4F5OA

Open ternary complex of r283k dna polymerase beta with a one metal bound dctp analog
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
326
structure length
321
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of dNTP Intermediate States during DNA Polymerase Active Site Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 108
structure length 321
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f5oA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4f5oA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4f5oA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4f5oA03
8ICGA 3ISBA 4R65A 2PI5A 1DK2A 4KLUA 1U9LA 1NKCA 2OWOA 4IG8A 5J0WA 4KLJA 4KLLA 4YP3A 4I2DA 2P6UA 4F93B 2V4RA 5DG9A 4RT3A 4NLNA 8ICOA 4Q8FA 4ELTA 1ZQUA 1NK6A 4M0AA 1BVSA 3UQ2A 3RRGA 4YN4A 3C2MA 1ZQKA 4EYIB 2KZMA 5HRKA 3M9MB 3Q8QB 4NY8A 1JN3A 4ECWA 2V9WA 1TK5A 7ICNA 4PGYA 2F1JA 3ISDA 3RH4A 3UQ0A 7ICFA 8ICBA 9ICJA 1XU4A 3Q8SB 5KFFA 4JWNA 1SKSA 4EBCA 1U49A 3LWMA 3GV8B 1QSSA 2ISPA 4DL7A 2ZUCA 4DL3A 2KP7A 2VANA 3Q8MA 3GQCA 5DQGA 1D8YA 4RUCA 2XGPA 4DFPA 2ZH7A 5KFWA 2NRXA 1NJXA 4ED0A 3C18A 4UBBA 1ZQLA 4DWIA 4DSKA 1ZQZA 4MFCA 9ICHA 2BQ3A 3BJYA 2HW3A 2C2EA 5L1IA 4WC3A 9ICVA 4YCXA 1NJZA 2MUTB 3G6XA 5DEDA 4RT2A 4C8MA 5HHIA 7ICPA 5J2AA 9ICGA 4DO9A 2AU0A 5KFRA 3RJHA 3LWLA 1Z3EB 2W9BA 3FDSA 2W8LA 3EPIA 4DFKA 4B9SA 1WOTA 4PPXA 1MQ3A 3BQ0A 2PBEA 5DECA 4J9PA 3C1YA 3HPOA 5KG2A 4F5NA 5KFYA 1ZQNA 3PR4A 1BPEA 4TQSA 1TK0A 2DR8A 3UXNA 3M8SA 3C5FA 3UPQA 2Y1IA 3RJKA 4QW8A 3PW5A 2C2RA 8ICSA 3PO4A 2J6UA 2DFLA 4YXJA 4M04A 1TAQA 5F9LA 5J29A 3T3FA 5HRHA 4NXZA 3GV5B 1JXLA 3T5HA 2HHPA 1TV9A 5J2DA 3V6JA 2DRAA 5EWFA 4NLKA 3K75D 3B0XA 3E2EA 4O3OA 3JYYA 3AQLA 2FPLA 4B9MA 1A76A 1K1QA 5KFTA 5KFHA 4E8FA 3OVSA 3PW0A 9ICUA 4RWOA 2DR5A 4YR2A 5JUMA 5KT3A 3RH6A 5J0YA 1UA1A 8ICQA 1UT5A 3WFQE 2ZH6A 4GLXA 1NZPA 4X4TA 4O3NA 4YD1A 4QZEA 1R8CA 4KN7A 4MFAA 4TUSA 5KFPA 2ZH3A 8ICPA 4ECUA 1VJ7A 3MGHA 2ID1A 1RPLA 3BQ2A 5KT5A 4QWBA 4I2IA 8ICHA 9ICKA 2C22A 3WFPA 2UVUA 3ZDEA 4ED3A 3KHLA 9ICMA 4IRDA 4ED1A 5KFZA 8ICLA 4LZGA 3V7KA 1S0OA 2XGQA 3RH5A 1X9WA 9ICXA 2AGOA 1S0MA 5KG0A 1ZQVA 2NRZA 4EBDA 2XY7A 1SL1A 4WBYA 5J0TA 2IHNA 4X4UA 5DB8A 3HT3A 1TKDA 4MFFA 9ICBA 4DS5A 8ICKA 4JK1A 1S9FA 4E0DA 2ZUDA 2BPCA 4XA5A 2XCAA 3RJEA 4KLOA 3GFKB 9ICLA 8ICIA 1MSWD 5J2IA 8ICCA 3JPRA 3QEAZ 4X5VA 1NK9A 4WC1A 1Z00A 3H4BA 4RQ8A 5KG3A 8ICNA 4FBTA 9ICSA 4RPYA 2ZJAA 4O3PA 3PX6A 2BGWA 4J9SA 3C21A 5DDYA 1UA0A 1DOQA 8ICXA 1KFTA 2H5XA 4UB1A 4ECSA 4AT9B 2ZJ8A 1L3TA 3Q8KA 1HUZA 3GV7B 4PH5A 1ZQFA 1NKEA 4PHEA 7ICMA 1UETA 4P4MA 4DSFA 5HRLA 2HHVA 1COOA 2R8IA 3MR5A 3H3AA 5J2EA 5J0SA 1ZQBA 4YFKA 2M2TA 1RYRA 1TFYA 5IIIA 2ISOA 2FMQA 3MR6A 2ATLA 4EP7A 4DLGA 3JPSA 8ICZA 3SV4A 8ICRA 2Q0ZX 2BQRA 9ICWA 3KHHA 3PW2A 4M6WA 2RDIA 1KTQA 2KFNA 3RTVA 1K1SA 4KLMA 2ZTDA 5KT2A 4BXOA 4GXIA 2HHSA 1UEUA 2R8GA 4ELUA 4FO6A 4KLSA 1NJWA 3V72A 4KLIA 1TVAA 4EEYA 1T7PA 3JZ0A 2M2VA 7ICLA 4CCHA 4RZRA 3MDAA 1SZPA 4J9RA 4DL4A 4UBCA 4DOAA 1Q79A 1ZQSA 4I29A 4C8LA 1S76D 2A1JA 1XSNA 5J2CA 1ZJMA 2JZBB 2DVIA 4QWCA 4XRHA 3M8RA 4YQWA 4R63A 5KFKA 5F9NA 5J0OA 1Z00B 3JPQA 4O5EA 3C66A 5KFDA 5DBCA 4IR9A 5HMMA 5BOMA 3G6YA 3QEBZ 4YMMA 4K4IA 4Z6CA 4Q8EA 2ZH1A 1C7YA 5KT4A 5DG8A 4EZ6A 1JMSA 2B21A 3LK9A 4DSEA 4DQIA 5DLGA 2AGPA 3MABA 4QZCA 1RXVA 1ZQOA 1BNPA 3OJUA 1KDHA 4RQ6A 5L1KA 1SL2A 3AQKA 4YD2A 4UB4A 3PW7A 2W9CA 3MDCA 4BGDA 5IIKA 4LVSA 4DSLA 2R8JA 9ICOA 1RZTA 1N56A 1UEVA 2BQUA 4QWAA 4K4HA 4F5QA 4FH3A 1TFWA 5KT7A 3H8SA 3V6KA 3NYBA 3JPTA 2FPMA 4TURA 3RB3A 3ZDBA 4RWQA 1V9PA 3L9DA 4BXOB 4PHAA 1YLQA 4ED2A 2ZHAA 3UPSA 4DQRA 4FHXA 4IR1A 4QZGA 4EBJA 3ZD9A 1QSYA 4EBKA 1JX4A 2JEIA 4WCWA 4O3QA 4O3SA 1ZETA 4X4OA 4QZ9A 1KSPA 2KTQA 2A1JB 4MF8A 4J9LA 4BWMA 4RPXA 2HVIA 1B22A 3OVBA 2VA8A 2XCPA 4O9MA 4YVZA 1BPXA 1DK3A 1WCLA 4FH5A 3FYHA 4X4RA 3PX4A 4X0BA 4UQGA 3GILA 4X4PA 4M9NA 4RNNA 2IA6A 4M47A 3M9NB 3RBEA 2MAXA 3HX0A 5DB7A 5KG6A 3QZ7A 5KFSA 4RNOA 2Y1JA 5EWEA 1KFDA 4UAZA 3AUOA 2ASDA 3RR7A 8ICAA 3LQCB 3H38A 2DR9A 4LZDA 3LDAA 4M9JA 5J2GA 3PMNA 4C8OA 2O5AA 4WC2A 4X4SA 5BOLA 1MC8A 3KTQA 5D4BA 5DDMA 2F1IA 2PXIA 1NJYA 2UVRA 4NLZA 1EXNA 1R8BA 4QW9A 1QTMA 1PZNA 4KN4A 4I2CA 2W9CB 7ICGA 3N4MB 4RQ0A 4DSJA 4I2BA 2W9MA 4KTQA 1JAJA 3TAQA 5EWGA 3H37A 2FLNA 4DF4A 3OSPA 3PO5A 2RDJA 4B9NA 1CUKA 4X4QA 5CB1A 4DL5A 4MEYA 3MGIA 1ZQDA 1KRPA 4PGQA 3RB4A 2C28A 3H8WA 1X9MA 5J0PA 3TARA 5KG4A 4ECYA 2FLLA 2PFQA 1XO1A 1X2IA 1CEZA 5KFQA 5L1LA 1S0VA 4NKUA 1VFGA 5HC9A 5KFBA 2XC9A 3GIJA 2KFZA 4E7XA 1ZYQA 5DLFA 4F4WA 3RAXA 1ZQJA 1ZQRA 4ATBA 3OUYA 9ICTA 5KFCA 4DS4A 4X0AA 4UB2A 4DL2A 2W9BB 1F5AA 4YXMA 4ECVA 1L3UA 4UD4A 7ICEA 2IHMA 1BGXT 4YR3A 4ECXA 4B9TA 1BNOA 4F91B 4S3NA 2DPJA 4KLFA 4DQPA 2XO7A 2I1QA 1T4GA 1T3NA 2BCUA 3GIIA 2HHUA 1NK0A 4BDPA 5IIMA 1Q78A 3BQTA 1U48A 1QSLA 4JWMA 4J9NA 4K4GA 4ZH4A 3TFRA 4C8NA 1WCNA 1XWLA 4P4PA 4FS2A 3Q8LA 1ZJNA 1L3SA 1ZQIA 4F2RA 3AQMA 3THVA 4F50A 3H7IA 3JPNA 4J9MA 4AT8A 3C2KA 3UXPA 3EZ5A 2J6SA 2HVHA 4YMOA 5J0UA 2M9NA 5IIJA 4DOCA 4O0IA 4ED6A 2PI4A 1NK5A 2AQ0A 4F5OA 5J2FA 5KFGA 2XY6A 1ZQQA 3OJSA 3TAPA 4EYHB 1RYSA 5TZVA 4XQ8A 4QZHA 1X9SA 3IHQB 3MFHA 2VA2A 4F4KA 2ZH4A 4FBUA 2ZHBA 4P4OA 2J6TA 4FHYA 2ZJ5A 4P2HA 3RR8A 2M2WA 1H38A 3RBDA 5DBAA 5IIOA 1NK7A 1HJPA 2V4QA 1BPZA 4UAYA 3NGDA 3GIMA 1BPDA 3SZ2A 2GWSA 3TI0A 4NLGA 4KLDA 1R8AA 2R8KA 3HIYA 3PMLA 3RRHA 4UD5A 5IILA 3OUYB 9ICIA 3EWAA 4F4ZA 4ATBB 2ALZA 4DSIA 4KLQA 5KG5A 1R89A 4BWJA 4F5PA 3BDPA 5HRBA 1IXRA 4QZFA 1DGSA 4GXKA 4QWEA 3OSNA 5C5JA 7ICIA 3EYZA 4I27A 3WFRE 4DFJA 4F3OA 4KITB 5HRDA 2JEGA 3BQ1A 7ICSA 1JQRA 3JPPA 4GXJA 3EPGA 2UVVA 5J2KA 5DG7A 1UT8A 8ICTA 3AQNA 8ICVA 3ETLA 1BPBA 4M2YA 3C5GA 4Q43A 4TUPA 5IINA 5J0QA 1TK8A 1MQ2A 3UXOA 4JV2A 4ECTA 5HRGA 4QZIA 4ECQA 2DPIA 4QWDA 3RJFA 4AT8B 1S10A 5J2JA 3AU2A 9ICPA 4XUSA 3H40A 4GC7A 4JV1A 1Y88A 5CR0A 4I2EA 1XSLA 2ZH2A 2W9AA 4RWPA 2FLPA 2HHQA 2UVWA 4WC5A 5CP2A 2R8HA 4WC7A 1L3VA 7ICJA 4RQ5A 5KT6A 3ISCA 4NKTA 1U4BA 3M9OB 4JV0A 4ECZA 1KFSA 4UB5A 2IMWP 2PFOA 2WTFA 4IRKA 7ICQA 3H39A 3PR5B 4Z6FA 4M9GA 4ELVA 3EW9A 7ICTA 4M6WB 4YMNA 5J0RA 3SYZA 2BCSA 2BCRA 4IRCA 4DLEA 3NTUA 4Q44A 1ZQTA 3PV8A 4J9QA 4RPZA 5L1JA 4YG2A 4RQ3A 1SKRA 1NK8A 3PNCA 8ICUA 5F2VO 4PGXA 5J2HA 4EZ9A 2AJQA 4KLHA 5BPCA 1T8EA 4UB3A 7ICOA 1RXWA 3MR2A 5DB9A 1FA0A 1NKBA 9ICNA 3QE9Y 5KFOA 3V7LA 2BPGA 5KFAA 1ZQMA 3PW4A 4I2AA 2ZTEA 1LB2B 4X4NA 2C2DA 4AT7A 5HR9A 4B9LA 1B43A 1KEJA 4RUAA 4TQRA 1S97A 2KZZA 3ZD8A 4MEXA 1QLNA 1JXEA 1TAUA 1LV5A 2HHTA 4F4XA 4DQQA 2FMPA 5KFLA 5DB6A 3Q8PB 4F92B 1ZQWA 4IQVA 4QZAA 4GC6A 4KLEA 4QZ8A 1NO5A 2P66A 2PFPA 1ZQGA 3PY8A 1TFRA 2BHNA 3ORYA 3HP6A 3T5JA 5DGAA 3RAQA 1D9DA 5KFNA 1S77D 5D46A 5KTQA 4XQ7A 3RJJA 2AQ4A 5DBBA 3T5KA 4Z6DA 5KFMA 1OU5A 2DR7A 5HHHA 4B9VA 1D9FA 3OHAA 1MIWA 3B0YA 4M9LA 4EBEA 1N48A 2M2UA 4YR0A 4G3IA 3ZDCA 3OHBA 9ICRA 8ICEA 3T5LA 3HJ1A 4WC6A 4WC0A 3G6VA 4E80A 4J9KA 9ICQA 1JIHA 1BPYA 3HWTA 4QZBA 1ZQXA 2BR0A 4DOBA 1ZQPA 5HRIA 3WFSC 9ICAA 5L9XA 4I2JA 3AU6A 3V7JA 3RB6A 8ICJA 4X4VA 5KFIA 4R64A 4ECRA 5HNKA 2KN7A 3ZDAA 5HRFA 2Q66A 3C2LA 4Q45A 4KMUA 2BPFA 4MF2A 3HJ4A 4F5RA 4DFMA 4AT7B 4I2FA 2ZUBA 3PX0A 1V4AA 2O1PA 5HMLA 5KFEA 4AT9A 4ED7A 1SKWA 2DRBA 7ICHA 3N97B 5KFJA 2P6RA 5DKWA 4NM1A 4FHVA 2AGQA 2NRWA 2BDPA 5KFVA 5KG7A 3ZDDA 1ZQCA 2BE3A 2JEFA 5KFXA 2HHWA 5CJ7A 3RB0A 2BKEA 2HHXA 7ICUA 4RQ4A 9ICEA 2JEJA 4C8KA 1PX5A 5HREA 3JPOA 4I28A 4R66A 4F2SA 5KG1A 1HUOA 2ASLA 4M5DA 2XY5A 3IM1A 4DL6A 3H8JA 9ICFA 2ZH9A 4UAWA 3H4DA 5DGBA 4PHPA 2ASJA 4F8RA 1XS9D 4FHPA 1MIVA 4LT6A 5CWRA 3MBYA 4O3RA 3GIKA 4DQSA 3RJGA 4R8UA 4IQTA 4TUQA 4HYKA 4RU9A 3PVXA 2I9GA 4F4YA 2NRVA 1D8LA 2JZBA 4Z6EA 3MR3A 1NK4A 2BCVA 2VA3A 5CHGA 4B9UA 2LYHA 3QZ8A 4ED8A 4WBZA 4RWNA 2F1HA 1ZQEA 3TFSA 2PFNA 5J2BA 3V6HA 3RJIA 8ICYA 3OV7A 3MFIA 5HP4A 5CA7A 4RQ2A 1NOMA 4PHDA 5D49A 3GDXA 3KHRA 3K4GA 1XC9A 2NRKA 3Q8RB 1ZQHA 5DQHA 4QZDA 4RNMA 3C1ZA 7ICKA 4JUZA 9ICCA 3WFOA 3TQ1A 4KLGA 1A77A 4WC4A 3OGUA 7ICVA 1KNYA 4RQ1A 8ICMA 7ICRA 1L5UA 1ZQAA 1XSPA 2FMSA 3SI8A 1U47A 4M9HA 2FPKA 5KFUA 2NRTA 1SL0A 4O5KA 4DEZA 5J0XA 8ICFA 2RFFA 3OVAA 2KZ3A 5DQIA 1MIYA 1U45A 2ZH8A 2ZTCA 2BCQA 5EOZA 2W8KA 3TANA 4O5CA 1KLNA 3SV3A 4I2HA 4I2GA 1S0NA 4FHWA 4IQUA 2ZH5A 3C23A 1ZQYA 4FS1A 4DF8A 3HW8A 4IQWA 2MUTA 4R8UB 1IM4A 2IBKA 4RQ7A 4KLTA 3KHGA 1AROP 4NM2A 4J9OA 8ICWA
chains in the Genus database with same CATH superfamily
