4F5PA

Open ternary mismatch complex of r283k dna polymerase beta with a datp analog
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of dNTP Intermediate States during DNA Polymerase Active Site Assembly.
pubmed doi rcsb
molecule keywords DNA polymerase beta
molecule tags Transferase, lyase/dna
source organism Homo sapiens
total genus 106
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f5pA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4f5pA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4f5pA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4f5pA03
1VJ7A 1L3UA 1T7PA 4Z6CA 4IQWA 1S76D 1T3NA 3RAQA 2AQ0A 4KLMA 3T5KA 3SI8A 1R8BA 2GWSA 1B43A 5KFVA 4R65A 4AT8B 5C5JA 3Q8SB 4DFJA 8ICVA 4K4IA 4LZDA 1UA1A 5TZVA 1ZQBA 3OVSA 1R8CA 3H3AA 2ZJ8A 5BOLA 3LK9A 3T5JA 5HNKA 5J0YA 1NJZA 1TK0A 4O9MA 2HW3A 4M6WB 1RYSA 4IQVA 5DB6A 4UAWA 5KFIA 3M8SA 1NKCA 4F4ZA 4RQ3A 4FH5A 3C18A 2BCVA 1NK5A 3TAPA 1SKRA 3WFOA 5HHHA 3RB3A 3OVAA 9ICMA 5DGAA 4AT9A 5HRLA 4ATBA 2ZTEA 3KHGA 1SKSA 3LDAA 3B0XA 8ICRA 3ISBA 1DK3A 5KFDA 4O5EA 5KT3A 3UPSA 4WC6A 4QW9A 1X9WA 1NK4A 4Z6EA 1MIWA 2UVUA 4LZGA 4YXJA 4NKUA 4QZCA 5DBCA 3HX0A 3TANA 4JWMA 4RWQA 5DDYA 2Y1JA 1VFGA 5DQHA 5KFNA 4UB4A 5J2JA 2C22A 4J9OA 4F5OA 3JPPA 4YN4A 3OHAA 4J9PA 1NJWA 3NYBA 5DEDA 3AUOA 5HRKA 4QWCA 1QSSA 8ICNA 1U48A 4J9QA 2ZH4A 5KT5A 3T5HA 5KFWA 2DR5A 1Z00B 5KFUA 3ISDA 1UT5A 2HHVA 3HPOA 4DS5A 4I2JA 4RU9A 2W9MA 2W8LA 7ICVA 1TFRA 5KFGA 1JXEA 3TAQA 4YVZA 4E0DA 4JWNA 5KT4A 1TAUA 4RT2A 3BQ2A 4WC4A 3MABA 4FS1A 2HVIA 1QSLA 1NK7A 5J0RA 4ECRA 3T5LA 3T3FA 2ZUCA 1NJYA 1MQ3A 5J2FA 4R8UA 2HHQA 4QZDA 4DFKA 3V7LA 1ZQXA 4RUCA 4O3NA 3PW0A 4UQGA 5D49A 1S97A 4I2GA 2W9CB 1NK9A 4F4WA 4X4UA 5CA7A 1KDHA 2BPFA 3PV8A 4KTQA 5HRDA 4Z6DA 3IM1A 4NY8A 8ICUA 4EEYA 4FO6A 4XQ8A 5J2AA 4E8FA 2DRBA 2O5AA 4GXKA 4WC3A 1HUOA 1F5AA 2VANA 4QZ9A 1ZQZA 5D4BA 1ZQOA 2C2EA 4KLQA 1JX4A 1K1SA 3OJUA 3RR7A 1ZQMA 3GIKA 4Q45A 2F1IA 3EW9A 4JK1A 2IHNA 3WFPA 4RZRA 2BCUA 4YD2A 4WBYA 4O3RA 4ED2A 4M47A 2ZH2A 3EPGA 4KLIA 4IG8A 4UB5A 4DL5A 5HRGA 3KHRA 5KFKA 4S3NA 4EBCA 5HMLA 5BOMA 4R64A 3KHHA 3C2MA 3RJKA 9ICLA 1Q79A 2BQ3A 8ICKA 4UD4A 1ZQWA 3GV7B 5DLFA 5J2HA 3RJJA 3AQNA 3RJGA 4DQQA 4QZHA 2KFNA 2AU0A 1R8AA 1S9FA 4RUAA 5KFYA 2UVRA 1JMSA 8ICJA 2H5XA 2XY7A 3PMNA 4DF8A 2XGPA 2IHMA 2XCPA 8ICTA 9ICNA 3ISCA 3NTUA 2IMWP 3HJ4A 2ZH9A 4IQUA 3TFSA 1N48A 3AQKA 5EWGA 4RQ6A 3Q8LA 4BGDA 2HHPA 2DR9A 2PFQA 4WC2A 3TQ1A 2ZTDA 5KFQA 3C5GA 3RH5A 4FHWA 4NM2A 2P6RA 1KLNA 4RWOA 3RB4A 4YMMA 2ISPA 4WC7A 4J9KA 4IRDA 1ZJMA 4YQWA 4J9NA 5KG5A 5DBAA 7ICHA 9ICWA 2BQUA 4RPXA 9ICFA 3H4DA 1NKBA 1TK5A 2ZUBA 3RR8A 2HHUA 2PI5A 5IIJA 3PO5A 4O3QA 8ICMA 4IRCA 4X4TA 4MFAA 3JPSA 3OSNA 1RXVA 2M2WA 2DR8A 4RWNA 3JPRA 1ZQDA 3SYZA 1ZQVA 4UBBA 4M9HA 2B21A 3H8JA 4C8NA 4RQ4A 2HHXA 1H38A 4M0AA 1U4BA 4G3IA 4BWMA 1JXLA 3EYZA 3AU6A 4KLLA 4QWAA 2XY6A 1ZJNA 9ICCA 4WBZA 5F9NA 5IIOA 3Q8PB 5L1IA 4O3PA 1BPZA 5HRHA 4KITB 1QLNA 3OUYB 3BQ1A 3M9NB 4DOCA 2DRAA 3C1YA 4DLGA 1NK8A 3LQCB 3G6YA 2ASLA 3V72A 4BXOA 4AT7B 1IM4A 1RPLA 3LWLA 3H39A 4RNNA 3GQCA 2JZBA 4KLSA 2FMSA 3RAXA 1KFSA 1S10A 3B0YA 3MR3A 5IINA 4I2FA 4ED0A 3UQ2A 5KFLA 4PHDA 1KFDA 1D9DA 5IIMA 2W9BA 4UD5A 2HVHA 4UB3A 4Q43A 4EP7A 2ZJ5A 5KFPA 4EZ6A 5KFRA 3HWTA 5KG2A 1KSPA 4F4XA 4DSLA 1Y88A 4O0IA 4TQRA 4UAZA 2A1JA 1S77D 3UPQA 2FPLA 5KTQA 5JUMA 5KFJA 4GXIA 4P4OA 3PX0A 2I1QA 1MSWD 2NRTA 4YXMA 3SZ2A 4ED8A 1MQ2A 3V6JA 4ECSA 5KG3A 3RB0A 2FLLA 2VA8A 4DL2A 2ALZA 4RQ0A 3PX4A 1AROP 1T8EA 2R8KA 4B9UA 1ZQIA 2BCQA 2ZHBA 1ZQNA 1A76A 2JEIA 5KFTA 4RQ5A 4EYIB 1JIHA 2ZJAA 2VA2A 4ECXA 3MR5A 2BGWA 4PGQA 1ZQJA 1ZQRA 4F50A 2UVVA 4DSJA 4PHAA 3AU2A 1UETA 3H8WA 5F2VO 4XA5A 4MF8A 1UEUA 4P4PA 7ICMA 1Z00A 5J2EA 4ATBB 1ZQUA 4FHYA 3OJSA 3V7JA 3SV3A 4C8OA 4FBTA 4O5CA 2NRXA 4PH5A 8ICIA 5DG7A 4WC5A 1TFWA 4F5QA 4J9LA 2J6UA 4ZH4A 4RQ8A 2BPCA 4DQSA 2BR0A 4DQIA 2RDJA 5HRBA 3PR4A 4QWBA 3RB6A 2PBEA 3OV7A 2AGQA 9ICAA 2P6UA 3LWMA 1DK2A 5CB1A 7ICQA 2BDPA 2R8GA 1PX5A 4YR2A 5L1LA 2LYHA 2W9CA 4YCXA 4KN4A 3HT3A 3PW7A 2M2TA 1WOTA 4XRHA 3UXNA 3NGDA 2XC9A 1N56A 3MBYA 5KFMA 3RJHA 4F4KA 5KG7A 4IRKA 4I2AA 3E2EA 8ICQA 9ICEA 2ISOA 1Q78A 1LB2B 4X0AA 4J9SA 1D8LA 3PO4A 3PW2A 1XWLA 5DDMA 4NLGA 4M9NA 4QZAA 4TURA 4EBKA 3Q8QB 2NRZA 4B9LA 2V4QA 2W8KA 4YP3A 4ECTA 3JZ0A 5KT7A 4DL6A 1ZYQA 5F9LA 5DQIA 3RH6A 3V6HA 2V9WA 9ICRA 1NOMA 2FPMA 4M9JA 5J0XA 4MEXA 3BDPA 3MDAA 8ICEA 4X0BA 2HHSA 1ZQGA 4WCWA 4XUSA 5HMMA 1B22A 2NRKA 1ZQTA 3TI0A 2MUTB 4I2IA 5J29A 4RQ2A 1HJPA 3HW8A 1ZQPA 2M2VA 5J2BA 4LVSA 5KFCA 5IILA 2FLPA 2VA3A 1JAJA 1SKWA 9ICHA 2PFPA 1DGSA 5J2GA 3RRGA 4ELUA 5J2DA 1BNPA 3WFRE 7ICKA 3GV5B 4TUPA 4DF4A 4NKTA 4PPXA 4QZ8A 8ICBA 2ID1A 4UB2A 3MDCA 9ICGA 5KFSA 4UB1A 4JV1A 1BVSA 3PNCA 4B9NA 3ZDEA 2NRVA 3PX6A 8ICOA 8ICPA 5HR9A 1BPDA 2ZH5A 2HHTA 1YLQA 4RPYA 3SV4A 4PHPA 3PVXA 4DSKA 3MGIA 4EYHB 5KFHA 4DO9A 1TV9A 4XQ7A 5DECA 5J0OA 3ZDAA 3IHQB 3QZ8A 2XCAA 4DSFA 4DOAA 4QW8A 2RDIA 4O3OA 4I2BA 3PR5B 4NLKA 3OVBA 4ECUA 1OU5A 3KTQA 7ICIA 2KZ3A 4QZFA 3UXPA 4KLFA 3MFHA 3GFKB 4DL3A 5KT2A 5DB9A 2XY5A 2V4RA 5HRIA 3EWAA 3RJFA 2AGOA 2M9NA 4EBDA 1RZTA 4M5DA 3M9MB 4F5NA 3RBEA 4KLGA 4DL7A 4DL4A 2I9GA 1TVAA 4B9MA 3EZ5A 1ZQFA 3ZD9A 4PGXA 4YR0A 2J6SA 4DSEA 2ZUDA 3Q8KA 1L5UA 2C28A 1ZQLA 4FH3A 1RXWA 5KFZA 1MIVA 5CR0A 4M2YA 2KZZA 5BPCA 1ZQHA 3ETLA 4KMUA 2F1JA 1UEVA 4P4MA 4I2HA 5DQGA 4I2CA 2BCSA 1ZETA 4KLUA 4RNMA 5J0QA 3H37A 2JEJA 4KLJA 3PW4A 4R66A 1WCNA 3ZDCA 3GIJA 1KRPA 3MR6A 3C5FA 3GV8B 2ZH8A 2PI4A 7ICRA 4QZEA 7ICGA 1CEZA 3H8SA 4I27A 3PW5A 3G6XA 5HHIA 3C23A 5J2KA 9ICJA 2ZH6A 4X4OA 3V6KA 3K75D 3V7KA 1S0NA 2PFOA 5KFBA 3HP6A 5L9XA 4B9SA 4JV2A 8ICSA 3RH4A 5D46A 1C7YA 1D9FA 3AQMA 4ELTA 5KFOA 3MR2A 4F8RA 3ZDBA 1Z3EB 4DWIA 4K4HA 5DKWA 4M9GA 3H38A 4AT8A 8ICGA 2R8IA 2F1HA 2AQ4A 5L1JA 2JEFA 4QZGA 1UA0A 3M9OB 4TUSA 4NM1A 3OSPA 4ED7A 4I2EA 2DPJA 5DBBA 5J0PA 5KG0A 3PY8A 4TQSA 4M6WA 2HHWA 2IA6A 1BGXT 1RYRA 7ICTA 2M2UA 4IR9A 7ICEA 4JUZA 4KLDA 5DG9A 4TUQA 5J0UA 1TKDA 4YMOA 1EXNA 4GLXA 1XSNA 1A77A 2FMQA 2ZHAA 9ICBA 5EWFA 4DS4A 1U47A 4RNOA 2P66A 4C8MA 3ZD8A 2FPKA 1UT8A 4YFKA 2W9BB 4ED1A 3JPTA 5J0TA 1S0MA 4I29A 3MFIA 3JPOA 4ED3A 1MC8A 4F5PA 4QWEA 1SL1A 1JN3A 4PGYA 4F92B 2J6TA 2XO7A 2A1JB 4F3OA 4DQPA 4M9LA 2KN7A 4X4SA 4Z6FA 4YD1A 5KG1A 3UXOA 5EWEA 3Q8RB 2ZH1A 1ZQCA 9ICKA 3M8RA 4IR1A 8ICWA 2BQRA 4AT9B 2DR7A 1KTQA 1T4GA 1X9SA 2ZTCA 1X9MA 4ECZA 3EPIA 4CCHA 1JQRA 4X5VA 3BQTA 4ECYA 5HP4A 4MEYA 2PXIA 1BPBA 9ICIA 3G6VA 2DVIA 4LT6A 5KG4A 1KNYA 8ICXA 4FBUA 3BJYA 3THVA 8ICFA 8ICAA 4RT3A 4GC7A 4C8KA 8ICZA 2DFLA 4Q8FA 5KT6A 1X2IA 1BPXA 4P2HA 1U49A 9ICVA 3TARA 1NO5A 1COOA 4F2SA 2Y1IA 7ICPA 4C8LA 4ECWA 3UQ0A 1U9LA 2ASJA 1ZQQA 1FA0A 4FHVA 1NK6A 4QZBA 1V9PA 4DLEA 2R8JA 7ICLA 1IXRA 1TAQA 4EBJA 1BPYA 5J2IA 1R89A 3RBDA 4BDPA 9ICUA 4ED6A 4R8UB 2BHNA 3H4BA 1ZQSA 9ICQA 4Q8EA 4E80A 1TFYA 2NRWA 9ICTA 3QE9Y 5DB8A 1NZPA 2PFNA 1HUZA 4UBCA 2IBKA 3OHBA 4FS2A 4EBEA 8ICYA 1TK8A 2C2RA 5KFXA 4KN7A 2RFFA 3GIMA 4RQ7A 1SZPA 4Q44A 4MFCA 3KHLA 1DOQA 3ZDDA 2MUTA 5KFFA 4DQRA 2KTQA 3GILA 3AQLA 4BWJA 1ZQAA 4F4YA 1ZQKA 4FHXA 1LV5A 2WTFA 4NLNA 3MGHA 1MIYA 3ORYA 1BPEA 4E7XA 4WC1A 2Q0ZX 3RRHA 5CHGA 4RWPA 3QEBZ 1PZNA 3H40A 3Q8MA 1NK0A 2BPGA 1CUKA 5KG6A 1QSYA 2UVWA 8ICLA 2KFZA 2KP7A 3L9DA 3JYYA 2ATLA 5DLGA 3RJIA 5J2CA 4YMNA 4QZIA 2C2DA 2JEGA 2OWOA 7ICUA 3WFSC 4X4VA 1S0OA 4GC6A 1V4AA 5HC9A 3FYHA 4PHEA 3RTVA 4J9MA 3N97B 2FLNA 2FMPA 4KLOA 7ICNA 4DFPA 4ECVA 4DSIA 1XSPA 2MAXA 1NKEA 1WCLA 2DPIA 2AJQA 1NJXA 3OGUA 4DOBA 1XS9D 1ZQEA 4ECQA 1L3SA 5J0SA 3TFRA 1L3TA 4B9VA 9ICOA 1SL0A 8ICCA 5HREA 4DFMA 2XGQA 1QTMA 9ICSA 3FDSA 1L3VA 1K1QA 2BKEA 4J9RA 4F5RA 4GXJA 3C1ZA 4ELVA 4B9TA 4I2DA 3C2LA 2KZMA 1BNOA 4X4NA 3PMLA 1D8YA 4WC0A 9ICPA 5CJ7A 1XC9A 3HIYA 4NLZA 3C21A 1SL2A 4R63A 5EOZA 7ICOA 5DGBA 1ZQYA 4YG2A 4RQ1A 3BQ0A 4KLEA 3OUYA 2AGPA 4I28A 4KLHA 5IIIA 4X4RA 4MF2A 1XU4A 2R8HA 4F2RA 3GDXA 4AT7A 4O3SA 5CWRA 3K4GA 5DB7A 2ASDA 4DEZA 3C66A 4IQTA 1XO1A 3JPNA 7ICSA 3C2KA 2BE3A 4X4PA 4RPZA 3QZ7A 4EZ9A 3H7IA 1U45A 3WFQE 3N4MB 9ICXA 4NXZA 3QEAZ 5IIKA 4JV0A 4X4QA 3HJ1A 5L1KA 3RJEA 4MFFA 4K4GA 4QWDA 4O5KA 2ZH7A 4FHPA 2BCRA 4YR3A 3GIIA 3JPQA 4M04A 7ICFA 2ZH3A 4HYKA 1KEJA 4BXOB 2Q66A 1S0VA 1KFTA 2O1PA 5CP2A 4F91B 2W9AA 5J0WA 4KLTA 5KFAA 5DG8A 2JZBB 5HRFA 7ICJA 5KFEA 1XSLA 4F93B 4UAYA 8ICHA
