1 A;  5IIN A;  3FDS A;  3UXO A;  2XGQ A;  3T3F A;  3PV8 A;  3UPS A;  3MDA A;  1D9D A;  4EP7 A;  5KT6 A;  5J0S A;  3C2M A;  8ICM A;  4RQ3 A;  5J0W A;  1XC9 A;  4UBB A;  2MAX A;  8ICS A;  4FH3 A;  3N97 B;  1XS9 D;  4XQ8 A;  4MEX A;  1X9W A;  4YR0 A;  4O3R A;  1ZET A;  2AQ4 A;  1S9F A;  2XO7 A;  4I2G A;  4HYK A;  4R8U B;  5DLG A;  1ZQH A;  2M9N A;  4RT2 A;  3WFP A;  1ZQX A;  1TK8 A;  9ICC A;  4FHY A;  3C1Y A;  4GXJ A;  5D46 A;  5KFF A;  8ICF A;  1Z00 A;  5KTQ A;  3Q8K A;  1BNP A;  2NRT A;  3TAQ A;  3V7L A;  5CJ7 A;  2ATL A;  4JK1 A;  2DPJ A;  4I2A A;  4JWN A;  8ICB A;  3TI0 A;  4M9L A;  4QZF A;  1T4G A;  3PML A;  4UD5 A;  5HML A;  4YQW A;  2PXI A;  4DFM A;  3PW7 A;  3GIJ A;  4DL2 A;  2IBK A;  3LDA A;  3Q8L A;  1MIV A;  4ECZ A;  8ICJ A;  4M9N A;  4O9M A;  4WC3 A;  2C28 A;  1ZQZ A;  3HPO A;  2VA2 A;  4I27 A;  1NJZ A;  7ICH A;  3RTV A;  9ICI A;  4FH5 A;  3BJY A;  4FHV A;  2HHS A;  3JPS A;  3SZ2 A;  4J9N A;  1ZQN A;  1BPB A;  1U48 A;  2J6S A;  4TUR A;  7ICP A;  4E80 A;  4EBC A;  3PW0 A;  8ICK A;  4RNM A;  4O3N A;  4X4T A;  5DEC A;  5J2E A;  4I2B A;  4LZD A;  3EPG A;  2BR0 A;  4RQ0 A;  3K75 D;  2R8G A;  3AU6 A;  8ICT A;  5KFO A;  1NJW A;  4EZ6 A;  2ZTC A;  4QW9 A;  2ZH1 A;  4DQP A;  3GII A;  4K4I A;  1JMS A;  1BPD A;  5KT2 A;  2HHU A;  1WCL A;  1ZQT A;  1R89 A;  4PH5 A;  4RWP A;  4X4S A;  3Q8P B;  2C2D A;  2ZH5 A;  4F50 A;  4WBY A;  3Q8Q B;  4O3O A;  3RJI A;  2UVU A;  1RZT A;  5F2V O;  1ZQS A;  2ZH7 A;  4R63 A;  4F5R A;  4JV0 A;  4PPX A;  3AU2 A;  3JPQ A;  1ZQO A;  4C8N A;  1S0V A;  4XQ7 A;  3G6V A;  4AT8 B;  3PVX A;  2RDJ A;  9ICR A;  1PX5 A;  1LB2 B;  4XRH A;  3PW5 A;  4RPZ A;  5CR0 A;  3LWL A;  3ISD A;  2FMS A;  2I9G A;  1NZP A;  2KTQ A;  3QE9 Y;  4TUP A;  3BQ2 A;  5DG8 A;  1JXL A;  5HRH A;  2FLP A;  5DLF A;  1BPE A;  4R8U A;  7ICE A;  4Q44 A;  5TZV A;  2BHN A;  3MAB A;  5KFS A;  4R66 A;  3ZDA A;  1NJX A;  5KG0 A;  3ZD9 A;  5D49 A;  3ISC A;  2JEJ A;  4JUZ A;  1MQ2 A;  1QSS A;  4X4Q A;  3QZ8 A;  4ATB A;  3KHH A;  1WCN A;  4QZ9 A;  1X9M A;  2BDP A;  2M2T A;  3OVB A;  2ZJ8 A;  1SL1 A;  1K1Q A;  3RR7 A;  2W9A A;  2BPC A;  3TAN A;  1NK4 A;  2BCS A;  4YFK A;  3T5L A;  5DG7 A;  2BQU A;  7ICV A;  5KFH A;  1U9L A;  1COO A;  3HP6 A;  3HX0 A;  3V7K A;  4WC0 A;  5KFJ A;  3KHG A;  1X9S A;  3NYB A;  2ZJ5 A;  5HRE A;  5KT3 A;  4ECR A;  3OSN A;  1NK7 A;  1JXE A;  2BCU A;  2RFF A;  4FBT A;  4KLL A;  5KFE A;  4O3S A;  2ZH3 A;  3IHQ B;  2Q0Z X;  4RZR A;  4RNN A;  3EYZ A;  4F8R A;  2ZHB A;  3PO5 A;  2IHM A;  4F5N A;  3NGD A;  1BPZ A;  3ZDB A;  4RNO A;  2FLL A;  3PY8 A;  5DQG A;  4G3I A;  4BWJ A;  1D8L A;  4GC6 A;  3SI8 A;  4RT3 A;  4RQ4 A;  3OGU A;  4KMU A;  3MGI A;  4J9K A;  3B0Y A;  1XSP A;  1RXW A;  4BXO A;  4LT6 A;  2ASD A;  2DR7 A;  5HRB A;  1SKR A;  4CCH A;  4EBE A;  4C8L A;  3WFR E;  5J2H A;  4MF8 A;  3QEA Z;  4ED8 A;  2DR9 A;  4YD1 A;  2P66 A;  5J0T A;  4K4H A;  2M2W A;  4B9L A;  2PFP A;  2XCP A;  3UQ0 A;  3GFK B;  2NRW A;  1L3T A;  4ECS A;  4ECY A;  1ZQR A;  2A1J A;  4NKU A;  5IIL A;  4TQS A;  4I2I A;  3OVA A;  2C2R A;  1Y88 A;  4RQ2 A;  2F1J A;  4KLJ A;  2HVH A;  4EBJ A;  4WC6 A;  3C5F A;  4NM2 A;  3BQ0 A;  1ZQC A;  1BNO A;  3SYZ A;  9ICJ A;  4Z6E A;  3GIM A;  2HHX A;  5HRL A;  8ICV A;  1LV5 A;  5KFL A;  3TAR A;  1S97 A;  2BGW A;  8ICO A;  4ED7 A;  2F1H A;  8ICL A;  4RUC A;  3NTU A;  1BPX A;  1UEV A;  3WFS C;  2B21 A;  2KZ3 A;  2ZH4 A;  4EEY A;  4I28 A;  4QWB A;  3QEB Z;  5KG6 A;  3PX4 A;  5J2I A;  5J2D A;  5EOZ A;  2R8I A;  3PX0 A;  3LK9 A;  1ZJN A;  1S0N A;  1KDH A;  2VA8 A;  5J2K A;  5DBC A;  1XU4 A;  4P4O A;  3V6J A;  1QLN A;  1MC8 A;  4YMM A;  4YR2 A;  3G6X A;  2XY6 A;  9ICM A;  3C23 A;  1KFT A;  4ED6 A;  3LQC B;  2JZB B;  2DFL A;  3RB3 A;  1QSY A;  4F4K A;  2HW3 A;  2KZM A;  4YMO A;  3HWT A;  4DOC A;  3MBY A;  4I2E A;  4RUA A;  4FHP A;  1PZN A;  4RQ5 A;  3H4B A;  1ZQB A;  3L9D A;  4RQ7 A;  3OJU A;  4KLG A;  2VAN A;  4F5Q A;  1RYR A;  3KTQ A;  4RQ6 A;  4DFJ A;  7ICF A;  1U4B A;  4UB3 A;  4PHD A;  3BQ1 A;  2BPG A;  3MR6 A;  1C7Y A;  1QTM A;  4QWC A;  7ICQ A;  5L1L A;  3T5K A;  9ICH A;  4RPX A;  1UET A;  4BXO B;  3OV7 A;  1A76 A;  5HC9 A;  3UQ2 A;  3ETL A;  3EWA A;  3RH6 A;  3ZD8 A;  1HUZ A;  3UXN A;  3SV4 A;  3V72 A;  4JV1 A;  3ZDD A;  4UB5 A;  5KG4 A;  1BPY A;  2KFZ A;  3AQM A;  2JZB A;  4M9G A;  2ALZ A;  1ZQU A;  5J2G A;  2DR5 A;  5J2B A;  2FMP A;  3MR3 A;  2P6R A;  5KFA A;  3OVS A;  4MEY A;  5CWR A;  5BOM A;  2O1P A;  1KLN A;  1D9F A;  9ICV A;  2NRX A;  5KFV A;  2V4Q A;  3H4D A;  4YG2 A;  8ICQ A;  1KEJ A;  4X5V A;  3AQL A;  3JYY A;  2FPK A;  3C2K A;  2ZH8 A;  4F4X A;  1KSP A;  4X4U A;  3RJH A;  2ISO A;  1XWL A;  4DSE A;  1ZJM A;  3RH4 A;  4QZC A;  1NK9 A;  4F2S A;  5HRF A;  5J2F A;  2PFN A;  3H40 A;  5J29 A;  4TUQ A;  1N48 A;  2ISP A;  4IQV A;  1ZQQ A;  7ICS A;  5J0X A;  4BWM A;  1NK8 A;  3RR8 A;  2PI5 A;  4GXK A;  3PR5 B;  4KLO A;  5KFK A;  5KFC A;  4DSI A;  3HIY A;  3PO4 A;  3K4G A;  2C2E A;  1NKC A;  3WFO A;  4F4Y A;  4ATB B;  4IRK A;  5DB7 A;  3PMN A;  1ZQK A;  3PR4 A;  5DB9 A;  3C2L A;  4ELU A;  7ICN A;  3MFH A;  2RDI A;  