4NLBA 3TACB 2FCLA 4IG8A 4I2DA 5DG9A 4ZOHC 8ICOA 4Q8FA 4ELTA 1NK6A 4M0AA 1BVSA 5HRKA 3Q8QB 1TK5A 1FO4A 2ESEA 1COKA 5D62A 5CFSA 1U49A 3LWMA 1X6JA 4NWIA 4DL3A 1D8YA 1RQLA 2XGPA 2ZH7A 5KFWA 2XVTA 4UBBA 4DWIA 4MFCA 2BQ3A 2LKYA 2HW3A 2C2EA 5L1IA 9ICVA 4C4SA 5DEDA 4P0QA 4RT2A 2VJ5A 1ZD3A 7ICPA 2GH1A 5KFRA 3RJHA 2W8LA 4EBKA 2W9BA 3EPIA 4DFKA 5DECA 4N7RA 5KL1B 3L4PA 5KG2A 1JI7A 4F5NA 3N28A 4TQSA 2KJ8A 3UXNA 2Y1IA 2C2RA 8ICSA 4CDGA 4YXJA 4OJPA 3T3FA 5HRHA 3WK6A 3ETRA 1JXLA 1TV9A 3E2EA 3B0XA 5JTIA 3JYYA 4B9MA 5KFHA 9ICUA 5JUMA 1UA1A 3TKAA 5J0YA 8ICQA 2LYAA 1NZPA 4X4TA 4O3NA 4YD1A 2KJ5A 2ZH3A 8ICPA 5F3XB 1L7NA 2H3ZA 5KT5A 4QWBA 8ICHA 2C22A 3KHLA 4ED1A 2NV3A 8ICLA 3V7KA 1X9WA 2NRZA 1F0MA 4WBYA 2IHNA 4X4UA 2LMRA 2F3NA 2ZUDA 2BPCA 4C7ZA 4P0PB 3JPRA 1NNLA 4WC1A 1Z00A 3H4BA 4RPYA 4J9SA 3C21A 5DDYA 1KFTA 4ECSA 3Q8KA 1UETA 2R8IA 5AK6A 1P7DA 5J0SA 2K60A 1ZQBA 4QIWF 2ISOA 2FMQA 3MR6A 1JALA 3JPSA 8ICRA 4C4RA 1K1SA 4OAHA 3PSFA 2R8GA 4C4TA 1T7PA 4EEYA 1YZ6A 4RZRA 3MDAA 4J9RA 1Q79A 4DOAA 2PKEA 4C8LA 1S76D 3BQ7A 2W7PA 2JZBB 3M8RA 5J0OA 3C66A 2KMDA 1KKXA 4Z6CA 1C7YA 5ALKA 3LK9A 4IC9A 2AGPA 2KHQA 1BNPA 1ZQOA 3OJUA 1KDHA 1SL2A 2H3IA 2ZIUA 2W11A 2EDUA 3AQEA 5IIKA 4FH3A 4F5QA 1TFWA 1N2XA 4TURA 1XNSA 3ZDBA 2OM6A 1YLQA 4DQRA 2EAMA 4IR1A 1CRXA 5ALNA 1ZETA 1KSPA 1PUZA 4MF8A 2HDOA 3KFUF 4X4RA 4X0BA 2IA6A 3RBEA 5CEHA 2ASDA 5EWEA 1KFDA 8ICAA 3LQCB 3H38A 3WK8A 4M9JA 3CRXA 4WC2A 2HI0A 2WF9A 5KL8B 4NLZA 2RRDA 2W3SA 2KKVA 1CI4A 4RQ0A 4I2BA 2DKZA 3CP8A 3RB4A 1OXJA 3H8WA 5J0PA 2ZIWB 4ECYA 2KIWA 2WF8A 5D61A 5KFQA 5L1LA 2YB4A 3HILA 5DLFA 2B4VA 4F4WA 1ZQJA 3OUYA 2E8NA 9ICTA 2P35A 1QQ7A 4DL2A 1F5AA 4YXMA 4ECVA 1BGXT 2QKQA 4Y2TA 4F91B 2DPJA 2XO7A 1T4GA 4BDPA 2XICA 3KZIU 2WF5A 1QSLA 4K4GA 4ZH4A 1ZQIA 1WCNA 4P4PA 4FS2A 5B5EU 2KG5A 3H7IA 4J9MA 2HVHA 4NXVA 4ED6A 3OJSA 1Q46A 4EYHB 1X9SA 1RQNA 3MFHA 2ZHBA 2J6TA 3RR8A 2WAQC 1RDFA 4UAYA 1BPDA 3UMCA 3I28A 2R8KA 4UD5A 3PMLA 3RRHA 5H2FU 1MA7A 9ICIA 3EWAA 2ALZA 1L7MA 5KG5A 5HRBA 1IXRA 2Z7JA 5EE1A 4Y2PA 1LVHA 1QQ5A 1JQRA 3PSIA 5HRDA 4PJ0U 3AQNA 1BPBA 3C5GA 4TUPA 2MU2A 2W04A 4JV2A 3QUQA 3UMBA 3H40A 5G5HA 1Y88A 2ZH2A 4K9BA 2UVWA 2R8HA 5ALRA 3M6ZA 3NRWA 4NKTA 4ECZA 4JV0A 3PR5B 4Y2VA 4Z6FA 2VJ4A 5J0RA 3D2NA 1AQ6A 1MN8A 3PV8A 4J9QA 4K96A 8ICUA 5J2HA 4KLHA 2OHFA 7ICOA 3V7LA 5KFAA 2KSOA 1LB2B 2K89A 3WKBA 4B9LA 1B43A 1KEJA 3MC1A 1S97A 2KZZA 1QLNA 1JXEA 5ALFA 5KFLA 2HSZA 4GC6A 1NO5A 5AHXA 3T5JA 5DGAA 4NL9C 5KFNA 1SV0A 1PVPA 4BX9C 5KFMA 1D9FA 2M2UA 2EQYA 3ZDCA 1WUDA 9ICRA 3LYSA 5EE0A 2ODGA 5CRXA 4C0ZA 5ALJA 9ICQA 1PK1B 5HRIA 5AKGA 5L9XA 5KFIA 5HNKA 2KN7A 3C2LA 5AM1A 4MF2A 3F5AA 1FIQA 3CW2C 4AT7B 2OCEA 4I2FA 2QB0B 2O1PA 1WG8A 2QARB 3N97B 4NM1A 2P6RA 2N1RA 1RG6A 3ZDDA 5KFVA 5AK3A 4RQNA 2HHWA 5CJ7A 2BKEA 5EE3A 1VLBA 4K9AA 4R66A 3IM1A 3H0LB 4DL6A 4UAWA 4WJ3B 5AIAA 4O3RA 3GIKA 3RJGA 4HYKA 2I9GA 4F4YA 3R9KA 4EX6A 5CHGA 2WB1C 4B9UA 4ED8A 4UB8U 1ZQEA 4EEBA 2PFNA 2ZIXB 3KHRA 3GDXA 1XC9A 3Q8RB 4NXTA 5DQHA 2L5YA 4RNMA 3C1ZA 1A77A 3OGUA 3H8MA 2FE9A 1U47A 2HOFA 2Q4TA 2ZTCA 2BCQA 2G0AA 3FM9A 4JMUA 1ZOLA 3GZFA 1S0NA 1X42A 4DF8A 3KHGA 5JU5A 3ISBA 4R65A 2PI5A 4KLUA 1PVRA 4KLJA 4YP3A 2JR5A 2P6UA 4Y2XA 4F93B 4RT3A 3M6KA 4LT6A 2KZMA 3M9MB 4NY8A 1JN3A 7ICNA 2YN4A 1UQVA 3B9JA 3UQ0A 1XU4A 4EGWA 5KFFA 2YMMA 4CF5A 5AKIA 2EH9A 3JCFA 2DWQA 3GQCA 5DQGA 4DFPA 1NJXA 4DSKA 1ZQZA 3WKCA 9ICHA 5T14A 3BJYA 4WC3A 1L6NA 4YCXA 2ZXHA 4C8MA 3QUTA 9ICGA 1Z3EB 4PPXA 2A3VA 4KM5A 3HPOA 1TK0A 5JTGA 2DR8A 3RJKA 5B3QA 4QW8A 3ALRA 3PO4A 5F9LA 1L8LA 4LEWA 3V6JA 4NLKA 2JV3A 3NVVA 2JGAA 4O3OA 2FPLA 1A76A 5AI5A 2LM4A 4RWOA 4HAIA 5ALUA 5KT3A 4OAGA 3OWGA 3WFQE 4QZEA 4KN7A 4MFAA 1VJ7A 3MGHA 1RPLA 1ED1A 9ICKA 4P0QB 2UVUA 9ICMA 5ALVA 4IRDA 5KFZA 4LEYA 1S0OA 9ICXA 4O67A 4F71A 4EBDA 2GLEA 5DB8A 4MFFA 9ICBA 4DS5A 8ICKA 2IHOA 9ICLA 5J2IA 5ALYA 1JROA 1OW5A 4X5VA 4FBTA 4O3PA 1UA0A 1DOQA 8ICXA 2H5XA 4UB1A 3PZPA 1L3TA 2D3DA 3UM9A 4PHEA 2EZZA 3H3AA 5GTIU 1RYRA 1TFYA 1O08A 4EP7A 4JLXA 4DLGA 3SV4A 2Q0ZX 1KTQA 1GO3F 2I6XA 4GIBA 1UEUA 2BZFA 4FO6A 4CF3A 1NJWA 4FE3A 3V72A 4OD0A 2AHOB 1RM6C 1J2NA 5AM3A 2A1JA 1XSNA 2DVIA 4CF4A 4XRHA 4YQWA 1Z00B 3AN1A 3HKZF 4DCCA 3NASA 2YX8A 4US9A 5DG8A 2B21A 5AKYA 1RXVA 5AI9A 5L1KA 5HR7A 2W9CA 3MCRA 3MDCA 4BGDA 3QNMA 2KHVA 1N56A 2BQUA 3V6KA 3NYBA 2FPMA 4ED2A 2GAFD 1QCKA 2JH1A 3ZD9A 1JX4A 2JEIA 4O3QA 2EZYA 2JMGA 2K4PA 4X4OA 5CFUA 2FJ6A 4QJFB 2KTQA 1B22A 2XCPA 4O9MA 4FO1A 1BPXA 4NV0A 2IOFK 3PX4A 4UQGA 4EEDA 4X4PA 4RNNA 4M47A 2LHTA 4RNOA 4FZMA 3RR7A 3AUOA 2DR9A 1NZBA 4NJ8A 3LDAA 2O5AA 4X4SA 4RWPA 2K4IA 2W3RA 4U6PA 1N63A 5ALZA 2W9MA 4KTQA 1JAJA 5EWGA 2FLNA 3PO5A 1CUKA 2FDRA 4C80A 2EAPA 4X4QA 2BBJA 3QYPA 3MGIA 1ZQDA 4PGQA 1L7OA 2C28A 3TARA 2PFQA 2D6FC 1X2IA 3BS5A 3K1RB 2G06A 2XC9A 3GIJA 2KFZA 4E7XA 1ZYQA 1ZQRA 3N7SC 4ATBA 4Y2SA 5ALDA 1V38A 1L3UA 1UCVA 4ECXA 3QU2A 3ERCC 2I1QA 1T3NA 5IIMA 1Q78A 1ZD5A 3BQTA 4J9NA 2BCUA 2Y9TA 1XWLA 3ER9B 5C0YA 2GA9D 3AQMA 4AT8A 4YMOA 5AIBA 5IIJA 1NK5A 4F5OA 1RYSA 5TZVA 2YMQA 4FZNA 4F4KA 3AMZA 4FHYA 3PSPA 3C29A 4P2HA 3RBDA 5IIOA 3SZ2A 2MA1A 4KLDA 5AM0A 3OUYB 3WK9A 4DSIA 4F5PA 3DDHA 3SEIA 5CHEA 5C5JA 7ICIA 4F3OA 7ICSA 3NRZA 4GXJA 2W03A 8ICTA 4M2YA 5ALLA 2EWRA 4QZIA 2DPIA 3N7PD 9ICPA 5CR0A 4I2EA 2W9AA 2EAOA 2FLPA 3E0FA 5CP2A 1L3VA 4OJ5A 4RQ5A 2IMWP 2PFOA 3QXGA 1SV0C 3EW9A 4M6WB 4YMNA 2BCSA 2BCRA 4IRCA 2E5SA 3NTUA 1SKRA 4MKPA 5F2VO 2KEYA 2AJQA 4EZ9A 5BPCA 5DB9A 5KFOA 2BPGA 1ZQMA 3PW4A 2RLTA 1SWWA 1IG6A 2DKXA 2FMPA 1M6YA 4F92B 1ZQWA 4KLEA 2H3FA 2PFPA 1ZQGA 1KQQA 1YZ7A 5D46A 4XQ7A 2DR7A 1MIWA 3OHAA 4NXXA 3A0HU 4M9LA 4G3IA 3D2SA 1S8OA 1URJA 4WC0A 4E80A 2LM1A 4J03A 4QZBA 1ZQXA 2BR0A 4DOBA 1ZRMA 4I2JA 5A0LA 3HJEA 4NLCA 8ICJA 4X4VA 4R64A 3BS7A 4UW9A 4KX3A 5HRFA 1PK3A 2KSOB 2WF7A 2BPFA 4PL2A 4EEKA 5HMLA 4ED7A 1SKWA 4FHVA 3VC8A 2NRWA 2BE3A 7ICUA 3RB0A 2HHXA 2G07A 4RQ4A 3SD7A 5HREA 4F2SA 2ASLA 4AYBC 3H8JA 9ICFA 2F2AB 3CK6A 4FHPA 1Z1BA 5AK5A 1N61A 4DQSA 4IQTA 4TUQA 3U26A 4RU9A 3PVXA 2NRVA 2JZBA 2YY6A 3QZ8A 2A19A 1IIPA 4QNLA 2F1HA 3T79A 5J8YC 4PL1A 8ICYA 3OV7A 5CA7A 4RQ2A 4PHDA 4IL6U 2Y0SF 5G5GA 7ICKA 4KLGA 2ZIVA 2FMSA 2JH7A 5KFUA 1O03A 4ICAA 1J97A 4O5KA 5J0XA 2OYYA 3OVAA 2MSNA 5DQIA 2KOBA 2W8KA 1LKYA 4O5CA 2ZH5A 4I2GA 4JLZA 3C23A 1KL9A 4K98A 1X6IA 2MUTA 2IBKA 1IM4A 4RQ7A 4NM2A 7ICJA 2OXOA 8ICWA 1U9LA 2OWOA 1HEKA 4KLLA 4F72A 5FP0A 3BZKA 1ZQUA 3UQ2A 3C2MA 2W43A 2HOQA 4PGYA 3ISDA 9ICJA 8ICBA 3Q8SB 4JWNA 1SKSA 4EBCA 2ZUCA 3QU7A 3D2QA 4UB6U 3NVYA 4AP9A 1ZQLA 2HBJA 1ZXIA 2CRXA 4Y2QA 5ALSA 5ALPA 4Y2JA 5HHIA 3RF9A 1Q3UA 1WOTA 3FDSA 4B9SA 3BQ0A 4J9PA 1Z19A 5KFYA 3L3FX 1BPEA 3IV6A 3M8SA 3UPQA 4UASA 2J6UA 2E3TA 4M04A 4EV6A 4NXZA 1ECWA 3TADC 2DRAA 2KV2A 3T5HA 5J2DA 5EWFA 4I0UA 4NXUA 5KFTA 3OVSA 3PW0A 3QUBA 4RQMA 5E79U 3RH6A 1R8CA 4TUSA 5KFPA 4ECUA 2ZG6A 2E8PA 1F5SA 4I2IA 3WFPA 4ED3A 2W54A 3KBBA 2E1FA 3H0RB 3RH5A 2AGOA 1S0MA 5KG0A 2XY7A 4LEZA 5J0TA 3HT3A 4G9BA 4JK1A 1S9FA 3GFKB 1MSWD 3IN5A 2QB1A 1SXEA 2JXJA 4RQ8A 5AKEA 9ICSA 2ZJAA 3QU9A 2BGWA 2G5HB 5ALXA 4AT9B 1HUZA 3AEVA 3SAGA 2QLTA 1NKEA 7ICMA 4DSFA 1COOA 5J2EA 2D8CA 2KIVA 1SIJA 5IIIA 4O3MA 8ICZA 2HOIA 2BQRA 9ICWA 3KHHA 3PW2A 2MRLA 4BXOA 5HR6A 2IOFA 2HHSA 4KLSA 4KLIA 1TVAA 3JZ0A 2M2VA 4UBCA 1ZQSA 5ALHA 3SR6A 5J8YA 4QWCA 4BJQA 5KNIA 4R63A 5F9NA 4O5EA 3VCBA 5HMMA 4UATA 4U7CA 3QEBZ 4K4IA 2ZH1A 5KT4A 4EZ6A 4DSEA 2WF6A 3MABA 4UAVA 4QZCA 4RQ6A 3AL0B 4YD2A 4UB4A 3PW7A 4DSLA 5AKHA 2R8JA 1RZTA 2E8OA 4QWAA 3RFAA 2DGZA 3H8SA 2K8CB 5AKJA 4RWQA 3L9DA 3L5KA 2ZHAA 3ONNA 3UPSA 4QZGA 2XIDA 3AM9A 1QSYA 4WCWA 4O3SA 4QZ9A 2OH2A 2A1JB 4BWMA 3OVBA 2VA8A 3NVWA 4YVZA 1DK3A 2HBMA 3FYHA 2QB0A 3GILA 4M9NA 5DB7A 2QARA 3QZ7A 5KFSA 2Y1JA 4OAIZ 4CGZA 2WB1F 4LZDA 3PMNA 4C8OA 5BOLA 1MC8A 1GPJA 1SZHA 5D4BA 2F1IA 2UVRA 1PZNA 4KN4A 3KOOA 4I2CA 2B56A 2W9CB 7ICGA 3N4MB 3ICXA 3TAQA 3OSPA 4B9NA 2RDJA 4Y2YA 4DL5A 2RHFA 1KRPA 3K1ZA 5KG4A 3HKZC 1S0VA 1VFGA 2K4HA 3WK7A 4DFDA 2DQNB 3RAXA 4DS4A 3I1YA 2W9BB 2ZIXA 4UD4A 2IHMA 4YR3A 2M0NA 4B9TA 4DQPA 4KMOB 3N7RC 2HHUA 2YQEA 3TADA 1K5OA 4C8NA 1L3SA 4F2RA 3THVA 3C2KA 2DF4B 3EZ5A 2J6SA 5J0UA 2M9NA 1Z4OA 4DOCA 5CFTA 2PI4A 3DEEA 2AQ0A 5J2FA 5KFGA 2XY6A 1ZQQA 1ZRNA 4XQ8A 4QZHA 3IHQB 2ZJ5A 5DBAA 1ZD4A 4O68A 3BZCA 1NK7A 1BPZA 4OO1J 5ALMA 3GIMA 3SAHA 1OUQA 4NLGA 3TI0A 1X9XA 3FAHA 5IILA 4ATBB 4KLQA 1Q3VA 3BDPA 4GXKA 4QWEA 3EYZA 4I27A 4DFJA 2DL0A 2JEGA 3BQ1A 3JPPA 2UVVA 5J2KA 5AI8A 8ICVA 3ETLA 3PSTA 3F5EA 1WWVA 5AICA 1TK8A 1SWVA 4ECTA 1MQ2A 4ECQA 4AT8B 4QWDA 1UHUA 1S10A 5J2JA 4GC7A 5ALTA 3SMVA 2IUBA 2HHQA 4WC7A 2E8MA 1D8BA 2PMZF 3ISCA 2RP5A 1U4BA 3M9OB 4FFDA 4IRKA 3H39A 4UB5A 1ZQ1C 7ICTA 1J2MA 3NS1A 3SYZA 4DLEA 2A1AA 2KD1A 5L1JA 4RQ3A 4PGXA 1T8EA 1DRGA 1NKBA 3ED5A 9ICNA 3QE9Y 4I2AA 2ZTEA 3WK5A 2RQ5A 4BUGA 2B0CA 1RYUA 4TQRA 3ZD8A 4QIWC 3IRUA 1LV5A 2HHTA 4F4XA 4DQQA 4IQVA 5AKZA 2LPEA 1JRPA 4QZ8A 2HN2A 7ICLA 3HP6A 1D9DA 1S77D 2ZIUB 2BDUA 2W7OA 2AQ4A 4Z6DA 1OU5A 5HHHA 3B0YA 4EBEA 1N48A 4YR0A 3OHBA 4WC6A 3IG8A 1L7PA 2Y9UA 4J9KA 1BPYA 3HWTA 3RB6A 4ECRA 5AM5A 4KB6A 2Q66A 4Q45A 4KMUA 4DFMA 2NO4A 2ZUBA 1V4AA 5KG7A 2F44A 2JEFA 5KFXA 1QH9A 1TE2A 1V85A 2B6GA 2YMLA 2JEJA 2JRZA 4I28A 5KG1A 1HUOA 3EUB2 2ZH9A 4F8RA 4PHPA 2ASJA 1MIVA 5ALOA 4R8UA 3PHZA 3LVVA 1HIWA 3MR3A 1D8LA 1SV4A 1NK4A 1A0PA 2LYHA 4WBZA 4RWNA 2HBKA 5AM4A 3V6HA 3MFIA 1NOMA 2NRKA 1ZQHA 4QZDA 3WFOA 4JUZA 3TQ1A 8ICMA 2K8AA 1B0XA 4IS7A 3HRDD 7ICRA 3EF2A 4US8A 2NRTA 1SL0A 8ICFA 2B51A 1U45A 3KZXA 3TANA 1KLNA 4I2HA 4FHWA 4IQUA 1ZQYA 4FS1A 3HW8A 4EELA 4IQWA 3M7DA 1WWUA 1PVQA 4CRXA 3CNHA 2CXYA 3SQIA 8ICGA 1DK2A 