chains in the Genus database with same CATH superfamily
1KBUA 1LVHA 4Z6CA 1S76D 1T3NA 1V97A 1PUZA 2AQ0A 3L5KA 3T5KA 4KLMA 3SD7A 4EELA 5KAFU 1ZQBA 2ZJ8A 3SAHA 1TK0A 1RYSA 4IQVA 4FH5A 5AM3A 2CN1A 3TAPA 2YN4A 1SKRA 5DGAA 3HKZC 5EE0A 1SKSA 3B0XA 4CGZA 2YX8A 1DK3A 5KFDA 3UPSA 3UMBA 2DKZA 4JWMA 2CRXA 4Y2XA 4OJOA 2C22A 4UB4A 2AJQA 2A1AA 4F5OA 2Y9TA 3OHAA 4Y2PA 2KJ9A 3NYBA 4PJ0U 4QWCA 1QSSA 1QQ6A 2H3FA 1XO0A 2HHVA 4LEYA 5AIBA 2W8LA 3WKBA 3TAQA 3MABA 4FS1A 1NJYA 5J2FA 1SXEA 3V7LA 1YZ6A 3PSTA 1KDHA 2E5SA 5AK3A 8ICUA 4EEYA 1QCKA 4E8FA 4WQKA 3PZPA 1HUOA 4QZ9A 5D4BA 2G08A 1QQ7A 3OJUA 2W03A 3N7PD 5AKHA 4M47A 3KHRA 5HMLA 4R64A 3C2MA 1Q79A 4WOYA 5D62A 3UMGA 4UD4A 5J2HA 2AU0A 1R8AA 4RUAA 1JMSA 2XY7A 4DF8A 2XCPA 5AM1A 1PK1B 2IMWP 1V38A 3TFSA 1GPJA 1FIQA 3WK8A 2DR9A 1SGGA 4WC2A 3C5GA 3D2NA 2PKEA 5DBAA 9ICWA 2BQUA 4RPXA 3PO5A 5AKKA 3OSNA 5CHEA 4RWNA 3SYZA 2B21A 3H8JA 2JRZA 1H38A 1JXLA 3EYZA 1N62A 5ALEA 5IIOA 4DOCA 4DLGA 2QARA 3G6YA 2GLEA 1RPLA 3H39A 3AM9A 2HBJA 1S10A 3MR3A 1MN8A 4PHDA 1D9DA 3QNMA 5IIMA 2IOFA 3DV9A 5AI4A 2W9BA 3ICXA 4EP7A 5KFRA 1OUQA 3BS7A 1F44A 4DSLA 1Y88A 2HSZA 1S77D 4KM5A 2EQYA 2FPLA 5KFJA 4P4OA 3PX0A 1J97A 4LEVA 1MQ2A 5KG3A 3RB0A 2FLLA 2DR8A 4RQ0A 3PX4A 4EGWA 2MU2A 4EYIB 1JIHA 1FEZA 1KW4A 3RF9A 1SIJA 3MR5A 2KNJA 4F50A 4XA5A 4MF8A 4OAIZ 1P7DA 5J2EA 3ER9B 4ATBB 3OJSA 3SV3A 4FBTA 5DG7A 3OTQA 2J6UA 3EUB2 2IUBA 4OD0A 2PBEA 3CW2C 2BDPA 2M2TA 3UXNA 9ICOA 4X0AA 5DDMA 2KEYA 4QZAA 4GFJA 3Q8QB 2BBJA 2V4QA 5KT7A 2Y0SF 2YTUA 3RH6A 9ICRA 1NOMA 4MEXA 4C80A 1Q8KA 1ZQGA 3UMCA 1B22A 4Y2QA 1B0XA 3BS5B 2MUTB 4RQ2A 4Y2VA 5J2BA 5KFCA 4QJFB 9ICHA 1Z1VA 5J2GA 4ELUA 5J2DA 3HJEA 2KHVA 4KB6A 4DF4A 1PK1A 4NKTA 4QZ8A 3MDCA 2W54A 2N1RA 4FZLA 3PNCA 2KSOB 8ICOA 8ICPA 5HR9A 1BPDA 2HHTA 2ZIUB 5KAIU 3H0MB 4EYHB 3D2QA 5KFHA 1DXSA 4XQ7A 5DECA 2KVCA 4DOAA 2RP5A 3PR5B 1OU5A 2HBMA 2KZ3A 3MFHA 4DL3A 3RFAA 2V4RA 1FFUA 4M5DA 4EBDA 1L7OA 3M9MB 4KLGA 4DFDA 4DL7A 2DGZA 4B9MA 2DR5A 3ZD9A 4PGXA 1L5UA 4FH3A 4OJ5A 5CR0A 2IHOA 2F1JA 5B5EU 4I2CA 2DKXA 1ED1A 3PW4A 1X6JA 1KRPA 3GV8B 1CEZA 5CEHA 5ALLA 2RRDA 3C23A 2ZH6A 4NJ8A 2QKQA 4B9SA 3HP6A 3HILA 5D46A 1C7YA 1D9FA 3ZDBA 4AT8A 5AIAA 4M9GA 8ICGA 1FFVA 3M9OB 4TUSA 5DBBA 5J0PA 1X40A 5KG0A 3N7SC 3AMZA 3PY8A 4M6WA 1BGXT 4IR9A 3IG5A 1K5OA 1A77A 5EWFA 3AQEA 1YT3A 5ALOA 4F5PA 5CFUA 4PGYA 4X4SA 2A1JB 5KG1A 4NV0A 4BJQA 5JU5A 8ICWA 4AT9B 4ECZA 1JQRA 4ECYA 1Z4NA 5AKIA 1BPBA 2DVIA 4FBUA 3KD3A 2ZIXB 4K99A 4Q8FA 2YY6A 9ICVA 1NO5A 2Y1IA 3WK9A 1FA0A 3UQ0A 1U9LA 2RHFA 1UHUA 7ICLA 2KG5A 4EBJA 3LVVA 2BHNA 1X42A 2KMDA 9ICQA 4E80A 2NRWA 4F72A 3IN5A 4FS2A 2G09A 1TK8A 4K9AA 2RFFA 4KN7A 4Q44A 4AYBF 5A0LA 4MFCA 2KIVA 2MUTA 3AQLA 4LJXA 1ZQAA 4F4YA 1ZQKA 4MKPA 1A0PA 3H40A 1NK0A 3OVSA 1CUKA 4NWIA 1QSYA 1L8OA 3SMVA 2ATLA 5DLGA 2OWOA 2KSOA 2QB0B 3QX7A 1S0OA 2FMPA 3N97B 1RQNA 2MAXA 2E8MA 2DPIA 4NXVA 4UAVA 1ZQEA 1OW5A 5HREA 3C28A 1K1QA 4J9RA 4G9BA 4ELVA 5G5GA 4I2DA 2B4VA 4X4NA 5AKZA 4WC0A 1XC9A 7ICOA 2I6XA 4RQ1A 3OUYA 2AGPA 4I28A 4KLHA 4X4RA 4MF2A 1B4FA 5DB7A 4O3SA 3C66A 3KKAC 4EZ9A 2WHEA 3H7IA 1U45A 4X4QA 5J8YC 1MA7A 4QWDA 2ZH7A 2G5IB 4UW9A 4B6JA 4C4TA 2GA9D 2DF4B 5CP2A 5KFAA 5KFEA 1BNPA 2HBKA 4US8A 3RAQA 1M6YA 3AEVA 1B43A 8ICVA 1R8CA 3T5JA 5J0YA 3MC1A 2HW3A 2WF5A 5DB6A 3M8SA 1NKCA 3C18A 2JXJA 4AT9A 2NO4A 3LDAA 4NLBA 5KT3A 4QW9A 5AK6A 1MIWA 1HEKA 2UVUA 3HX0A 5DBCA 4RWQA 2Y1JA 2KZMA 1NJWA 4YN4A 4J9PA 2ZH4A 2W3RA 1U48A 5KT5A 3T5HA 5KFWA 1X66A 1Z00B 5AKGA 1UT5A 7ICVA 2F3NA 4RU9A 1TFRA 5KFGA 3A0BU 5F2VO 4RT2A 3BQ2A 2HVIA 3LVWA 1NK7A 3D2SA 2HHQA 2MRLA 1ZQXA 3NWIA 2EAOA 4RUCA 5D49A 4I2GA 2B6GA 2W9CB 4X4UA 3PV8A 2ODGA 3IM1A 4NY8A 4XQ8A 2O5AA 3IG8A 4WC3A 5F3XB 1COKA 1ZQZA 3QU4A 4Y2JA 2LHTA 1ZQOA 2KJ8A 3NVYA 2KKPA 1JX4A 5TISU 3GIKA 2F1IA 3PSIA 4WBYA 4YD2A 4ED2A 3EPGA 4K97A 4DL5A 5HRGA 5KFKA 2K60A 3AQNA 4DQQA 4PL2A 2K4PA 5KFYA 1V85A 2H5XA 2IHMA 8ICTA 2Y0SC 4Y2YA 3HJ4A 4USAA 4IQUA 1N48A 1QQ5A 5ALUA 4RQ6A 4BGDA 1SWVA 3TQ1A 4JLZA 3RB4A 2BBHA 4UASA 2K4HA 7ICHA 9ICFA 1TK5A 2PI5A 4X4TA 1RXVA 2W11A 2ZXIA 3JPRA 1N5WA 1ZQVA 3KKAA 4M0AA 1U4BA 4G3IA 5B66U 1OXJA 3AU6A 4CNQA 5J8YA 4KLLA 5AICA 1BPZA 3Q8PB 5L1IA 5HRHA 3BQ1A 1NNLA 3H0LB 3C1YA 2ASLA 3V72A 1IM4A 1O08A 3LWLA 4OJPA 4Y2RA 3GQCA 3GU3A 4KLSA 2FMSA 3B0YA 1SZHA 4ED0A 2K4EA 2VKQA 3UQ2A 1KFDA 2H3IA 4UD5A 3H0RB 1VJ5A 4Q43A 2EAPA 4EZ6A 1KSPA 2F8LA 5KG2A 4TQRA 1VLBA 4UAZA 3UPQA 5KTQA 4OJ6A 4WJ3B 3SZ2A 4ED8A 3V6JA 2HMXA 2ALZA 1T8EA 4B9UA 1AROP 1ZQNA 5KFTA 2BGWA 1ZQRA 2EANA 4DSJA 1Z00A 3KBBA 1UCVA 2R18A 4C8OA 1TFWA 4F5QA 4J9LA 4ZH4A 1PK3A 9ICAA 4WH5A 2P6UA 2R8GA 4QIWC 5L1LA 2LYHA 2W9CA 5ALIA 3MBYA 3RJHA 3E2EA 8ICQA 2OYYA 2WB1C 1LB2B 1D8LA 4NLGA 3PW2A 4A8EA 4TURA 5AM0A 1ZYQA 4BX9C 2PMZF 4UB6U 3MDAA 2KK0A 4X0BA 4ACOA 3A0HU 4FFDA 5HMMA 2GOLA 1X9XA 2NRKA 3L4PA 5J29A 4CRXA 1ZQPA 5JRTA 2WF8A 3RRGA 5ALYA 7ICKA 1ECWA 4PPXA 5EE9A 2ID1A 4UB2A 3TADA 5B3QA 4B9NA 3I76A 1KL9A 1TV9A 4AYBC 3ZDAA 3QZ8A 3IHQB 1LKYA 4DSFA 4I2BA 3OVBA 4C4SA 4ECUA 7ICIA 4KLFA 5KT2A 5D63A 3RJFA 2AGOA 1RZTA 4DL4A 2I9GA 1TVAA 2WFAA 3Q8KA 1ZQLA 3BQ7A 2KZZA 2G0AA 1UEVA 4P4MA 1RM6C 5DQGA 1ZETA 1S8OA 4RNMA 3H37A 3F5AA 2JEJA 4R66A 1JALA 2ZH8A 2PI4A 4QZEA 4UATA 4Y2SA 3KZIU 3H8SA 3PW5A 5J2KA 1HIWA 3V6KA 1S0NA 5HRDA 8ICSA 5KFBA 3RH4A 5KFOA 3MR2A 1Z19A 4DWIA 2LYAA 5DKWA 2I5HA 2YMLA 1UPHA 2F1HA 4QZGA 4ED7A 2DPJA 2YMQA 4CE6A 2A3VA 4TQSA 2IA6A 7ICTA 2M2UA 7ICEA 1JUDA 4JUZA 4NL9A 3FAHA 4KLDA 5DG9A 1TKDA 2ES6A 3IRUA 2FMQA 3QU2A 4DS4A 4ED1A 3N28A 4KX5A 3VCBA 3MFIA 4ED3A 3M7DA 1J2MA 2F44A 4QWEA 1D8BA 2F8KA 5AM4A 1JN3A 2XO7A 4DQPA 4YD1A 3Q8RB 4EEDA 3QU9A 3WK6A 1X9MA 4CCHA 2OHFA 3BQTA 1NZBA 4EV6A 3G6VA 4NXWA 5KG4A 4CF4A 8ICXA 3SR6A 4RT3A 4NXXA 8ICZA 3QU7A 2W55A 1X2IA 5AKYA 1BPXA 4F2SA 2ASJA 1NK6A 4DLEA 2R8JA 1BPYA 5J2IA 1R89A 4BDPA 9ICUA 1TFYA 1ZQSA 4Q8EA 1CRXA 9ICTA 3QE9Y 5DB8A 5AI9A 2PFNA 4UBCA 2K8BB 8ICYA 4EBEA 2E1EA 5KFXA 3GIMA 2Y9UA 1SZPA 1WWVA 3KHLA 5KFFA 5H2FU 4BWJA 1ZQ1C 2KV2A 2Z7JA 3MGHA 4WC1A 2Q0ZX 4P0PB 5CHGA 4Y2UA 4RWPA 3Q8MA 2UVWA 2JV3A 8ICLA 5KG6A 2KFZA 2C2DA 3WFSC 4QZIA 7ICUA 2O6KA 4GIBA 4GC6A 1RDFA 1V4AA 2B51A 3FYHA 4KLOA 2G06A 4OAHA 1KN5A 4OAGA 1NKEA 1WCLA 1T94A 1NJXA 4DOBA 1L3SA 4WC7A 8ICCA 1L3VA 2KE7A 2ZIWB 4GXJA 1L6NA 3C1ZA 2KICA 4B9TA 3NRZA 1WYGA 3PMLA 9ICPA 5CJ7A 3HIYA 2AHOB 4R63A 5DGBA 4UARA 3BQ0A 4KLEA 1A6SA 1XU4A 2R8HA 4LEZA 5ALQA 3K4GA 4EENA 1UQVA 2BE3A 2OCEA 2G07A 2E8PA 1Z4OA 3N4MB 4UAUA 9ICXA 3QEAZ 2HI0A 3T79A 1IG6A 5EE3A 4FHPA 2BCRA 4YR3A 3GIIA 1PVQA 2Q66A 1S0VA 2XIDA 2O1PA 5J0WA 4KLTA 2JZBB 5HRFA 4I0UA 3RB6A 8ICHA 1VJ7A 1ZXIA 4IQWA 3CP8A 2GWSA 2LBOA 4R65A 5C5JA 2XICA 3R9KA 4QIWF 4LZDA 4K4IA 1DRGA 5BOLA 5HNKA 1RYUA 1NJZA 5KFIA 2WB1F 3KOOA 4RQ3A 2BCVA 5AKEA 3WFOA 5ALVA 3RB3A 3OVAA 9ICMA 4ATBA 2ZTEA 3ISBA 4O5EA 4WC6A 1NK4A 1ZD5A 2JR5A 2LM4A 4LZGA 4YXJA 4QZCA 3TANA 3QXGA 3FC4A 5DDYA 2FI1A 5J2JA 5DEDA 3JPPA 5ALKA 3AUOA 5ALWA 2EDUA 8ICNA 4J9QA 3CRXA 4FZMA 5KFUA 4EEBA 3HPOA 4DS5A 4I2JA 2W9MA 4UB8U 4C4RA 2H3VA 4E0DA 1TAUA 4K9BA 4KMOB 3WK5A 2AXTU 5J0RA 3T5LA 4C7YA 2F77X 2GH1A 4DFKA 5AM5A 5KNIA 4KTQA 3BS5A 2DQNB 4CF5A 4FO6A 3WK4A 5J2AA 2DRBA 3E58A 1F5AA 2VANA 2E3TA 3SAFA 4KLQA 2HOIA 3RR7A 4Q45A 2FE9A 4JK1A 4O3RA 2ZIUA 5BOMA 3K1RB 1ZQWA 3S6JA 3GV7B 2EZXA 5DLFA 3RJJA 3RJGA 2VIXA 4QZHA 1L7PA 2UVRA 8ICJA 2W7PA 1Q3UA 1TAMA 9ICNA 3ISCA 3NTUA 2PMZC 3DDHA 3AQKA 5L1MA 2PFQA 5KL8B 3RH5A 4NM2A 2P6RA 3EF2A 5T14A 4YMMA 3OWGA 4OO1J 4J9NA 5KG5A 2ZUBA 3RR8A 2HHUA 5IIJA 1YZ7A 4O3QA 4IRCA 4MFAA 2B56A 2LYBA 4C8NA 4RQ4A 1SWWA 2KIWA 4QWAA 1ZJNA 9ICCA 4WBZA 2KHQA 1QLNA 2DRAA 3M9NB 1Q3VA 1WG8A 3M6KA 3CK6A 4AT7B 3HRDD 4RNNA 2JZBA 2KOBA 3ER8C 3RAXA 2K89A 5IINA 3QUTA 2HVHA 2XVTA 5AM2A 2ZJ5A 2OM6A 2A1JA 2W43A 3SENA 5KL1B 2I1QA 2NRTA 5ALSA 4YXMA 4K96A 1PVRA 4ECSA 3BZCA 2VA8A 4DL2A 2R8KA 3QUBA 1ZQIA 2ZHBA 3M1YA 1A76A 2JEIA 2ZIXA 2VA2A 5GTIU 4ECXA 2UVVA 3F2BA 3AU2A 3H8WA 4FHYA 4O5CA 4WC5A 