5J0Y A;  1H38 A;  3C66 A;  3UPQ A;  9ICL A;  1XO1 A;  5C5J A;  2UVV A;  4Q43 A;  9ICW A;  3IM1 A;  3PX6 A;  2UVR A;  2DVI A;  4I2F A;  3QZ7 A;  4WC4 A;  5KG1 A;  4O5C A;  3GV8 B;  1JX4 A;  5DB8 A;  1DGS A;  3RB0 A;  3G6Y A;  4UB1 A;  3THV A;  1T7P A;  4IG8 A;  1U45 A;  4Z6D A;  3MR5 A;  3C1Z A;  5DQH A;  2GWS A;  1Z3E B;  4M47 A;  2AGQ A;  4KIT B;  1DK2 A;  3OJS A;  4P4M A;  4MFA A;  1S0O A;  1NKE A;  9ICA A;  4GLX A;  7ICM A;  3JPP A;  4FHX A;  3GDX A;  2BCR A;  4DLG A;  1T3N A;  3SV3 A;  1JAJ A;  3AUO A;  4DS5 A;  3JZ0 A;  4C8O A;  4M9J A;  3E2E A;  2KFN A;  4MFF A;  2FPM A;  3RAX A;  1JQR A;  4X4V A;  2F1I A;  4ECW A;  2P6U A;  1TK5 A;  2H5X A;  2O5A A;  1TFR A;  4ECV A;  4UBC A;  3AQN A;  5KFI A;  5KFW A;  3JPR A;  3LWM A;  4DQS A;  2R8K A;  9ICO A;  2M2V A;  4IR9 A;  9ICP A;  3RRH A;  4QZH A;  4I2C A;  1KRP A;  5HP4 A;  4X0B A;  4IRC A;  2DR8 A;  3GIK A;  2FMQ A;  2ZTD A;  4YXJ A;  4J9P A;  4XA5 A;  4Q8F A;  4XUS A;  1Q79 A;  4DSF A;  4DL3 A;  5DGB A;  5DDM A;  2V9W A;  4YMN A;  4DL6 A;  5HHH A;  1HJP A;  4DF8 A;  2BQ3 A;  2HHV A;  8ICH A;  1S76 D;  3H38 A;  4PGQ A;  4GC7 A;  2AGP A;  4M0A A;  2C22 A;  4NLG A;  5DKW A;  4KN7 A;  1VJ7 A;  4RWQ A;  1Z00 B;  1TAQ A;  4F5O A;  4DFP A;  4KLM A;  1NK5 A;  8ICP A;  2DRA A;  1ZQF A;  8ICZ A;  2JEF A;  1DOQ A;  2W9B B;  4I2H A;  4O3P A;  2PFO A;  5HNK A;  2Q66 A;  2JEI A;  2W9B A;  2FLN A;  2BE3 A;  2PBE A;  2KN7 A;  1NK0 A;  1IXR A;  4X4R A;  3M8R A;  4LZG A;  2VA3 A;  4F3O A;  5DED A;  2AU0 A;  3C18 A;  4KLT A;  2ASL A;  4EBD A;  4PGY A;  4DFK A;  4UAW A;  8ICC A;  4QZD A;  9ICF A;  3GIL A;  4X4N A;  4KLE A;  5EWG A;  5CA7 A;  5KG3 A;  4PGX A;  5KG5 A;  5CB1 A;  3OHA A;  4DSJ A;  1DK3 A;  1V4A A;  2DPI A;  3JPO A;  8ICI A;  4PHA A;  4KTQ A;  4WC2 A;  4KN4 A;  1UA0 A;  4C8K A;  4Z6C A;  5L1J A;  5KFU A;  2J6U A;  5KFX A;  3T5J A;  4IQW A;  3MR2 A;  5HMM A;  4M9H A;  2HVI A;  7ICU A;  2ZH9 A;  1SL0 A;  4C8M A;  4R64 A;  9ICU A;  4QWD A;  8ICE A;  3RJJ A;  5KFD A;  3HW8 A;  5KFY A;  1SZP A;  3JPN A;  4J9Q A;  3RB6 A;  1HUO A;  1ZQG A;  4B9U A;  4Q8E A;  5F9N A;  1L5U A;  4IR1 A;  2WTF A;  1UT8 A;  5KFN A;  4DL4 A;  1ZQI A;  3GV7 B;  3H8S A;  4MF2 A;  4QWE A;  2J6T A;  4NLZ A;  1ZQM A;  2W8L A;  1ZQY A;  5JUM A;  2Y1I A;  4DO9 A;  8ICY A;  1FA0 A;  4O0I A;  3EZ5 A;  4ECT A;  4F5P A;  3V6K A;  9ICN A;  5KFT A;  1TKD A;  5IIO A;  2KZZ A;  4R65 A;  4M6W B;  1R8C A;  5DB6 A;  3OUY B;  3Q8R B;  4JV2 A;  1NK6 A;  4I2J A;  4PHE A;  2JEG A;  1OU5 A;  1V9P A;  2W9C B;  2ZJA A;  1SL2 A;  1EXN A;  4JWM A;  1MSW D;  4B9V A;  2AQ0 A;  2HHT A;  8ICG A;  4LVS A;  4ZH4 A;  5HRD A;  4S3N A;  3TFS A;  4TUS A;  4EYI B;  2HHQ A;  4AT7 A;  5IIK A;  3KHR A;  2FPL A;  2W8K A;  1F5A A;  4AT8 A;  1BGX T;  4YVZ A;  2IMW P;  4NKT A;  4BDP A;  4KLI A;  3V7J A;  4KLS A;  2NRZ A;  1N56 A;  4FHW A;  4DSL A;  2DRB A;  1XSL A;  1QSL A;  3H8W A;  5D4B A;  4B9M A;  1YLQ A;  4ED2 A;  5KT7 A;  2XGP A;  5L1K A;  1ZQA A;  4DF4 A;  4KLD A;  4O3Q A;  2ZTE A;  3Q8M A;  4AT9 A;  5KFR A;  1MIY A;  5III A;  1VFG A;  1ZQP A;  9ICG A;  3H7I A;  4ECQ A;  1NO5 A;  1CUK A;  4DL5 A;  1A77 A;  4KLQ A;  4DSK A;  1JN3 A;  5DBB A;  4P4P A;  7ICT A;  3M9O B;  4E0D A;  4P2H A;  2A1J B;  1B43 A;  4WBZ A;  4EBK A;  1BVS A;  4I2D A;  4F92 B;  3N4M B;  1ZQJ A;  4ELT A;  7ICK A;  4RQ8 A;  3H3A A;  4DQR A;  4IQT A;  4ED0 A;  5DGA A;  4O5K A;  2M2U A;  9ICE A;  8ICR A;  1B22 A;  4X4P A;  1ZQL A;  1NOM A;  2AJQ A;  4RPY A;  2R8J A;  5L9X A;  3WFQ E;  4KLH A;  5J0P A;  4FO6 A;  1XSN A;  4I29 A;  3AQK A;  1MQ3 A;  4KLU A;  4K4G A;  1RXV A;  3Q8S B;  3M9M B;  3EPI A;  2ZHA A;  7ICJ A;  3OHB A;  1R8A A;  5HR9 A;  5J0R A;  1UT5 A;  3B0X A;  4Z6F A;  1U49 A;  2NRV A;  3TQ1 A;  4AT9 B;  9ICT A;  4RWO A;  5J0Q A;  4J9L A;  2BCQ A;  4F2R A;  8ICU A;  2XC9 A;  4J9S A;  2IA6 A;  5BOL A;  4IRD A;  3FYH A;  1CEZ A;  2I1Q A;  3RJK A;  1X2I A;  3T5H A;  4YXM A;  1TV9 A;  4YN4 A;  9ICQ A;  1TFY A;  4RU9 A;  2PI4 A;  1ZQE A;  3V6H A;  4MFC A;  3GV5 B;  1L3U A;  4Q45 A;  3ZDE A;  2XCA A;  1RPL A;  2BKE A;  5KFQ A;  2V4R A;  5KT5 A;  4AT7 B;  5DG9 A;  4DEZ A;  5KFZ A;  4DL7 A;  4B9S A;  8ICX A;  4E8F A;  5HRK A;  5HRG A;  4ED1 A;  2BPF A;  1TVA A;  2W9C A;  2W9M A;  2ZUB A;  3PW4 A;  2IHN A;  4YCX A;  5J0O A;  3HJ4 A;  2XY5 A;  8ICA A;  4UD4 A;  5KFP A;  3JPT A;  4DOB A;  4QW8 A;  3MDC A;  1UA1 A;  2BCV A;  2UVW A;  1TAU A;  9ICB A;  3OUY A;  5KG2 A;  4M6W A;  3RJE A;  4NLN A;  1MIW A;  4RWN A;  3H37 A;  4J9R A;  7ICL A;  1NKB A;  4RQ1 A;  4GXI A;  2XY7 A;  3RB4 A;  2BQR A;  1KFD A;  3GQC A;  4DQQ A;  1K1S A;  3RJF A;  4M5D A;  3PNC A;  4FS2 A;  4UQG A;  4DLE A;  5J0U A;  4NM1 A;  4NLK A;  4UAZ A;  5CP2 A;  4YD2 A;  5F9L A;  1IM4 A;  2LYH A;  4QZI A;  3TFR A;  3ORY A;  4EZ9 A;  1ZYQ A;  4TQR A;  4X0A A;  3M9N B;  3ISB A;  3C21 A;  4NXZ A;  1ZQD A;  4QZA A;  5KFG A;  4O5E A;  3RRG A;  5IIJ A;  4YR3 A;  2HHW A;  4J9M A;  3RJG A;  1UEU A;  3BDP A;  5L1I A;  2HHP A;  3OSP A;  3H8J A;  4ELV A;  2AGO A;  8ICW A;  1KNY A;  1SKS A;  5BPC A;  4B9N A;  7ICI A;  4B9T A;  1R8B A;  3MFI A;  5HHI A;  4DS4 A;  3TAP A;  1KFS A;  3RBE A;  7ICR A;  3RBD A;  4ECU A;  4IQU A;  2R8H A;  5KFM A;  4DQI A;  4J9O A;  5DBA A;  4YP3 A;  2ZH6 A; 