1NKCA 4K8VA 5J0WA 3KKAC 2V4RA 4NLNA 1Z1VA 2KJ9A 1B4FA 3RRGA 4YN4A 1ZQKA 4EYIB 4ECWA 2V9WA 3C28A 2F1JA 3RH4A 7ICFA 1QSSA 3GV8B 2ZIVB 1KN5A 2ISPA 4DL7A 2KP7A 2VANA 3Q8MA 4RUCA 2F77X 4EX7A 2NRXA 2EZXA 1QQ6A 1F44A 1VDVA 4ED0A 3C18A 2GOLA 2IOHA 1LKYB 5B3PA 1NJZA 2MUTB 3G6XA 1S5LU 5TISU 2KVCA 4Y2UA 2Y0SC 5KAIU 5J2AA 4DO9A 2AU0A 3LWLA 3QU4A 1MQ3A 2PBEA 3C1YA 2E1EA 1ZQNA 3PR4A 3A0BU 4OJLA 3D6JA 3C5FA 4P0PA 1IV8A 3PW5A 4O6AA 2DFLA 1TAQA 5J29A 3MGVA 4ACOA 2KVSA 5AKXA 3GV5B 2HHPA 3DV9A 3K75D 3AQLA 3NKUA 4E8FA 1K1QA 3NWIA 2DR5A 1KW4A 4YR2A 4K97A 1UT5A 5JRTA 4GLXA 2ZH6A 3NVZA 3AQFA 2ID1A 1FEZA 3BQ2A 5GTHU 3ZDEA 3M1YA 4LZGA 3QU5A 2XGQA 3QX7A 1ZQVA 3WU2U 1SL1A 3F53A 1TKDA 4XA5A 2OEHA 2XCAA 3RJEA 4KLOA 8ICIA 8ICCA 1ZD2P 3QEAZ 1NK9A 5KG3A 8ICNA 1UPHA 3PX6A 1KBUA 4PZNA 2ZJ8A 3GV7B 4PH5A 1ZQFA 2HN1A 4P4MA 5HRLA 2VKQA 2HHVA 3MR5A 4K99A 2NYVA 4YFKA 2M2TA 3NVOA 5AI0A 5AK4A 2ATLA 2LYBA 4M6WA 2RDIA 2KFNA 5AI6A 3RTVA 4KLMA 1N60A 2ZTDA 5AI4A 3IDWA 5KT2A 4GXIA 4ELUA 1DXSA 3OPXA 4WQKA 5ALGA 2G09A 4CCHA 4DL4A 1SZPA 2G08A 2H3QA 4KX5A 4I29A 5J2CA 1ZJMA 2EANA 3NUQA 2WHEA 2H3VA 5KFKA 3JPQA 5KFDA 4FZLA 1SGGA 5DBCA 5BOMA 4IR9A 3G6YA 4NXWA 4YMMA 4Q8EA 1SXDA 1JMSA 4DQIA 5DLGA 1N62A 5EE9A 5K4LA 3AQKA 1TAMA 3WK4A 4LVSA 9ICOA 1UEVA 4K4HA 5KT7A 3JPTA 3RB3A 1V9PA 4BXOB 4PHAA 4FHXA 5ALEA 4EBJA 1DGJA 2ZIWA 1V97A 2KE7A 4LJXA 4AYBF 2KKPA 3KKAA 4HX0A 1N5XA 4J9LA 4RPXA 2HVIA 4FH5A 1WCLA 2DUYA 1T94A 3M9NB 2MAXA 3HX0A 5KG6A 2WAQF 4UAZA 5J2GA 3KTQA 5DDMA 2PXIA 1NJYA 1NI3A 3WKEA 1R8BA 1EXNA 4QW9A 1QTMA 2F76X 3J81j 4OAFA 1N5WA 4DSJA 3H37A 4DF4A 5CB1A 4MEYA 2O6KA 1X9MA 4Y2RA 2FLLA 1XO1A 3S6JA 1CEZA 4NKUA 5HC9A 5KFBA 5KFCA 4X0AA 4C7YA 4UB2A 7ICEA 5B66U 1T3QA 1BNOA 4WQLA 4S3NA 4KLFA 3GIIA 1NK0A 1U48A 4JWMA 3TFRA 4E0DA 1ZJNA 3Q8LA 4F50A 2I5HA 3JPNA 3UXPA 4O0IA 2HBLA 1YT3A 3TAPA 2VA2A 2ZH4A 4FBUA 4JB3A 4P4OA 3WKAA 4B6JA 2M2WA 4UAUA 3KD3A 5KAFU 1H38A 1VJ5A 4CE6A 1HJPA 2V4QA 3NGDA 2GWSA 1R8AA 3HIYA 2HCFA 4F4ZA 2AH5A 2KICA 1R89A 4BWJA 4XJEA 4QZFA 1DGSA 3OSNA 2G5IB 3WFRE 4KITB 5AKLA 5AM2A 3QUCA 2LBOA 3EPGA 5DG7A 1UT8A 4Q43A 5IINA 5J0QA 1A6SA 5HRGA 3IP4B 3UXOA 3RJFA 5ALQA 3AU2A 4EENA 4XUSA 4JV1A 1XSLA 2AXTU 2WFAA 2KK0A 4WC5A 1WYGA 5KT6A 3ER8C 2DBYA 1KFSA 2HMXA 2WTFA 7ICQA 3CYMA 4CNQA 2KNJA 4ELVA 4M9GA 2GO7A 4Q44A 1ZQTA 1C20A 4RPZA 3WKDA 4YG2A 1NK8A 3PNCA 1PK1A 4UB3A 1JUDA 1RXWA 3MR2A 1FA0A 4X4NA 2C2DA 4AT7A 5HR9A 4RUAA 4MEXA 1TAUA 4A8EA 5DB6A 3Q8PB 2ZXIA 1X40A 3GU3A 4QZAA 1FFUA 4O69A 2P66A 3PY8A 1TFRA 2BHNA 3ORYA 2JHDA 3RAQA 5KTQA 3RJJA 5DBBA 3T5KA 4UARA 2K4EA 4B9VA 3F2DA 2NO5A 1X66A 3HJ1A 2YTUA 8ICEA 3T5LA 4WH5A 2K8BB 3K7DA 3G6VA 1JIHA 1ZQPA 1Q8KA 3WFSC 9ICAA 3AU6A 3V7JA 3OTQA 3O0FA 3ZDAA 5ALIA 5AKKA 4MHVA 3HJ4A 4F5RA 3IG5A 3PX0A 4AT9A 5KFEA 2PMZC 2FI1A 2DRBA 1Z4NA 7ICHA 5KFJA 2F8LA 5DKWA 4PZOA 3FC4A 3SAFA 2CPRA 2AGQA 2BDPA 4NL9A 1ZQCA 2R18A 3LVWA 1SB3C 9ICEA 2XI9A 4C8KA 1PX5A 3JPOA 4M5DA 3H0MB 2W55A 2XY5A 3H4DA 5DGBA 4USAA 2ES6A 1XS9D 5CWRA 3MBYA 4LEVA 2F8KA 4Z6EA 3BS5B 2BCVA 2CN1A 2VA3A 2YMPA 5ALWA 3TFSA 5J2BA 3RJIA 1XO0A 4OJ6A 5HP4A 2YB1A 5D63A 5D49A 3K4GA 3ZI4A 9ICCA 4WOYA 2LI6A 3I76A 4WC4A 3F2BA 1L8OA 7ICVA 1KNYA 4RQ1A 5L1MA 3F2CA 1L5UA 1ZQAA 1XSPA 4OJOA 3E58A 3SI8A 1FFVA 2FPKA 4M9HA 4DEZA 2RFFA 2KZ3A 1MIYA 3UMGA 4GFJA 2ZH8A 4OCZA 5EOZA 2BBHA 3SV3A 2VIXA 3SENA 4R8UB 4KLTA 1AROP 4J9OA
chains in the Genus database with same CATH topology
8ICGA 3ISBA 4R65A 2PI5A 1DK2A 4KLUA 1U9LA 1NKCA 2OWOA 4IG8A 5J0WA 4KLJA 4KLLA 4YP3A 4I2DA 2P6UA 4F93B 2V4RA 5DG9A 4RT3A 4NLNA 8ICOA 4Q8FA 4ELTA 1ZQUA 1NK6A 4M0AA 1BVSA 3UQ2A 3RRGA 4YN4A 3C2MA 1ZQKA 4EYIB 2KZMA 5HRKA 3M9MB 3Q8QB 4NY8A 1JN3A 4ECWA 2V9WA 1TK5A 7ICNA 4PGYA 2F1JA 3ISDA 3RH4A 3UQ0A 7ICFA 8ICBA 9ICJA 1XU4A 3Q8SB 5KFFA 4JWNA 1SKSA 4EBCA 1U49A 3LWMA 3GV8B 1QSSA 2ISPA 4DL7A 2ZUCA 4DL3A 2KP7A 2VANA 3Q8MA 3GQCA 5DQGA 1D8YA 4RUCA 2XGPA 4DFPA 2ZH7A 5KFWA 2NRXA 1NJXA 4ED0A 3C18A 4UBBA 1ZQLA 4DWIA 4DSKA 1ZQZA 4MFCA 9ICHA 2BQ3A 3BJYA 2HW3A 2C2EA 5L1IA 4WC3A 9ICVA 4YCXA 1NJZA 2MUTB 3G6XA 5DEDA 4RT2A 4C8MA 5HHIA 7ICPA 5J2AA 9ICGA 4DO9A 2AU0A 5KFRA 3RJHA 3LWLA 1Z3EB 2W9BA 3FDSA 2W8LA 3EPIA 4DFKA 4B9SA 1WOTA 4PPXA 1MQ3A 3BQ0A 2PBEA 5DECA 4J9PA 3C1YA 3HPOA 5KG2A 4F5NA 5KFYA 1ZQNA 3PR4A 1BPEA 4TQSA 1TK0A 2DR8A 3UXNA 3M8SA 3C5FA 3UPQA 2Y1IA 3RJKA 4QW8A 3PW5A 2C2RA 8ICSA 3PO4A 2J6UA 2DFLA 4YXJA 4M04A 1TAQA 5F9LA 5J29A 3T3FA 5HRHA 4NXZA 3GV5B 1JXLA 3T5HA 2HHPA 1TV9A 5J2DA 3V6JA 2DRAA 5EWFA 4NLKA 3K75D 3B0XA 3E2EA 4O3OA 3JYYA 3AQLA 2FPLA 4B9MA 1A76A 1K1QA 5KFTA 5KFHA 4E8FA 3OVSA 3PW0A 9ICUA 4RWOA 2DR5A 4YR2A 5JUMA 5KT3A 3RH6A 5J0YA 1UA1A 8ICQA 1UT5A 3WFQE 2ZH6A 4GLXA 1NZPA 4X4TA 4O3NA 4YD1A 4QZEA 1R8CA 4KN7A 4MFAA 4TUSA 5KFPA 2ZH3A 8ICPA 4ECUA 1VJ7A 3MGHA 2ID1A 1RPLA 3BQ2A 5KT5A 4QWBA 4I2IA 8ICHA 9ICKA 2C22A 3WFPA 2UVUA 3ZDEA 4ED3A 3KHLA 9ICMA 4IRDA 4ED1A 5KFZA 8ICLA 4LZGA 3V7KA 1S0OA 2XGQA 3RH5A 1X9WA 9ICXA 2AGOA 1S0MA 5KG0A 1ZQVA 2NRZA 4EBDA 2XY7A 1SL1A 4WBYA 5J0TA 2IHNA 4X4UA 5DB8A 3HT3A 1TKDA 4MFFA 9ICBA 4DS5A 8ICKA 4JK1A 1S9FA 4E0DA 2ZUDA 2BPCA 4XA5A 2XCAA 3RJEA 4KLOA 3GFKB 9ICLA 8ICIA 1MSWD 5J2IA 8ICCA 3JPRA 3QEAZ 4X5VA 1NK9A 4WC1A 1Z00A 3H4BA 4RQ8A 5KG3A 8ICNA 4FBTA 9ICSA 4RPYA 2ZJAA 4O3PA 3PX6A 2BGWA 4J9SA 3C21A 5DDYA 1UA0A 1DOQA 8ICXA 1KFTA 2H5XA 4UB1A 4ECSA 4AT9B 2ZJ8A 1L3TA 3Q8KA 1HUZA 3GV7B 4PH5A 1ZQFA 1NKEA 4PHEA 7ICMA 1UETA 4P4MA 4DSFA 5HRLA 2HHVA 1COOA 2R8IA 3MR5A 3H3AA 5J2EA 5J0SA 1ZQBA 4YFKA 2M2TA 1RYRA 1TFYA 5IIIA 2ISOA 2FMQA 3MR6A 2ATLA 4EP7A 4DLGA 3JPSA 8ICZA 3SV4A 8ICRA 2Q0ZX 2BQRA 9ICWA 3KHHA 3PW2A 4M6WA 2RDIA 1KTQA 2KFNA 3RTVA 1K1SA 4KLMA 2ZTDA 5KT2A 4BXOA 4GXIA 2HHSA 1UEUA 2R8GA 4ELUA 4FO6A 4KLSA 1NJWA 3V72A 4KLIA 1TVAA 4EEYA 1T7PA 3JZ0A 2M2VA 7ICLA 4CCHA 4RZRA 3MDAA 1SZPA 4J9RA 4DL4A 4UBCA 4DOAA 1Q79A 1ZQSA 4I29A 4C8LA 1S76D 2A1JA 1XSNA 5J2CA 1ZJMA 2JZBB 2DVIA 4QWCA 4XRHA 3M8RA 4YQWA 4R63A 5KFKA 5F9NA 5J0OA 1Z00B 3JPQA 4O5EA 3C66A 5KFDA 5DBCA 4IR9A 5HMMA 5BOMA 3G6YA 3QEBZ 4YMMA 4K4IA 4Z6CA 4Q8EA 2ZH1A 1C7YA 5KT4A 5DG8A 4EZ6A 1JMSA 2B21A 3LK9A 4DSEA 4DQIA 5DLGA 2AGPA 3MABA 4QZCA 1RXVA 1ZQOA 1BNPA 3OJUA 1KDHA 4RQ6A 5L1KA 1SL2A 3AQKA 4YD2A 4UB4A 3PW7A 2W9CA 3MDCA 4BGDA 5IIKA 4LVSA 4DSLA 2R8JA 9ICOA 1RZTA 1N56A 1UEVA 2BQUA 4QWAA 4K4HA 4F5QA 4FH3A 1TFWA 5KT7A 3H8SA 3V6KA 3NYBA 3JPTA 2FPMA 4TURA 3RB3A 3ZDBA 4RWQA 1V9PA 3L9DA 4BXOB 4PHAA 1YLQA 4ED2A 2ZHAA 3UPSA 4DQRA 4FHXA 4IR1A 4QZGA 4EBJA 3ZD9A 1QSYA 4EBKA 1JX4A 2JEIA 4WCWA 4O3QA 4O3SA 1ZETA 4X4OA 4QZ9A 1KSPA 2KTQA 2A1JB 4MF8A 4J9LA 4BWMA 4RPXA 2HVIA 1B22A 3OVBA 2VA8A 2XCPA 4O9MA 4YVZA 1BPXA 1DK3A 1WCLA 4FH5A 3FYHA 4X4RA 3PX4A 4X0BA 4UQGA 3GILA 4X4PA 4M9NA 4RNNA 2IA6A 4M47A 3M9NB 3RBEA 2MAXA 3HX0A 5DB7A 5KG6A 3QZ7A 5KFSA 4RNOA 2Y1JA 5EWEA 1KFDA 4UAZA 3AUOA 2ASDA 3RR7A 8ICAA 3LQCB 3H38A 2DR9A 4LZDA 3LDAA 4M9JA 5J2GA 3PMNA 4C8OA 2O5AA 4WC2A 4X4SA 5BOLA 1MC8A 3KTQA 5D4BA 5DDMA 2F1IA 2PXIA 1NJYA 2UVRA 4NLZA 1EXNA 1R8BA 4QW9A 1QTMA 1PZNA 4KN4A 4I2CA 2W9CB 7ICGA 3N4MB 4RQ0A 4DSJA 4I2BA 2W9MA 4KTQA 1JAJA 3TAQA 5EWGA 3H37A 2FLNA 4DF4A 3OSPA 3PO5A 2RDJA 4B9NA 1CUKA 4X4QA 5CB1A 4DL5A 4MEYA 3MGIA 1ZQDA 1KRPA 4PGQA 3RB4A 2C28A 3H8WA 1X9MA 5J0PA 3TARA 5KG4A 4ECYA 2FLLA 2PFQA 1XO1A 1X2IA 1CEZA 5KFQA 5L1LA 1S0VA 4NKUA 1VFGA 5HC9A 5KFBA 2XC9A 3GIJA 2KFZA 4E7XA 1ZYQA 5DLFA 4F4WA 3RAXA 1ZQJA 1ZQRA 4ATBA 3OUYA 9ICTA 5KFCA 4DS4A 4X0AA 4UB2A 4DL2A 2W9BB 1F5AA 4YXMA 4ECVA 1L3UA 4UD4A 7ICEA 2IHMA 1BGXT 4YR3A 4ECXA 4B9TA 1BNOA 4F91B 4S3NA 2DPJA 4KLFA 4DQPA 2XO7A 2I1QA 1T4GA 1T3NA 2BCUA 3GIIA 2HHUA 1NK0A 4BDPA 5IIMA 1Q78A 3BQTA 1U48A 1QSLA 4JWMA 4J9NA 4K4GA 4ZH4A 3TFRA 4C8NA 1WCNA 1XWLA 4P4PA 4FS2A 3Q8LA 1ZJNA 1L3SA 1ZQIA 4F2RA 3AQMA 3THVA 4F50A 3H7IA 3JPNA 4J9MA 4AT8A 3C2KA 3UXPA 3EZ5A 2J6SA 2HVHA 4YMOA 5J0UA 2M9NA 5IIJA 4DOCA 4O0IA 4ED6A 2PI4A 1NK5A 2AQ0A 4F5OA 5J2FA 5KFGA 2XY6A 1ZQQA 3OJSA 3TAPA 4EYHB 1RYSA 5TZVA 4XQ8A 4QZHA 1X9SA 3IHQB 3MFHA 2VA2A 4F4KA 2ZH4A 4FBUA 2ZHBA 4P4OA 2J6TA 4FHYA 2ZJ5A 4P2HA 3RR8A 2M2WA 1H38A 3RBDA 5DBAA 5IIOA 1NK7A 1HJPA 2V4QA 1BPZA 4UAYA 3NGDA 3GIMA 1BPDA 3SZ2A 2GWSA 3TI0A 4NLGA 4KLDA 1R8AA 2R8KA 3HIYA 3PMLA 3RRHA 4UD5A 5IILA 3OUYB 9ICIA 3EWAA 4F4ZA 4ATBB 2ALZA 4DSIA 4KLQA 5KG5A 1R89A 4BWJA 4F5PA 3BDPA 5HRBA 1IXRA 4QZFA 1DGSA 4GXKA 4QWEA 3OSNA 5C5JA 7ICIA 3EYZA 4I27A 3WFRE 4DFJA 4F3OA 4KITB 5HRDA 2JEGA 3BQ1A 7ICSA 1JQRA 3JPPA 4GXJA 3EPGA 2UVVA 5J2KA 5DG7A 1UT8A 8ICTA 3AQNA 8ICVA 3ETLA 1BPBA 4M2YA 3C5GA 4Q43A 4TUPA 5IINA 5J0QA 1TK8A 1MQ2A 3UXOA 4JV2A 4ECTA 5HRGA 4QZIA 4ECQA 2DPIA 4QWDA 3RJFA 4AT8B 1S10A 5J2JA 3AU2A 9ICPA 4XUSA 3H40A 4GC7A 4JV1A 1Y88A 5CR0A 4I2EA 1XSLA 2ZH2A 2W9AA 4RWPA 2FLPA 2HHQA 2UVWA 4WC5A 5CP2A 2R8HA 4WC7A 1L3VA 7ICJA 4RQ5A 5KT6A 3ISCA 4NKTA 1U4BA 3M9OB 4JV0A 4ECZA 1KFSA 4UB5A 2IMWP 2PFOA 2WTFA 4IRKA 7ICQA 3H39A 3PR5B 4Z6FA 4M9GA 4ELVA 3EW9A 7ICTA 4M6WB 4YMNA 5J0RA 3SYZA 2BCSA 2BCRA 4IRCA 4DLEA 3NTUA 4Q44A 1ZQTA 3PV8A 