2NRXA 4RQ8A 2BPCA 4DQSA 3NVZA 2RDJA 5HRBA 2AGQA 2L5YA 5CB1A 7ICQA 1PX5A 3PW7A 2HOQA 4YCXA 4KN4A 1L7MA 3HT3A 1WOTA 1N56A 3NGDA 2XC9A 5KFMA 1Q78A 4Y2TA 5KG7A 4IRKA 4I2AA 2ISOA 4J9SA 1XWLA 4M9NA 2NRZA 2W8KA 2XI9A 2VJ5A 3MGVA 3V6HA 5J0XA 3CNHA 8ICEA 2Q4TA 2HHSA 2QB0A 5K4LA 1ZQTA 1URJA 1HJPA 2M2VA 4N7RA 4JMUA 4LVSA 5IILA 2VA3A 4AP9A 1JAJA 1SKWA 2W7OA 1DGSA 2ZXHA 3WFRE 3GV5B 4TUPA 3TADC 8ICBA 4LEWA 9ICGA 2M0NA 4UB1A 3UM9A 4IS7A 2NRVA 3ZDEA 3PX6A 1YLQA 4RPYA 3SV4A 4PHPA 3PVXA 4DSKA 2HDOA 4HAIA 4DO9A 3NRWA 2IOFK 4QW8A 4O3OA 2EZZA 1AQ6A 3UXPA 5DB9A 2XY5A 3F5EA 5HRIA 1SB3C 4F5NA 2ZG6A 3D6JA 1ZQFA 1X6IA 2J6SA 4DSEA 2ZUDA 2K8AA 1RXWA 5KFZA 1MIVA 2LMRA 3ETLA 1ZQHA 1QH9A 3ONNA 2QLTA 1SV4A 2CPRA 2BCSA 5ALHA 4KLJA 2F76X 2GAFD 2B0CA 3GIJA 1L8LA 3C5FA 3L3FX 3G6XA 5HHIA 9ICJA 5AI6A 3WKCA 2PFOA 3V7KA 5L9XA 2E1FA 3AQMA 4K4HA 1ZD4A 5CRXA 2R8IA 5AI0A 2QARB 3OSPA 1ZD3A 5AK5A 4EX6A 2HHWA 3FM9A 4NL9C 3F53A 3SAGA 3M6ZA 4OJLA 5J0UA 4YMOA 5ALXA 1EXNA 4GLXA 5AI8A 9ICBA 1U47A 4RNOA 2W9BB 1UT8A 4YFKA 2LM1A 1JI7A 5J0TA 4I29A 3JPOA 1MC8A 1SL1A 4FE3A 2J6TA 4F92B 4M9LA 5AKLA 2KN7A 4Z6FA 1ZQCA 3M8RA 2DL0A 2BQRA 1X9SA 1T4GA 1WUDA 5AHXA 4F71A 5HP4A 2PXIA 1O03A 1JRPA 2BDUA 3BJYA 3THVA 8ICAA 4GC7A 2DFLA 5KT6A 4P2HA 1U49A 2HOFA 1COOA 1SV0C 4C8LA 2WF9A 1ZQQA 4FHVA 4QZBA 1V9PA 1IXRA 5AKXA 4ED6A 4R8UB 3I28A 2RLTA 1HUZA 2IBKA 3OHBA 3I1YA 5ALMA 1N60A 3AQFA 2C2RA 4U7CA 1TE2A 1DOQA 2JH7A 3GILA 3N7RC 4FHXA 1LV5A 1BPEA 3RRHA 5ALRA 3QEBZ 1PZNA 2BPGA 4NLCA 3ETRA 5ALNA 2JEGA 4K8VA 2K8CB 2FLNA 4DFPA 5ALFA 3IDWA 1N61A 1XS9D 4B9VA 1S5LU 4ECQA 4X4OA 5J0SA 1L3TA 1SL0A 4DFMA 9ICSA 1ZRMA 3ZI4A 4CDGA 5HR7A 1F5SA 1SL2A 3QYPA 5EOZA 4YG2A 2FCLA 5IIIA 4F2RA 2ASDA 4DEZA 2NO5A 7ICSA 2D6FC 3AL0B 5C0YA 4OAFA 4NXZA 3QU5A 1ZOLA 3RJEA 7ICFA 5AK4A 2JMGA 4FZNA 4BXOB 2CXYA 1RG6A 2W9AA 5DG8A 7ICJA 5EE1A 4MHVA 1XSLA 2WTFA 4F93B 1L3UA 1T7PA 5CFTA 3SI8A 1R8BA 5KFVA 4AT8B 4EX7A 3Q8SB 4DFJA 3GZFA 1UA1A 5TZVA 3PSPA 3H3AA 3LK9A 2KVSA 5E79U 3VC8A 4O9MA 1L7NA 4M6WB 5ALDA 4UAWA 3OPXA 4F4ZA 1NK5A 5HHHA 5HRLA 3KHGA 8ICRA 1X9WA 4Z6EA 4NKUA 3WKDA 3F2CA 1WWUA 2WAQF 1VFGA 1N63A 5DQHA 5KFNA 4J9OA 5HRKA 3ISDA 2HCFA 1DGJA 5HR6A 1SV0A 1JXEA 4YVZA 2LI6A 4JWNA 5KT4A 2HN2A 1QSLA 4ECRA 3T3FA 2FDRA 2OXOA 2ZUCA 1MQ3A 4K98A 4R8UA 4QZDA 3PW0A 4O3NA 2ZIVB 2W3SA 4UQGA 1PVPA 1S97A 1NK9A 4F4WA 2MA1A 2H3ZA 3B9JA 5CA7A 2BPFA 4P0QB 4BUGA 3NASA 4Z6DA 4O68A 3IP4B 2JH1A 3C29A 4GXKA 2C2EA 1F0MA 3QUQA 1K1SA 4NXUA 1ZQMA 3EW9A 3WFPA 2IHNA 4RZRA 2BCUA 2YMMA 2ZH2A 4KLIA 4IG8A 4UB5A 4S3NA 4EBCA 3KHHA 3RJKA 9ICLA 2E8OA 2BQ3A 8ICKA 4O69A 2KFNA 1S9FA 3NUQA 3PMNA 2XGPA 1SXDA 2ZH9A 5EWGA 3Q8LA 2W04A 2VJ4A 2HHPA 2ZTDA 5KFQA 4RWOA 4FHWA 4PZNA 1KLNA 3WU2U 1RQLA 4J9KA 4IRDA 1ZJMA 4YQWA 4O3MA 3H4DA 1NKBA 2H3QA 5ALZA 8ICMA 3WK7A 3JPSA 2M2WA 1ZQDA 4C0ZA 4UBBA 4M9HA 4FO1A 2HHXA 4KX3A 4BWMA 2WF7A 2XY6A 5G5HA 5F9NA 4O3PA 1GO3F 4KITB 2LKYA 3OUYB 3JCFA 2JGAA 1NK8A 3LQCB 1T3QA 4BXOA 3KFUF 3HKZF 4EEKA 1KFSA 1IV8A 2MSNA 4I2FA 5KFLA 3SEIA 4UB3A 3WKEA 3U26A 5KFPA 3HWTA 3NS1A 4F4XA 4O0IA 2OH2A 5D61A 1Q46A 5JUMA 4GXIA 1MSWD 3ALRA 2YB1A 4J03A 2BZFA 2BCQA 4RQ5A 2ZJAA 2DUYA 5ALJA 3QUCA 1ZQJA 4PGQA 3O0FA 2OEHA 2D8CA 4PHAA 1UETA 1UEUA 4P4PA 7ICMA 2YMPA 1ZQUA 3V7JA 8ICIA 4PH5A 3NKUA 3TACB 2BR0A 4DQIA 3KZXA 3PR4A 4QWBA 3OV7A 3LWMA 1DK2A 2ZIVA 4C7ZA 4YR2A 2EWRA 4US9A 4XRHA 4P0QA 4F4KA 4WC4A 4NXTA 9ICEA 3PO4A 4QNLA 4EBKA 2WF6A 4B9LA 1ZRNA 4YP3A 4ECTA 5B3PA 3JZ0A 4DL6A 3MCRA 5F9LA 5DQIA 4P0PA 2V9WA 2A19A 2FPMA 5JTGA 4M9JA 3F2DA 4O6AA 3BDPA 1KKXA 4WCWA 4XUSA 2QB1A 3TI0A 4I2IA 1N2XA 3HW8A 2FLPA 2FJ6A 2PFPA 4IL6U 3IV6A 3J81j 2ZIWA 3PHZA 5KFSA 4JV1A 2HBLA 1BVSA 2ZH5A 3MGIA 1IIPA 2EAMA 5J0OA 2XCAA 5ALGA 2RDIA 4DCCA 4NLKA 1JROA 3KTQA 4QZFA 3GFKB 3EWAA 2EZYA 2M9NA 5ALTA 3RBEA 3EZ5A 4JLXA 2KKVA 4YR0A 2P35A 2C28A 4M2YA 4U6PA 5BPCA 4KMUA 4O67A 2E8NA 4I2HA 1Z1BA 4KLUA 5J0QA 3K1ZA 3NVWA 1WCNA 1FO4A 4RQMA 3ZDCA 3MR6A 7ICRA 7ICGA 1N5XA 4I27A 4CF3A 3ERCC 3K75D 4ZOHC 4JV2A 5AKJA 4ELTA 4F8RA 1Z3EB 4OCZA 3PSFA 3H8MA 3H38A 2AQ4A 5L1JA 2JEFA 1UA0A 4NM1A 4I2EA 5FP0A 4ICAA 5JTIA 1RYRA 4TUQA 1XSNA 2G5HB 2ZHAA 2KD1A 2P66A 4C8MA 3ZD8A 2FPKA 1S0MA 3JPTA 2NV3A 2HN1A 4F3OA 3UXOA 5EWEA 5AI5A 2ZH1A 9ICKA 4IR1A 2EH9A 2DR7A 1KTQA 2YQEA 2ZTCA 4PZOA 3EPIA 4X5VA 1XNSA 4MEYA 9ICIA 4LT6A 1KNYA 8ICFA 1VDVA 2D3DA 3E0FA 2YB4A 4C8KA 5GTHU 4XJEA 3TARA 7ICPA 4WQLA 4ECWA 3K7DA 1ZD2P 2RQ5A 4JB3A 4IC9A 1TAQA 2DWQA 3RBDA 3H4BA 3AN1A 2F2AB 1NZPA 2NYVA 2WAQC 2IOHA 3LYSA 4PL1A 4RQ7A 2LPEA 3ED5A 1C20A 3ZDDA 2KTQA 4DQRA 4NLNA 1MIYA 3ORYA 4E7XA 5CFSA 1CI4A 2KP7A 3L9DA 3JYYA 3RJIA 5J2CA 4YMNA 4X4VA 3NVOA 3NVVA 5HC9A 4PHEA 3RTVA 4J9MA 7ICNA 4ECVA 2ESEA 4DSIA 1XSPA 3OGUA 3TFRA 2KJ5A 5ALPA 2XGQA 1QTMA 3FDSA 4HX0A 2BKEA 4F5RA 1BNOA 3C2LA 1D8YA 4NLZA 3C21A 3DEEA 1LKYB 1ZQYA 2K4IA 3GDXA 2GO7A 3TKAA 5CWRA 4AT7A 4IQTA 1XO1A 3JPNA 4X4PA 3C2KA 4RPZA 3QZ7A 3WFQE 5IIKA 4JV0A 3HJ1A 5L1KA 4MFFA 4K4GA 4RQNA 4O5KA 1J2NA 2JHDA 3JPQA 4M04A 3BZKA 2ZH3A 4HYKA 1KQQA 1KEJA 3WKAA 1KFTA 4F91B 1NI3A 2DBYA 3SQIA 2AH5A 2ISPA 3CYMA 4UAYA
chains in the Genus database with same CATH topology
1VJ7A 1L3UA 1T7PA 4Z6CA 4IQWA 1S76D 1T3NA 3RAQA 2AQ0A 4KLMA 3T5KA 3SI8A 1R8BA 2GWSA 1B43A 5KFVA 4R65A 4AT8B 5C5JA 3Q8SB 4DFJA 8ICVA 4K4IA 4LZDA 1UA1A 5TZVA 1ZQBA 3OVSA 1R8CA 3H3AA 2ZJ8A 5BOLA 3LK9A 3T5JA 5HNKA 5J0YA 1NJZA 1TK0A 4O9MA 2HW3A 4M6WB 1RYSA 4IQVA 5DB6A 4UAWA 5KFIA 3M8SA 1NKCA 4F4ZA 4RQ3A 4FH5A 3C18A 2BCVA 1NK5A 3TAPA 1SKRA 3WFOA 5HHHA 3RB3A 3OVAA 9ICMA 5DGAA 4AT9A 5HRLA 4ATBA 2ZTEA 3KHGA 1SKSA 3LDAA 3B0XA 8ICRA 3ISBA 1DK3A 5KFDA 4O5EA 5KT3A 3UPSA 4WC6A 4QW9A 1X9WA 1NK4A 4Z6EA 1MIWA 2UVUA 4LZGA 4YXJA 4NKUA 4QZCA 5DBCA 3HX0A 3TANA 4JWMA 4RWQA 5DDYA 2Y1JA 1VFGA 5DQHA 5KFNA 4UB4A 5J2JA 2C22A 4J9OA 4F5OA 3JPPA 4YN4A 3OHAA 4J9PA 1NJWA 3NYBA 5DEDA 3AUOA 5HRKA 4QWCA 1QSSA 8ICNA 1U48A 4J9QA 2ZH4A 5KT5A 3T5HA 5KFWA 2DR5A 1Z00B 5KFUA 3ISDA 1UT5A 2HHVA 3HPOA 4DS5A 4I2JA 4RU9A 2W9MA 2W8LA 7ICVA 1TFRA 5KFGA 1JXEA 3TAQA 4YVZA 4E0DA 4JWNA 5KT4A 1TAUA 4RT2A 3BQ2A 4WC4A 3MABA 4FS1A 2HVIA 1QSLA 1NK7A 5J0RA 4ECRA 3T5LA 3T3FA 2ZUCA 1NJYA 1MQ3A 5J2FA 4R8UA 2HHQA 4QZDA 4DFKA 3V7LA 1ZQXA 4RUCA 4O3NA 3PW0A 4UQGA 5D49A 1S97A 4I2GA 2W9CB 1NK9A 4F4WA 4X4UA 5CA7A 1KDHA 2BPFA 3PV8A 4KTQA 5HRDA 4Z6DA 3IM1A 4NY8A 8ICUA 4EEYA 4FO6A 4XQ8A 5J2AA 4E8FA 2DRBA 2O5AA 4GXKA 4WC3A 1HUOA 1F5AA 2VANA 4QZ9A 1ZQZA 5D4BA 1ZQOA 2C2EA 4KLQA 1JX4A 1K1SA 3OJUA 3RR7A 1ZQMA 3GIKA 4Q45A 2F1IA 3EW9A 4JK1A 2IHNA 3WFPA 4RZRA 2BCUA 4YD2A 4WBYA 4O3RA 4ED2A 4M47A 2ZH2A 3EPGA 4KLIA 4IG8A 4UB5A 4DL5A 5HRGA 3KHRA 5KFKA 4S3NA 4EBCA 5HMLA 5BOMA 4R64A 3KHHA 3C2MA 3RJKA 9ICLA 1Q79A 2BQ3A 8ICKA 4UD4A 1ZQWA 3GV7B 5DLFA 5J2HA 3RJJA 3AQNA 3RJGA 4DQQA 4QZHA 2KFNA 2AU0A 1R8AA 1S9FA 4RUAA 5KFYA 2UVRA 1JMSA 8ICJA 2H5XA 2XY7A 3PMNA 4DF8A 2XGPA 2IHMA 2XCPA 8ICTA 9ICNA 3ISCA 3NTUA 2IMWP 3HJ4A 2ZH9A 4IQUA 3TFSA 1N48A 3AQKA 5EWGA 4RQ6A 3Q8LA 4BGDA 2HHPA 2DR9A 2PFQA 4WC2A 3TQ1A 2ZTDA 5KFQA 3C5GA 3RH5A 4FHWA 4NM2A 2P6RA 1KLNA 4RWOA 3RB4A 4YMMA 2ISPA 4WC7A 4J9KA 4IRDA 1ZJMA 4YQWA 4J9NA 5KG5A 5DBAA 7ICHA 9ICWA 2BQUA 4RPXA 9ICFA 3H4DA 1NKBA 1TK5A 2ZUBA 3RR8A 2HHUA 2PI5A 5IIJA 3PO5A 4O3QA 8ICMA 4IRCA 4X4TA 4MFAA 3JPSA 3OSNA 1RXVA 2M2WA 2DR8A 4RWNA 3JPRA 1ZQDA 3SYZA 1ZQVA 4UBBA 4M9HA 2B21A 3H8JA 4C8NA 4RQ4A 2HHXA 1H38A 4M0AA 1U4BA 4G3IA 4BWMA 1JXLA 3EYZA 3AU6A 4KLLA 4QWAA 2XY6A 1ZJNA 9ICCA 4WBZA 5F9NA 5IIOA 3Q8PB 5L1IA 4O3PA 1BPZA 5HRHA 4KITB 1QLNA 3OUYB 3BQ1A 3M9NB 4DOCA 2DRAA 3C1YA 4DLGA 1NK8A 3LQCB 3G6YA 2ASLA 3V72A 4BXOA 4AT7B 1IM4A 1RPLA 3LWLA 3H39A 4RNNA 3GQCA 2JZBA 4KLSA 2FMSA 3RAXA 1KFSA 1S10A 3B0YA 3MR3A 5IINA 4I2FA 4ED0A 3UQ2A 5KFLA 4PHDA 1KFDA 1D9DA 5IIMA 2W9BA 4UD5A 2HVHA 4UB3A 4Q43A 4EP7A 2ZJ5A 5KFPA 4EZ6A 5KFRA 3HWTA 5KG2A 1KSPA 4F4XA 4DSLA 1Y88A 4O0IA 4TQRA 4UAZA 2A1JA 1S77D 3UPQA 2FPLA 5KTQA 5JUMA 5KFJA 4GXIA 4P4OA 3PX0A 2I1QA 1MSWD 2NRTA 4YXMA 3SZ2A 4ED8A 1MQ2A 3V6JA 4ECSA 5KG3A 3RB0A 2FLLA 2VA8A 4DL2A 2ALZA 4RQ0A 3PX4A 1AROP 1T8EA 2R8KA 4B9UA 1ZQIA 2BCQA 2ZHBA 1ZQNA 1A76A 2JEIA 5KFTA 4RQ5A 4EYIB 