#chains in the Genus database with same CATH topology
 1A0P A;  4QZE A;  3EW9 A;  2ZUD A;  5J2C A;  4ED3 A;  1S10 A;  4QZ8 A;  2NRK A;  3PW2 A;  7ICG A;  2HOF A;  4X4O A;  4F4Z A;  1COK A;  4WC5 A;  1YZ7 A;  4M04 A;  2KJ9 A;  5AKJ A;  4DWI A;  3HJ1 A;  4NLC A;  5IIM A;  2MUT A;  2GH1 A;  4M2Y A;  1FIQ A;  3BQT A;  5DDY A;  4UB2 A;  4QZG A;  1WOT A;  2ID1 A;  2E3T A;  3MDA A;  1D9D A;  1JRP A;  3CK6 A;  4UBB A;  8ICS A;  4MEX A;  4O3R A;  2KJ5 A;  5AKZ A;  4YR0 A;  1ZET A;  5AKI A;  9ICC A;  3C1Y A;  3Q8K A;  4I2A A;  4JWN A;  4M9L A;  2DL0 A;  4UD5 A;  3PML A;  1PVP A;  3N7P D;  4YQW A;  3PW7 A;  1WYG A;  3LDA A;  1MIV A;  5ALN A;  1Q3U A;  2N1R A;  4M9N A;  5HR7 A;  2C28 A;  1ZQZ A;  4WC3 A;  3BJY A;  1ZRN A;  3BZC A;  3JPS A;  1ZQN A;  1BPB A;  2JV3 A;  7ICP A;  4PL1 A;  2KV2 A;  1XO0 A;  5C0Y A;  2KVC A;  8ICK A;  3EPG A;  4RQ0 A;  8ICT A;  2PMZ F;  2ZTC A;  4OAG A;  1JMS A;  5KT2 A;  4X4S A;  2LYA A;  2RP5 A;  4F50 A;  5ALO A;  5F2V O;  4R63 A;  4F5R A;  4PPX A;  3JPQ A;  4C8N A;  2HI0 A;  3G6V A;  1MN8 A;  3SR6 A;  2B0C A;  1PX5 A;  4RPZ A;  2WF8 A;  2DUY A;  2I9G A;  1IG6 A;  3QE9 Y;  4TUP A;  3BQ2 A;  5AM1 A;  2FLP A;  4XQ7 A;  3MAB A;  3ZDA A;  3F5E A;  1NJX A;  5D49 A;  2AXT U;  1MQ2 A;  5CFS A;  3QUB A;  3QZ8 A;  1WCN A;  3OVB A;  2M2T A;  2W54 A;  2VJ5 A;  2WHE A;  2XI9 A;  2BCS A;  4YFK A;  2ZIV B;  2KD1 A;  5DG7 A;  3V7K A;  5KFJ A;  3NYB A;  2PMZ C;  2RFF A;  3S6J A;  3IHQ B;  2Q0Z X;  3QXG A;  3EYZ A;  4F8R A;  3PO5 A;  2ZHB A;  1BPZ A;  5DQG A;  3NVW A;  4RT3 A;  3OGU A;  4LT6 A;  2DR7 A;  2ASD A;  3BQ7 A;  1SKR A;  4EBE A;  3QEA Z;  2P66 A;  2YY6 A;  5EE9 A;  4JMU A;  4PZO A;  4RQ2 A;  4WC6 A;  3BQ0 A;  3IG5 A;  3GIM A;  1FFV A;  8ICV A;  1LV5 A;  5ALP A;  3I28 A;  5T14 A;  2KZ3 A;  2E1F A;  4I28 A;  3QEB Z;  1J2N A;  2R8I A;  2OXO A;  3LK9 A;  4P4O A;  5J2K A;  1QLN A;  2BZF A;  4EEN A;  3C23 A;  2F3N A;  1QSY A;  4F4K A;  3RB3 A;  1Q3V A;  2KZM A;  5AK4 A;  4DOC A;  1PZN A;  3SQI A;  3KZI U;  4NL9 A;  1ZQB A;  4RQ7 A;  5ALV A;  4QIW C;  3D2Q A;  3E58 A;  4UB3 A;  3BQ1 A;  7ICQ A;  4QWC A;  2K8A A;  2A1A A;  4RPX A;  2FDR A;  5HC9 A;  3AEV A;  3UXN A;  4CF4 A;  4UB5 A;  2DKX A;  1KN5 A;  2DR5 A;  5KFA A;  4QIW F;  3CRX A;  3H4D A;  4YG2 A;  8ICQ A;  3JYY A;  2K4H A;  5ALF A;  4X4U A;  2LYB A;  1XWL A;  1ZJM A;  1NK9 A;  3RH4 A;  4QZC A;  5HRF A;  3SD7 A;  2PFN A;  3H40 A;  2VIX A;  3LVW A;  3BZK A;  4IQV A;  4BWM A;  1NK8 A;  1X42 A;  3PR5 B;  3HIY A;  3PO4 A;  3NVV A;  5EE3 A;  1RG6 A;  4F4Y A;  5DB7 A;  3PMN A;  5DB9 A;  7ICN A;  5J0Y A;  1VLB A;  1XO1 A;  2VJ4 A;  3IM1 A;  3QYP A;  3HKZ C;  2DWQ A;  2G08 A;  2IHO A;  3G6Y A;  4UB1 A;  3THV A;  4Z6D A;  1Z3E B;  1DK2 A;  2RQ5 A;  4KIT B;  4GLX A;  3JPP A;  4FHX A;  3F2D A;  3SV3 A;  1JAJ A;  4O3M A;  4C0Z A;  4Y2R A;  4DS5 A;  1JQR A;  1RYU A;  2FPM A;  4X4V A;  5ALQ A;  1SWW A;  4KX3 A;  1VDV A;  4ECW A;  5KFW A;  2M2V A;  9ICO A;  4NLB A;  4IR9 A;  3E0F A;  3WK6 A;  1KRP A;  4X0B A;  1Q79 A;  4XUS A;  3F2B A;  4DSF A;  4YMN A;  5HHH A;  3CNH A;  2BQ3 A;  1S76 D;  4PGQ A;  4M0A A;  3C29 A;  2AGP A;  4RWQ A;  5DKW A;  2EZZ A;  1VJ7 A;  1TAQ A;  4F5O A;  4DFP A;  4KLM A;  2DRA A;  1ZQF A;  2B51 A;  2F8L A;  4BX9 C;  2KN7 A;  1NK0 A;  4X4R A;  4KLT A;  2KSO A;  4DFK A;  4PGY A;  4UAW A;  5EWG A;  2DGZ A;  5KG3 A;  1DK3 A;  5AI6 A;  4OJL A;  5KG5 A;  3OHA A;  1V38 A;  3JPO A;  2HOQ A;  4KN4 A;  1UA0 A;  5AK5 A;  4Z6C A;  5KFX A;  3T5J A;  4M9H A;  1KW4 A;  1SL0 A;  4QWD A;  8ICE A;  3RJJ A;  1SZP A;  4B9U A;  2QB0 A;  3QU2 A;  5F9N A;  4MF2 A;  1SV0 A;  3I1Y A;  4NLZ A;  1ZQY A;  4DO9 A;  3F2C A;  4ECT A;  3EZ5 A;  1ZD5 A;  3V6K A;  5KFT A;  1Z1B A;  3OPX A;  3WK5 A;  2BDU A;  3WKA A;  4JV2 A;  2YB4 A;  3QNM A;  2JEG A;  1V9P A;  5AKK A;  5ALL A;  1SL2 A;  1EXN A;  1MSW D;  4B9V A;  2AQ0 A;  3WKC A;  3N7S C;  2FCL A;  4TUS A;  2KEY A;  5CFU A;  1BGX T;  2IMW P;  2G5I B;  4AP9 A;  4FHW A;  4DSL A;  2DRB A;  1XSL A;  1QSL A;  2O6K A;  3H8W A;  2KNJ A;  5D4B A;  4ED2 A;  2XGP A;  2ESE A;  2H3I A;  5L1K A;  2ZTE A;  3Q8M A;  4AT9 A;  5III A;  1VJ5 A;  3SEI A;  4DSK A;  4P2H A;  1B43 A;  4WBZ A;  3T79 A;  4I2D A;  7ICK A;  2KG5 A;  4ED0 A;  9ICE A;  8ICR A;  3KFU F;  2F76 X;  5J0P A;  1MQ3 A;  3BS5 A;  3OHB A;  2HSZ A;  5J0R A;  1UT5 A;  3B0X A;  4RWO A;  4F71 A;  2XC9 A;  4C7Y A;  1CEZ A;  2Y0S F;  4OJ5 A;  2W03 A;  3JCF A;  1L7M A;  3GV5 B;  1L3U A;  5A0L A;  2XCA A;  4AT7 B;  2YTU A;  4DEZ A;  5DG9 A;  4B9S A;  4JLX A;  4E8F A;  2KHQ A;  1TVA A;  2W9C A;  3PW4 A;  2ZUB A;  2IHN A;  3TKA A;  4DOB A;  2BCV A;  4QW8 A;  3MDC A;  2UVW A;  9ICB A;  2K4P A;  3RJE A;  4MKP A;  4DQQ A;  3TAD A;  4OAH A;  4NM1 A;  2KHV A;  4UAZ A;  5F9L A;  1IM4 A;  2LYH A;  4EZ9 A;  4OJO A;  3ORY A;  1O08 A;  1RQL A;  2ZXI A;  4TQR A;  3ISB A;  3C21 A;  1ZQD A;  4QZA A;  5KFG A;  2K60 A;  2E8M A;  3RF9 A;  4YR3 A;  