4J9QA 4RPZA 5L1JA 4YG2A 4RQ3A 1SKRA 1NK8A 3PNCA 8ICUA 5F2VO 4PGXA 5J2HA 4EZ9A 2AJQA 4KLHA 5BPCA 1T8EA 4UB3A 7ICOA 1RXWA 3MR2A 5DB9A 1FA0A 1NKBA 9ICNA 3QE9Y 5KFOA 3V7LA 2BPGA 5KFAA 1ZQMA 3PW4A 4I2AA 2ZTEA 1LB2B 4X4NA 2C2DA 4AT7A 5HR9A 4B9LA 1B43A 1KEJA 4RUAA 4TQRA 1S97A 2KZZA 3ZD8A 4MEXA 1QLNA 1JXEA 1TAUA 1LV5A 2HHTA 4F4XA 4DQQA 2FMPA 5KFLA 5DB6A 3Q8PB 4F92B 1ZQWA 4IQVA 4QZAA 4GC6A 4KLEA 4QZ8A 1NO5A 2P66A 2PFPA 1ZQGA 3PY8A 1TFRA 2BHNA 3ORYA 3HP6A 3T5JA 5DGAA 3RAQA 1D9DA 5KFNA 1S77D 5D46A 5KTQA 4XQ7A 3RJJA 2AQ4A 5DBBA 3T5KA 4Z6DA 5KFMA 1OU5A 2DR7A 5HHHA 4B9VA 1D9FA 3OHAA 1MIWA 3B0YA 4M9LA 4EBEA 1N48A 2M2UA 4YR0A 4G3IA 3ZDCA 3OHBA 9ICRA 8ICEA 3T5LA 3HJ1A 4WC6A 4WC0A 3G6VA 4E80A 4J9KA 9ICQA 1JIHA 1BPYA 3HWTA 4QZBA 1ZQXA 2BR0A 4DOBA 1ZQPA 5HRIA 3WFSC 9ICAA 5L9XA 4I2JA 3AU6A 3V7JA 3RB6A 8ICJA 4X4VA 5KFIA 4R64A 4ECRA 5HNKA 2KN7A 3ZDAA 5HRFA 2Q66A 3C2LA 4Q45A 4KMUA 2BPFA 4MF2A 3HJ4A 4F5RA 4DFMA 4AT7B 4I2FA 2ZUBA 3PX0A 1V4AA 2O1PA 5HMLA 5KFEA 4AT9A 4ED7A 1SKWA 2DRBA 7ICHA 3N97B 5KFJA 2P6RA 5DKWA 4NM1A 4FHVA 2AGQA 2NRWA 2BDPA 5KFVA 5KG7A 3ZDDA 1ZQCA 2BE3A 2JEFA 5KFXA 2HHWA 5CJ7A 3RB0A 2BKEA 2HHXA 7ICUA 4RQ4A 9ICEA 2JEJA 4C8KA 1PX5A 5HREA 3JPOA 4I28A 4R66A 4F2SA 5KG1A 1HUOA 2ASLA 4M5DA 2XY5A 3IM1A 4DL6A 3H8JA 9ICFA 2ZH9A 4UAWA 3H4DA 5DGBA 4PHPA 2ASJA 4F8RA 1XS9D 4FHPA 1MIVA 4LT6A 5CWRA 3MBYA 4O3RA 3GIKA 4DQSA 3RJGA 4R8UA 4IQTA 4TUQA 4HYKA 4RU9A 3PVXA 2I9GA 4F4YA 2NRVA 1D8LA 2JZBA 4Z6EA 3MR3A 1NK4A 2BCVA 2VA3A 5CHGA 4B9UA 2LYHA 3QZ8A 4ED8A 4WBZA 4RWNA 2F1HA 1ZQEA 3TFSA 2PFNA 5J2BA 3V6HA 3RJIA 8ICYA 3OV7A 3MFIA 5HP4A 5CA7A 4RQ2A 1NOMA 4PHDA 5D49A 3GDXA 3KHRA 3K4GA 1XC9A 2NRKA 3Q8RB 1ZQHA 5DQHA 4QZDA 4RNMA 3C1ZA 7ICKA 4JUZA 9ICCA 3WFOA 3TQ1A 4KLGA 1A77A 4WC4A 3OGUA 7ICVA 1KNYA 4RQ1A 8ICMA 7ICRA 1L5UA 1ZQAA 1XSPA 2FMSA 3SI8A 1U47A 4M9HA 2FPKA 5KFUA 2NRTA 1SL0A 4O5KA 4DEZA 5J0XA 8ICFA 2RFFA 3OVAA 2KZ3A 5DQIA 1MIYA 1U45A 2ZH8A 2ZTCA 2BCQA 5EOZA 2W8KA 3TANA 4O5CA 1KLNA 3SV3A 4I2HA 4I2GA 1S0NA 4FHWA 4IQUA 2ZH5A 3C23A 1ZQYA 4FS1A 4DF8A 3HW8A 4IQWA 2MUTA 4R8UB 1IM4A 2IBKA 4RQ7A 4KLTA 3KHGA 1AROP 4NM2A 4J9OA 8ICWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8ICG A;  3ISB A;  4R65 A;  2PI5 A;  1DK2 A;  4KLU A;  1U9L A;  1NKC A;  2OWO A;  4IG8 A;  5J0W A;  4KLJ A;  4KLL A;  4YP3 A;  4I2D A;  2P6U A;  4F93 B;  2V4R A;  5DG9 A;  4RT3 A;  4NLN A;  8ICO A;  4Q8F A;  4ELT A;  1ZQU A;  1NK6 A;  4M0A A;  1BVS A;  3UQ2 A;  3RRG A;  4YN4 A;  3C2M A;  1ZQK A;  4EYI B;  2KZM A;  5HRK A;  3M9M B;  3Q8Q B;  4NY8 A;  1JN3 A;  4ECW A;  2V9W A;  1TK5 A;  7ICN A;  4PGY A;  2F1J A;  3ISD A;  3RH4 A;  3UQ0 A;  7ICF A;  8ICB A;  9ICJ A;  1XU4 A;  3Q8S B;  5KFF A;  4JWN A;  1SKS A;  4EBC A;  1U49 A;  3LWM A;  3GV8 B;  1QSS A;  2ISP A;  4DL7 A;  2ZUC A;  4DL3 A;  2KP7 A;  2VAN A;  3Q8M A;  3GQC A;  5DQG A;  1D8Y A;  4RUC A;  2XGP A;  4DFP A;  2ZH7 A;  5KFW A;  2NRX A;  1NJX A;  4ED0 A;  3C18 A;  4UBB A;  1ZQL A;  4DWI A;  4DSK A;  1ZQZ A;  4MFC A;  9ICH A;  2BQ3 A;  3BJY A;  2HW3 A;  2C2E A;  5L1I A;  4WC3 A;  9ICV A;  4YCX A;  1NJZ A;  2MUT B;  3G6X A;  5DED A;  4RT2 A;  4C8M A;  5HHI A;  7ICP A;  5J2A A;  9ICG A;  4DO9 A;  2AU0 A;  5KFR A;  3RJH A;  3LWL A;  1Z3E B;  2W9B A;  3FDS A;  2W8L A;  3EPI A;  4DFK A;  4B9S A;  1WOT A;  4PPX A;  1MQ3 A;  3BQ0 A;  2PBE A;  5DEC A;  4J9P A;  3C1Y A;  3HPO A;  5KG2 A;  4F5N A;  5KFY A;  1ZQN A;  3PR4 A;  1BPE A;  4TQS A;  1TK0 A;  2DR8 A;  3UXN A;  3M8S A;  3C5F A;  3UPQ A;  2Y1I A;  3RJK A;  4QW8 A;  3PW5 A;  2C2R A;  8ICS A;  3PO4 A;  2J6U A;  2DFL A;  4YXJ A;  4M04 A;  1TAQ A;  5F9L A;  5J29 A;  3T3F A;  5HRH A;  4NXZ A;  3GV5 B;  1JXL A;  3T5H A;  2HHP A;  1TV9 A;  5J2D A;  3V6J A;  2DRA A;  5EWF A;  4NLK A;  3K75 D;  3B0X A;  3E2E A;  4O3O A;  3JYY A;  3AQL A;  2FPL A;  4B9M A;  1A76 A;  1K1Q A;  5KFT A;  5KFH A;  4E8F A;  3OVS A;  3PW0 A;  9ICU A;  4RWO A;  2DR5 A;  4YR2 A;  5JUM A;  5KT3 A;  3RH6 A;  5J0Y A;  1UA1 A;  8ICQ A;  1UT5 A;  3WFQ E;  2ZH6 A;  4GLX A;  1NZP A;  4X4T A;  4O3N A;  4YD1 A;  4QZE A;  1R8C A;  4KN7 A;  4MFA A;  4TUS A;  5KFP A;  2ZH3 A;  8ICP A;  4ECU A;  1VJ7 A;  3MGH A;  2ID1 A;  1RPL A;  3BQ2 A;  5KT5 A;  4QWB A;  4I2I A;  8ICH A;  9ICK A;  2C22 A;  3WFP A;  2UVU A;  3ZDE A;  4ED3 A;  3KHL A;  9ICM A;  4IRD A;  4ED1 A;  5KFZ A;  8ICL A;  4LZG A;  3V7K A;  1S0O A;  2XGQ A;  3RH5 A;  1X9W A;  9ICX A;  2AGO A;  1S0M A;  5KG0 A;  1ZQV A;  2NRZ A;  4EBD A;  2XY7 A;  1SL1 A;  4WBY A;  5J0T A;  2IHN A;  4X4U A;  5DB8 A;  3HT3 A;  1TKD A;  4MFF A;  9ICB A;  4DS5 A;  8ICK A;  4JK1 A;  1S9F A;  4E0D A;  2ZUD A;  2BPC A;  4XA5 A;  2XCA A;  3RJE A;  4KLO A;  3GFK B;  9ICL A;  8ICI A;  1MSW D;  5J2I A;  8ICC A;  3JPR A;  3QEA Z;  4X5V A;  1NK9 A;  4WC1 A;  1Z00 A;  3H4B A;  4RQ8 A;  5KG3 A;  8ICN A;  4FBT A;  9ICS A;  4RPY A;  2ZJA A;  4O3P A;  3PX6 A;  2BGW A;  4J9S A;  3C21 A;  5DDY A;  1UA0 A;  1DOQ A;  8ICX A;  1KFT A;  2H5X A;  4UB1 A;  4ECS A;  4AT9 B;  2ZJ8 A;  1L3T A;  3Q8K A;  1HUZ A;  3GV7 B;  4PH5 A;  1ZQF A;  1NKE A;  4PHE A;  7ICM A;  1UET A;  4P4M A;  4DSF A;  5HRL A;  2HHV A;  1COO A;  2R8I A;  3MR5 A;  3H3A A;  5J2E A;  5J0S A;  1ZQB A;  4YFK A;  2M2T A;  1RYR A;  1TFY A;  5III A;  2ISO A;  2FMQ A;  3MR6 A;  2ATL A;  4EP7 A;  4DLG A;  3JPS A;  8ICZ A;  3SV4 A;  8ICR A;  2Q0Z X;  2BQR A;  9ICW A;  3KHH A;  3PW2 A;  4M6W A;  2RDI A;  1KTQ A;  2KFN A;  3RTV A;  1K1S A;  4KLM A;  2ZTD A;  5KT2 A;  4BXO A;  4GXI A;  2HHS A;  1UEU A;  2R8G A;  4ELU A;  4FO6 A;  4KLS A;  1NJW A;  3V72 A;  4KLI A;  1TVA A;  4EEY A;  1T7P A;  3JZ0 A;  2M2V A;  7ICL A;  4CCH A;  4RZR A;  3MDA A;  1SZP A;  4J9R A;  4DL4 A;  4UBC A;  4DOA A;  1Q79 A;  1ZQS A;  4I29 A;  4C8L A;  1S76 D;  2A1J A;  1XSN A;  5J2C A;  1ZJM A;  2JZB B;  2DVI A;  4QWC A;  4XRH A;  3M8R A;  4YQW A;  4R63 A;  5KFK A;  5F9N A;  5J0O A;  1Z00 B;  3JPQ A;  4O5E A;  3C66 A;  5KFD A;  5DBC A;  4IR9 A;  5HMM A;  5BOM A;  3G6Y A;  3QEB Z;  4YMM A;  4K4I A;  4Z6C A;  4Q8E A;  2ZH1 A;  1C7Y A;  5KT4 A;  5DG8 A;  4EZ6 A;  1JMS A;  2B21 A;  3LK9 A;  4DSE A;  4DQI A;  5DLG A;  2AGP A;  3MAB A;  4QZC A;  1RXV A;  1ZQO A;  1BNP A;  3OJU A;  1KDH A;  4RQ6 A;  5L1K A;  1SL2 A;  3AQK A;  4YD2 A;  4UB4 A;  3PW7 A;  2W9C A;  3MDC A;  4BGD A;  5IIK A;  4LVS A;  4DSL A;  2R8J A;  9ICO A;  1RZT A;  1N56 A;  1UEV A;  2BQU A;  4QWA A;  4K4H A;  4F5Q A;  4FH3 A;  1TFW A;  5KT7 A;  3H8S A;  3V6K A;  3NYB A;  3JPT A;  2FPM A;  4TUR A;  3RB3 A;  3ZDB A;  4RWQ A;  1V9P A;  3L9D A;  4BXO B;  4PHA A;  1YLQ A;  4ED2 A;  2ZHA A;  3UPS A;  4DQR A;  4FHX A;  4IR1 A;  4QZG A;  4EBJ A;  3ZD9 A;  1QSY A;  4EBK A;  1JX4 A;  2JEI A;  4WCW A;  4O3Q A;  4O3S A;  1ZET A;  4X4O A;  4QZ9 A;  1KSP A;  2KTQ A;  2A1J B;  4MF8 A;  4J9L A;  4BWM A;  4RPX A;  2HVI A;  1B22 A;  3OVB A;  2VA8 A;  2XCP A;  4O9M A;  4YVZ A;  1BPX A;  1DK3 A;  1WCL A;  4FH5 A;  3FYH A;  4X4R A;  3PX4 A;  4X0B A;  4UQG A;  3GIL A;  4X4P A;  4M9N A;  4RNN A;  2IA6 A;  4M47 A;  3M9N B;  3RBE A;  2MAX A;  3HX0 A;  5DB7 A;  5KG6 A;  3QZ7 A;  5KFS A;  4RNO A;  2Y1J A;  5EWE A;  1KFD A;  4UAZ A;  3AUO A;  2ASD A;  3RR7 A;  8ICA A;  3LQC B;  3H38 A;  2DR9 A;  4LZD A;  3LDA A;  4M9J A;  5J2G A;  3PMN A;  4C8O A;  2O5A A;  4WC2 A;  4X4S A;  5BOL A;  1MC8 A;  3KTQ A;  5D4B A;  5DDM A;  2F1I A;  2PXI A;  1NJY A;  2UVR A;  4NLZ A;  1EXN A;  1R8B A;  4QW9 A;  1QTM A;  1PZN A;  4KN4 A;  4I2C A;  2W9C B;  7ICG A;  3N4M B;  4RQ0 A;  4DSJ A;  4I2B A;  2W9M A;  4KTQ A;  1JAJ A;  3TAQ A;  5EWG A;  3H37 A;  2FLN A;  4DF4 A;  3OSP A;  3PO5 A;  2RDJ A;  4B9N A;  1CUK A;  4X4Q A;  5CB1 A;  4DL5 A;  4MEY A;  3MGI A;  1ZQD A;  1KRP A;  4PGQ A;  3RB4 A;  2C28 A;  3H8W A;  1X9M A;  5J0P A;  3TAR A;  5KG4 A;  4ECY A;  2FLL A;  2PFQ A;  1XO1 A;  1X2I A;  1CEZ A;  5KFQ A;  5L1L A;  1S0V A;  4NKU A;  1VFG A;  5HC9 A;  5KFB A;  2XC9 A;  3GIJ A;  2KFZ A;  4E7X A;  1ZYQ A;  5DLF A;  4F4W A;  3RAX A;  1ZQJ A;  1ZQR A;  4ATB A;  3OUY A;  9ICT A;  5KFC A;  4DS4 A;  4X0A A;  4UB2 A;  4DL2 A;  2W9B B;  1F5A A;  4YXM A;  4ECV A;  1L3U A;  4UD4 A;  7ICE A;  2IHM A;  1BGX T;  4YR3 A;  4ECX A;  4B9T A;  1BNO A;  4F91 B;  4S3N A;  2DPJ A;  4KLF A;  4DQP A;  2XO7 A;  2I1Q A;  1T4G A;  1T3N A;  2BCU A;  3GII A;  2HHU A;  1NK0 A;  4BDP A;  5IIM A;  1Q78 A;  3BQT A;  1U48 A;  1QSL A;  4JWM A;  4J9N A;  4K4G A;  4ZH4 A;  3TFR A;  4C8N A;  1WCN A;  1XWL A;  4P4P A;  4FS2 A;  3Q8L A;  1ZJN A;  1L3S A;  1ZQI A;  4F2R A;  3AQM A;  3THV A;  4F50 A;  3H7I A;  3JPN A;  4J9M A;  4AT8 A;  3C2K A;  3UXP A;  3EZ5 A;  2J6S A;  2HVH A;  4YMO A;  5J0U A;  2M9N A;  5IIJ A;  4DOC A;  4O0I A;  4ED6 A;  2PI4 A;  1NK5 A;  2AQ0 A;  4F5O A;  5J2F A;  5KFG A;  2XY6 A;  1ZQQ A;  3OJS A;  3TAP A;  4EYH B;  1RYS A;  5TZV A;  4XQ8 A;  4QZH A;  