1JIHA 2ZJAA 2VA2A 4ECXA 3MR5A 2BGWA 4PGQA 1ZQJA 1ZQRA 4F50A 2UVVA 4DSJA 4PHAA 3AU2A 1UETA 3H8WA 5F2VO 4XA5A 4MF8A 1UEUA 4P4PA 7ICMA 1Z00A 5J2EA 4ATBB 1ZQUA 4FHYA 3OJSA 3V7JA 3SV3A 4C8OA 4FBTA 4O5CA 2NRXA 4PH5A 8ICIA 5DG7A 4WC5A 1TFWA 4F5QA 4J9LA 2J6UA 4ZH4A 4RQ8A 2BPCA 4DQSA 2BR0A 4DQIA 2RDJA 5HRBA 3PR4A 4QWBA 3RB6A 2PBEA 3OV7A 2AGQA 9ICAA 2P6UA 3LWMA 1DK2A 5CB1A 7ICQA 2BDPA 2R8GA 1PX5A 4YR2A 5L1LA 2LYHA 2W9CA 4YCXA 4KN4A 3HT3A 3PW7A 2M2TA 1WOTA 4XRHA 3UXNA 3NGDA 2XC9A 1N56A 3MBYA 5KFMA 3RJHA 4F4KA 5KG7A 4IRKA 4I2AA 3E2EA 8ICQA 9ICEA 2ISOA 1Q78A 1LB2B 4X0AA 4J9SA 1D8LA 3PO4A 3PW2A 1XWLA 5DDMA 4NLGA 4M9NA 4QZAA 4TURA 4EBKA 3Q8QB 2NRZA 4B9LA 2V4QA 2W8KA 4YP3A 4ECTA 3JZ0A 5KT7A 4DL6A 1ZYQA 5F9LA 5DQIA 3RH6A 3V6HA 2V9WA 9ICRA 1NOMA 2FPMA 4M9JA 5J0XA 4MEXA 3BDPA 3MDAA 8ICEA 4X0BA 2HHSA 1ZQGA 4WCWA 4XUSA 5HMMA 1B22A 2NRKA 1ZQTA 3TI0A 2MUTB 4I2IA 5J29A 4RQ2A 1HJPA 3HW8A 1ZQPA 2M2VA 5J2BA 4LVSA 5KFCA 5IILA 2FLPA 2VA3A 1JAJA 1SKWA 9ICHA 2PFPA 1DGSA 5J2GA 3RRGA 4ELUA 5J2DA 1BNPA 3WFRE 7ICKA 3GV5B 4TUPA 4DF4A 4NKTA 4PPXA 4QZ8A 8ICBA 2ID1A 4UB2A 3MDCA 9ICGA 5KFSA 4UB1A 4JV1A 1BVSA 3PNCA 4B9NA 3ZDEA 2NRVA 3PX6A 8ICOA 8ICPA 5HR9A 1BPDA 2ZH5A 2HHTA 1YLQA 4RPYA 3SV4A 4PHPA 3PVXA 4DSKA 3MGIA 4EYHB 5KFHA 4DO9A 1TV9A 4XQ7A 5DECA 5J0OA 3ZDAA 3IHQB 3QZ8A 2XCAA 4DSFA 4DOAA 4QW8A 2RDIA 4O3OA 4I2BA 3PR5B 4NLKA 3OVBA 4ECUA 1OU5A 3KTQA 7ICIA 2KZ3A 4QZFA 3UXPA 4KLFA 3MFHA 3GFKB 4DL3A 5KT2A 5DB9A 2XY5A 2V4RA 5HRIA 3EWAA 3RJFA 2AGOA 2M9NA 4EBDA 1RZTA 4M5DA 3M9MB 4F5NA 3RBEA 4KLGA 4DL7A 4DL4A 2I9GA 1TVAA 4B9MA 3EZ5A 1ZQFA 3ZD9A 4PGXA 4YR0A 2J6SA 4DSEA 2ZUDA 3Q8KA 1L5UA 2C28A 1ZQLA 4FH3A 1RXWA 5KFZA 1MIVA 5CR0A 4M2YA 2KZZA 5BPCA 1ZQHA 3ETLA 4KMUA 2F1JA 1UEVA 4P4MA 4I2HA 5DQGA 4I2CA 2BCSA 1ZETA 4KLUA 4RNMA 5J0QA 3H37A 2JEJA 4KLJA 3PW4A 4R66A 1WCNA 3ZDCA 3GIJA 1KRPA 3MR6A 3C5FA 3GV8B 2ZH8A 2PI4A 7ICRA 4QZEA 7ICGA 1CEZA 3H8SA 4I27A 3PW5A 3G6XA 5HHIA 3C23A 5J2KA 9ICJA 2ZH6A 4X4OA 3V6KA 3K75D 3V7KA 1S0NA 2PFOA 5KFBA 3HP6A 5L9XA 4B9SA 4JV2A 8ICSA 3RH4A 5D46A 1C7YA 1D9FA 3AQMA 4ELTA 5KFOA 3MR2A 4F8RA 3ZDBA 1Z3EB 4DWIA 4K4HA 5DKWA 4M9GA 3H38A 4AT8A 8ICGA 2R8IA 2F1HA 2AQ4A 5L1JA 2JEFA 4QZGA 1UA0A 3M9OB 4TUSA 4NM1A 3OSPA 4ED7A 4I2EA 2DPJA 5DBBA 5J0PA 5KG0A 3PY8A 4TQSA 4M6WA 2HHWA 2IA6A 1BGXT 1RYRA 7ICTA 2M2UA 4IR9A 7ICEA 4JUZA 4KLDA 5DG9A 4TUQA 5J0UA 1TKDA 4YMOA 1EXNA 4GLXA 1XSNA 1A77A 2FMQA 2ZHAA 9ICBA 5EWFA 4DS4A 1U47A 4RNOA 2P66A 4C8MA 3ZD8A 2FPKA 1UT8A 4YFKA 2W9BB 4ED1A 3JPTA 5J0TA 1S0MA 4I29A 3MFIA 3JPOA 4ED3A 1MC8A 4F5PA 4QWEA 1SL1A 1JN3A 4PGYA 4F92B 2J6TA 2XO7A 2A1JB 4F3OA 4DQPA 4M9LA 2KN7A 4X4SA 4Z6FA 4YD1A 5KG1A 3UXOA 5EWEA 3Q8RB 2ZH1A 1ZQCA 9ICKA 3M8RA 4IR1A 8ICWA 2BQRA 4AT9B 2DR7A 1KTQA 1T4GA 1X9SA 2ZTCA 1X9MA 4ECZA 3EPIA 4CCHA 1JQRA 4X5VA 3BQTA 4ECYA 5HP4A 4MEYA 2PXIA 1BPBA 9ICIA 3G6VA 2DVIA 4LT6A 5KG4A 1KNYA 8ICXA 4FBUA 3BJYA 3THVA 8ICFA 8ICAA 4RT3A 4GC7A 4C8KA 8ICZA 2DFLA 4Q8FA 5KT6A 1X2IA 1BPXA 4P2HA 1U49A 9ICVA 3TARA 1NO5A 1COOA 4F2SA 2Y1IA 7ICPA 4C8LA 4ECWA 3UQ0A 1U9LA 2ASJA 1ZQQA 1FA0A 4FHVA 1NK6A 4QZBA 1V9PA 4DLEA 2R8JA 7ICLA 1IXRA 1TAQA 4EBJA 1BPYA 5J2IA 1R89A 3RBDA 4BDPA 9ICUA 4ED6A 4R8UB 2BHNA 3H4BA 1ZQSA 9ICQA 4Q8EA 4E80A 1TFYA 2NRWA 9ICTA 3QE9Y 5DB8A 1NZPA 2PFNA 1HUZA 4UBCA 2IBKA 3OHBA 4FS2A 4EBEA 8ICYA 1TK8A 2C2RA 5KFXA 4KN7A 2RFFA 3GIMA 4RQ7A 1SZPA 4Q44A 4MFCA 3KHLA 1DOQA 3ZDDA 2MUTA 5KFFA 4DQRA 2KTQA 3GILA 3AQLA 4BWJA 1ZQAA 4F4YA 1ZQKA 4FHXA 1LV5A 2WTFA 4NLNA 3MGHA 1MIYA 3ORYA 1BPEA 4E7XA 4WC1A 2Q0ZX 3RRHA 5CHGA 4RWPA 3QEBZ 1PZNA 3H40A 3Q8MA 1NK0A 2BPGA 1CUKA 5KG6A 1QSYA 2UVWA 8ICLA 2KFZA 2KP7A 3L9DA 3JYYA 2ATLA 5DLGA 3RJIA 5J2CA 4YMNA 4QZIA 2C2DA 2JEGA 2OWOA 7ICUA 3WFSC 4X4VA 1S0OA 4GC6A 1V4AA 5HC9A 3FYHA 4PHEA 3RTVA 4J9MA 3N97B 2FLNA 2FMPA 4KLOA 7ICNA 4DFPA 4ECVA 4DSIA 1XSPA 2MAXA 1NKEA 1WCLA 2DPIA 2AJQA 1NJXA 3OGUA 4DOBA 1XS9D 1ZQEA 4ECQA 1L3SA 5J0SA 3TFRA 1L3TA 4B9VA 9ICOA 1SL0A 8ICCA 5HREA 4DFMA 2XGQA 1QTMA 9ICSA 3FDSA 1L3VA 1K1QA 2BKEA 4J9RA 4F5RA 4GXJA 3C1ZA 4ELVA 4B9TA 4I2DA 3C2LA 2KZMA 1BNOA 4X4NA 3PMLA 1D8YA 4WC0A 9ICPA 5CJ7A 1XC9A 3HIYA 4NLZA 3C21A 1SL2A 4R63A 5EOZA 7ICOA 5DGBA 1ZQYA 4YG2A 4RQ1A 3BQ0A 4KLEA 3OUYA 2AGPA 4I28A 4KLHA 5IIIA 4X4RA 4MF2A 1XU4A 2R8HA 4F2RA 3GDXA 4AT7A 4O3SA 5CWRA 3K4GA 5DB7A 2ASDA 4DEZA 3C66A 4IQTA 1XO1A 3JPNA 7ICSA 3C2KA 2BE3A 4X4PA 4RPZA 3QZ7A 4EZ9A 3H7IA 1U45A 3WFQE 3N4MB 9ICXA 4NXZA 3QEAZ 5IIKA 4JV0A 4X4QA 3HJ1A 5L1KA 3RJEA 4MFFA 4K4GA 4QWDA 4O5KA 2ZH7A 4FHPA 2BCRA 4YR3A 3GIIA 3JPQA 4M04A 7ICFA 2ZH3A 4HYKA 1KEJA 4BXOB 2Q66A 1S0VA 1KFTA 2O1PA 5CP2A 4F91B 2W9AA 5J0WA 4KLTA 5KFAA 5DG8A 2JZBB 5HRFA 7ICJA 5KFEA 1XSLA 4F93B 4UAYA 8ICHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJ7 A;  1L3U A;  1T7P A;  4Z6C A;  4IQW A;  1S76 D;  1T3N A;  3RAQ A;  2AQ0 A;  4KLM A;  3T5K A;  3SI8 A;  1R8B A;  2GWS A;  1B43 A;  5KFV A;  4R65 A;  4AT8 B;  5C5J A;  3Q8S B;  4DFJ A;  8ICV A;  4K4I A;  4LZD A;  1UA1 A;  5TZV A;  1ZQB A;  3OVS A;  1R8C A;  3H3A A;  2ZJ8 A;  5BOL A;  3LK9 A;  3T5J A;  5HNK A;  5J0Y A;  1NJZ A;  1TK0 A;  4O9M A;  2HW3 A;  4M6W B;  1RYS A;  4IQV A;  5DB6 A;  4UAW A;  5KFI A;  3M8S A;  1NKC A;  4F4Z A;  4RQ3 A;  4FH5 A;  3C18 A;  2BCV A;  1NK5 A;  3TAP A;  1SKR A;  3WFO A;  5HHH A;  3RB3 A;  3OVA A;  9ICM A;  5DGA A;  4AT9 A;  5HRL A;  4ATB A;  2ZTE A;  3KHG A;  1SKS A;  3LDA A;  3B0X A;  8ICR A;  3ISB A;  1DK3 A;  5KFD A;  4O5E A;  5KT3 A;  3UPS A;  4WC6 A;  4QW9 A;  1X9W A;  1NK4 A;  4Z6E A;  1MIW A;  2UVU A;  4LZG A;  4YXJ A;  4NKU A;  4QZC A;  5DBC A;  3HX0 A;  3TAN A;  4JWM A;  4RWQ A;  5DDY A;  2Y1J A;  1VFG A;  5DQH A;  5KFN A;  4UB4 A;  5J2J A;  2C22 A;  4J9O A;  4F5O A;  3JPP A;  4YN4 A;  3OHA A;  4J9P A;  1NJW A;  3NYB A;  5DED A;  3AUO A;  5HRK A;  4QWC A;  1QSS A;  8ICN A;  1U48 A;  4J9Q A;  2ZH4 A;  5KT5 A;  3T5H A;  5KFW A;  2DR5 A;  1Z00 B;  5KFU A;  3ISD A;  1UT5 A;  2HHV A;  3HPO A;  4DS5 A;  4I2J A;  4RU9 A;  2W9M A;  2W8L A;  7ICV A;  1TFR A;  5KFG A;  1JXE A;  3TAQ A;  4YVZ A;  4E0D A;  4JWN A;  5KT4 A;  1TAU A;  4RT2 A;  3BQ2 A;  4WC4 A;  3MAB A;  4FS1 A;  2HVI A;  1QSL A;  1NK7 A;  5J0R A;  4ECR A;  3T5L A;  3T3F A;  2ZUC A;  1NJY A;  1MQ3 A;  5J2F A;  4R8U A;  2HHQ A;  4QZD A;  4DFK A;  3V7L A;  1ZQX A;  4RUC A;  4O3N A;  3PW0 A;  4UQG A;  5D49 A;  1S97 A;  4I2G A;  2W9C B;  1NK9 A;  4F4W A;  4X4U A;  5CA7 A;  1KDH A;  2BPF A;  3PV8 A;  4KTQ A;  5HRD A;  4Z6D A;  3IM1 A;  4NY8 A;  8ICU A;  4EEY A;  4FO6 A;  4XQ8 A;  5J2A A;  4E8F A;  2DRB A;  2O5A A;  4GXK A;  4WC3 A;  1HUO A;  1F5A A;  2VAN A;  4QZ9 A;  1ZQZ A;  5D4B A;  1ZQO A;  2C2E A;  4KLQ A;  1JX4 A;  1K1S A;  3OJU A;  3RR7 A;  1ZQM A;  3GIK A;  4Q45 A;  2F1I A;  3EW9 A;  4JK1 A;  2IHN A;  3WFP A;  4RZR A;  2BCU A;  4YD2 A;  4WBY A;  4O3R A;  4ED2 A;  4M47 A;  2ZH2 A;  3EPG A;  4KLI A;  4IG8 A;  4UB5 A;  4DL5 A;  5HRG A;  3KHR A;  5KFK A;  4S3N A;  4EBC A;  5HML A;  5BOM A;  4R64 A;  3KHH A;  3C2M A;  3RJK A;  9ICL A;  1Q79 A;  2BQ3 A;  8ICK A;  4UD4 A;  1ZQW A;  3GV7 B;  5DLF A;  5J2H A;  3RJJ A;  3AQN A;  3RJG A;  4DQQ A;  4QZH A;  2KFN A;  2AU0 A;  1R8A A;  1S9F A;  4RUA A;  5KFY A;  2UVR A;  1JMS A;  8ICJ A;  2H5X A;  2XY7 A;  3PMN A;  4DF8 A;  2XGP A;  2IHM A;  2XCP A;  8ICT A;  9ICN A;  3ISC A;  3NTU A;  2IMW P;  3HJ4 A;  2ZH9 A;  4IQU A;  3TFS A;  1N48 A;  3AQK A;  5EWG A;  4RQ6 A;  3Q8L A;  4BGD A;  2HHP A;  2DR9 A;  2PFQ A;  4WC2 A;  3TQ1 A;  2ZTD A;  5KFQ A;  3C5G A;  3RH5 A;  4FHW A;  4NM2 A;  2P6R A;  1KLN A;  4RWO A;  3RB4 A;  4YMM A;  2ISP A;  4WC7 A;  4J9K A;  4IRD A;  1ZJM A;  4YQW A;  4J9N A;  5KG5 A;  5DBA A;  7ICH A;  9ICW A;  2BQU A;  4RPX A;  9ICF A;  3H4D A;  1NKB A;  1TK5 A;  2ZUB A;  3RR8 A;  2HHU A;  2PI5 A;  5IIJ A;  3PO5 A;  4O3Q A;  8ICM A;  4IRC A;  4X4T A;  4MFA A;  3JPS A;  3OSN A;  1RXV A;  2M2W A;  2DR8 A;  4RWN A;  3JPR A;  1ZQD A;  3SYZ A;  1ZQV A;  4UBB A;  4M9H A;  2B21 A;  3H8J A;  4C8N A;  4RQ4 A;  2HHX A;  1H38 A;  4M0A A;  1U4B A;  