2HHP A;  4ELV A;  2AGO A;  7ICI A;  7ICR A;  1IV8 A;  3RBD A;  4ECU A;  2R8H A;  5DBA A;  4ECX A;  4RQ5 A;  4YP3 A;  3NKU A;  4WC1 A;  5ALW A;  5AI8 A;  7ICO A;  4F93 B;  1T94 A;  3MGH A;  4FBU A;  4F91 B;  3UXP A;  4WQL A;  1T3Q A;  1UPH A;  4OAI Z;  2PFQ A;  2KP7 A;  3AQF A;  5KNI A;  4QWA A;  4DOA A;  2OWO A;  1TFW A;  2ASJ A;  2ZUC A;  2HCF A;  2LM1 A;  3ER9 B;  9ICS A;  1ZQV A;  1X9X A;  3NVY A;  5ALD A;  1S77 D;  4K96 A;  4E7X A;  1Z1V A;  2IUB A;  1HIW A;  2KJ8 A;  4CF5 A;  3AMZ A;  3KZX A;  5F3X B;  5IIN A;  1KL9 A;  1ZOL A;  4IC9 A;  5AM2 A;  8ICM A;  4RQ3 A;  1XC9 A;  4FH3 A;  1XS9 D;  5ALJ A;  1X9W A;  4F72 A;  2AQ4 A;  4R8U B;  5DLG A;  2M9N A;  1ZQX A;  2CPR A;  8ICF A;  3V7L A;  5CJ7 A;  2ATL A;  4JK1 A;  2YMQ A;  3TI0 A;  4UW9 A;  2E8N A;  1T4G A;  4QZF A;  5HML A;  4DL2 A;  3Q8L A;  4GFJ A;  4O9M A;  2VA2 A;  3NWI A;  2E8P A;  4EBC A;  5JU5 A;  5AK3 A;  3PW0 A;  2NO4 A;  4O3N A;  5ALU A;  4X4T A;  5J2E A;  4I2B A;  1FO4 A;  4CF3 A;  4DQP A;  5ALX A;  3GII A;  2HHU A;  2K89 A;  3PHZ A;  4PH5 A;  2YQE A;  4K9A A;  4WBY A;  1V85 A;  1CI4 A;  3Q8Q B;  4O3O A;  2D6F C;  3F53 A;  2UVU A;  3SAH A;  1PK1 A;  2ZH7 A;  1SWV A;  5ALR A;  1ZQO A;  3IV6 A;  1F5S A;  2BBH A;  2NYV A;  1LB2 B;  5CR0 A;  3LWL A;  3ISD A;  1NZP A;  1PUZ A;  5HRH A;  3WK4 A;  1WWV A;  4R8U A;  5KFS A;  5JRT A;  8ICP A;  5CFT A;  1TFY A;  1Z4N A;  2JEJ A;  4JUZ A;  4ATB A;  1X9M A;  1O03 A;  4QZ9 A;  1F44 A;  4Y2U A;  1JRO A;  3RR7 A;  2W9A A;  3TAN A;  1NK4 A;  4OJP A;  1UCV A;  1U9L A;  4UB8 U;  4EEK A;  5KFH A;  2ZJ5 A;  3F5A A;  5B5E U;  3OSN A;  4USA A;  5KFE A;  4NXX A;  2EH9 A;  4F5N A;  3NGD A;  3PY8 A;  4RNO A;  4G3I A;  4BWJ A;  4GC6 A;  5KL1 B;  3MGI A;  1X6I A;  3NRW A;  1XSP A;  1RXW A;  3QU4 A;  4M5D A;  4C8L A;  1X6J A;  4ED8 A;  4US9 A;  4K4H A;  3GFK B;  2NRW A;  4MHV A;  3AN1 A;  4I2I A;  4P0P B;  4NM2 A;  2F2A B;  1ZQC A;  9ICJ A;  5HRL A;  1UEV A;  3PX4 A;  5J2I A;  5J2D A;  1S0N A;  2VA8 A;  5DBC A;  9ICM A;  4YMM A;  1N5W A;  3LQC B;  4ED6 A;  2JZB B;  2DFL A;  1IIP A;  1PK1 B;  3K1Z A;  3HWT A;  3L9D A;  3OJU A;  4OJ6 A;  3C28 A;  3QUQ A;  4RQ6 A;  5E79 U;  7ICF A;  3IN5 A;  1QTM A;  3D2S A;  2KIW A;  3T5K A;  4BXO B;  3UQ2 A;  3ETL A;  2ZIW A;  3RH6 A;  3ZD8 A;  4JV1 A;  3V72 A;  1BPY A;  3AQM A;  4AYB F;  2ALZ A;  1ZQU A;  5J2G A;  1Q46 A;  5ALE A;  2QLT A;  3OVS A;  2D3D A;  1KLN A;  9ICV A;  1KEJ A;  3IRU A;  4KX5 A;  4F4X A;  1KSP A;  3RJH A;  5AM0 A;  2FJ6 A;  5J2F A;  4U7C A;  5J29 A;  1F0M A;  2EAP A;  4ICA A;  4GXK A;  4DSI A;  3NAS A;  3K4G A;  4ATB B;  4WH5 A;  1X40 A;  4ELU A;  2RDI A;  3C66 A;  5C5J A;  2EAM A;  2UVV A;  3PX6 A;  3QZ7 A;  5KG1 A;  2EQY A;  4O5C A;  3GV8 B;  2LMR A;  1JX4 A;  1DGS A;  3RB0 A;  2KSO B;  2DBY A;  1T7P A;  2WAQ F;  2HDO A;  4M47 A;  3OJS A;  4MFA A;  1S0O A;  1WG8 A;  4DLG A;  4IS7 A;  2ZIX A;  3JZ0 A;  3E2E A;  4MFF A;  2F1I A;  2P6U A;  4UAT A;  2H5X A;  2KIV A;  4ECV A;  2O5A A;  4UBC A;  3MCR A;  3LWM A;  9ICP A;  4QZH A;  2K8C B;  4YXJ A;  4Q8F A;  4XA5 A;  4Y2X A;  1DGJ A;  1UQV A;  2ZXH A;  2WF5 A;  4GC7 A;  4KN7 A;  3H0R B;  2W9B B;  5HNK A;  2Q66 A;  5J8Y A;  4P0Q B;  3M8R A;  5DED A;  1KKX A;  8ICC A;  4QZD A;  3UMB A;  1ZD3 A;  5CB1 A;  1NNL A;  4C4S A;  4PHA A;  1SXE A;  5AIA A;  4IQW A;  3MR2 A;  5HMM A;  3HIL A;  2YB1 A;  4C8M A;  3PZP A;  9ICU A;  4GIB A;  2Z7J A;  5KFY A;  3JPN A;  1ZQG A;  5KAF U;  4Q8E A;  1L5U A;  2WTF A;  1ZQI A;  3GV7 B;  4OO1 J;  1JUD A;  2YMP A;  2ZIU B;  2W8L A;  8ICY A;  2Q4T A;  1FA0 A;  4O0I A;  9ICN A;  1PK3 A;  5IIO A;  3PSF A;  5DB6 A;  1NK6 A;  1N2X A;  4I2J A;  2W9C B;  1DRG A;  5TIS U;  5HRD A;  2HHQ A;  2D8C A;  1LVH A;  5IIK A;  2Y9U A;  3QX7 A;  2E8O A;  4KLS A;  2NRZ A;  1N56 A;  2CXY A;  4B9M A;  2WFA A;  2H3V A;  4DF4 A;  4KLD A;  4O3Q A;  1VFG A;  1ZQP A;  9ICG A;  2KVS A;  5AM4 A;  4KLQ A;  1URJ A;  3H0M B;  4EBK A;  2A1J B;  4ELT A;  2DKZ A;  4OAF A;  1KBU A;  2NV3 A;  4IQT A;  4O5K A;  1NOM A;  2M0N A;  3WFQ E;  4FO6 A;  1Z19 A;  4I29 A;  4KLU A;  4K4G A;  5AIC A;  4O69 A;  4A8E A;  1U49 A;  3TQ1 A;  1GO3 F;  9ICT A;  5J0Q A;  2BCQ A;  8ICU A;  2IA6 A;  4IRD A;  2I1Q A;  3RJK A;  4YXM A;  9ICQ A;  2EZX A;  1SZH A;  3ZDE A;  2BKE A;  5KFQ A;  2V4R A;  3M6K A;  2BPF A;  4YCX A;  5J0O A;  5KFP A;  1UA1 A;  2QAR A;  4OD0 A;  5KG2 A;  5ALK A;  2EDU A;  1MIW A;  4RWN A;  3OTQ A;  3H37 A;  1NKB A;  4RQ1 A;  2YN4 A;  4GXI A;  2XY7 A;  3RJF A;  1K1S A;  1QQ6 A;  4FS2 A;  4DLE A;  5J0U A;  2DQN B;  4YD2 A;  3TFR A;  3SAG A;  4X0A A;  4EX7 A;  2W7O A;  2W11 A;  4C4T A;  3RRG A;  2HHW A;  3RJG A;  3NS1 A;  3BDP A;  1PVQ A;  3H8J A;  5BPC A;  3HRD D;  1YT3 A;  3MFI A;  3ALR A;  1B0X A;  4IQU A;  5KFM A;  4DQI A;  1DXS A;  1NI3 A;  3ZDC A;  8ICN A;  5EWE A;  1D8Y A;  2P35 A;  4UAY A;  4PHP A;  5ALM A;  5EWF A;  4WCW A;  5KFB A;  1JAL A;  4F4W A;  4WOY A;  1N5X A;  3C5G A;  3H39 A;  4KLF A;  1JIH A;  5CHG A;  4BGD A;  4N7R A;  2VKQ A;  2E1E A;  4FS1 A;  5DQI A;  3EF2 A;  1T8E A;  3CYM A;  4EYH B;  1U47 A;  4NY8 A;  3LYS A;  4WC7 