1X9S A;  3IHQ B;  3MFH A;  2VA2 A;  4F4K A;  2ZH4 A;  4FBU A;  2ZHB A;  4P4O A;  2J6T A;  4FHY A;  2ZJ5 A;  4P2H A;  3RR8 A;  2M2W A;  1H38 A;  3RBD A;  5DBA A;  5IIO A;  1NK7 A;  1HJP A;  2V4Q A;  1BPZ A;  4UAY A;  3NGD A;  3GIM A;  1BPD A;  3SZ2 A;  2GWS A;  3TI0 A;  4NLG A;  4KLD A;  1R8A A;  2R8K A;  3HIY A;  3PML A;  3RRH A;  4UD5 A;  5IIL A;  3OUY B;  9ICI A;  3EWA A;  4F4Z A;  4ATB B;  2ALZ A;  4DSI A;  4KLQ A;  5KG5 A;  1R89 A;  4BWJ A;  4F5P A;  3BDP A;  5HRB A;  1IXR A;  4QZF A;  1DGS A;  4GXK A;  4QWE A;  3OSN A;  5C5J A;  7ICI A;  3EYZ A;  4I27 A;  3WFR E;  4DFJ A;  4F3O A;  4KIT B;  5HRD A;  2JEG A;  3BQ1 A;  7ICS A;  1JQR A;  3JPP A;  4GXJ A;  3EPG A;  2UVV A;  5J2K A;  5DG7 A;  1UT8 A;  8ICT A;  3AQN A;  8ICV A;  3ETL A;  1BPB A;  4M2Y A;  3C5G A;  4Q43 A;  4TUP A;  5IIN A;  5J0Q A;  1TK8 A;  1MQ2 A;  3UXO A;  4JV2 A;  4ECT A;  5HRG A;  4QZI A;  4ECQ A;  2DPI A;  4QWD A;  3RJF A;  4AT8 B;  1S10 A;  5J2J A;  3AU2 A;  9ICP A;  4XUS A;  3H40 A;  4GC7 A;  4JV1 A;  1Y88 A;  5CR0 A;  4I2E A;  1XSL A;  2ZH2 A;  2W9A A;  4RWP A;  2FLP A;  2HHQ A;  2UVW A;  4WC5 A;  5CP2 A;  2R8H A;  4WC7 A;  1L3V A;  7ICJ A;  4RQ5 A;  5KT6 A;  3ISC A;  4NKT A;  1U4B A;  3M9O B;  4JV0 A;  4ECZ A;  1KFS A;  4UB5 A;  2IMW P;  2PFO A;  2WTF A;  4IRK A;  7ICQ A;  3H39 A;  3PR5 B;  4Z6F A;  4M9G A;  4ELV A;  3EW9 A;  7ICT A;  4M6W B;  4YMN A;  5J0R A;  3SYZ A;  2BCS A;  2BCR A;  4IRC A;  4DLE A;  3NTU A;  4Q44 A;  1ZQT A;  3PV8 A;  4J9Q A;  4RPZ A;  5L1J A;  4YG2 A;  4RQ3 A;  1SKR A;  1NK8 A;  3PNC A;  8ICU A;  5F2V O;  4PGX A;  5J2H A;  4EZ9 A;  2AJQ A;  4KLH A;  5BPC A;  1T8E A;  4UB3 A;  7ICO A;  1RXW A;  3MR2 A;  5DB9 A;  1FA0 A;  1NKB A;  9ICN A;  3QE9 Y;  5KFO A;  3V7L A;  2BPG A;  5KFA A;  1ZQM A;  3PW4 A;  4I2A A;  2ZTE A;  1LB2 B;  4X4N A;  2C2D A;  4AT7 A;  5HR9 A;  4B9L A;  1B43 A;  1KEJ A;  4RUA A;  4TQR A;  1S97 A;  2KZZ A;  3ZD8 A;  4MEX A;  1QLN A;  1JXE A;  1TAU A;  1LV5 A;  2HHT A;  4F4X A;  4DQQ A;  2FMP A;  5KFL A;  5DB6 A;  3Q8P B;  4F92 B;  1ZQW A;  4IQV A;  4QZA A;  4GC6 A;  4KLE A;  4QZ8 A;  1NO5 A;  2P66 A;  2PFP A;  1ZQG A;  3PY8 A;  1TFR A;  2BHN A;  3ORY A;  3HP6 A;  3T5J A;  5DGA A;  3RAQ A;  1D9D A;  5KFN A;  1S77 D;  5D46 A;  5KTQ A;  4XQ7 A;  3RJJ A;  2AQ4 A;  5DBB A;  3T5K A;  4Z6D A;  5KFM A;  1OU5 A;  2DR7 A;  5HHH A;  4B9V A;  1D9F A;  3OHA A;  1MIW A;  3B0Y A;  4M9L A;  4EBE A;  1N48 A;  2M2U A;  4YR0 A;  4G3I A;  3ZDC A;  3OHB A;  9ICR A;  8ICE A;  3T5L A;  3HJ1 A;  4WC6 A;  4WC0 A;  3G6V A;  4E80 A;  4J9K A;  9ICQ A;  1JIH A;  1BPY A;  3HWT A;  4QZB A;  1ZQX A;  2BR0 A;  4DOB A;  1ZQP A;  5HRI A;  3WFS C;  9ICA A;  5L9X A;  4I2J A;  3AU6 A;  3V7J A;  3RB6 A;  8ICJ A;  4X4V A;  5KFI A;  4R64 A;  4ECR A;  5HNK A;  2KN7 A;  3ZDA A;  5HRF A;  2Q66 A;  3C2L A;  4Q45 A;  4KMU A;  2BPF A;  4MF2 A;  3HJ4 A;  4F5R A;  4DFM A;  4AT7 B;  4I2F A;  2ZUB A;  3PX0 A;  1V4A A;  2O1P A;  5HML A;  5KFE A;  4AT9 A;  4ED7 A;  1SKW A;  2DRB A;  7ICH A;  3N97 B;  5KFJ A;  2P6R A;  5DKW A;  4NM1 A;  4FHV A;  2AGQ A;  2NRW A;  2BDP A;  5KFV A;  5KG7 A;  3ZDD A;  1ZQC A;  2BE3 A;  2JEF A;  5KFX A;  2HHW A;  5CJ7 A;  3RB0 A;  2BKE A;  2HHX A;  7ICU A;  4RQ4 A;  9ICE A;  2JEJ A;  4C8K A;  1PX5 A;  5HRE A;  3JPO A;  4I28 A;  4R66 A;  4F2S A;  5KG1 A;  1HUO A;  2ASL A;  4M5D A;  2XY5 A;  3IM1 A;  4DL6 A;  3H8J A;  9ICF A;  2ZH9 A;  4UAW A;  3H4D A;  5DGB A;  4PHP A;  2ASJ A;  4F8R A;  1XS9 D;  4FHP A;  1MIV A;  4LT6 A;  5CWR A;  3MBY A;  4O3R A;  3GIK A;  4DQS A;  3RJG A;  4R8U A;  4IQT A;  4TUQ A;  4HYK A;  4RU9 A;  3PVX A;  2I9G A;  4F4Y A;  2NRV A;  1D8L A;  2JZB A;  4Z6E A;  3MR3 A;  1NK4 A;  2BCV A;  2VA3 A;  5CHG A;  4B9U A;  2LYH A;  3QZ8 A;  4ED8 A;  4WBZ A;  4RWN A;  2F1H A;  1ZQE A;  3TFS A;  2PFN A;  5J2B A;  3V6H A;  3RJI A;  8ICY A;  3OV7 A;  3MFI A;  5HP4 A;  5CA7 A;  4RQ2 A;  1NOM A;  4PHD A;  5D49 A;  3GDX A;  3KHR A;  3K4G A;  1XC9 A;  2NRK A;  3Q8R B;  1ZQH A;  5DQH A;  4QZD A;  4RNM A;  3C1Z A;  7ICK A;  4JUZ A;  9ICC A;  3WFO A;  3TQ1 A;  4KLG A;  1A77 A;  4WC4 A;  3OGU A;  7ICV A;  1KNY A;  4RQ1 A;  8ICM A;  7ICR A;  1L5U A;  1ZQA A;  1XSP A;  2FMS A;  3SI8 A;  1U47 A;  4M9H A;  2FPK A;  5KFU A;  2NRT A;  1SL0 A;  4O5K A;  4DEZ A;  5J0X A;  8ICF A;  2RFF A;  3OVA A;  2KZ3 A;  5DQI A;  1MIY A;  1U45 A;  2ZH8 A;  2ZTC A;  2BCQ A;  5EOZ A;  2W8K A;  3TAN A;  4O5C A;  1KLN A;  3SV3 A;  4I2H A;  4I2G A;  1S0N A;  4FHW A;  4IQU A;  2ZH5 A;  3C23 A;  1ZQY A;  4FS1 A;  4DF8 A;  3HW8 A;  4IQW A;  2MUT A;  4R8U B;  1IM4 A;  2IBK A;  4RQ7 A;  4KLT A;  3KHG A;  1ARO P;  4NM2 A;  4J9O A;  8ICW A; 
#chains in the Genus database with same CATH topology
 4NLB A;  3TAC B;  2FCL A;  4IG8 A;  4I2D A;  5DG9 A;  4ZOH C;  8ICO A;  4Q8F A;  4ELT A;  1NK6 A;  4M0A A;  1BVS A;  5HRK A;  3Q8Q B;  1TK5 A;  1FO4 A;  2ESE A;  1COK A;  5D62 A;  5CFS A;  1U49 A;  3LWM A;  1X6J A;  4NWI A;  4DL3 A;  1D8Y A;  1RQL A;  2XGP A;  2ZH7 A;  5KFW A;  2XVT A;  4UBB A;  4DWI A;  4MFC A;  2BQ3 A;  2LKY A;  2HW3 A;  2C2E A;  5L1I A;  9ICV A;  4C4S A;  5DED A;  4P0Q A;  4RT2 A;  2VJ5 A;  1ZD3 A;  7ICP A;  2GH1 A;  5KFR A;  3RJH A;  2W8L A;  4EBK A;  2W9B A;  3EPI A;  4DFK A;  5DEC A;  4N7R A;  5KL1 B;  3L4P A;  5KG2 A;  1JI7 A;  4F5N A;  3N28 A;  4TQS A;  2KJ8 A;  3UXN A;  2Y1I A;  2C2R A;  8ICS A;  4CDG A;  4YXJ A;  4OJP A;  3T3F A;  5HRH A;  3WK6 A;  3ETR A;  1JXL A;  1TV9 A;  3E2E A;  3B0X A;  5JTI A;  3JYY A;  4B9M A;  5KFH A;  9ICU A;  5JUM A;  1UA1 A;  3TKA A;  5J0Y A;  8ICQ A;  2LYA A;  1NZP A;  4X4T A;  4O3N A;  4YD1 A;  2KJ5 A;  2ZH3 A;  8ICP A;  5F3X B;  1L7N A;  2H3Z A;  5KT5 A;  4QWB A;  8ICH A;  2C22 A;  3KHL A;  4ED1 A;  2NV3 A;  8ICL A;  3V7K A;  1X9W A;  2NRZ A;  1F0M A;  4WBY A;  2IHN A;  4X4U A;  2LMR A;  2F3N A;  2ZUD A;  2BPC A;  4C7Z A;  4P0P B;  3JPR A;  1NNL A;  4WC1 A;  1Z00 A;  3H4B A;  4RPY A;  4J9S A;  3C21 A;  5DDY A;  1KFT A;  4ECS A;  3Q8K A;  1UET A;  2R8I A;  5AK6 A;  1P7D A;  5J0S A;  2K60 A;  1ZQB A;  4QIW F;  2ISO A;  2FMQ A;  3MR6 A;  1JAL A;  3JPS A;  8ICR A;  4C4R A;  1K1S A;  4OAH A;  3PSF A;  2R8G A;  4C4T A;  1T7P A;  4EEY A;  1YZ6 A;  4RZR A;  3MDA A;  4J9R A;  1Q79 A;  4DOA A;  2PKE A;  4C8L A;  1S76 D;  3BQ7 A;  2W7P A;  2JZB B;  3M8R A;  5J0O A;  3C66 A;  2KMD A;  1KKX A;  4Z6C A;  1C7Y A;  5ALK A;  3LK9 A;  4IC9 A;  2AGP A;  2KHQ A;  1BNP A;  1ZQO A;  3OJU A;  1KDH A;  1SL2 A;  2H3I A;  2ZIU A;  2W11 A;  2EDU A;  3AQE A;  5IIK A;  4FH3 A;  4F5Q A;  1TFW A;  1N2X A;  4TUR A;  1XNS A;  3ZDB A;  2OM6 A;  1YLQ A;  4DQR A;  2EAM A;  4IR1 A;  1CRX A;  5ALN A;  1ZET A;  1KSP A;  1PUZ A;  4MF8 A;  2HDO A;  3KFU F;  4X4R A;  4X0B A;  2IA6 A;  3RBE A;  5CEH A;  2ASD A;  5EWE A;  1KFD A;  8ICA A;  3LQC B;  3H38 A;  3WK8 A;  4M9J A;  3CRX A;  4WC2 A;  2HI0 A;  2WF9 A;  5KL8 B;  4NLZ A;  2RRD A;  2W3S A;  2KKV A;  1CI4 A;  4RQ0 A;  4I2B A;  2DKZ A;  3CP8 A;  3RB4 A;  1OXJ A;  3H8W A;  5J0P A;  2ZIW B;  4ECY A;  2KIW A;  2WF8 A;  5D61 A;  5KFQ A;  5L1L A;  2YB4 A;  3HIL A;  5DLF A;  2B4V A;  4F4W A;  1ZQJ A;  3OUY A;  2E8N A;  9ICT A;  2P35 A;  1QQ7 A;  4DL2 A;  1F5A A;  4YXM A;  4ECV A;  1BGX T;  2QKQ A;  4Y2T A;  4F91 B;  2DPJ A;  2XO7 A;  1T4G A;  4BDP A;  2XIC A;  3KZI U;  2WF5 A;  1QSL A;  4K4G A;  4ZH4 A;  1ZQI A;  1WCN A;  4P4P A;  4FS2 A;  5B5E U;  2KG5 A;  3H7I A;  4J9M A;  2HVH A;  4NXV A;  4ED6 A;  3OJS A;  1Q46 A;  4EYH B;  1X9S A;  1RQN A;  3MFH A;  2ZHB A;  2J6T A;  3RR8 A;  2WAQ C;  1RDF A;  4UAY A;  1BPD A;  3UMC A;  3I28 A;  2R8K A;  4UD5 A;  3PML A;  3RRH A;  5H2F U;  1MA7 A;  9ICI A;  3EWA A;  2ALZ A;  1L7M A;  5KG5 A;  5HRB A;  1IXR A;  2Z7J A;  5EE1 A;  4Y2P A;  1LVH A;  1QQ5 A;  1JQR A;  3PSI A;  5HRD A;  4PJ0 U;  3AQN A;  1BPB A;  3C5G A;  4TUP A;  2MU2 A;  2W04 A;  4JV2 A;  3QUQ A;  3UMB A;  3H40 A;  5G5H A;  1Y88 A;  2ZH2 A;  4K9B A;  2UVW A;  2R8H A;  5ALR A;  3M6Z A;  3NRW A;  4NKT A;  4ECZ A;  4JV0 A;  3PR5 B;  4Y2V A;  4Z6F A;  2VJ4 A;  5J0R A;  3D2N A;  1AQ6 A;  1MN8 A;  3PV8 A;  4J9Q A;  4K96 A;  8ICU A;  5J2H A;  4KLH A;  2OHF A;  7ICO A;  3V7L A;  5KFA A;  2KSO A;  1LB2 B;  2K89 A;  3WKB A;  4B9L A;  1B43 A;  1KEJ A;  3MC1 A;  1S97 A;  2KZZ A;  1QLN A;  1JXE A;  5ALF A;  5KFL A;  2HSZ A;  4GC6 A;  1NO5 A;  5AHX A;  3T5J A;  5DGA A;  4NL9 C;  5KFN A;  1SV0 A;  1PVP A;  4BX9 C;  5KFM A;  1D9F A;  2M2U A;  2EQY A;  3ZDC A;  1WUD A;  9ICR A;  3LYS A;  5EE0 A;  2ODG A;  5CRX A;  4C0Z A;  5ALJ A;  9ICQ A;  1PK1 B;  5HRI A;  5AKG A;  5L9X A;  5KFI A;  5HNK A;  2KN7 A;  3C2L A;  5AM1 A;  4MF2 A;  3F5A A;  1FIQ A;  3CW2 C;  4AT7 B;  2OCE A;  4I2F A;  2QB0 B;  2O1P A;  1WG8 A;  2QAR B;  3N97 B;  4NM1 A;  2P6R A;  2N1R A;  1RG6 A;  3ZDD A;  5KFV A;  5AK3 A;  