4G3I A;  4BWM A;  1JXL A;  3EYZ A;  3AU6 A;  4KLL A;  4QWA A;  2XY6 A;  1ZJN A;  9ICC A;  4WBZ A;  5F9N A;  5IIO A;  3Q8P B;  5L1I A;  4O3P A;  1BPZ A;  5HRH A;  4KIT B;  1QLN A;  3OUY B;  3BQ1 A;  3M9N B;  4DOC A;  2DRA A;  3C1Y A;  4DLG A;  1NK8 A;  3LQC B;  3G6Y A;  2ASL A;  3V72 A;  4BXO A;  4AT7 B;  1IM4 A;  1RPL A;  3LWL A;  3H39 A;  4RNN A;  3GQC A;  2JZB A;  4KLS A;  2FMS A;  3RAX A;  1KFS A;  1S10 A;  3B0Y A;  3MR3 A;  5IIN A;  4I2F A;  4ED0 A;  3UQ2 A;  5KFL A;  4PHD A;  1KFD A;  1D9D A;  5IIM A;  2W9B A;  4UD5 A;  2HVH A;  4UB3 A;  4Q43 A;  4EP7 A;  2ZJ5 A;  5KFP A;  4EZ6 A;  5KFR A;  3HWT A;  5KG2 A;  1KSP A;  4F4X A;  4DSL A;  1Y88 A;  4O0I A;  4TQR A;  4UAZ A;  2A1J A;  1S77 D;  3UPQ A;  2FPL A;  5KTQ A;  5JUM A;  5KFJ A;  4GXI A;  4P4O A;  3PX0 A;  2I1Q A;  1MSW D;  2NRT A;  4YXM A;  3SZ2 A;  4ED8 A;  1MQ2 A;  3V6J A;  4ECS A;  5KG3 A;  3RB0 A;  2FLL A;  2VA8 A;  4DL2 A;  2ALZ A;  4RQ0 A;  3PX4 A;  1ARO P;  1T8E A;  2R8K A;  4B9U A;  1ZQI A;  2BCQ A;  2ZHB A;  1ZQN A;  1A76 A;  2JEI A;  5KFT A;  4RQ5 A;  4EYI B;  1JIH A;  2ZJA A;  2VA2 A;  4ECX A;  3MR5 A;  2BGW A;  4PGQ A;  1ZQJ A;  1ZQR A;  4F50 A;  2UVV A;  4DSJ A;  4PHA A;  3AU2 A;  1UET A;  3H8W A;  5F2V O;  4XA5 A;  4MF8 A;  1UEU A;  4P4P A;  7ICM A;  1Z00 A;  5J2E A;  4ATB B;  1ZQU A;  4FHY A;  3OJS A;  3V7J A;  3SV3 A;  4C8O A;  4FBT A;  4O5C A;  2NRX A;  4PH5 A;  8ICI A;  5DG7 A;  4WC5 A;  1TFW A;  4F5Q A;  4J9L A;  2J6U A;  4ZH4 A;  4RQ8 A;  2BPC A;  4DQS A;  2BR0 A;  4DQI A;  2RDJ A;  5HRB A;  3PR4 A;  4QWB A;  3RB6 A;  2PBE A;  3OV7 A;  2AGQ A;  9ICA A;  2P6U A;  3LWM A;  1DK2 A;  5CB1 A;  7ICQ A;  2BDP A;  2R8G A;  1PX5 A;  4YR2 A;  5L1L A;  2LYH A;  2W9C A;  4YCX A;  4KN4 A;  3HT3 A;  3PW7 A;  2M2T A;  1WOT A;  4XRH A;  3UXN A;  3NGD A;  2XC9 A;  1N56 A;  3MBY A;  5KFM A;  3RJH A;  4F4K A;  5KG7 A;  4IRK A;  4I2A A;  3E2E A;  8ICQ A;  9ICE A;  2ISO A;  1Q78 A;  1LB2 B;  4X0A A;  4J9S A;  1D8L A;  3PO4 A;  3PW2 A;  1XWL A;  5DDM A;  4NLG A;  4M9N A;  4QZA A;  4TUR A;  4EBK A;  3Q8Q B;  2NRZ A;  4B9L A;  2V4Q A;  2W8K A;  4YP3 A;  4ECT A;  3JZ0 A;  5KT7 A;  4DL6 A;  1ZYQ A;  5F9L A;  5DQI A;  3RH6 A;  3V6H A;  2V9W A;  9ICR A;  1NOM A;  2FPM A;  4M9J A;  5J0X A;  4MEX A;  3BDP A;  3MDA A;  8ICE A;  4X0B A;  2HHS A;  1ZQG A;  4WCW A;  4XUS A;  5HMM A;  1B22 A;  2NRK A;  1ZQT A;  3TI0 A;  2MUT B;  4I2I A;  5J29 A;  4RQ2 A;  1HJP A;  3HW8 A;  1ZQP A;  2M2V A;  5J2B A;  4LVS A;  5KFC A;  5IIL A;  2FLP A;  2VA3 A;  1JAJ A;  1SKW A;  9ICH A;  2PFP A;  1DGS A;  5J2G A;  3RRG A;  4ELU A;  5J2D A;  1BNP A;  3WFR E;  7ICK A;  3GV5 B;  4TUP A;  4DF4 A;  4NKT A;  4PPX A;  4QZ8 A;  8ICB A;  2ID1 A;  4UB2 A;  3MDC A;  9ICG A;  5KFS A;  4UB1 A;  4JV1 A;  1BVS A;  3PNC A;  4B9N A;  3ZDE A;  2NRV A;  3PX6 A;  8ICO A;  8ICP A;  5HR9 A;  1BPD A;  2ZH5 A;  2HHT A;  1YLQ A;  4RPY A;  3SV4 A;  4PHP A;  3PVX A;  4DSK A;  3MGI A;  4EYH B;  5KFH A;  4DO9 A;  1TV9 A;  4XQ7 A;  5DEC A;  5J0O A;  3ZDA A;  3IHQ B;  3QZ8 A;  2XCA A;  4DSF A;  4DOA A;  4QW8 A;  2RDI A;  4O3O A;  4I2B A;  3PR5 B;  4NLK A;  3OVB A;  4ECU A;  1OU5 A;  3KTQ A;  7ICI A;  2KZ3 A;  4QZF A;  3UXP A;  4KLF A;  3MFH A;  3GFK B;  4DL3 A;  5KT2 A;  5DB9 A;  2XY5 A;  2V4R A;  5HRI A;  3EWA A;  3RJF A;  2AGO A;  2M9N A;  4EBD A;  1RZT A;  4M5D A;  3M9M B;  4F5N A;  3RBE A;  4KLG A;  4DL7 A;  4DL4 A;  2I9G A;  1TVA A;  4B9M A;  3EZ5 A;  1ZQF A;  3ZD9 A;  4PGX A;  4YR0 A;  2J6S A;  4DSE A;  2ZUD A;  3Q8K A;  1L5U A;  2C28 A;  1ZQL A;  4FH3 A;  1RXW A;  5KFZ A;  1MIV A;  5CR0 A;  4M2Y A;  2KZZ A;  5BPC A;  1ZQH A;  3ETL A;  4KMU A;  2F1J A;  1UEV A;  4P4M A;  4I2H A;  5DQG A;  4I2C A;  2BCS A;  1ZET A;  4KLU A;  4RNM A;  5J0Q A;  3H37 A;  2JEJ A;  4KLJ A;  3PW4 A;  4R66 A;  1WCN A;  3ZDC A;  3GIJ A;  1KRP A;  3MR6 A;  3C5F A;  3GV8 B;  2ZH8 A;  2PI4 A;  7ICR A;  4QZE A;  7ICG A;  1CEZ A;  3H8S A;  4I27 A;  3PW5 A;  3G6X A;  5HHI A;  3C23 A;  5J2K A;  9ICJ A;  2ZH6 A;  4X4O A;  3V6K A;  3K75 D;  3V7K A;  1S0N A;  2PFO A;  5KFB A;  3HP6 A;  5L9X A;  4B9S A;  4JV2 A;  8ICS A;  3RH4 A;  5D46 A;  1C7Y A;  1D9F A;  3AQM A;  4ELT A;  5KFO A;  3MR2 A;  4F8R A;  3ZDB A;  1Z3E B;  4DWI A;  4K4H A;  5DKW A;  4M9G A;  3H38 A;  4AT8 A;  8ICG A;  2R8I A;  2F1H A;  2AQ4 A;  5L1J A;  2JEF A;  4QZG A;  1UA0 A;  3M9O B;  4TUS A;  4NM1 A;  3OSP A;  4ED7 A;  4I2E A;  2DPJ A;  5DBB A;  5J0P A;  5KG0 A;  3PY8 A;  4TQS A;  4M6W A;  2HHW A;  2IA6 A;  1BGX T;  1RYR A;  7ICT A;  2M2U A;  4IR9 A;  7ICE A;  4JUZ A;  4KLD A;  5DG9 A;  4TUQ A;  5J0U A;  1TKD A;  4YMO A;  1EXN A;  4GLX A;  1XSN A;  1A77 A;  2FMQ A;  2ZHA A;  9ICB A;  5EWF A;  4DS4 A;  1U47 A;  4RNO A;  2P66 A;  4C8M A;  3ZD8 A;  2FPK A;  1UT8 A;  4YFK A;  2W9B B;  4ED1 A;  3JPT A;  5J0T A;  1S0M A;  4I29 A;  3MFI A;  3JPO A;  4ED3 A;  1MC8 A;  4F5P A;  4QWE A;  1SL1 A;  1JN3 A;  4PGY A;  4F92 B;  2J6T A;  2XO7 A;  2A1J B;  4F3O A;  4DQP A;  4M9L A;  2KN7 A;  4X4S A;  4Z6F A;  4YD1 A;  5KG1 A;  3UXO A;  5EWE A;  3Q8R B;  2ZH1 A;  1ZQC A;  9ICK A;  3M8R A;  4IR1 A;  8ICW A;  2BQR A;  4AT9 B;  2DR7 A;  1KTQ A;  1T4G A;  1X9S A;  2ZTC A;  1X9M A;  4ECZ A;  3EPI A;  4CCH A;  1JQR A;  4X5V A;  3BQT A;  4ECY A;  5HP4 A;  4MEY A;  2PXI A;  1BPB A;  9ICI A;  3G6V A;  2DVI A;  4LT6 A;  5KG4 A;  1KNY A;  8ICX A;  4FBU A;  3BJY A;  3THV A;  8ICF A;  8ICA A;  4RT3 A;  4GC7 A;  4C8K A;  8ICZ A;  2DFL A;  4Q8F A;  5KT6 A;  1X2I A;  1BPX A;  4P2H A;  1U49 A;  9ICV A;  3TAR A;  1NO5 A;  1COO A;  4F2S A;  2Y1I A;  7ICP A;  4C8L A;  4ECW A;  3UQ0 A;  1U9L A;  2ASJ A;  1ZQQ A;  1FA0 A;  4FHV A;  1NK6 A;  4QZB A;  1V9P A;  4DLE A;  2R8J A;  7ICL A;  1IXR A;  1TAQ A;  4EBJ A;  1BPY A;  5J2I A;  1R89 A;  3RBD A;  4BDP A;  9ICU A;  4ED6 A;  4R8U B;  2BHN A;  3H4B A;  1ZQS A;  9ICQ A;  4Q8E A;  4E80 A;  1TFY A;  2NRW A;  9ICT A;  3QE9 Y;  5DB8 A;  1NZP A;  2PFN A;  1HUZ A;  4UBC A;  2IBK A;  3OHB A;  4FS2 A;  4EBE A;  8ICY A;  1TK8 A;  2C2R A;  5KFX A;  4KN7 A;  2RFF A;  3GIM A;  4RQ7 A;  1SZP A;  4Q44 A;  4MFC A;  3KHL A;  1DOQ A;  3ZDD A;  2MUT A;  5KFF A;  4DQR A;  2KTQ A;  3GIL A;  3AQL A;  4BWJ A;  1ZQA A;  4F4Y A;  1ZQK A;  4FHX A;  1LV5 A;  2WTF A;  4NLN A;  3MGH A;  1MIY A;  3ORY A;  1BPE A;  4E7X A;  4WC1 A;  2Q0Z X;  3RRH A;  5CHG A;  4RWP A;  3QEB Z;  1PZN A;  3H40 A;  3Q8M A;  1NK0 A;  2BPG A;  1CUK A;  5KG6 A;  1QSY A;  2UVW A;  8ICL A;  2KFZ A;  2KP7 A;  3L9D A;  3JYY A;  2ATL A;  5DLG A;  3RJI A;  5J2C A;  4YMN A;  4QZI A;  2C2D A;  2JEG A;  2OWO A;  7ICU A;  3WFS C;  4X4V A;  1S0O A;  4GC6 A;  1V4A A;  5HC9 A;  3FYH A;  4PHE A;  3RTV A;  4J9M A;  3N97 B;  2FLN A;  2FMP A;  4KLO A;  7ICN A;  4DFP A;  4ECV A;  4DSI A;  1XSP A;  2MAX A;  1NKE A;  1WCL A;  2DPI A;  2AJQ A;  1NJX A;  3OGU A;  4DOB A;  1XS9 D;  1ZQE A;  4ECQ A;  1L3S A;  5J0S A;  3TFR A;  1L3T A;  4B9V A;  9ICO A;  1SL0 A;  8ICC A;  5HRE A;  4DFM A;  2XGQ A;  1QTM A;  9ICS A;  3FDS A;  1L3V A;  1K1Q A;  2BKE A;  4J9R A;  4F5R A;  4GXJ A;  3C1Z A;  4ELV A;  4B9T A;  4I2D A;  3C2L A;  2KZM A;  1BNO A;  4X4N A;  3PML A;  1D8Y A;  4WC0 A;  9ICP A;  5CJ7 A;  1XC9 A;  3HIY A;  4NLZ A;  3C21 A;  1SL2 A;  4R63 A;  5EOZ A;  7ICO A;  5DGB A;  1ZQY A;  4YG2 A;  4RQ1 A;  3BQ0 A;  4KLE A;  3OUY A;  2AGP A;  4I28 A;  4KLH A;  5III A;  4X4R A;  4MF2 A;  1XU4 A;  2R8H A;  4F2R A;  3GDX A;  4AT7 A;  4O3S A;  5CWR A;  3K4G A;  5DB7 A;  2ASD A;  4DEZ A;  3C66 A;  4IQT A;  1XO1 A;  3JPN A;  7ICS A;  3C2K A;  2BE3 A;  4X4P A;  4RPZ A;  3QZ7 A;  4EZ9 A;  3H7I A;  1U45 A;  3WFQ E;  3N4M B;  9ICX A;  4NXZ A;  3QEA Z;  5IIK A;  4JV0 A;  4X4Q A;  3HJ1 A;  5L1K A;  3RJE A;  4MFF A;  4K4G A;  4QWD A;  4O5K A;  2ZH7 A;  4FHP A;  2BCR A;  4YR3 A;  3GII A;  3JPQ A;  4M04 A;  7ICF A;  2ZH3 A;  4HYK A;  1KEJ A;  4BXO B;  2Q66 A;  1S0V A;  1KFT A;  2O1P A;  5CP2 A;  4F91 B;  2W9A A;  5J0W A;  4KLT A;  5KFA A;  5DG8 A;  2JZB B;  5HRF A;  7ICJ A;  5KFE A;  1XSL A;  4F93 B;  4UAY A;  8ICH A; 