A;  1Q78 A;  3UM9 A;  3L5K A;  3DEE A;  3KHL A;  1RYS A;  1SKW A;  1S0M A;  9ICX A;  4UB4 A;  2JH1 A;  5J2J A;  1ARO P;  2EZY A;  3FDS A;  3UXO A;  2XGQ A;  5AK6 A;  2GAF D;  5KT6 A;  2A3V A;  1L8L A;  2MAX A;  3N97 B;  4XQ8 A;  1S9F A;  2XO7 A;  4HYK A;  2HMX A;  4RT2 A;  3WFP A;  4FHY A;  5ALS A;  5KTQ A;  2JR5 A;  1BNP A;  2OHF A;  4PZN A;  2DPJ A;  2CRX A;  5D63 A;  2IBK A;  3GIJ A;  5AM5 A;  4EEL A;  4NXU A;  1SXD A;  8ICJ A;  7ICH A;  4I27 A;  1NJZ A;  3LVV A;  3RTV A;  9ICI A;  4FH5 A;  2EAN A;  2J6S A;  1U48 A;  4E80 A;  4TUR A;  4O67 A;  2I5H A;  4RNM A;  1A6S A;  4LZD A;  3AU6 A;  1NJW A;  5JTI A;  4HX0 A;  4QW9 A;  1BPD A;  1R89 A;  1WCL A;  2ZH5 A;  3RJI A;  1RZT A;  1ZQS A;  4JV0 A;  2WF7 A;  3AU2 A;  4EV6 A;  2RDJ A;  9ICR A;  4XRH A;  2KTQ A;  1JXL A;  3J81 j;  7ICE A;  2BHN A;  1X66 A;  4AYB C;  1OW5 A;  4R66 A;  5KG0 A;  3ZD9 A;  3ISC A;  1QSS A;  5L1M A;  3KHH A;  4UAU A;  2ZJ8 A;  1K1Q A;  3WK7 A;  2HBK A;  3DDH A;  3HJE A;  5K4L A;  2QKQ A;  2BQU A;  7ICV A;  3M1Y A;  1COO A;  3HP6 A;  4CGZ A;  4WC0 A;  1X9S A;  2MA1 A;  4LEW A;  5HRE A;  5KT3 A;  4ECR A;  1NK7 A;  1JXE A;  2F77 X;  1TE2 A;  4RNN A;  4RZR A;  3RFA A;  3ZDB A;  2FLL A;  4RQ4 A;  4KMU A;  3B0Y A;  3VC8 A;  5ALY A;  4BXO A;  2HN1 A;  4EGW A;  5HRB A;  2CN1 A;  4CCH A;  3WFR E;  5J2H A;  4MF8 A;  4CE6 A;  2RRD A;  4P0P A;  2DR9 A;  5J0T A;  2M2W A;  2PFP A;  1L3T A;  3UQ0 A;  1ZQR A;  4FZM A;  3OVA A;  2C2R A;  2F1J A;  5CEH A;  2HVH A;  4EBJ A;  3C5F A;  3SYZ A;  4Z6E A;  2HHX A;  1S97 A;  2BGW A;  8ICO A;  2LI6 A;  8ICL A;  2FE9 A;  3WFS C;  3NTU A;  3DV9 A;  4LJX A;  4EEY A;  1CRX A;  4QWB A;  1ZJN A;  5ALZ A;  5EOZ A;  3FAH A;  3PX0 A;  3V6J A;  1XU4 A;  1MC8 A;  4YR2 A;  2IOH A;  5AM3 A;  3G6X A;  1KFT A;  3NRZ A;  2LHT A;  4YMO A;  3MBY A;  4I2E A;  2HOI A;  3FC4 A;  3H4B A;  4FHP A;  4F5Q A;  1RYR A;  5GTI U;  4DFJ A;  4Y2P A;  3B9J A;  2LPE A;  1U4B A;  3MR6 A;  5AKY A;  1L7P A;  9ICH A;  2DF4 B;  1UET A;  1N61 A;  1SB3 C;  3SV4 A;  5KG4 A;  2KFZ A;  4M9G A;  3CW2 C;  5J2B A;  2FMP A;  3MR3 A;  4UB6 U;  5BOM A;  2NRX A;  2MSN A;  5KFV A;  2V4Q A;  3AQL A;  4O6A A;  2FPK A;  2ZH8 A;  4F2S A;  5EE1 A;  1ZD2 P;  2ISP A;  2ZIU A;  5J0X A;  3RR8 A;  2PI5 A;  2OEH A;  5KFK A;  1ED1 A;  2C2E A;  2FI1 A;  3WKD A;  1ZQK A;  4LEV A;  3PR4 A;  3C2L A;  9ICL A;  1K5O A;  1JI7 A;  4C4R A;  4Q43 A;  9ICW A;  2IOF A;  2UVR A;  4I2F A;  1J97 A;  4KB6 A;  1OUQ A;  4Y2J A;  5DB8 A;  5DQH A;  2GWS A;  2AGQ A;  2H3F A;  2WF9 A;  1NKE A;  7ICM A;  1FFU A;  2BCR A;  4UAV A;  3WU2 U;  1T3N A;  1ZRM A;  4C8O A;  2OH2 A;  4M9J A;  2KFN A;  1ZQ1 C;  3AQN A;  5KFI A;  2ODG A;  4I2C A;  1ECW A;  1WUD A;  3GIK A;  2FMQ A;  2ZTD A;  4DL3 A;  4DL6 A;  4DF8 A;  2HHV A;  2I6X A;  4NLG A;  4ZOH C;  2F8K A;  4UAS A;  1DOQ A;  4I2H A;  4O3P A;  2QB0 B;  2K4I A;  2FLN A;  2BE3 A;  2L5Y A;  5G5G A;  4CRX A;  4LZG A;  3PSI A;  2VA3 A;  2ASL A;  4PGX A;  4PL2 A;  5CA7 A;  8ICI A;  4BUG A;  4C8K A;  5KFU A;  2RHF A;  2ZH9 A;  4JB3 A;  4LEY A;  4R64 A;  5KFD A;  3SAF A;  4J9Q A;  3RB6 A;  2LM4 A;  1XNS A;  3FM9 A;  2J6T A;  1ZQM A;  2Y1I A;  4DFD A;  4US8 A;  4F5P A;  1TKD A;  2KZZ A;  4R65 A;  2Y0S C;  3ETR A;  3Q8R B;  4NL9 C;  2PKE A;  1OU5 A;  1FEZ A;  2HHT A;  4LVS A;  4ZH4 A;  4S3N A;  3TFS A;  4EYI B;  4QJF B;  3KHR A;  2FPL A;  2W8K A;  1F5A A;  4AT8 A;  4YVZ A;  4NKT A;  2JMG A;  2RLT A;  4BJQ A;  1QQ7 A;  2QB1 A;  1YLQ A;  5KT7 A;  5KFR A;  5ALH A;  3WKE A;  3H7I A;  4ECQ A;  1NO5 A;  1CUK A;  1A77 A;  5DBB A;  5ALG A;  4F92 B;  5AHX A;  1ZQJ A;  5CHE A;  1OXJ A;  2G06 A;  4DQR A;  4J03 A;  5KL8 B;  4NXW A;  4X4P A;  4RPY A;  5L9X A;  2G07 A;  1XSN A;  3AQK A;  4CDG A;  3Q8S B;  2ZHA A;  1R8A A;  2AHO B;  2MRL A;  4KM5 A;  2NRV A;  4J9L A;  4J9S A;  5BOL A;  2ES6 A;  2ZIX B;  1D8B A;  1TV9 A;  1SGG A;  4YN4 A;  1ZQE A;  3V6H A;  3PSP A;  4MFC A;  5B3Q A;  4Q45 A;  8ICX A;  2IOF K;  4ED1 A;  1KQQ A;  3HJ4 A;  5B3P A;  4UD4 A;  2XY5 A;  8ICA A;  3OV7 A;  3JPT A;  3KD3 A;  4NLN A;  3ERC C;  3QU9 A;  4J9R A;  7ICL A;  1SV4 A;  3RB4 A;  2BQR A;  1KFD A;  3GQC A;  4FZN A;  3KKA C;  5H2F U;  5CP2 A;  4FO1 A;  3UMG A;  5KAI U;  2JXJ A;  4QZI A;  1ZYQ A;  3M9N B;  4NXZ A;  3GZF A;  1UHU A;  1SIJ A;  4J9M A;  1HEK A;  4JLZ A;  5L1I A;  3OSP A;  8ICW A;  1KNY A;  2B6G A;  1Z4O A;  1KFS A;  3L4P A;  2ZH6 A;  4O68 A;  1C20 A;  1TK0 A;  4P0Q A;  2OM6 A;  3R9K A;  4QZB A;  2EAO A;  5KT4 A;  4WQK A;  4C80 A;  1ZQW A;  9ICK A;  1KTQ A;  2F44 A;  3QU7 A;  1L3V A;  2Y1J A;  5J2A A;  3RH5 A;  1N63 A;  4EED A;  3RAQ A;  5HRI A;  1NJY A;  2QAR B;  3HT3 A;  5KG7 A;  4HAI A;  4G9B A;  2MUT B;  5ALI A;  1L3S A;  4EEB A;  3M8S A;  3T3F A;  3PV8 A;  3UPS A;  4EP7 A;  2XIC A;  5AI9 A;  2OCE A;  4NJ8 A;  5J0S A;  3C2M A;  5J0W A;  1GPJ A;  2JGA A;  4I2G A;  1ZQH A;  3WKB A;  3OWG A;  3IDW A;  1TK8 A;  4GXJ A;  5D46 A;  5KFF A;  3CP8 A;  3AL0 B;  1Z00 A;  1QCK A;  1N60 A;  2NRT A;  3TAQ A;  8ICB A;  2PXI A;  4DFM A;  5AIB A;  4ECZ A;  1YZ6 A;  3HPO A;  4KMO B;  4FHV A;  3IG8 A;  2HHS A;  