4RQN A;  2HHW A;  5CJ7 A;  2BKE A;  5EE3 A;  1VLB A;  4K9A A;  4R66 A;  3IM1 A;  3H0L B;  4DL6 A;  4UAW A;  4WJ3 B;  5AIA A;  4O3R A;  3GIK A;  3RJG A;  4HYK A;  2I9G A;  4F4Y A;  3R9K A;  4EX6 A;  5CHG A;  2WB1 C;  4B9U A;  4ED8 A;  4UB8 U;  1ZQE A;  4EEB A;  2PFN A;  2ZIX B;  3KHR A;  3GDX A;  1XC9 A;  3Q8R B;  4NXT A;  5DQH A;  2L5Y A;  4RNM A;  3C1Z A;  1A77 A;  3OGU A;  3H8M A;  2FE9 A;  1U47 A;  2HOF A;  2Q4T A;  2ZTC A;  2BCQ A;  2G0A A;  3FM9 A;  4JMU A;  1ZOL A;  3GZF A;  1S0N A;  1X42 A;  4DF8 A;  3KHG A;  5JU5 A;  3ISB A;  4R65 A;  2PI5 A;  4KLU A;  1PVR A;  4KLJ A;  4YP3 A;  2JR5 A;  2P6U A;  4Y2X A;  4F93 B;  4RT3 A;  3M6K A;  4LT6 A;  2KZM A;  3M9M B;  4NY8 A;  1JN3 A;  7ICN A;  2YN4 A;  1UQV A;  3B9J A;  3UQ0 A;  1XU4 A;  4EGW A;  5KFF A;  2YMM A;  4CF5 A;  5AKI A;  2EH9 A;  3JCF A;  2DWQ A;  3GQC A;  5DQG A;  4DFP A;  1NJX A;  4DSK A;  1ZQZ A;  3WKC A;  9ICH A;  5T14 A;  3BJY A;  4WC3 A;  1L6N A;  4YCX A;  2ZXH A;  4C8M A;  3QUT A;  9ICG A;  1Z3E B;  4PPX A;  2A3V A;  4KM5 A;  3HPO A;  1TK0 A;  5JTG A;  2DR8 A;  3RJK A;  5B3Q A;  4QW8 A;  3ALR A;  3PO4 A;  5F9L A;  1L8L A;  4LEW A;  3V6J A;  4NLK A;  2JV3 A;  3NVV A;  2JGA A;  4O3O A;  2FPL A;  1A76 A;  5AI5 A;  2LM4 A;  4RWO A;  4HAI A;  5ALU A;  5KT3 A;  4OAG A;  3OWG A;  3WFQ E;  4QZE A;  4KN7 A;  4MFA A;  1VJ7 A;  3MGH A;  1RPL A;  1ED1 A;  9ICK A;  4P0Q B;  2UVU A;  9ICM A;  5ALV A;  4IRD A;  5KFZ A;  4LEY A;  1S0O A;  9ICX A;  4O67 A;  4F71 A;  4EBD A;  2GLE A;  5DB8 A;  4MFF A;  9ICB A;  4DS5 A;  8ICK A;  2IHO A;  9ICL A;  5J2I A;  5ALY A;  1JRO A;  1OW5 A;  4X5V A;  4FBT A;  4O3P A;  1UA0 A;  1DOQ A;  8ICX A;  2H5X A;  4UB1 A;  3PZP A;  1L3T A;  2D3D A;  3UM9 A;  4PHE A;  2EZZ A;  3H3A A;  5GTI U;  1RYR A;  1TFY A;  1O08 A;  4EP7 A;  4JLX A;  4DLG A;  3SV4 A;  2Q0Z X;  1KTQ A;  1GO3 F;  2I6X A;  4GIB A;  1UEU A;  2BZF A;  4FO6 A;  4CF3 A;  1NJW A;  4FE3 A;  3V72 A;  4OD0 A;  2AHO B;  1RM6 C;  1J2N A;  5AM3 A;  2A1J A;  1XSN A;  2DVI A;  4CF4 A;  4XRH A;  4YQW A;  1Z00 B;  3AN1 A;  3HKZ F;  4DCC A;  3NAS A;  2YX8 A;  4US9 A;  5DG8 A;  2B21 A;  5AKY A;  1RXV A;  5AI9 A;  5L1K A;  5HR7 A;  2W9C A;  3MCR A;  3MDC A;  4BGD A;  3QNM A;  2KHV A;  1N56 A;  2BQU A;  3V6K A;  3NYB A;  2FPM A;  4ED2 A;  2GAF D;  1QCK A;  2JH1 A;  3ZD9 A;  1JX4 A;  2JEI A;  4O3Q A;  2EZY A;  2JMG A;  2K4P A;  4X4O A;  5CFU A;  2FJ6 A;  4QJF B;  2KTQ A;  1B22 A;  2XCP A;  4O9M A;  4FO1 A;  1BPX A;  4NV0 A;  2IOF K;  3PX4 A;  4UQG A;  4EED A;  4X4P A;  4RNN A;  4M47 A;  2LHT A;  4RNO A;  4FZM A;  3RR7 A;  3AUO A;  2DR9 A;  1NZB A;  4NJ8 A;  3LDA A;  2O5A A;  4X4S A;  4RWP A;  2K4I A;  2W3R A;  4U6P A;  1N63 A;  5ALZ A;  2W9M A;  4KTQ A;  1JAJ A;  5EWG A;  2FLN A;  3PO5 A;  1CUK A;  2FDR A;  4C80 A;  2EAP A;  4X4Q A;  2BBJ A;  3QYP A;  3MGI A;  1ZQD A;  4PGQ A;  1L7O A;  2C28 A;  3TAR A;  2PFQ A;  2D6F C;  1X2I A;  3BS5 A;  3K1R B;  2G06 A;  2XC9 A;  3GIJ A;  2KFZ A;  4E7X A;  1ZYQ A;  1ZQR A;  3N7S C;  4ATB A;  4Y2S A;  5ALD A;  1V38 A;  1L3U A;  1UCV A;  4ECX A;  3QU2 A;  3ERC C;  2I1Q A;  1T3N A;  5IIM A;  1Q78 A;  1ZD5 A;  3BQT A;  4J9N A;  2BCU A;  2Y9T A;  1XWL A;  3ER9 B;  5C0Y A;  2GA9 D;  3AQM A;  4AT8 A;  4YMO A;  5AIB A;  5IIJ A;  1NK5 A;  4F5O A;  1RYS A;  5TZV A;  2YMQ A;  4FZN A;  4F4K A;  3AMZ A;  4FHY A;  3PSP A;  3C29 A;  4P2H A;  3RBD A;  5IIO A;  3SZ2 A;  2MA1 A;  4KLD A;  5AM0 A;  3OUY B;  3WK9 A;  4DSI A;  4F5P A;  3DDH A;  3SEI A;  5CHE A;  5C5J A;  7ICI A;  4F3O A;  7ICS A;  3NRZ A;  4GXJ A;  2W03 A;  8ICT A;  4M2Y A;  5ALL A;  2EWR A;  4QZI A;  2DPI A;  3N7P D;  9ICP A;  5CR0 A;  4I2E A;  2W9A A;  2EAO A;  2FLP A;  3E0F A;  5CP2 A;  1L3V A;  4OJ5 A;  4RQ5 A;  2IMW P;  2PFO A;  3QXG A;  1SV0 C;  3EW9 A;  4M6W B;  4YMN A;  2BCS A;  2BCR A;  4IRC A;  2E5S A;  3NTU A;  1SKR A;  4MKP A;  5F2V O;  2KEY A;  2AJQ A;  4EZ9 A;  5BPC A;  5DB9 A;  5KFO A;  2BPG A;  1ZQM A;  3PW4 A;  2RLT A;  1SWW A;  1IG6 A;  2DKX A;  2FMP A;  1M6Y A;  4F92 B;  1ZQW A;  4KLE A;  2H3F A;  2PFP A;  1ZQG A;  1KQQ A;  1YZ7 A;  5D46 A;  4XQ7 A;  2DR7 A;  1MIW A;  3OHA A;  4NXX A;  3A0H U;  4M9L A;  4G3I A;  3D2S A;  1S8O A;  1URJ A;  4WC0 A;  4E80 A;  2LM1 A;  4J03 A;  4QZB A;  1ZQX A;  2BR0 A;  4DOB A;  1ZRM A;  4I2J A;  5A0L A;  3HJE A;  4NLC A;  8ICJ A;  4X4V A;  4R64 A;  3BS7 A;  4UW9 A;  4KX3 A;  5HRF A;  1PK3 A;  2KSO B;  2WF7 A;  2BPF A;  4PL2 A;  4EEK A;  5HML A;  4ED7 A;  1SKW A;  4FHV A;  3VC8 A;  2NRW A;  2BE3 A;  7ICU A;  3RB0 A;  2HHX A;  2G07 A;  4RQ4 A;  3SD7 A;  5HRE A;  4F2S A;  2ASL A;  4AYB C;  3H8J A;  9ICF A;  2F2A B;  3CK6 A;  4FHP A;  1Z1B A;  5AK5 A;  1N61 A;  4DQS A;  4IQT A;  4TUQ A;  3U26 A;  4RU9 A;  3PVX A;  2NRV A;  2JZB A;  2YY6 A;  3QZ8 A;  2A19 A;  1IIP A;  4QNL A;  2F1H A;  3T79 A;  5J8Y C;  4PL1 A;  8ICY A;  3OV7 A;  5CA7 A;  4RQ2 A;  4PHD A;  4IL6 U;  2Y0S F;  5G5G A;  7ICK A;  4KLG A;  2ZIV A;  2FMS A;  2JH7 A;  5KFU A;  1O03 A;  4ICA A;  1J97 A;  4O5K A;  5J0X A;  2OYY A;  3OVA A;  2MSN A;  5DQI A;  2KOB A;  2W8K A;  1LKY A;  4O5C A;  2ZH5 A;  4I2G A;  4JLZ A;  3C23 A;  1KL9 A;  4K98 A;  1X6I A;  2MUT A;  2IBK A;  1IM4 A;  4RQ7 A;  4NM2 A;  7ICJ A;  2OXO A;  8ICW A;  1U9L A;  2OWO A;  1HEK A;  4KLL A;  4F72 A;  5FP0 A;  3BZK A;  1ZQU A;  3UQ2 A;  3C2M A;  2W43 A;  2HOQ A;  4PGY A;  3ISD A;  9ICJ A;  8ICB A;  3Q8S B;  4JWN A;  1SKS A;  4EBC A;  2ZUC A;  3QU7 A;  3D2Q A;  4UB6 U;  3NVY A;  4AP9 A;  1ZQL A;  2HBJ A;  1ZXI A;  2CRX A;  4Y2Q A;  5ALS A;  5ALP A;  4Y2J A;  5HHI A;  3RF9 A;  1Q3U A;  1WOT A;  3FDS A;  4B9S A;  3BQ0 A;  4J9P A;  1Z19 A;  5KFY A;  3L3F X;  1BPE A;  3IV6 A;  3M8S A;  3UPQ A;  4UAS A;  2J6U A;  2E3T A;  4M04 A;  4EV6 A;  4NXZ A;  1ECW A;  3TAD C;  2DRA A;  2KV2 A;  3T5H A;  5J2D A;  5EWF A;  4I0U A;  4NXU A;  5KFT A;  3OVS A;  3PW0 A;  3QUB A;  4RQM A;  5E79 U;  3RH6 A;  1R8C A;  4TUS A;  5KFP A;  4ECU A;  2ZG6 A;  2E8P A;  1F5S A;  4I2I A;  3WFP A;  4ED3 A;  2W54 A;  3KBB A;  2E1F A;  3H0R B;  3RH5 A;  2AGO A;  1S0M A;  5KG0 A;  2XY7 A;  4LEZ A;  5J0T A;  3HT3 A;  4G9B A;  4JK1 A;  1S9F A;  3GFK B;  1MSW D;  3IN5 A;  2QB1 A;  1SXE A;  2JXJ A;  4RQ8 A;  5AKE A;  9ICS A;  2ZJA A;  3QU9 A;  2BGW A;  2G5H B;  5ALX A;  4AT9 B;  1HUZ A;  3AEV A;  3SAG A;  2QLT A;  1NKE A;  7ICM A;  4DSF A;  1COO A;  5J2E A;  2D8C A;  2KIV A;  1SIJ A;  5III A;  4O3M A;  8ICZ A;  2HOI A;  2BQR A;  9ICW A;  3KHH A;  3PW2 A;  2MRL A;  4BXO A;  5HR6 A;  2IOF A;  2HHS A;  4KLS A;  4KLI A;  1TVA A;  3JZ0 A;  2M2V A;  4UBC A;  1ZQS A;  5ALH A;  3SR6 A;  5J8Y A;  4QWC A;  4BJQ A;  5KNI A;  4R63 A;  5F9N A;  4O5E A;  3VCB A;  5HMM A;  4UAT A;  4U7C A;  3QEB Z;  4K4I A;  2ZH1 A;  5KT4 A;  4EZ6 A;  4DSE A;  2WF6 A;  3MAB A;  4UAV A;  4QZC A;  4RQ6 A;  3AL0 B;  4YD2 A;  4UB4 A;  3PW7 A;  4DSL A;  5AKH A;  2R8J A;  1RZT A;  2E8O A;  4QWA A;  3RFA A;  2DGZ A;  3H8S A;  2K8C B;  5AKJ A;  4RWQ A;  3L9D A;  3L5K A;  2ZHA A;  3ONN A;  3UPS A;  4QZG A;  2XID A;  3AM9 A;  1QSY A;  4WCW A;  4O3S A;  4QZ9 A;  2OH2 A;  2A1J B;  4BWM A;  3OVB A;  2VA8 A;  3NVW A;  4YVZ A;  1DK3 A;  2HBM A;  3FYH A;  2QB0 A;  3GIL A;  4M9N A;  5DB7 A;  2QAR A;  3QZ7 A;  5KFS A;  2Y1J A;  4OAI Z;  4CGZ A;  2WB1 F;  4LZD A;  3PMN A;  4C8O A;  5BOL A;  1MC8 A;  1GPJ A;  1SZH A;  5D4B A;  2F1I A;  2UVR A;  1PZN A;  4KN4 A;  3KOO A;  4I2C A;  2B56 A;  2W9C B;  7ICG A;  3N4M B;  3ICX A;  3TAQ A;  3OSP A;  4B9N A;  2RDJ A;  4Y2Y A;  4DL5 A;  2RHF A;  1KRP A;  3K1Z A;  5KG4 A;  3HKZ C;  1S0V A;  1VFG A;  2K4H A;  3WK7 A;  4DFD A;  2DQN B;  3RAX A;  4DS4 A;  3I1Y A;  2W9B B;  2ZIX A;  4UD4 A;  2IHM A;  4YR3 A;  2M0N A;  4B9T A;  4DQP A;  4KMO B;  3N7R C;  2HHU A;  2YQE A;  3TAD A;  1K5O A;  4C8N A;  1L3S A;  4F2R A;  3THV A;  3C2K A;  2DF4 B;  3EZ5 A;  2J6S A;  5J0U A;  2M9N A;  1Z4O A;  4DOC A;  5CFT A;  2PI4 A;  3DEE A;  2AQ0 A;  5J2F A;  5KFG A;  2XY6 A;  1ZQQ A;  1ZRN A;  4XQ8 A;  4QZH A;  3IHQ B;  2ZJ5 A;  5DBA A;  1ZD4 A;  4O68 A;  3BZC A;  1NK7 A;  1BPZ A;  4OO1 J;  5ALM A;  3GIM A;  3SAH A;  1OUQ A;  4NLG A;  3TI0 A;  1X9X A;  3FAH A;  5IIL A;  4ATB B;  4KLQ A;  1Q3V A;  3BDP A;  4GXK A;  4QWE A;  3EYZ A;  4I27 A;  4DFJ A;  2DL0 A;  2JEG A;  3BQ1 A;  3JPP A;  2UVV A;  5J2K A;  5AI8 A;  8ICV A;  3ETL A;  3PST A;  3F5E A;  1WWV A;  5AIC A;  1TK8 A;  1SWV A;  4ECT A;  1MQ2 A;  4ECQ A;  4AT8 B;  4QWD A;  1UHU A;  1S10 A;  5J2J A;  4GC7 A;  5ALT A;  3SMV A;  2IUB A;  2HHQ A;  4WC7 A;  2E8M A;  1D8B A;  2PMZ F;  3ISC A;  2RP5 A;  1U4B A;  3M9O B;  4FFD A;  4IRK A;  3H39 A;  4UB5 A;  1ZQ1 C;  7ICT A;  1J2M A;  3NS1 A;  3SYZ A;  4DLE A;  2A1A A;  2KD1 A;  5L1J A;  4RQ3 A;  4PGX A;  1T8E A;  1DRG A;  1NKB A;  3ED5 A;  9ICN A;  3QE9 Y;  4I2A A;  2ZTE A;  3WK5 A;  2RQ5 