#chains in the Genus database with same CATH topology
 1KBU A;  1LVH A;  4Z6C A;  1S76 D;  1T3N A;  1V97 A;  1PUZ A;  2AQ0 A;  3L5K A;  3T5K A;  4KLM A;  3SD7 A;  4EEL A;  5KAF U;  1ZQB A;  2ZJ8 A;  3SAH A;  1TK0 A;  1RYS A;  4IQV A;  4FH5 A;  5AM3 A;  2CN1 A;  3TAP A;  2YN4 A;  1SKR A;  5DGA A;  3HKZ C;  5EE0 A;  1SKS A;  3B0X A;  4CGZ A;  2YX8 A;  1DK3 A;  5KFD A;  3UPS A;  3UMB A;  2DKZ A;  4JWM A;  2CRX A;  4Y2X A;  4OJO A;  2C22 A;  4UB4 A;  2AJQ A;  2A1A A;  4F5O A;  2Y9T A;  3OHA A;  4Y2P A;  2KJ9 A;  3NYB A;  4PJ0 U;  4QWC A;  1QSS A;  1QQ6 A;  2H3F A;  1XO0 A;  2HHV A;  4LEY A;  5AIB A;  2W8L A;  3WKB A;  3TAQ A;  3MAB A;  4FS1 A;  1NJY A;  5J2F A;  1SXE A;  3V7L A;  1YZ6 A;  3PST A;  1KDH A;  2E5S A;  5AK3 A;  8ICU A;  4EEY A;  1QCK A;  4E8F A;  4WQK A;  3PZP A;  1HUO A;  4QZ9 A;  5D4B A;  2G08 A;  1QQ7 A;  3OJU A;  2W03 A;  3N7P D;  5AKH A;  4M47 A;  3KHR A;  5HML A;  4R64 A;  3C2M A;  1Q79 A;  4WOY A;  5D62 A;  3UMG A;  4UD4 A;  5J2H A;  2AU0 A;  1R8A A;  4RUA A;  1JMS A;  2XY7 A;  4DF8 A;  2XCP A;  5AM1 A;  1PK1 B;  2IMW P;  1V38 A;  3TFS A;  1GPJ A;  1FIQ A;  3WK8 A;  2DR9 A;  1SGG A;  4WC2 A;  3C5G A;  3D2N A;  2PKE A;  5DBA A;  9ICW A;  2BQU A;  4RPX A;  3PO5 A;  5AKK A;  3OSN A;  5CHE A;  4RWN A;  3SYZ A;  2B21 A;  3H8J A;  2JRZ A;  1H38 A;  1JXL A;  3EYZ A;  1N62 A;  5ALE A;  5IIO A;  4DOC A;  4DLG A;  2QAR A;  3G6Y A;  2GLE A;  1RPL A;  3H39 A;  3AM9 A;  2HBJ A;  1S10 A;  3MR3 A;  1MN8 A;  4PHD A;  1D9D A;  3QNM A;  5IIM A;  2IOF A;  3DV9 A;  5AI4 A;  2W9B A;  3ICX A;  4EP7 A;  5KFR A;  1OUQ A;  3BS7 A;  1F44 A;  4DSL A;  1Y88 A;  2HSZ A;  1S77 D;  4KM5 A;  2EQY A;  2FPL A;  5KFJ A;  4P4O A;  3PX0 A;  1J97 A;  4LEV A;  1MQ2 A;  5KG3 A;  3RB0 A;  2FLL A;  2DR8 A;  4RQ0 A;  3PX4 A;  4EGW A;  2MU2 A;  4EYI B;  1JIH A;  1FEZ A;  1KW4 A;  3RF9 A;  1SIJ A;  3MR5 A;  2KNJ A;  4F50 A;  4XA5 A;  4MF8 A;  4OAI Z;  1P7D A;  5J2E A;  3ER9 B;  4ATB B;  3OJS A;  3SV3 A;  4FBT A;  5DG7 A;  3OTQ A;  2J6U A;  3EUB 2;  2IUB A;  4OD0 A;  2PBE A;  3CW2 C;  2BDP A;  2M2T A;  3UXN A;  9ICO A;  4X0A A;  5DDM A;  2KEY A;  4QZA A;  4GFJ A;  3Q8Q B;  2BBJ A;  2V4Q A;  5KT7 A;  2Y0S F;  2YTU A;  3RH6 A;  9ICR A;  1NOM A;  4MEX A;  4C80 A;  1Q8K A;  1ZQG A;  3UMC A;  1B22 A;  4Y2Q A;  1B0X A;  3BS5 B;  2MUT B;  4RQ2 A;  4Y2V A;  5J2B A;  5KFC A;  4QJF B;  9ICH A;  1Z1V A;  5J2G A;  4ELU A;  5J2D A;  3HJE A;  2KHV A;  4KB6 A;  4DF4 A;  1PK1 A;  4NKT A;  4QZ8 A;  3MDC A;  2W54 A;  2N1R A;  4FZL A;  3PNC A;  2KSO B;  8ICO A;  8ICP A;  5HR9 A;  1BPD A;  2HHT A;  2ZIU B;  5KAI U;  3H0M B;  4EYH B;  3D2Q A;  5KFH A;  1DXS A;  4XQ7 A;  5DEC A;  2KVC A;  4DOA A;  2RP5 A;  3PR5 B;  1OU5 A;  2HBM A;  2KZ3 A;  3MFH A;  4DL3 A;  3RFA A;  2V4R A;  1FFU A;  4M5D A;  4EBD A;  1L7O A;  3M9M B;  4KLG A;  4DFD A;  4DL7 A;  2DGZ A;  4B9M A;  2DR5 A;  3ZD9 A;  4PGX A;  1L5U A;  4FH3 A;  4OJ5 A;  5CR0 A;  2IHO A;  2F1J A;  5B5E U;  4I2C A;  2DKX A;  1ED1 A;  3PW4 A;  1X6J A;  1KRP A;  3GV8 B;  1CEZ A;  5CEH A;  5ALL A;  2RRD A;  3C23 A;  2ZH6 A;  4NJ8 A;  2QKQ A;  4B9S A;  3HP6 A;  3HIL A;  5D46 A;  1C7Y A;  1D9F A;  3ZDB A;  4AT8 A;  5AIA A;  4M9G A;  8ICG A;  1FFV A;  3M9O B;  4TUS A;  5DBB A;  5J0P A;  1X40 A;  5KG0 A;  3N7S C;  3AMZ A;  3PY8 A;  4M6W A;  1BGX T;  4IR9 A;  3IG5 A;  1K5O A;  1A77 A;  5EWF A;  3AQE A;  1YT3 A;  5ALO A;  4F5P A;  5CFU A;  4PGY A;  4X4S A;  2A1J B;  5KG1 A;  4NV0 A;  4BJQ A;  5JU5 A;  8ICW A;  4AT9 B;  4ECZ A;  1JQR A;  4ECY A;  1Z4N A;  5AKI A;  1BPB A;  2DVI A;  4FBU A;  3KD3 A;  2ZIX B;  4K99 A;  4Q8F A;  2YY6 A;  9ICV A;  1NO5 A;  2Y1I A;  3WK9 A;  1FA0 A;  3UQ0 A;  1U9L A;  2RHF A;  1UHU A;  7ICL A;  2KG5 A;  4EBJ A;  3LVV A;  2BHN A;  1X42 A;  2KMD A;  9ICQ A;  4E80 A;  2NRW A;  4F72 A;  3IN5 A;  4FS2 A;  2G09 A;  1TK8 A;  4K9A A;  2RFF A;  4KN7 A;  4Q44 A;  4AYB F;  5A0L A;  4MFC A;  2KIV A;  2MUT A;  3AQL A;  4LJX A;  1ZQA A;  4F4Y A;  1ZQK A;  4MKP A;  1A0P A;  3H40 A;  1NK0 A;  3OVS A;  1CUK A;  4NWI A;  1QSY A;  1L8O A;  3SMV A;  2ATL A;  5DLG A;  2OWO A;  2KSO A;  2QB0 B;  3QX7 A;  1S0O A;  2FMP A;  3N97 B;  1RQN A;  2MAX A;  2E8M A;  2DPI A;  4NXV A;  4UAV A;  1ZQE A;  1OW5 A;  5HRE A;  3C28 A;  1K1Q A;  4J9R A;  4G9B A;  4ELV A;  5G5G A;  4I2D A;  2B4V A;  4X4N A;  5AKZ A;  4WC0 A;  1XC9 A;  7ICO A;  2I6X A;  4RQ1 A;  3OUY A;  2AGP A;  4I28 A;  4KLH A;  4X4R A;  4MF2 A;  1B4F A;  5DB7 A;  4O3S A;  3C66 A;  3KKA C;  4EZ9 A;  2WHE A;  3H7I A;  1U45 A;  4X4Q A;  5J8Y C;  1MA7 A;  4QWD A;  2ZH7 A;  2G5I B;  4UW9 A;  4B6J A;  4C4T A;  2GA9 D;  2DF4 B;  5CP2 A;  5KFA A;  5KFE A;  1BNP A;  2HBK A;  4US8 A;  3RAQ A;  1M6Y A;  3AEV A;  1B43 A;  8ICV A;  1R8C A;  3T5J A;  5J0Y A;  3MC1 A;  2HW3 A;  2WF5 A;  5DB6 A;  3M8S A;  1NKC A;  3C18 A;  2JXJ A;  4AT9 A;  2NO4 A;  3LDA A;  4NLB A;  5KT3 A;  4QW9 A;  5AK6 A;  1MIW A;  1HEK A;  2UVU A;  3HX0 A;  5DBC A;  4RWQ A;  2Y1J A;  2KZM A;  1NJW A;  4YN4 A;  4J9P A;  2ZH4 A;  2W3R A;  1U48 A;  5KT5 A;  3T5H A;  5KFW A;  1X66 A;  1Z00 B;  5AKG A;  1UT5 A;  7ICV A;  2F3N A;  4RU9 A;  1TFR A;  5KFG A;  3A0B U;  5F2V O;  4RT2 A;  3BQ2 A;  2HVI A;  3LVW A;  1NK7 A;  3D2S A;  2HHQ A;  2MRL A;  1ZQX A;  3NWI A;  2EAO A;  4RUC A;  5D49 A;  4I2G A;  2B6G A;  2W9C B;  4X4U A;  3PV8 A;  2ODG A;  3IM1 A;  4NY8 A;  4XQ8 A;  2O5A A;  3IG8 A;  4WC3 A;  5F3X B;  1COK A;  1ZQZ A;  3QU4 A;  4Y2J A;  2LHT A;  1ZQO A;  2KJ8 A;  3NVY A;  2KKP A;  1JX4 A;  5TIS U;  3GIK A;  2F1I A;  3PSI A;  4WBY A;  4YD2 A;  4ED2 A;  3EPG A;  4K97 A;  4DL5 A;  5HRG A;  5KFK A;  2K60 A;  3AQN A;  4DQQ A;  4PL2 A;  2K4P A;  5KFY A;  1V85 A;  2H5X A;  2IHM A;  8ICT A;  2Y0S C;  4Y2Y A;  3HJ4 A;  4USA A;  4IQU A;  1N48 A;  1QQ5 A;  5ALU A;  4RQ6 A;  4BGD A;  1SWV A;  3TQ1 A;  4JLZ A;  3RB4 A;  2BBH A;  4UAS A;  2K4H A;  7ICH A;  9ICF A;  1TK5 A;  2PI5 A;  4X4T A;  1RXV A;  2W11 A;  2ZXI A;  3JPR A;  1N5W A;  1ZQV A;  3KKA A;  4M0A A;  1U4B A;  4G3I A;  5B66 U;  1OXJ A;  3AU6 A;  4CNQ A;  5J8Y A;  4KLL A;  5AIC A;  1BPZ A;  3Q8P B;  5L1I A;  5HRH A;  3BQ1 A;  1NNL A;  3H0L B;  3C1Y A;  2ASL A;  3V72 A;  1IM4 A;  1O08 A;  3LWL A;  4OJP A;  4Y2R A;  3GQC A;  3GU3 A;  4KLS A;  2FMS A;  3B0Y A;  1SZH A;  4ED0 A;  2K4E A;  2VKQ A;  3UQ2 A;  1KFD A;  2H3I A;  4UD5 A;  3H0R B;  1VJ5 A;  4Q43 A;  2EAP A;  4EZ6 A;  1KSP A;  2F8L A;  5KG2 A;  4TQR A;  1VLB A;  4UAZ A;  3UPQ A;  5KTQ A;  4OJ6 A;  4WJ3 B;  3SZ2 A;  4ED8 A;  3V6J A;  2HMX A;  2ALZ A;  1T8E A;  4B9U A;  1ARO P;  1ZQN A;  5KFT A;  2BGW A;  1ZQR A;  2EAN A;  4DSJ A;  1Z00 A;  3KBB A;  1UCV A;  2R18 A;  4C8O A;  1TFW A;  4F5Q A;  4J9L A;  4ZH4 A;  1PK3 A;  9ICA A;  4WH5 A;  2P6U A;  2R8G A;  4QIW C;  5L1L A;  2LYH A;  2W9C A;  5ALI A;  3MBY A;  3RJH A;  3E2E A;  8ICQ A;  2OYY A;  2WB1 C;  1LB2 B;  1D8L A;  4NLG A;  3PW2 A;  4A8E A;  4TUR A;  5AM0 A;  1ZYQ A;  4BX9 C;  2PMZ F;  4UB6 U;  3MDA A;  2KK0 A;  4X0B A;  4ACO A;  3A0H U;  4FFD A;  5HMM A;  2GOL A;  1X9X A;  2NRK A;  3L4P A;  5J29 A;  4CRX A;  1ZQP A;  5JRT A;  2WF8 A;  3RRG A;  5ALY A;  7ICK A;  1ECW A;  4PPX A;  5EE9 A;  2ID1 A;  4UB2 A;  3TAD A;  5B3Q A;  4B9N A;  3I76 A;  1KL9 A;  1TV9 A;  4AYB C;  3ZDA A;  3QZ8 A;  3IHQ B;  1LKY A;  4DSF A;  4I2B A;  3OVB A;  4C4S A;  4ECU A;  7ICI A;  4KLF A;  5KT2 A;  5D63 A;  3RJF A;  2AGO A;  1RZT A;  4DL4 A;  2I9G A;  1TVA A;  2WFA A;  3Q8K A;  1ZQL A;  3BQ7 A;  2KZZ A;  2G0A A;  1UEV A;  4P4M A;  1RM6 C;  5DQG A;  1ZET A;  1S8O A;  4RNM A;  3H37 A;  3F5A A;  2JEJ A;  4R66 A;  1JAL A;  2ZH8 A;  2PI4 A;  4QZE A;  4UAT A;  4Y2S A;  3KZI U;  3H8S A;  3PW5 A;  5J2K A;  1HIW A;  3V6K A;  1S0N A;  5HRD A;  8ICS A;  5KFB A;  3RH4 A;  5KFO A;  3MR2 A;  1Z19 A;  4DWI A;  2LYA A;  5DKW A;  2I5H A;  2YML A;  1UPH A;  2F1H A;  4QZG A;  4ED7 A;  2DPJ A;  2YMQ A;  4CE6 A;  