1PVR A;  3SZ2 A;  4J9N A;  2A19 A;  2WB1 F;  5G5H A;  5B66 U;  5DEC A;  2BR0 A;  3K75 D;  2R8G A;  1S5L U;  5KFO A;  1WWU A;  4EZ6 A;  2ZH1 A;  4K98 A;  4K4I A;  2AH5 A;  1ZQT A;  2WAQ C;  4RWP A;  3Q8P B;  1L8O A;  2C2D A;  4B6J A;  1J2M A;  1S0V A;  4K99 A;  4AT8 B;  3PVX A;  3PW5 A;  2FMS A;  5D61 A;  5DG8 A;  5DLF A;  1BPE A;  4Q44 A;  5TZV A;  4NXV A;  2JHD A;  4X4Q A;  5AKE A;  4NV0 A;  2BDP A;  1SL1 A;  2BPC A;  3ONN A;  3T5L A;  4NWI A;  3HX0 A;  3KHG A;  2BCU A;  3BS7 A;  4FBT A;  4KLL A;  3MC1 A;  4O3S A;  2ZH3 A;  5AKL A;  2KMD A;  3O0F A;  2IHM A;  3SI8 A;  1D8L A;  4J9K A;  3NVO A;  4YD1 A;  1L7O A;  4B9L A;  2XCP A;  4ECS A;  4ECY A;  2A1J A;  4NKU A;  5IIL A;  1S8O A;  4TQS A;  2KOB A;  1Y88 A;  4KLJ A;  1BNO A;  3TAD C;  5KFL A;  3TAR A;  1ZXI A;  4ED7 A;  2F1H A;  4RUC A;  1BPX A;  3U26 A;  2B21 A;  3AQE A;  2ZH4 A;  5KG6 A;  1TAM A;  3IP4 B;  1KDH A;  3H8M A;  2XY6 A;  4Y2T A;  2HW3 A;  4RUA A;  3WK8 A;  4KLG A;  2VAN A;  1L7N A;  3KTQ A;  2HBL A;  2W3S A;  4PHD A;  2BPG A;  1C7Y A;  5L1L A;  4FZL A;  1SV0 C;  1A76 A;  2GOL A;  4OCZ A;  5AI0 A;  3EWA A;  1HUZ A;  3ZDD A;  2BBJ A;  2JZB A;  5AI4 A;  3D2N A;  3AM9 A;  2YX8 A;  2W43 A;  2P6R A;  2MU2 A;  4MEY A;  5CWR A;  2O1P A;  1D9F A;  2LKY A;  4X5V A;  4WJ3 B;  3C2K A;  3A0B U;  2EWR A;  2ISO A;  4DSE A;  4TUQ A;  1ZQQ A;  7ICS A;  2ZG6 A;  3K1R B;  4RQN A;  4KLO A;  5KFC A;  4PJ0 U;  1V97 A;  1NKC A;  4DCC A;  3WFO A;  4IRK A;  4I0U A;  5AKG A;  1NZB A;  3MFH A;  1H38 A;  1P7D A;  2K8B B;  3QUT A;  3UPQ A;  3KBB A;  1L6N A;  2DVI A;  4WC4 A;  4K9B A;  3GU3 A;  1QQ5 A;  3L3F X;  4IG8 A;  1U45 A;  3MR5 A;  3C1Z A;  4P4M A;  9ICA A;  3I76 A;  3GDX A;  3AUO A;  1MA7 A;  2HBM A;  4CNQ A;  4NXT A;  2KIC A;  3RAX A;  2H3Q A;  2ZH2 A;  1TK5 A;  1M6Y A;  1TFR A;  3JPR A;  4DQS A;  1N62 A;  2R8K A;  1QH9 A;  3N28 A;  3RRH A;  1AQ6 A;  5HP4 A;  2NO5 A;  4IRC A;  4Y2Y A;  2DR8 A;  4K97 A;  4J9P A;  1RM6 C;  4XJE A;  2OYY A;  5DGB A;  5DDM A;  5JTG A;  2V9W A;  1HJP A;  4FE3 A;  8ICH A;  1RDF A;  2C22 A;  1Z00 B;  5AKX A;  2G0A A;  1NK5 A;  8ICZ A;  5D62 A;  5FP0 A;  2JEF A;  3SMV A;  2PFO A;  2JEI A;  2W9B A;  2JRZ A;  2PBE A;  1IXR A;  4F3O A;  2KKV A;  2AU0 A;  3KKA A;  3C18 A;  4EBD A;  9ICF A;  4X4N A;  3GIL A;  4KLE A;  1V4A A;  4DSJ A;  1B4F A;  2DPI A;  4KTQ A;  4WC2 A;  5L1J A;  2J6U A;  2W3R A;  2YMM A;  2Y9T A;  2HVI A;  7ICU A;  1ZD4 A;  3M6Z A;  4K8V A;  3HW8 A;  1HUO A;  3QUC A;  4IR1 A;  1UT8 A;  5KFN A;  3MGV A;  4DL4 A;  1LKY B;  3H8S A;  2B56 A;  4QWE A;  5JUM A;  4IL6 U;  3A0H U;  2G5H B;  2HN2 A;  4ACO A;  4M6W B;  1R8C A;  4LEZ A;  3OUY B;  4Y2V A;  4PHE A;  4JWM A;  2ZJA A;  3TAC B;  2H3Z A;  8ICG A;  4U6P A;  4AT7 A;  2R18 A;  3UMC A;  4UAR A;  4RQM A;  3QU5 A;  4BDP A;  1Q8K A;  2KKP A;  4KLI A;  3V7J A;  2WF6 A;  3K7D A;  3NUQ A;  3KOO A;  3M7D A;  1ZQA A;  2W7P A;  1LKY A;  1MIY A;  3ICX A;  2B4V A;  2W04 A;  4DL5 A;  3EUB 2;  1JN3 A;  4P4P A;  7ICT A;  3BS5 B;  3M9O B;  4E0D A;  2YML A;  1BVS A;  3N4M B;  4RQ8 A;  3H3A A;  5DGA A;  2KK0 A;  2WB1 C;  2M2U A;  3ED5 A;  3N7R C;  1B22 A;  1ZQL A;  3ER8 C;  2AJQ A;  5AI5 A;  2R8J A;  3PST A;  4KLH A;  2W55 A;  3VCB A;  3NVZ A;  1RXV A;  3M9M B;  3EPI A;  7ICJ A;  3SEN A;  5HR9 A;  4Z6F A;  4AT9 B;  2GO7 A;  2GA9 D;  3H0L B;  4F2R A;  2ZIV A;  3FYH A;  4FFD A;  1X2I A;  3T5H A;  2HBJ A;  4RU9 A;  2PI4 A;  2JH7 A;  4Y2Q A;  1RPL A;  2XVT A;  2GLE A;  5AKH A;  4C7Z A;  5KT5 A;  4DL7 A;  5KFZ A;  5HRK A;  5HRG A;  2KE7 A;  2W9M A;  2ZIW B;  1TAU A;  3OUY A;  2XID A;  4M6W A;  3ZI4 A;  5J8Y C;  3HKZ F;  5ALT A;  3PNC A;  4QNL A;  4UQG A;  4NLK A;  1RQN A;  3D6J A;  2E5S A;  2LBO A;  2G09 A;  4O5E A;  5HR6 A;  5IIJ A;  5GTH U;  4EX6 A;  2K4E A;  1UEU A;  5EE0 A;  3WK9 A;  1SKS A;  4B9N A;  4Y2S A;  4B9T A;  1R8B A;  4DS4 A;  5HHI A;  3TAP A;  5CRX A;  3RBE A;  1N48 A;  4J9O A;  3H38 A; 
#chains in the Genus database with same CATH homology
 4WC1 A;  7ICO A;  4F93 B;  3ZDC A;  4QZE A;  1TK0 A;  8ICN A;  5EWE A;  1D8Y A;  3MGH A;  4FBU A;  4F91 B;  4UAY A;  4QZB A;  3UXP A;  5KT4 A;  3EW9 A;  4PHP A;  5EWF A;  2PFQ A;  2ZUD A;  5J2C A;  5KFB A;  4ED3 A;  2KP7 A;  1S10 A;  4QZ8 A;  4F4W A;  2NRK A;  1ZQW A;  4WCW A;  4ECX A;  3PW2 A;  7ICG A;  4QWA A;  4DOA A;  2OWO A;  3C5G A;  9ICK A;  4X4O A;  3H39 A;  4KLF A;  1KTQ A;  1JIH A;  1TFW A;  4F4Z A;  2ASJ A;  4WC5 A;  5CHG A;  2ZUC A;  4BGD A;  2ZH2 A;  9ICS A;  1ZQV A;  1L3V A;  4M04 A;  4FS1 A;  2Y1J A;  4DWI A;  5DQI A;  5J2A A;  3RH5 A;  4EYH B;  1T8E A;  1S77 D;  3HJ1 A;  1U47 A;  4NY8 A;  4E7X A;  4WC7 A;  1Q78 A;  5IIM A;  2MUT A;  3RAQ A;  4M2Y A;  5HRI A;  1NJY A;  3HT3 A;  3KHL A;  3BQT A;  5KG7 A;  5DDY A;  1RYS A;  1SKW A;  1S0M A;  9ICX A;  4UB2 A;  4QZG A;  4UB4 A;  1WOT A;  5J2J A;  2MUT B;  1ARO P;  1L3S A;  3M8S A;  2ID1 A;  5IIN A;  3FDS A;  3UXO A;  2XGQ A;  3T3F A;  3PV8 A;  3UPS A;  3MDA A;  1D9D A;  4EP7 A;  5KT6 A;  5J0S A;  3C2M A;  8ICM A;  4RQ3 A;  5J0W A;  1XC9 A;  4UBB A;  2MAX A;  8ICS A;  4FH3 A;  3N97 B;  1XS9 D;  4XQ8 