A;  4BUG A;  2B0C A;  1RYU A;  4TQR A;  3ZD8 A;  4QIW C;  3IRU A;  1LV5 A;  2HHT A;  4F4X A;  4DQQ A;  4IQV A;  5AKZ A;  2LPE A;  1JRP A;  4QZ8 A;  2HN2 A;  7ICL A;  3HP6 A;  1D9D A;  1S77 D;  2ZIU B;  2BDU A;  2W7O A;  2AQ4 A;  4Z6D A;  1OU5 A;  5HHH A;  3B0Y A;  4EBE A;  1N48 A;  4YR0 A;  3OHB A;  4WC6 A;  3IG8 A;  1L7P A;  2Y9U A;  4J9K A;  1BPY A;  3HWT A;  3RB6 A;  4ECR A;  5AM5 A;  4KB6 A;  2Q66 A;  4Q45 A;  4KMU A;  4DFM A;  2NO4 A;  2ZUB A;  1V4A A;  5KG7 A;  2F44 A;  2JEF A;  5KFX A;  1QH9 A;  1TE2 A;  1V85 A;  2B6G A;  2YML A;  2JEJ A;  2JRZ A;  4I28 A;  5KG1 A;  1HUO A;  3EUB 2;  2ZH9 A;  4F8R A;  4PHP A;  2ASJ A;  1MIV A;  5ALO A;  4R8U A;  3PHZ A;  3LVV A;  1HIW A;  3MR3 A;  1D8L A;  1SV4 A;  1NK4 A;  1A0P A;  2LYH A;  4WBZ A;  4RWN A;  2HBK A;  5AM4 A;  3V6H A;  3MFI A;  1NOM A;  2NRK A;  1ZQH A;  4QZD A;  3WFO A;  4JUZ A;  3TQ1 A;  8ICM A;  2K8A A;  1B0X A;  4IS7 A;  3HRD D;  7ICR A;  3EF2 A;  4US8 A;  2NRT A;  1SL0 A;  8ICF A;  2B51 A;  1U45 A;  3KZX A;  3TAN A;  1KLN A;  4I2H A;  4FHW A;  4IQU A;  1ZQY A;  4FS1 A;  3HW8 A;  4EEL A;  4IQW A;  3M7D A;  1WWU A;  1PVQ A;  4CRX A;  3CNH A;  2CXY A;  3SQI A;  8ICG A;  1DK2 A;  1NKC A;  4K8V A;  5J0W A;  3KKA C;  2V4R A;  4NLN A;  1Z1V A;  2KJ9 A;  1B4F A;  3RRG A;  4YN4 A;  1ZQK A;  4EYI B;  4ECW A;  2V9W A;  3C28 A;  2F1J A;  3RH4 A;  7ICF A;  1QSS A;  3GV8 B;  2ZIV B;  1KN5 A;  2ISP A;  4DL7 A;  2KP7 A;  2VAN A;  3Q8M A;  4RUC A;  2F77 X;  4EX7 A;  2NRX A;  2EZX A;  1QQ6 A;  1F44 A;  1VDV A;  4ED0 A;  3C18 A;  2GOL A;  2IOH A;  1LKY B;  5B3P A;  1NJZ A;  2MUT B;  3G6X A;  1S5L U;  5TIS U;  2KVC A;  4Y2U A;  2Y0S C;  5KAI U;  5J2A A;  4DO9 A;  2AU0 A;  3LWL A;  3QU4 A;  1MQ3 A;  2PBE A;  3C1Y A;  2E1E A;  1ZQN A;  3PR4 A;  3A0B U;  4OJL A;  3D6J A;  3C5F A;  4P0P A;  1IV8 A;  3PW5 A;  4O6A A;  2DFL A;  1TAQ A;  5J29 A;  3MGV A;  4ACO A;  2KVS A;  5AKX A;  3GV5 B;  2HHP A;  3DV9 A;  3K75 D;  3AQL A;  3NKU A;  4E8F A;  1K1Q A;  3NWI A;  2DR5 A;  1KW4 A;  4YR2 A;  4K97 A;  1UT5 A;  5JRT A;  4GLX A;  2ZH6 A;  3NVZ A;  3AQF A;  2ID1 A;  1FEZ A;  3BQ2 A;  5GTH U;  3ZDE A;  3M1Y A;  4LZG A;  3QU5 A;  2XGQ A;  3QX7 A;  1ZQV A;  3WU2 U;  1SL1 A;  3F53 A;  1TKD A;  4XA5 A;  2OEH A;  2XCA A;  3RJE A;  4KLO A;  8ICI A;  8ICC A;  1ZD2 P;  3QEA Z;  1NK9 A;  5KG3 A;  8ICN A;  1UPH A;  3PX6 A;  1KBU A;  4PZN A;  2ZJ8 A;  3GV7 B;  4PH5 A;  1ZQF A;  2HN1 A;  4P4M A;  5HRL A;  2VKQ A;  2HHV A;  3MR5 A;  4K99 A;  2NYV A;  4YFK A;  2M2T A;  3NVO A;  5AI0 A;  5AK4 A;  2ATL A;  2LYB A;  4M6W A;  2RDI A;  2KFN A;  5AI6 A;  3RTV A;  4KLM A;  1N60 A;  2ZTD A;  5AI4 A;  3IDW A;  5KT2 A;  4GXI A;  4ELU A;  1DXS A;  3OPX A;  4WQK A;  5ALG A;  2G09 A;  4CCH A;  4DL4 A;  1SZP A;  2G08 A;  2H3Q A;  4KX5 A;  4I29 A;  5J2C A;  1ZJM A;  2EAN A;  3NUQ A;  2WHE A;  2H3V A;  5KFK A;  3JPQ A;  5KFD A;  4FZL A;  1SGG A;  5DBC A;  5BOM A;  4IR9 A;  3G6Y A;  4NXW A;  4YMM A;  4Q8E A;  1SXD A;  1JMS A;  4DQI A;  5DLG A;  1N62 A;  5EE9 A;  5K4L A;  3AQK A;  1TAM A;  3WK4 A;  4LVS A;  9ICO A;  1UEV A;  4K4H A;  5KT7 A;  3JPT A;  3RB3 A;  1V9P A;  4BXO B;  4PHA A;  4FHX A;  5ALE A;  4EBJ A;  1DGJ A;  2ZIW A;  1V97 A;  2KE7 A;  4LJX A;  4AYB F;  2KKP A;  3KKA A;  4HX0 A;  1N5X A;  4J9L A;  4RPX A;  2HVI A;  4FH5 A;  1WCL A;  2DUY A;  1T94 A;  3M9N B;  2MAX A;  3HX0 A;  5KG6 A;  2WAQ F;  4UAZ A;  5J2G A;  3KTQ A;  5DDM A;  2PXI A;  1NJY A;  1NI3 A;  3WKE A;  1R8B A;  1EXN A;  4QW9 A;  1QTM A;  2F76 X;  3J81 j;  4OAF A;  1N5W A;  4DSJ A;  3H37 A;  4DF4 A;  5CB1 A;  4MEY A;  2O6K A;  1X9M A;  4Y2R A;  2FLL A;  1XO1 A;  3S6J A;  1CEZ A;  4NKU A;  5HC9 A;  5KFB A;  5KFC A;  4X0A A;  4C7Y A;  4UB2 A;  7ICE A;  5B66 U;  1T3Q A;  1BNO A;  4WQL A;  4S3N A;  4KLF A;  3GII A;  1NK0 A;  1U48 A;  4JWM A;  3TFR A;  4E0D A;  1ZJN A;  3Q8L A;  4F50 A;  2I5H A;  3JPN A;  3UXP A;  4O0I A;  2HBL A;  1YT3 A;  3TAP A;  2VA2 A;  2ZH4 A;  4FBU A;  4JB3 A;  4P4O A;  3WKA A;  4B6J A;  2M2W A;  4UAU A;  3KD3 A;  5KAF U;  1H38 A;  1VJ5 A;  4CE6 A;  1HJP A;  2V4Q A;  3NGD A;  2GWS A;  1R8A A;  3HIY A;  2HCF A;  4F4Z A;  2AH5 A;  2KIC A;  1R89 A;  4BWJ A;  4XJE A;  4QZF A;  1DGS A;  3OSN A;  2G5I B;  3WFR E;  4KIT B;  5AKL A;  5AM2 A;  3QUC A;  2LBO A;  3EPG A;  5DG7 A;  1UT8 A;  4Q43 A;  5IIN A;  5J0Q A;  1A6S A;  5HRG A;  3IP4 B;  3UXO A;  3RJF A;  5ALQ A;  3AU2 A;  4EEN A;  4XUS A;  4JV1 A;  1XSL A;  2AXT U;  2WFA A;  2KK0 A;  4WC5 A;  1WYG A;  5KT6 A;  3ER8 C;  2DBY A;  1KFS A;  2HMX A;  2WTF A;  7ICQ A;  3CYM A;  4CNQ A;  2KNJ A;  4ELV A;  4M9G A;  2GO7 A;  4Q44 A;  1ZQT A;  1C20 A;  4RPZ A;  3WKD A;  4YG2 A;  1NK8 A;  3PNC A;  1PK1 A;  4UB3 A;  1JUD A;  1RXW A;  3MR2 A;  1FA0 A;  4X4N A;  2C2D A;  4AT7 A;  5HR9 A;  4RUA A;  4MEX A;  1TAU A;  4A8E A;  5DB6 A;  3Q8P B;  2ZXI A;  1X40 A;  3GU3 A;  4QZA A;  1FFU A;  4O69 A;  2P66 A;  3PY8 A;  1TFR A;  2BHN A;  3ORY A;  2JHD A;  3RAQ A;  5KTQ A;  3RJJ A;  5DBB A;  3T5K A;  4UAR A;  2K4E A;  4B9V A;  3F2D A;  2NO5 A;  1X66 A;  3HJ1 A;  2YTU A;  8ICE A;  3T5L A;  4WH5 A;  2K8B B;  3K7D A;  3G6V A;  1JIH A;  1ZQP A;  1Q8K A;  3WFS C;  9ICA A;  3AU6 A;  3V7J A;  3OTQ A;  3O0F A;  3ZDA A;  5ALI A;  5AKK A;  4MHV A;  3HJ4 A;  4F5R A;  3IG5 A;  3PX0 A;  4AT9 A;  5KFE A;  2PMZ C;  2FI1 A;  2DRB A;  1Z4N A;  7ICH A;  5KFJ A;  2F8L A;  5DKW A;  4PZO A;  3FC4 A;  3SAF A;  2CPR A;  2AGQ A;  2BDP A;  4NL9 A;  1ZQC A;  2R18 A;  3LVW A;  1SB3 C;  9ICE A;  2XI9 A;  4C8K A;  1PX5 A;  3JPO A;  4M5D A;  3H0M B;  2W55 A;  2XY5 A;  3H4D A;  5DGB A;  4USA A;  2ES6 A;  1XS9 D;  5CWR A;  3MBY A;  4LEV A;  2F8K A;  4Z6E A;  3BS5 B;  2BCV A;  2CN1 A;  2VA3 A;  2YMP A;  5ALW A;  3TFS A;  5J2B A;  3RJI A;  1XO0 A;  4OJ6 A;  5HP4 A;  2YB1 A;  5D63 A;  5D49 A;  3K4G A;  3ZI4 A;  9ICC A;  4WOY A;  2LI6 A;  3I76 A;  4WC4 A;  3F2B A;  1L8O A;  7ICV A;  1KNY A;  4RQ1 A;  5L1M A;  3F2C A;  1L5U A;  1ZQA A;  1XSP A;  4OJO A;  3E58 A;  3SI8 A;  1FFV A;  2FPK A;  4M9H A;  4DEZ A;  2RFF A;  2KZ3 A;  1MIY A;  3UMG A;  4GFJ A;  2ZH8 A;  4OCZ A;  5EOZ A;  2BBH A;  3SV3 A;  2VIX A;  3SEN A;  4R8U B;  4KLT A;  1ARO P;  4J9O A; 
#chains in the Genus database with same CATH homology
 8ICG A;  3ISB A;  4R65 A;  2PI5 A;  1DK2 A;  4KLU A;  1U9L A;  1NKC A;  2OWO A;  4IG8 A;  5J0W A;  4KLJ A;  4KLL A;  4YP3 A;  4I2D A;  2P6U A;  4F93 B;  2V4R A;  5DG9 A;  4RT3 A;  4NLN A;  8ICO A;  4Q8F A;  4ELT A;  1ZQU A;  1NK6 A;  4M0A A;  1BVS A;  3UQ2 A;  3RRG A;  4YN4 A;  3C2M A;  1ZQK A;  4EYI B;  2KZM A;  5HRK A;  3M9M B;  3Q8Q B;  4NY8 A;  1JN3 A;  4ECW A;  2V9W A;  1TK5 A;  7ICN A;  4PGY A;  2F1J A;  3ISD A;  3RH4 A;  3UQ0 A;  7ICF A;  8ICB A;  9ICJ A;  1XU4 A;  3Q8S B;  5KFF A;  4JWN A;  1SKS A;  4EBC A;  1U49 A;  3LWM A;  3GV8 B;  1QSS A;  2ISP A;  4DL7 A;  2ZUC A;  4DL3 A;  2KP7 A;  2VAN A;  3Q8M A;  3GQC A;  5DQG A;  1D8Y A;  4RUC A;  2XGP A;  4DFP A;  2ZH7 A;  5KFW A;  2NRX A;  1NJX A;  4ED0 A;  3C18 A;  4UBB A;  1ZQL A;  4DWI A;  4DSK A;  1ZQZ A;  4MFC A;  9ICH A;  2BQ3 A;  3BJY A;  2HW3 A;  2C2E A;  5L1I A;  4WC3 A;  9ICV A;  4YCX A;  1NJZ A;  2MUT B;  3G6X A;  5DED A;  4RT2 A;  4C8M A;  5HHI A;  7ICP A;  5J2A A;  9ICG A;  4DO9 A;  2AU0 A;  5KFR A;  3RJH A;  3LWL A;  1Z3E B;  2W9B A;  3FDS A;  2W8L A;  3EPI A;  4DFK A;  4B9S A;  1WOT A;  4PPX A;  1MQ3 A;  3BQ0 A;  2PBE A;  5DEC A;  4J9P A;  3C1Y A;  3HPO A;  5KG2 A;  4F5N A;  5KFY A;  1ZQN A;  3PR4 A;  1BPE A;  4TQS A;  1TK0 A;  2DR8 A;  3UXN A;  3M8S A;  3C5F A;  3UPQ A;  2Y1I A;  3RJK A;  4QW8 A;  3PW5 A;  2C2R A;  8ICS A;  3PO4 A;  2J6U A;  2DFL A;  4YXJ A;  4M04 A;  1TAQ A;  5F9L A;  5J29 A;  3T3F A;  5HRH A;  4NXZ A;  3GV5 B;  1JXL A;  3T5H A;  2HHP A;  1TV9 A;  5J2D A;  3V6J A;  2DRA A;  5EWF A;  4NLK A;  3K75 D;  3B0X A;  3E2E A;  4O3O A;  3JYY A;  3AQL A;  2FPL A;  4B9M A;  1A76 A;  1K1Q A;  5KFT A;  5KFH A;  4E8F A;  3OVS A;  3PW0 A;  9ICU A;  4RWO A;  2DR5 A;  4YR2 A;  5JUM A;  5KT3 A;  3RH6 A;  5J0Y A;  1UA1 A;  8ICQ A;  1UT5 A;  3WFQ E;  2ZH6 A;  4GLX A;  1NZP A;  4X4T A;  4O3N A;  4YD1 A;  4QZE A;  1R8C A;  4KN7 A;  4MFA A;  4TUS A;  5KFP A;  2ZH3 A;  8ICP A;  4ECU A;  1VJ7 A;  3MGH A;  2ID1 A;  1RPL A;  3BQ2 A;  5KT5 A;  4QWB A;  4I2I A;  8ICH A;  9ICK A;  2C22 A;  3WFP A;  2UVU A;  3ZDE A;  4ED3 A;  3KHL A;  9ICM A;  4IRD A;  4ED1 A;  5KFZ A;  8ICL A;  4LZG A;  3V7K A;  1S0O A;  2XGQ A;  3RH5 A;  1X9W A;  9ICX A;  2AGO A;  1S0M A;  5KG0 A;  1ZQV A;  2NRZ A;  4EBD A;  2XY7 A;  1SL1 A;  4WBY A;  5J0T A;  2IHN A;  4X4U A;  5DB8 A;  3HT3 A;  1TKD A;  4MFF A;  9ICB A;  4DS5 A;  8ICK A;  4JK1 A;  1S9F A;  4E0D A;  2ZUD A;  2BPC A;  4XA5 A;  2XCA A;  3RJE A;  4KLO A;  3GFK B;  9ICL A;  8ICI A;  1MSW D;  5J2I A;  8ICC A;  3JPR A;  3QEA