2A3V A;  4TQS A;  2IA6 A;  7ICT A;  2M2U A;  7ICE A;  1JUD A;  4JUZ A;  4NL9 A;  3FAH A;  4KLD A;  5DG9 A;  1TKD A;  2ES6 A;  3IRU A;  2FMQ A;  3QU2 A;  4DS4 A;  4ED1 A;  3N28 A;  4KX5 A;  3VCB A;  3MFI A;  4ED3 A;  3M7D A;  1J2M A;  2F44 A;  4QWE A;  1D8B A;  2F8K A;  5AM4 A;  1JN3 A;  2XO7 A;  4DQP A;  4YD1 A;  3Q8R B;  4EED A;  3QU9 A;  3WK6 A;  1X9M A;  4CCH A;  2OHF A;  3BQT A;  1NZB A;  4EV6 A;  3G6V A;  4NXW A;  5KG4 A;  4CF4 A;  8ICX A;  3SR6 A;  4RT3 A;  4NXX A;  8ICZ A;  3QU7 A;  2W55 A;  1X2I A;  5AKY A;  1BPX A;  4F2S A;  2ASJ A;  1NK6 A;  4DLE A;  2R8J A;  1BPY A;  5J2I A;  1R89 A;  4BDP A;  9ICU A;  1TFY A;  1ZQS A;  4Q8E A;  1CRX A;  9ICT A;  3QE9 Y;  5DB8 A;  5AI9 A;  2PFN A;  4UBC A;  2K8B B;  8ICY A;  4EBE A;  2E1E A;  5KFX A;  3GIM A;  2Y9U A;  1SZP A;  1WWV A;  3KHL A;  5KFF A;  5H2F U;  4BWJ A;  1ZQ1 C;  2KV2 A;  2Z7J A;  3MGH A;  4WC1 A;  2Q0Z X;  4P0P B;  5CHG A;  4Y2U A;  4RWP A;  3Q8M A;  2UVW A;  2JV3 A;  8ICL A;  5KG6 A;  2KFZ A;  2C2D A;  3WFS C;  4QZI A;  7ICU A;  2O6K A;  4GIB A;  4GC6 A;  1RDF A;  1V4A A;  2B51 A;  3FYH A;  4KLO A;  2G06 A;  4OAH A;  1KN5 A;  4OAG A;  1NKE A;  1WCL A;  1T94 A;  1NJX A;  4DOB A;  1L3S A;  4WC7 A;  8ICC A;  1L3V A;  2KE7 A;  2ZIW B;  4GXJ A;  1L6N A;  3C1Z A;  2KIC A;  4B9T A;  3NRZ A;  1WYG A;  3PML A;  9ICP A;  5CJ7 A;  3HIY A;  2AHO B;  4R63 A;  5DGB A;  4UAR A;  3BQ0 A;  4KLE A;  1A6S A;  1XU4 A;  2R8H A;  4LEZ A;  5ALQ A;  3K4G A;  4EEN A;  1UQV A;  2BE3 A;  2OCE A;  2G07 A;  2E8P A;  1Z4O A;  3N4M B;  4UAU A;  9ICX A;  3QEA Z;  2HI0 A;  3T79 A;  1IG6 A;  5EE3 A;  4FHP A;  2BCR A;  4YR3 A;  3GII A;  1PVQ A;  2Q66 A;  1S0V A;  2XID A;  2O1P A;  5J0W A;  4KLT A;  2JZB B;  5HRF A;  4I0U A;  3RB6 A;  8ICH A;  1VJ7 A;  1ZXI A;  4IQW A;  3CP8 A;  2GWS A;  2LBO A;  4R65 A;  5C5J A;  2XIC A;  3R9K A;  4QIW F;  4LZD A;  4K4I A;  1DRG A;  5BOL A;  5HNK A;  1RYU A;  1NJZ A;  5KFI A;  2WB1 F;  3KOO A;  4RQ3 A;  2BCV A;  5AKE A;  3WFO A;  5ALV A;  3RB3 A;  3OVA A;  9ICM A;  4ATB A;  2ZTE A;  3ISB A;  4O5E A;  4WC6 A;  1NK4 A;  1ZD5 A;  2JR5 A;  2LM4 A;  4LZG A;  4YXJ A;  4QZC A;  3TAN A;  3QXG A;  3FC4 A;  5DDY A;  2FI1 A;  5J2J A;  5DED A;  3JPP A;  5ALK A;  3AUO A;  5ALW A;  2EDU A;  8ICN A;  4J9Q A;  3CRX A;  4FZM A;  5KFU A;  4EEB A;  3HPO A;  4DS5 A;  4I2J A;  2W9M A;  4UB8 U;  4C4R A;  2H3V A;  4E0D A;  1TAU A;  4K9B A;  4KMO B;  3WK5 A;  2AXT U;  5J0R A;  3T5L A;  4C7Y A;  2F77 X;  2GH1 A;  4DFK A;  5AM5 A;  5KNI A;  4KTQ A;  3BS5 A;  2DQN B;  4CF5 A;  4FO6 A;  3WK4 A;  5J2A A;  2DRB A;  3E58 A;  1F5A A;  2VAN A;  2E3T A;  3SAF A;  4KLQ A;  2HOI A;  3RR7 A;  4Q45 A;  2FE9 A;  4JK1 A;  4O3R A;  2ZIU A;  5BOM A;  3K1R B;  1ZQW A;  3S6J A;  3GV7 B;  2EZX A;  5DLF A;  3RJJ A;  3RJG A;  2VIX A;  4QZH A;  1L7P A;  2UVR A;  8ICJ A;  2W7P A;  1Q3U A;  1TAM A;  9ICN A;  3ISC A;  3NTU A;  2PMZ C;  3DDH A;  3AQK A;  5L1M A;  2PFQ A;  5KL8 B;  3RH5 A;  4NM2 A;  2P6R A;  3EF2 A;  5T14 A;  4YMM A;  3OWG A;  4OO1 J;  4J9N A;  5KG5 A;  2ZUB A;  3RR8 A;  2HHU A;  5IIJ A;  1YZ7 A;  4O3Q A;  4IRC A;  4MFA A;  2B56 A;  2LYB A;  4C8N A;  4RQ4 A;  1SWW A;  2KIW A;  4QWA A;  1ZJN A;  9ICC A;  4WBZ A;  2KHQ A;  1QLN A;  2DRA A;  3M9N B;  1Q3V A;  1WG8 A;  3M6K A;  3CK6 A;  4AT7 B;  3HRD D;  4RNN A;  2JZB A;  2KOB A;  3ER8 C;  3RAX A;  2K89 A;  5IIN A;  3QUT A;  2HVH A;  2XVT A;  5AM2 A;  2ZJ5 A;  2OM6 A;  2A1J A;  2W43 A;  3SEN A;  5KL1 B;  2I1Q A;  2NRT A;  5ALS A;  4YXM A;  4K96 A;  1PVR A;  4ECS A;  3BZC A;  2VA8 A;  4DL2 A;  2R8K A;  3QUB A;  1ZQI A;  2ZHB A;  3M1Y A;  1A76 A;  2JEI A;  2ZIX A;  2VA2 A;  5GTI U;  4ECX A;  2UVV A;  3F2B A;  3AU2 A;  3H8W A;  4FHY A;  4O5C A;  4WC5 A;  2NRX A;  4RQ8 A;  2BPC A;  4DQS A;  3NVZ A;  2RDJ A;  5HRB A;  2AGQ A;  2L5Y A;  5CB1 A;  7ICQ A;  1PX5 A;  3PW7 A;  2HOQ A;  4YCX A;  4KN4 A;  1L7M A;  3HT3 A;  1WOT A;  1N56 A;  3NGD A;  2XC9 A;  5KFM A;  1Q78 A;  4Y2T A;  5KG7 A;  4IRK A;  4I2A A;  2ISO A;  4J9S A;  1XWL A;  4M9N A;  2NRZ A;  2W8K A;  2XI9 A;  2VJ5 A;  3MGV A;  3V6H A;  5J0X A;  3CNH A;  8ICE A;  2Q4T A;  2HHS A;  2QB0 A;  5K4L A;  1ZQT A;  1URJ A;  1HJP A;  2M2V A;  4N7R A;  4JMU A;  4LVS A;  5IIL A;  2VA3 A;  4AP9 A;  1JAJ A;  1SKW A;  2W7O A;  1DGS A;  2ZXH A;  3WFR E;  3GV5 B;  4TUP A;  3TAD C;  8ICB A;  4LEW A;  9ICG A;  2M0N A;  4UB1 A;  3UM9 A;  4IS7 A;  2NRV A;  3ZDE A;  3PX6 A;  1YLQ A;  4RPY A;  3SV4 A;  4PHP A;  3PVX A;  4DSK A;  2HDO A;  4HAI A;  4DO9 A;  3NRW A;  2IOF K;  4QW8 A;  4O3O A;  2EZZ A;  1AQ6 A;  3UXP A;  5DB9 A;  2XY5 A;  3F5E A;  5HRI A;  1SB3 C;  4F5N A;  2ZG6 A;  3D6J A;  1ZQF A;  1X6I A;  2J6S A;  4DSE A;  2ZUD A;  2K8A A;  1RXW A;  5KFZ A;  1MIV A;  2LMR A;  3ETL A;  1ZQH A;  1QH9 A;  3ONN A;  2QLT A;  1SV4 A;  2CPR A;  2BCS A;  5ALH A;  4KLJ A;  2F76 X;  2GAF D;  2B0C A;  3GIJ A;  1L8L A;  3C5F A;  3L3F X;  3G6X A;  5HHI A;  9ICJ A;  5AI6 A;  3WKC A;  2PFO A;  3V7K A;  5L9X A;  2E1F A;  3AQM A;  4K4H A;  1ZD4 A;  5CRX A;  2R8I A;  5AI0 A;  2QAR B;  3OSP A;  1ZD3 A;  5AK5 A;  4EX6 A;  2HHW A;  3FM9 A;  4NL9 C;  3F53 A;  3SAG A;  3M6Z A;  4OJL A;  5J0U A;  4YMO A;  5ALX A;  1EXN A;  4GLX A;  5AI8 A;  9ICB A;  1U47 A;  4RNO A;  2W9B B;  1UT8 A;  4YFK A;  2LM1 A;  1JI7 A;  5J0T A;  4I29 A;  3JPO A;  1MC8 A;  1SL1 A;  4FE3 A;  2J6T A;  4F92 B;  4M9L A;  5AKL A;  2KN7 A;  4Z6F A;  1ZQC A;  3M8R A;  2DL0 A;  2BQR A;  1X9S A;  1T4G A;  1WUD A;  5AHX A;  4F71 A;  5HP4 A;  2PXI A;  1O03 A;  1JRP A;  2BDU A;  3BJY A;  3THV A;  8ICA A;  4GC7 A;  2DFL A;  5KT6 A;  4P2H A;  1U49 A;  2HOF A;  1COO A;  1SV0 C;  4C8L A;  2WF9 A;  1ZQQ A;  4FHV A;  4QZB A;  1V9P A;  1IXR A;  5AKX A;  4ED6 A;  4R8U B;  3I28 A;  2RLT A;  1HUZ A;  2IBK A;  3OHB A;  3I1Y A;  5ALM A;  1N60 A;  3AQF A;  2C2R A;  4U7C A;  1TE2 A;  1DOQ A;  2JH7 A;  3GIL A;  3N7R C;  4FHX A;  1LV5 A;  1BPE A;  3RRH A;  5ALR A;  3QEB Z;  1PZN A;  2BPG A;  4NLC A;  3ETR A;  5ALN A;  2JEG A;  4K8V A;  2K8C B;  2FLN A;  4DFP A;  5ALF A;  3IDW A;  1N61 A;  1XS9 D;  4B9V A;  1S5L U;  4ECQ A;  4X4O A;  5J0S A;  1L3T A;  1SL0 A;  4DFM A;  9ICS A;  1ZRM A;  3ZI4 A;  4CDG A;  5HR7 A;  1F5S A;  1SL2 A;  3QYP A;  5EOZ A;  4YG2 A;  2FCL A;  5III A;  4F2R A;  2ASD A;  4DEZ A;  2NO5 A;  7ICS A;  2D6F C;  3AL0 B;  5C0Y A;  4OAF A;  4NXZ A;  3QU5 A;  1ZOL A;  3RJE A;  7ICF A;  5AK4 A;  2JMG A;  4FZN A;  4BXO B;  2CXY A;  1RG6 A;  2W9A A;  5DG8 A;  7ICJ A;  5EE1 A;  4MHV A;  1XSL A;  2WTF A;  4F93 B;  1L3U A;  1T7P A;  5CFT A;  3SI8 A;  1R8B A;  5KFV A;  4AT8 B;  4EX7 A;  3Q8S B;  4DFJ A;  3GZF A;  1UA1 A;  5TZV A;  3PSP A;  3H3A A;  3LK9 A;  2KVS A;  5E79 U;  3VC8 A;  4O9M A;  1L7N A;  4M6W B;  5ALD A;  4UAW A;  3OPX A;  4F4Z A;  1NK5 A;  5HHH A;  5HRL A;  3KHG A;  8ICR A;  1X9W A;  4Z6E A;  4NKU A;  3WKD A;  3F2C A;  1WWU A;  2WAQ F;  1VFG A;  1N63 A;  5DQH A;  5KFN A;  4J9O A;  5HRK A;  3ISD A;  2HCF A;  1DGJ A;  5HR6 A;  1SV0 A;  1JXE A;  4YVZ A;  2LI6 A;  4JWN A;  5KT4 A;  2HN2 A;  1QSL A;  4ECR A;  3T3F A;  2FDR A;  2OXO A;  2ZUC A;  1MQ3 A;  4K98 A;  4R8U A;  4QZD A;  3PW0 A;  4O3N A;  2ZIV B;  2W3S A;  4UQG A;  1PVP A;  1S97 A;  1NK9 A;  4F4W A;  2MA1 A;  2H3Z A;  3B9J A;  5CA7 A;  2BPF A;  4P0Q B;  4BUG A;  3NAS A;  4Z6D A;  4O68 A;  3IP4 B;  2JH1 A;  3C29 A;  4GXK A;  2C2E A;  1F0M A;  3QUQ A;  1K1S A;  4NXU A;  1ZQM A;  3EW9 A;  3WFP A;  2IHN A;  4RZR A;  2BCU A;  2YMM A;  2ZH2 A;  4KLI A;  4IG8 A;  4UB5 A;  4S3N A;  4EBC A;  3KHH A;  3RJK A;  9ICL A;  2E8O A;  2BQ3 A;  8ICK A;  4O69 A;  2KFN A;  1S9F A;  3NUQ A;  3PMN A;  2XGP A;  1SXD A;  2ZH9 A;  5EWG A;  3Q8L A;  2W04 A;  2VJ4 A;  2HHP A;  2ZTD A;  5KFQ A;  4RWO A;  4FHW A;  4PZN A;  1KLN A;  3WU2 U;  1RQL A;  4J9K A;  4IRD A;  1ZJM A;  4YQW A;  4O3M A;  3H4D A;  1NKB A;  2H3Q A;  5ALZ A;  8ICM A;  3WK7 A;  3JPS A;  2M2W A;  1ZQD A;  4C0Z A;  4UBB A;  4M9H A;  4FO1 A;  2HHX A;  