A;  4MEX A;  1X9W A;  4YR0 A;  4O3R A;  1ZET A;  2AQ4 A;  1S9F A;  2XO7 A;  4I2G A;  4HYK A;  4R8U B;  5DLG A;  1ZQH A;  2M9N A;  4RT2 A;  3WFP A;  1ZQX A;  1TK8 A;  9ICC A;  4FHY A;  3C1Y A;  4GXJ A;  5D46 A;  5KFF A;  8ICF A;  1Z00 A;  5KTQ A;  3Q8K A;  1BNP A;  2NRT A;  3TAQ A;  3V7L A;  5CJ7 A;  2ATL A;  4JK1 A;  2DPJ A;  4I2A A;  4JWN A;  8ICB A;  3TI0 A;  4M9L A;  4QZF A;  1T4G A;  3PML A;  4UD5 A;  5HML A;  4YQW A;  2PXI A;  4DFM A;  3PW7 A;  3GIJ A;  4DL2 A;  2IBK A;  3LDA A;  3Q8L A;  1MIV A;  4ECZ A;  8ICJ A;  4M9N A;  4O9M A;  4WC3 A;  2C28 A;  1ZQZ A;  3HPO A;  2VA2 A;  4I27 A;  1NJZ A;  7ICH A;  3RTV A;  9ICI A;  4FH5 A;  3BJY A;  4FHV A;  2HHS A;  3JPS A;  3SZ2 A;  4J9N A;  1ZQN A;  1BPB A;  1U48 A;  2J6S A;  4TUR A;  7ICP A;  4E80 A;  4EBC A;  3PW0 A;  8ICK A;  4RNM A;  4O3N A;  4X4T A;  5DEC A;  5J2E A;  4I2B A;  4LZD A;  3EPG A;  2BR0 A;  4RQ0 A;  3K75 D;  2R8G A;  3AU6 A;  8ICT A;  5KFO A;  1NJW A;  4EZ6 A;  2ZTC A;  4QW9 A;  2ZH1 A;  4DQP A;  3GII A;  4K4I A;  1JMS A;  1BPD A;  5KT2 A;  2HHU A;  1WCL A;  1ZQT A;  1R89 A;  4PH5 A;  4RWP A;  4X4S A;  3Q8P B;  2C2D A;  2ZH5 A;  4F50 A;  4WBY A;  3Q8Q B;  4O3O A;  3RJI A;  2UVU A;  1RZT A;  5F2V O;  1ZQS A;  2ZH7 A;  4R63 A;  4F5R A;  4JV0 A;  4PPX A;  3AU2 A;  3JPQ A;  1ZQO A;  4C8N A;  1S0V A;  4XQ7 A;  3G6V A;  4AT8 B;  3PVX A;  2RDJ A;  9ICR A;  1PX5 A;  1LB2 B;  4XRH A;  3PW5 A;  4RPZ A;  5CR0 A;  3LWL A;  3ISD A;  2FMS A;  2I9G A;  1NZP A;  2KTQ A;  3QE9 Y;  4TUP A;  3BQ2 A;  5DG8 A;  1JXL A;  5HRH A;  2FLP A;  5DLF A;  1BPE A;  4R8U A;  7ICE A;  4Q44 A;  5TZV A;  2BHN A;  3MAB A;  5KFS A;  4R66 A;  3ZDA A;  1NJX A;  5KG0 A;  3ZD9 A;  5D49 A;  3ISC A;  2JEJ A;  4JUZ A;  1MQ2 A;  1QSS A;  4X4Q A;  3QZ8 A;  4ATB A;  3KHH A;  1WCN A;  4QZ9 A;  1X9M A;  2BDP A;  2M2T A;  3OVB A;  2ZJ8 A;  1SL1 A;  1K1Q A;  3RR7 A;  2W9A A;  2BPC A;  3TAN A;  1NK4 A;  2BCS A;  4YFK A;  3T5L A;  5DG7 A;  2BQU A;  7ICV A;  5KFH A;  1U9L A;  1COO A;  3HP6 A;  3HX0 A;  3V7K A;  4WC0 A;  5KFJ A;  3KHG A;  1X9S A;  3NYB A;  2ZJ5 A;  5HRE A;  5KT3 A;  4ECR A;  3OSN A;  1NK7 A;  1JXE A;  2BCU A;  2RFF A;  4FBT A;  4KLL A;  5KFE A;  4O3S A;  2ZH3 A;  3IHQ B;  2Q0Z X;  4RZR A;  4RNN A;  3EYZ A;  4F8R A;  2ZHB A;  3PO5 A;  2IHM A;  4F5N A;  3NGD A;  1BPZ A;  3ZDB A;  4RNO A;  2FLL A;  3PY8 A;  5DQG A;  4G3I A;  4BWJ A;  1D8L A;  4GC6 A;  3SI8 A;  4RT3 A;  4RQ4 A;  3OGU A;  4KMU A;  3MGI A;  4J9K A;  3B0Y A;  1XSP A;  1RXW A;  4BXO A;  4LT6 A;  2ASD A;  2DR7 A;  5HRB A;  1SKR A;  4CCH A;  4EBE A;  4C8L A;  3WFR E;  5J2H A;  4MF8 A;  3QEA Z;  4ED8 A;  2DR9 A;  4YD1 A;  2P66 A;  5J0T A;  4K4H A;  2M2W A;  4B9L A;  2PFP A;  2XCP A;  3UQ0 A;  3GFK B;  2NRW A;  1L3T A;  4ECS A;  4ECY A;  1ZQR A;  2A1J A;  4NKU A;  5IIL A;  4TQS A;  4I2I A;  3OVA A;  2C2R A;  1Y88 A;  4RQ2 A;  2F1J A;  4KLJ A;  2HVH A;  4EBJ A;  4WC6 A;  3C5F A;  4NM2 A;  3BQ0 A;  1ZQC A;  1BNO A;  3SYZ A;  9ICJ A;  4Z6E A;  3GIM A;  2HHX A;  5HRL A;  8ICV A;  1LV5 A;  5KFL A;  3TAR A;  1S97 A;  2BGW A;  8ICO A;  4ED7 A;  2F1H A;  8ICL A;  4RUC A;  3NTU A;  1BPX A;  1UEV A;  3WFS C;  2B21 A;  2KZ3 A;  2ZH4 A;  4EEY A;  4I28 A;  4QWB A;  3QEB Z;  5KG6 A;  3PX4 A;  5J2I A;  5J2D A;  5EOZ A;  2R8I A;  3PX0 A;  3LK9 A;  1ZJN A;  1S0N A;  1KDH A;  2VA8 A;  5J2K A;  5DBC A;  1XU4 A;  4P4O A;  3V6J A;  1QLN A;  1MC8 A;  4YMM A;  4YR2 A;  3G6X A;  2XY6 A;  9ICM A;  3C23 A;  1KFT A;  4ED6 A;  3LQC B;  2JZB B;  2DFL A;  3RB3 A;  1QSY A;  4F4K A;  2HW3 A;  2KZM A;  4YMO A;  3HWT A;  4DOC A;  3MBY A;  4I2E A;  4RUA A;  4FHP A;  1PZN A;  4RQ5 A;  3H4B A;  1ZQB A;  3L9D A;  4RQ7 A;  3OJU A;  4KLG A;  2VAN A;  4F5Q A;  1RYR A;  3KTQ A;  4RQ6 A;  4DFJ A;  7ICF A;  1U4B A;  4UB3 A;  4PHD A;  3BQ1 A;  2BPG A;  3MR6 A;  1C7Y A;  1QTM A;  4QWC A;  7ICQ A;  5L1L A;  3T5K A;  9ICH A;  4RPX A;  1UET A;  4BXO B;  3OV7 A;  1A76 A;  5HC9 A;  3UQ2 A;  3ETL A;  3EWA A;  3RH6 A;  3ZD8 A;  1HUZ A;  3UXN A;  3SV4 A;  3V72 A;  4JV1 A;  3ZDD A;  4UB5 A;  5KG4 A;  1BPY A;  2KFZ A;  3AQM A;  2JZB A;  4M9G A;  2ALZ A;  1ZQU A;  5J2G A;  2DR5 A;  5J2B A;  2FMP A;  3MR3 A;  2P6R A;  5KFA A;  3OVS A;  4MEY A;  5CWR A;  5BOM A;  2O1P A;  1KLN A;  1D9F A;  9ICV A;  2NRX A;  5KFV A;  2V4Q A;  3H4D A;  4YG2 A;  8ICQ A;  1KEJ A;  4X5V A;  3AQL A;  3JYY A;  2FPK A;  3C2K A;  2ZH8 A;  4F4X A;  1KSP A;  4X4U A;  3RJH A;  2ISO A;  1XWL A;  4DSE A;  1ZJM A;  3RH4 A;  4QZC A;  1NK9 A;  4F2S A;  5HRF A;  5J2F A;  2PFN A;  3H40 A;  5J29 A;  4TUQ A;  1N48 A;  2ISP A;  4IQV A;  1ZQQ A;  7ICS A;  5J0X A;  4BWM A;  1NK8 A;  3RR8 A;  2PI5 A;  4GXK A;  3PR5 B;  4KLO A;  5KFK A;  5KFC A;  4DSI A;  3HIY A;  3PO4 A;  3K4G A;  2C2E A;  1NKC A;  3WFO A;  4F4Y A;  4ATB B;  4IRK A;  5DB7 A;  3PMN A;  1ZQK A;  3PR4 A;  5DB9 A;  3C2L A;  4ELU A;  7ICN A;  3MFH A;  2RDI A;  5J0Y A;  1H38 A;  3C66 A;  3UPQ A;  9ICL A;  1XO1 A;  5C5J A;  2UVV A;  4Q43 A;  9ICW A;  3IM1 A;  3PX6 A;  2UVR A;  2DVI A;  4I2F A;  3QZ7 A;  4WC4 A;  5KG1 A;  4O5C A;  3GV8 B;  1JX4 A;  5DB8 A;  1DGS A;  3RB0 A;  