Z;  4X5V A;  1NK9 A;  4WC1 A;  1Z00 A;  3H4B A;  4RQ8 A;  5KG3 A;  8ICN A;  4FBT A;  9ICS A;  4RPY A;  2ZJA A;  4O3P A;  3PX6 A;  2BGW A;  4J9S A;  3C21 A;  5DDY A;  1UA0 A;  1DOQ A;  8ICX A;  1KFT A;  2H5X A;  4UB1 A;  4ECS A;  4AT9 B;  2ZJ8 A;  1L3T A;  3Q8K A;  1HUZ A;  3GV7 B;  4PH5 A;  1ZQF A;  1NKE A;  4PHE A;  7ICM A;  1UET A;  4P4M A;  4DSF A;  5HRL A;  2HHV A;  1COO A;  2R8I A;  3MR5 A;  3H3A A;  5J2E A;  5J0S A;  1ZQB A;  4YFK A;  2M2T A;  1RYR A;  1TFY A;  5III A;  2ISO A;  2FMQ A;  3MR6 A;  2ATL A;  4EP7 A;  4DLG A;  3JPS A;  8ICZ A;  3SV4 A;  8ICR A;  2Q0Z X;  2BQR A;  9ICW A;  3KHH A;  3PW2 A;  4M6W A;  2RDI A;  1KTQ A;  2KFN A;  3RTV A;  1K1S A;  4KLM A;  2ZTD A;  5KT2 A;  4BXO A;  4GXI A;  2HHS A;  1UEU A;  2R8G A;  4ELU A;  4FO6 A;  4KLS A;  1NJW A;  3V72 A;  4KLI A;  1TVA A;  4EEY A;  1T7P A;  3JZ0 A;  2M2V A;  7ICL A;  4CCH A;  4RZR A;  3MDA A;  1SZP A;  4J9R A;  4DL4 A;  4UBC A;  4DOA A;  1Q79 A;  1ZQS A;  4I29 A;  4C8L A;  1S76 D;  2A1J A;  1XSN A;  5J2C A;  1ZJM A;  2JZB B;  2DVI A;  4QWC A;  4XRH A;  3M8R A;  4YQW A;  4R63 A;  5KFK A;  5F9N A;  5J0O A;  1Z00 B;  3JPQ A;  4O5E A;  3C66 A;  5KFD A;  5DBC A;  4IR9 A;  5HMM A;  5BOM A;  3G6Y A;  3QEB Z;  4YMM A;  4K4I A;  4Z6C A;  4Q8E A;  2ZH1 A;  1C7Y A;  5KT4 A;  5DG8 A;  4EZ6 A;  1JMS A;  2B21 A;  3LK9 A;  4DSE A;  4DQI A;  5DLG A;  2AGP A;  3MAB A;  4QZC A;  1RXV A;  1ZQO A;  1BNP A;  3OJU A;  1KDH A;  4RQ6 A;  5L1K A;  1SL2 A;  3AQK A;  4YD2 A;  4UB4 A;  3PW7 A;  2W9C A;  3MDC A;  4BGD A;  5IIK A;  4LVS A;  4DSL A;  2R8J A;  9ICO A;  1RZT A;  1N56 A;  1UEV A;  2BQU A;  4QWA A;  4K4H A;  4F5Q A;  4FH3 A;  1TFW A;  5KT7 A;  3H8S A;  3V6K A;  3NYB A;  3JPT A;  2FPM A;  4TUR A;  3RB3 A;  3ZDB A;  4RWQ A;  1V9P A;  3L9D A;  4BXO B;  4PHA A;  1YLQ A;  4ED2 A;  2ZHA A;  3UPS A;  4DQR A;  4FHX A;  4IR1 A;  4QZG A;  4EBJ A;  3ZD9 A;  1QSY A;  4EBK A;  1JX4 A;  2JEI A;  4WCW A;  4O3Q A;  4O3S A;  1ZET A;  4X4O A;  4QZ9 A;  1KSP A;  2KTQ A;  2A1J B;  4MF8 A;  4J9L A;  4BWM A;  4RPX A;  2HVI A;  1B22 A;  3OVB A;  2VA8 A;  2XCP A;  4O9M A;  4YVZ A;  1BPX A;  1DK3 A;  1WCL A;  4FH5 A;  3FYH A;  4X4R A;  3PX4 A;  4X0B A;  4UQG A;  3GIL A;  4X4P A;  4M9N A;  4RNN A;  2IA6 A;  4M47 A;  3M9N B;  3RBE A;  2MAX A;  3HX0 A;  5DB7 A;  5KG6 A;  3QZ7 A;  5KFS A;  4RNO A;  2Y1J A;  5EWE A;  1KFD A;  4UAZ A;  3AUO A;  2ASD A;  3RR7 A;  8ICA A;  3LQC B;  3H38 A;  2DR9 A;  4LZD A;  3LDA A;  4M9J A;  5J2G A;  3PMN A;  4C8O A;  2O5A A;  4WC2 A;  4X4S A;  5BOL A;  1MC8 A;  3KTQ A;  5D4B A;  5DDM A;  2F1I A;  2PXI A;  1NJY A;  2UVR A;  4NLZ A;  1EXN A;  1R8B A;  4QW9 A;  1QTM A;  1PZN A;  4KN4 A;  4I2C A;  2W9C B;  7ICG A;  3N4M B;  4RQ0 A;  4DSJ A;  4I2B A;  2W9M A;  4KTQ A;  1JAJ A;  3TAQ A;  5EWG A;  3H37 A;  2FLN A;  4DF4 A;  3OSP A;  3PO5 A;  2RDJ A;  4B9N A;  1CUK A;  4X4Q A;  5CB1 A;  4DL5 A;  4MEY A;  3MGI A;  1ZQD A;  1KRP A;  4PGQ A;  3RB4 A;  2C28 A;  3H8W A;  1X9M A;  5J0P A;  3TAR A;  5KG4 A;  4ECY A;  2FLL A;  2PFQ A;  1XO1 A;  1X2I A;  1CEZ A;  5KFQ A;  5L1L A;  1S0V A;  4NKU A;  1VFG A;  5HC9 A;  5KFB A;  2XC9 A;  3GIJ A;  2KFZ A;  4E7X A;  1ZYQ A;  5DLF A;  4F4W A;  3RAX A;  1ZQJ A;  1ZQR A;  4ATB A;  3OUY A;  9ICT A;  5KFC A;  4DS4 A;  4X0A A;  4UB2 A;  4DL2 A;  2W9B B;  1F5A A;  4YXM A;  4ECV A;  1L3U A;  4UD4 A;  7ICE A;  2IHM A;  1BGX T;  4YR3 A;  4ECX A;  4B9T A;  1BNO A;  4F91 B;  4S3N A;  2DPJ A;  4KLF A;  4DQP A;  2XO7 A;  2I1Q A;  1T4G A;  1T3N A;  2BCU A;  3GII A;  2HHU A;  1NK0 A;  4BDP A;  5IIM A;  1Q78 A;  3BQT A;  1U48 A;  1QSL A;  4JWM A;  4J9N A;  4K4G A;  4ZH4 A;  3TFR A;  4C8N A;  1WCN A;  1XWL A;  4P4P A;  4FS2 A;  3Q8L A;  1ZJN A;  1L3S A;  1ZQI A;  4F2R A;  3AQM A;  3THV A;  4F50 A;  3H7I A;  3JPN A;  4J9M A;  4AT8 A;  3C2K A;  3UXP A;  3EZ5 A;  2J6S A;  2HVH A;  4YMO A;  5J0U A;  2M9N A;  5IIJ A;  4DOC A;  4O0I A;  4ED6 A;  2PI4 A;  1NK5 A;  2AQ0 A;  4F5O A;  5J2F A;  5KFG A;  2XY6 A;  1ZQQ A;  3OJS A;  3TAP A;  4EYH B;  1RYS A;  5TZV A;  4XQ8 A;  4QZH A;  1X9S A;  3IHQ B;  3MFH A;  2VA2 A;  4F4K A;  2ZH4 A;  4FBU A;  2ZHB A;  4P4O A;  2J6T A;  4FHY A;  2ZJ5 A;  4P2H A;  3RR8 A;  2M2W A;  1H38 A;  3RBD A;  5DBA A;  5IIO A;  1NK7 A;  1HJP A;  2V4Q A;  1BPZ A;  4UAY A;  3NGD A;  3GIM A;  1BPD A;  3SZ2 A;  2GWS A;  3TI0 A;  4NLG A;  4KLD A;  1R8A A;  2R8K A;  3HIY A;  3PML A;  3RRH A;  4UD5 A;  5IIL A;  3OUY B;  9ICI A;  3EWA A;  4F4Z A;  4ATB B;  2ALZ A;  4DSI A;  4KLQ A;  5KG5 A;  1R89 A;  4BWJ A;  4F5P A;  3BDP A;  5HRB A;  1IXR A;  4QZF A;  1DGS A;  4GXK A;  4QWE A;  3OSN A;  5C5J A;  7ICI A;  3EYZ A;  4I27 A;  3WFR E;  4DFJ A;  4F3O A;  4KIT B;  5HRD A;  2JEG A;  3BQ1 A;  7ICS A;  1JQR A;  3JPP A;  4GXJ A;  3EPG A;  2UVV A;  5J2K A;  5DG7 A;  1UT8 A;  8ICT A;  3AQN A;  8ICV A;  3ETL A;  1BPB A;  4M2Y A;  3C5G A;  4Q43 A;  4TUP A;  5IIN A;  5J0Q A;  1TK8 A;  1MQ2 A;  3UXO A;  4JV2 A;  4ECT A;  5HRG A;  4QZI A;  4ECQ A;  2DPI A;  4QWD A;  3RJF A;  4AT8 B;  1S10 A;  5J2J A;  3AU2 A;  9ICP A;  4XUS A;  3H40 A;  4GC7 A;  4JV1 A;  1Y88 A;  5CR0 A;  4I2E A;  1XSL A;  2ZH2 A;  2W9A A;  4RWP A;  2FLP A;  2HHQ A;  2UVW A;  4WC5 A;  5CP2 A;  2R8H A;  4WC7 A;  1L3V A;  7ICJ A;  4RQ5 A;  5KT6 A;  3ISC A;  4NKT A;  1U4B A;  3M9O B;  4JV0 A;  4ECZ A;  1KFS A;  4UB5 A;  2IMW P;  2PFO A;  2WTF A;  4IRK A;  7ICQ A;  3H39 A;  3PR5 B;  4Z6F A;  4M9G A;  4ELV A;  3EW9 A;  7ICT A;  4M6W B;  4YMN A;  5J0R A;  3SYZ A;  2BCS A;  2BCR A;  4IRC A;  4DLE A;  3NTU A;  4Q44 A;  1ZQT A;  3PV8 A;  4J9Q A;  4RPZ A;  5L1J A;  4YG2 A;  4RQ3 A;  1SKR A;  1NK8 A;  3PNC A;  8ICU A;  5F2V O;  4PGX A;  5J2H A;  4EZ9 A;  2AJQ A;  4KLH A;  5BPC A;  1T8E A;  4UB3 A;  7ICO A;  1RXW A;  3MR2 A;  5DB9 A;  1FA0 A;  1NKB A;  9ICN A;  3QE9 Y;  5KFO A;  3V7L A;  2BPG A;  5KFA A;  1ZQM A;  3PW4 A;  4I2A A;  2ZTE A;  1LB2 B;  4X4N A;  2C2D A;  4AT7 A;  5HR9 A;  4B9L A;  1B43 A;  1KEJ A;  4RUA A;  4TQR A;  1S97 A;  2KZZ A;  3ZD8 A;  4MEX A;  1QLN A;  1JXE A;  1TAU A;  1LV5 A;  2HHT A;  4F4X A;  4DQQ A;  2FMP A;  5KFL A;  5DB6 A;  3Q8P B;  4F92 B;  1ZQW A;  4IQV A;  4QZA A;  4GC6 A;  4KLE A;  4QZ8 A;  1NO5 A;  2P66 A;  2PFP A;  1ZQG A;  3PY8 A;  1TFR A;  2BHN A;  3ORY A;  3HP6 A;  3T5J A;  5DGA A;  3RAQ A;  1D9D A;  5KFN A;  1S77 D;  5D46 A;  5KTQ A;  4XQ7 A;  3RJJ A;  2AQ4 A;  5DBB A;  3T5K A;  4Z6D A;  5KFM A;  1OU5 A;  2DR7 A;  5HHH A;  4B9V A;  1D9F A;  3OHA A;  1MIW A;  3B0Y A;  4M9L A;  4EBE A;  1N48 A;  2M2U A;  4YR0 A;  4G3I A;  3ZDC A;  3OHB A;  9ICR A;  8ICE A;  3T5L A;  3HJ1 A;  4WC6 A;  4WC0 A;  3G6V A;  4E80 A;  4J9K A;  9ICQ A;  1JIH A;  1BPY A;  3HWT A;  4QZB A;  1ZQX A;  2BR0 A;  4DOB A;  1ZQP A;  5HRI A;  3WFS C;  9ICA A;  5L9X A;  4I2J A;  3AU6 A;  3V7J A;  3RB6 A;  8ICJ A;  4X4V A;  5KFI A;  4R64 A;  4ECR A;  5HNK A;  2KN7 A;  3ZDA A;  5HRF A;  2Q66 A;  3C2L A;  4Q45 A;  4KMU A;  2BPF A;  4MF2 A;  3HJ4 A;  4F5R A;  4DFM A;  4AT7 B;  4I2F A;  2ZUB A;  3PX0 A;  1V4A A;  2O1P A;  5HML A;  5KFE A;  4AT9 A;  4ED7 A;  1SKW A;  2DRB A;  7ICH A;  3N97 B;  5KFJ A;  2P6R A;  5DKW A;  4NM1 A;  4FHV A;  2AGQ A;  2NRW A;  2BDP A;  5KFV A;  5KG7 A;  3ZDD A;  1ZQC A;  2BE3 A;  2JEF A;  5KFX A;  2HHW A;  5CJ7 A;  3RB0 A;  2BKE A;  2HHX A;  7ICU A;  4RQ4 A;  9ICE A;  2JEJ A;  4C8K A;  1PX5 A;  5HRE A;  3JPO A;  4I28 A;  4R66 A;  4F2S A;  5KG1 A;  1HUO A;  2ASL A;  4M5D A;  2XY5 A;  3IM1 A;  4DL6 A;  3H8J A;  9ICF A;  2ZH9 A;  4UAW A;  3H4D A;  5DGB A;  4PHP A;  2ASJ A;  4F8R A;  1XS9 D;  4FHP A;  1MIV A;  4LT6 A;  5CWR A;  3MBY A;  4O3R A;  3GIK A;  4DQS A;  3RJG A;  4R8U A;  4IQT A;  4TUQ A;  4HYK A;  4RU9 A;  3PVX A;  2I9G A;  4F4Y A;  2NRV A;  1D8L A;  2JZB A;  4Z6E A;  3MR3 A;  1NK4 A;  2BCV A;  2VA3 A;  5CHG A;  4B9U A;  2LYH A;  3QZ8 A;  4ED8 A;  4WBZ A;  4RWN A;  2F1H A;  1ZQE A;  3TFS A;  2PFN A;  5J2B A;  3V6H A;  3RJI A;  8ICY A;  3OV7 A;  3MFI A;  5HP4 A;  5CA7 A;  4RQ2 A;  1NOM A;  4PHD A;  5D49 A;  3GDX A;  3KHR A;  3K4G A;  1XC9 A;  2NRK A;  3Q8R B;  1ZQH A;  5DQH A;  4QZD A;  4RNM A;  3C1Z A;  7ICK A;  4JUZ A;  9ICC A;  3WFO A;  3TQ1 A;  4KLG A;  1A77 A;  4WC4 A;  3OGU A;  7ICV A;  1KNY A;  4RQ1 A;  8ICM A;  7ICR A;  1L5U A;  1ZQA A;  1XSP A;  2FMS A;  3SI8 A;  1U47 A;  4M9H A;  2FPK A;  5KFU A;  2NRT A;  1SL0 A;  4O5K A;  4DEZ A;  5J0X A;  8ICF A;  2RFF A;  3OVA A;  2KZ3 A;  5DQI A;  1MIY A;  1U45 A;  2ZH8 A;  2ZTC A;  2BCQ A;  5EOZ A;  2W8K A;  3TAN A;  4O5C A;  1KLN A;  3SV3 A;  4I2H A;  4I2G A;  1S0N A;  4FHW A;  4IQU A;  2ZH5 A;  3C23 A;  1ZQY A;  4FS1 A;  4DF8 A;  3HW8 A;  4IQW A;  2MUT A;  4R8U B;  1IM4 A;  2IBK A;  4RQ7 A;  4KLT A;  3KHG A;  1ARO P;  4NM2 A;  4J9O A;  8ICW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...