3G6Y A;  4UB1 A;  3THV A;  1T7P A;  4IG8 A;  1U45 A;  4Z6D A;  3MR5 A;  3C1Z A;  5DQH A;  2GWS A;  1Z3E B;  4M47 A;  2AGQ A;  4KIT B;  1DK2 A;  3OJS A;  4P4M A;  4MFA A;  1S0O A;  1NKE A;  9ICA A;  4GLX A;  7ICM A;  3JPP A;  4FHX A;  3GDX A;  2BCR A;  4DLG A;  1T3N A;  3SV3 A;  1JAJ A;  3AUO A;  4DS5 A;  3JZ0 A;  4C8O A;  4M9J A;  3E2E A;  2KFN A;  4MFF A;  2FPM A;  3RAX A;  1JQR A;  4X4V A;  2F1I A;  4ECW A;  2P6U A;  1TK5 A;  2H5X A;  2O5A A;  1TFR A;  4ECV A;  4UBC A;  3AQN A;  5KFI A;  5KFW A;  3JPR A;  3LWM A;  4DQS A;  2R8K A;  9ICO A;  2M2V A;  4IR9 A;  9ICP A;  3RRH A;  4QZH A;  4I2C A;  1KRP A;  5HP4 A;  4X0B A;  4IRC A;  2DR8 A;  3GIK A;  2FMQ A;  2ZTD A;  4YXJ A;  4J9P A;  4XA5 A;  4Q8F A;  4XUS A;  1Q79 A;  4DSF A;  4DL3 A;  5DGB A;  5DDM A;  2V9W A;  4YMN A;  4DL6 A;  5HHH A;  1HJP A;  4DF8 A;  2BQ3 A;  2HHV A;  8ICH A;  1S76 D;  3H38 A;  4PGQ A;  4GC7 A;  2AGP A;  4M0A A;  2C22 A;  4NLG A;  5DKW A;  4KN7 A;  1VJ7 A;  4RWQ A;  1Z00 B;  1TAQ A;  4F5O A;  4DFP A;  4KLM A;  1NK5 A;  8ICP A;  2DRA A;  1ZQF A;  8ICZ A;  2JEF A;  1DOQ A;  2W9B B;  4I2H A;  4O3P A;  2PFO A;  5HNK A;  2Q66 A;  2JEI A;  2W9B A;  2FLN A;  2BE3 A;  2PBE A;  2KN7 A;  1NK0 A;  1IXR A;  4X4R A;  3M8R A;  4LZG A;  2VA3 A;  4F3O A;  5DED A;  2AU0 A;  3C18 A;  4KLT A;  2ASL A;  4EBD A;  4PGY A;  4DFK A;  4UAW A;  8ICC A;  4QZD A;  9ICF A;  3GIL A;  4X4N A;  4KLE A;  5EWG A;  5CA7 A;  5KG3 A;  4PGX A;  5KG5 A;  5CB1 A;  3OHA A;  4DSJ A;  1DK3 A;  1V4A A;  2DPI A;  3JPO A;  8ICI A;  4PHA A;  4KTQ A;  4WC2 A;  4KN4 A;  1UA0 A;  4C8K A;  4Z6C A;  5L1J A;  5KFU A;  2J6U A;  5KFX A;  3T5J A;  4IQW A;  3MR2 A;  5HMM A;  4M9H A;  2HVI A;  7ICU A;  2ZH9 A;  1SL0 A;  4C8M A;  4R64 A;  9ICU A;  4QWD A;  8ICE A;  3RJJ A;  5KFD A;  3HW8 A;  5KFY A;  1SZP A;  3JPN A;  4J9Q A;  3RB6 A;  1HUO A;  1ZQG A;  4B9U A;  4Q8E A;  5F9N A;  1L5U A;  4IR1 A;  2WTF A;  1UT8 A;  5KFN A;  4DL4 A;  1ZQI A;  3GV7 B;  3H8S A;  4MF2 A;  4QWE A;  2J6T A;  4NLZ A;  1ZQM A;  2W8L A;  1ZQY A;  5JUM A;  2Y1I A;  4DO9 A;  8ICY A;  1FA0 A;  4O0I A;  3EZ5 A;  4ECT A;  4F5P A;  3V6K A;  9ICN A;  5KFT A;  1TKD A;  5IIO A;  2KZZ A;  4R65 A;  4M6W B;  1R8C A;  5DB6 A;  3OUY B;  3Q8R B;  4JV2 A;  1NK6 A;  4I2J A;  4PHE A;  2JEG A;  1OU5 A;  1V9P A;  2W9C B;  2ZJA A;  1SL2 A;  1EXN A;  4JWM A;  1MSW D;  4B9V A;  2AQ0 A;  2HHT A;  8ICG A;  4LVS A;  4ZH4 A;  5HRD A;  4S3N A;  3TFS A;  4TUS A;  4EYI B;  2HHQ A;  4AT7 A;  5IIK A;  3KHR A;  2FPL A;  2W8K A;  1F5A A;  4AT8 A;  1BGX T;  4YVZ A;  2IMW P;  4NKT A;  4BDP A;  4KLI A;  3V7J A;  4KLS A;  2NRZ A;  1N56 A;  4FHW A;  4DSL A;  2DRB A;  1XSL A;  1QSL A;  3H8W A;  5D4B A;  4B9M A;  1YLQ A;  4ED2 A;  5KT7 A;  2XGP A;  5L1K A;  1ZQA A;  4DF4 A;  4KLD A;  4O3Q A;  2ZTE A;  3Q8M A;  4AT9 A;  5KFR A;  1MIY A;  5III A;  1VFG A;  1ZQP A;  9ICG A;  3H7I A;  4ECQ A;  1NO5 A;  1CUK A;  4DL5 A;  1A77 A;  4KLQ A;  4DSK A;  1JN3 A;  5DBB A;  4P4P A;  7ICT A;  3M9O B;  4E0D A;  4P2H A;  2A1J B;  1B43 A;  4WBZ A;  4EBK A;  1BVS A;  4I2D A;  4F92 B;  3N4M B;  1ZQJ A;  4ELT A;  7ICK A;  4RQ8 A;  3H3A A;  4DQR A;  4IQT A;  4ED0 A;  5DGA A;  4O5K A;  2M2U A;  9ICE A;  8ICR A;  1B22 A;  4X4P A;  1ZQL A;  1NOM A;  2AJQ A;  4RPY A;  2R8J A;  5L9X A;  3WFQ E;  4KLH A;  5J0P A;  4FO6 A;  1XSN A;  4I29 A;  3AQK A;  1MQ3 A;  4KLU A;  4K4G A;  1RXV A;  3Q8S B;  3M9M B;  3EPI A;  2ZHA A;  7ICJ A;  3OHB A;  1R8A A;  5HR9 A;  5J0R A;  1UT5 A;  3B0X A;  4Z6F A;  1U49 A;  2NRV A;  3TQ1 A;  4AT9 B;  9ICT A;  4RWO A;  5J0Q A;  4J9L A;  2BCQ A;  4F2R A;  8ICU A;  2XC9 A;  4J9S A;  2IA6 A;  5BOL A;  4IRD A;  3FYH A;  1CEZ A;  2I1Q A;  3RJK A;  1X2I A;  3T5H A;  4YXM A;  1TV9 A;  4YN4 A;  9ICQ A;  1TFY A;  4RU9 A;  2PI4 A;  1ZQE A;  3V6H A;  4MFC A;  3GV5 B;  1L3U A;  4Q45 A;  3ZDE A;  2XCA A;  1RPL A;  2BKE A;  5KFQ A;  2V4R A;  5KT5 A;  4AT7 B;  5DG9 A;  4DEZ A;  5KFZ A;  4DL7 A;  4B9S A;  8ICX A;  4E8F A;  5HRK A;  5HRG A;  4ED1 A;  2BPF A;  1TVA A;  2W9C A;  2W9M A;  2ZUB A;  3PW4 A;  2IHN A;  4YCX A;  5J0O A;  3HJ4 A;  2XY5 A;  8ICA A;  4UD4 A;  5KFP A;  3JPT A;  4DOB A;  4QW8 A;  3MDC A;  1UA1 A;  2BCV A;  2UVW A;  1TAU A;  9ICB A;  3OUY A;  5KG2 A;  4M6W A;  3RJE A;  4NLN A;  1MIW A;  4RWN A;  3H37 A;  4J9R A;  7ICL A;  1NKB A;  4RQ1 A;  4GXI A;  2XY7 A;  3RB4 A;  2BQR A;  1KFD A;  3GQC A;  4DQQ A;  1K1S A;  3RJF A;  4M5D A;  3PNC A;  4FS2 A;  4UQG A;  4DLE A;  5J0U A;  4NM1 A;  4NLK A;  4UAZ A;  5CP2 A;  4YD2 A;  5F9L A;  1IM4 A;  2LYH A;  4QZI A;  3TFR A;  3ORY A;  4EZ9 A;  1ZYQ A;  4TQR A;  4X0A A;  3M9N B;  3ISB A;  3C21 A;  4NXZ A;  1ZQD A;  4QZA A;  5KFG A;  4O5E A;  3RRG A;  5IIJ A;  4YR3 A;  2HHW A;  4J9M A;  3RJG A;  1UEU A;  3BDP A;  5L1I A;  2HHP A;  3OSP A;  3H8J A;  4ELV A;  2AGO A;  8ICW A;  1KNY A;  1SKS A;  5BPC A;  4B9N A;  7ICI A;  4B9T A;  1R8B A;  3MFI A;  5HHI A;  4DS4 A;  3TAP A;  1KFS A;  3RBE A;  7ICR A;  3RBD A;  4ECU A;  4IQU A;  2R8H A;  5KFM A;  4DQI A;  4J9O A;  5DBA A;  4YP3 A;  2ZH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...