4KX3 A;  4BWM A;  2WF7 A;  2XY6 A;  5G5H A;  5F9N A;  4O3P A;  1GO3 F;  4KIT B;  2LKY A;  3OUY B;  3JCF A;  2JGA A;  1NK8 A;  3LQC B;  1T3Q A;  4BXO A;  3KFU F;  3HKZ F;  4EEK A;  1KFS A;  1IV8 A;  2MSN A;  4I2F A;  5KFL A;  3SEI A;  4UB3 A;  3WKE A;  3U26 A;  5KFP A;  3HWT A;  3NS1 A;  4F4X A;  4O0I A;  2OH2 A;  5D61 A;  1Q46 A;  5JUM A;  4GXI A;  1MSW D;  3ALR A;  2YB1 A;  4J03 A;  2BZF A;  2BCQ A;  4RQ5 A;  2ZJA A;  2DUY A;  5ALJ A;  3QUC A;  1ZQJ A;  4PGQ A;  3O0F A;  2OEH A;  2D8C A;  4PHA A;  1UET A;  1UEU A;  4P4P A;  7ICM A;  2YMP A;  1ZQU A;  3V7J A;  8ICI A;  4PH5 A;  3NKU A;  3TAC B;  2BR0 A;  4DQI A;  3KZX A;  3PR4 A;  4QWB A;  3OV7 A;  3LWM A;  1DK2 A;  2ZIV A;  4C7Z A;  4YR2 A;  2EWR A;  4US9 A;  4XRH A;  4P0Q A;  4F4K A;  4WC4 A;  4NXT A;  9ICE A;  3PO4 A;  4QNL A;  4EBK A;  2WF6 A;  4B9L A;  1ZRN A;  4YP3 A;  4ECT A;  5B3P A;  3JZ0 A;  4DL6 A;  3MCR A;  5F9L A;  5DQI A;  4P0P A;  2V9W A;  2A19 A;  2FPM A;  5JTG A;  4M9J A;  3F2D A;  4O6A A;  3BDP A;  1KKX A;  4WCW A;  4XUS A;  2QB1 A;  3TI0 A;  4I2I A;  1N2X A;  3HW8 A;  2FLP A;  2FJ6 A;  2PFP A;  4IL6 U;  3IV6 A;  3J81 j;  2ZIW A;  3PHZ A;  5KFS A;  4JV1 A;  2HBL A;  1BVS A;  2ZH5 A;  3MGI A;  1IIP A;  2EAM A;  5J0O A;  2XCA A;  5ALG A;  2RDI A;  4DCC A;  4NLK A;  1JRO A;  3KTQ A;  4QZF A;  3GFK B;  3EWA A;  2EZY A;  2M9N A;  5ALT A;  3RBE A;  3EZ5 A;  4JLX A;  2KKV A;  4YR0 A;  2P35 A;  2C28 A;  4M2Y A;  4U6P A;  5BPC A;  4KMU A;  4O67 A;  2E8N A;  4I2H A;  1Z1B A;  4KLU A;  5J0Q A;  3K1Z A;  3NVW A;  1WCN A;  1FO4 A;  4RQM A;  3ZDC A;  3MR6 A;  7ICR A;  7ICG A;  1N5X A;  4I27 A;  4CF3 A;  3ERC C;  3K75 D;  4ZOH C;  4JV2 A;  5AKJ A;  4ELT A;  4F8R A;  1Z3E B;  4OCZ A;  3PSF A;  3H8M A;  3H38 A;  2AQ4 A;  5L1J A;  2JEF A;  1UA0 A;  4NM1 A;  4I2E A;  5FP0 A;  4ICA A;  5JTI A;  1RYR A;  4TUQ A;  1XSN A;  2G5H B;  2ZHA A;  2KD1 A;  2P66 A;  4C8M A;  3ZD8 A;  2FPK A;  1S0M A;  3JPT A;  2NV3 A;  2HN1 A;  4F3O A;  3UXO A;  5EWE A;  5AI5 A;  2ZH1 A;  9ICK A;  4IR1 A;  2EH9 A;  2DR7 A;  1KTQ A;  2YQE A;  2ZTC A;  4PZO A;  3EPI A;  4X5V A;  1XNS A;  4MEY A;  9ICI A;  4LT6 A;  1KNY A;  8ICF A;  1VDV A;  2D3D A;  3E0F A;  2YB4 A;  4C8K A;  5GTH U;  4XJE A;  3TAR A;  7ICP A;  4WQL A;  4ECW A;  3K7D A;  1ZD2 P;  2RQ5 A;  4JB3 A;  4IC9 A;  1TAQ A;  2DWQ A;  3RBD A;  3H4B A;  3AN1 A;  2F2A B;  1NZP A;  2NYV A;  2WAQ C;  2IOH A;  3LYS A;  4PL1 A;  4RQ7 A;  2LPE A;  3ED5 A;  1C20 A;  3ZDD A;  2KTQ A;  4DQR A;  4NLN A;  1MIY A;  3ORY A;  4E7X A;  5CFS A;  1CI4 A;  2KP7 A;  3L9D A;  3JYY A;  3RJI A;  5J2C A;  4YMN A;  4X4V A;  3NVO A;  3NVV A;  5HC9 A;  4PHE A;  3RTV A;  4J9M A;  7ICN A;  4ECV A;  2ESE A;  4DSI A;  1XSP A;  3OGU A;  3TFR A;  2KJ5 A;  5ALP A;  2XGQ A;  1QTM A;  3FDS A;  4HX0 A;  2BKE A;  4F5R A;  1BNO A;  3C2L A;  1D8Y A;  4NLZ A;  3C21 A;  3DEE A;  1LKY B;  1ZQY A;  2K4I A;  3GDX A;  2GO7 A;  3TKA A;  5CWR A;  4AT7 A;  4IQT A;  1XO1 A;  3JPN A;  4X4P A;  3C2K A;  4RPZ A;  3QZ7 A;  3WFQ E;  5IIK A;  4JV0 A;  3HJ1 A;  5L1K A;  4MFF A;  4K4G A;  4RQN A;  4O5K A;  1J2N A;  2JHD A;  3JPQ A;  4M04 A;  3BZK A;  2ZH3 A;  4HYK A;  1KQQ A;  1KEJ A;  3WKA A;  1KFT A;  4F91 B;  1NI3 A;  2DBY A;  3SQI A;  2AH5 A;  2ISP A;  3CYM A;  4UAY A; 
#chains in the Genus database with same CATH homology
 1VJ7 A;  1L3U A;  1T7P A;  4Z6C A;  4IQW A;  1S76 D;  1T3N A;  3RAQ A;  2AQ0 A;  4KLM A;  3T5K A;  3SI8 A;  1R8B A;  2GWS A;  1B43 A;  5KFV A;  4R65 A;  4AT8 B;  5C5J A;  3Q8S B;  4DFJ A;  8ICV A;  4K4I A;  4LZD A;  1UA1 A;  5TZV A;  1ZQB A;  3OVS A;  1R8C A;  3H3A A;  2ZJ8 A;  5BOL A;  3LK9 A;  3T5J A;  5HNK A;  5J0Y A;  1NJZ A;  1TK0 A;  4O9M A;  2HW3 A;  4M6W B;  1RYS A;  4IQV A;  5DB6 A;  4UAW A;  5KFI A;  3M8S A;  1NKC A;  4F4Z A;  4RQ3 A;  4FH5 A;  3C18 A;  2BCV A;  1NK5 A;  3TAP A;  1SKR A;  3WFO A;  5HHH A;  3RB3 A;  3OVA A;  9ICM A;  5DGA A;  4AT9 A;  5HRL A;  4ATB A;  2ZTE A;  3KHG A;  1SKS A;  3LDA A;  3B0X A;  8ICR A;  3ISB A;  1DK3 A;  5KFD A;  4O5E A;  5KT3 A;  3UPS A;  4WC6 A;  4QW9 A;  1X9W A;  1NK4 A;  4Z6E A;  1MIW A;  2UVU A;  4LZG A;  4YXJ A;  4NKU A;  4QZC A;  5DBC A;  3HX0 A;  3TAN A;  4JWM A;  4RWQ A;  5DDY A;  2Y1J A;  1VFG A;  5DQH A;  5KFN A;  4UB4 A;  5J2J A;  2C22 A;  4J9O A;  4F5O A;  3JPP A;  4YN4 A;  3OHA A;  4J9P A;  1NJW A;  3NYB A;  5DED A;  3AUO A;  5HRK A;  4QWC A;  1QSS A;  8ICN A;  1U48 A;  4J9Q A;  2ZH4 A;  5KT5 A;  3T5H A;  5KFW A;  2DR5 A;  1Z00 B;  5KFU A;  3ISD A;  1UT5 A;  2HHV A;  3HPO A;  4DS5 A;  4I2J A;  4RU9 A;  2W9M A;  2W8L A;  7ICV A;  1TFR A;  5KFG A;  1JXE A;  3TAQ A;  4YVZ A;  4E0D A;  4JWN A;  5KT4 A;  1TAU A;  4RT2 A;  3BQ2 A;  4WC4 A;  3MAB A;  4FS1 A;  2HVI A;  1QSL A;  1NK7 A;  5J0R A;  4ECR A;  3T5L A;  3T3F A;  2ZUC A;  1NJY A;  1MQ3 A;  5J2F A;  4R8U A;  2HHQ A;  4QZD A;  4DFK A;  3V7L A;  1ZQX A;  4RUC A;  4O3N A;  3PW0 A;  4UQG A;  5D49 A;  1S97 A;  4I2G A;  2W9C B;  1NK9 A;  4F4W A;  4X4U A;  5CA7 A;  1KDH A;  2BPF A;  3PV8 A;  4KTQ A;  5HRD A;  4Z6D A;  3IM1 A;  4NY8 A;  8ICU A;  4EEY A;  4FO6 A;  4XQ8 A;  5J2A A;  4E8F A;  2DRB A;  2O5A A;  4GXK A;  4WC3 A;  1HUO A;  1F5A A;  2VAN A;  4QZ9 A;  1ZQZ A;  5D4B A;  1ZQO A;  2C2E A;  4KLQ A;  1JX4 A;  1K1S A;  3OJU A;  3RR7 A;  1ZQM A;  3GIK A;  4Q45 A;  2F1I A;  3EW9 A;  4JK1 A;  2IHN A;  3WFP A;  4RZR A;  2BCU A;  4YD2 A;  4WBY A;  4O3R A;  4ED2 A;  4M47 A;  2ZH2 A;  3EPG A;  4KLI A;  4IG8 A;  4UB5 A;  4DL5 A;  5HRG A;  3KHR A;  5KFK A;  4S3N A;  4EBC A;  5HML A;  5BOM A;  4R64 A;  3KHH A;  3C2M A;  3RJK A;  9ICL A;  1Q79 A;  2BQ3 A;  8ICK A;  4UD4 A;  1ZQW A;  3GV7 B;  5DLF A;  5J2H A;  3RJJ A;  3AQN A;  3RJG A;  4DQQ A;  4QZH A;  2KFN A;  2AU0 A;  1R8A A;  1S9F A;  4RUA A;  5KFY A;  2UVR A;  1JMS A;  8ICJ A;  2H5X A;  2XY7 A;  3PMN A;  4DF8 A;  2XGP A;  2IHM A;  2XCP A;  8ICT A;  9ICN A;  3ISC A;  3NTU A;  2IMW P;  3HJ4 A;  2ZH9 A;  4IQU A;  3TFS A;  1N48 A;  3AQK A;  5EWG A;  4RQ6 A;  3Q8L A;  4BGD A;  2HHP A;  2DR9 A;  2PFQ A;  4WC2 A;  3TQ1 A;  2ZTD A;  5KFQ A;  3C5G A;  3RH5 A;  4FHW A;  4NM2 A;  2P6R A;  1KLN A;  4RWO A;  3RB4 A;  4YMM A;  2ISP A;  4WC7 A;  4J9K A;  4IRD A;  1ZJM A;  4YQW A;  4J9N A;  5KG5 A;  5DBA A;  7ICH A;  9ICW A;  2BQU A;  4RPX A;  9ICF A;  3H4D A;  1NKB A;  1TK5 A;  2ZUB A;  3RR8 A;  2HHU A;  2PI5 A;  5IIJ A;  3PO5 A;  4O3Q A;  8ICM A;  4IRC A;  4X4T A;  4MFA A;  3JPS A;  3OSN A;  1RXV A;  2M2W A;  2DR8 A;  4RWN A;  3JPR A;  1ZQD A;  3SYZ A;  1ZQV A;  4UBB A;  4M9H A;  2B21 A;  3H8J A;  4C8N A;  4RQ4 A;  2HHX A;  1H38 A;  4M0A A;  1U4B A;  4G3I A;  4BWM A;  1JXL A;  3EYZ A;  3AU6 A;  4KLL A;  4QWA A;  2XY6 A;  1ZJN A;  9ICC A;  4WBZ A;  5F9N A;  5IIO A;  3Q8P B;  5L1I A;  4O3P A;  1BPZ A;  5HRH A;  4KIT B;  1QLN A;  3OUY B;  3BQ1 A;  3M9N B;  4DOC A;  2DRA A;  3C1Y A;  4DLG A;  1NK8 A;  3LQC B;  3G6Y A;  2ASL A;  3V72 A;  4BXO A;  4AT7 B;  1IM4 A;  1RPL A;  3LWL A;  3H39 A;  4RNN A;  3GQC A;  2JZB A;  4KLS A;  2FMS A;  3RAX A;  1KFS A;  1S10 A;  3B0Y A;  3MR3 A;  5IIN A;  4I2F A;  4ED0 A;  3UQ2 A;  5KFL A;  4PHD A;  1KFD A;  1D9D A;  5IIM A;  2W9B A;  4UD5 A;  2HVH A;  4UB3 A;  4Q43 A;  4EP7 A;  2ZJ5 A;  5KFP A;  4EZ6 A;  5KFR A;  3HWT A;  5KG2 A;  1KSP A;  4F4X A;  4DSL A;  1Y88 A;  4O0I A;  4TQR A;  4UAZ A;  2A1J A;  1S77 D;  3UPQ A;  2FPL A;  5KTQ A;  5JUM A;  5KFJ A;  4GXI A;  4P4O A;  3PX0 A;  2I1Q A;  1MSW D;  2NRT A;  4YXM A;  3SZ2 A;  4ED8 A;  1MQ2 A;  3V6J A;  4ECS A;  5KG3 A;  3RB0 A;  2FLL A;  2VA8 A;  4DL2 A;  2ALZ A;  4RQ0 A;  3PX4 A;  1ARO P;  1T8E A;  2R8K A;  4B9U A;  1ZQI A;  2BCQ A;  2ZHB A;  1ZQN A;  1A76 A;  2JEI A;  5KFT A;  4RQ5 A;  4EYI B;  1JIH A;  2ZJA A;  2VA2 A;  4ECX A;  3MR5 A;  2BGW A;  4PGQ A;  1ZQJ A;  1ZQR A;  4F50 A;  2UVV A;  4DSJ A;  4PHA A;  3AU2 A;  1UET A;  3H8W A;  5F2V O;  4XA5 A;  4MF8 A;  1UEU A;  4P4P A;  7ICM A;  1Z00 A;  5J2E A;  4ATB B;  1ZQU A;  4FHY A;  3OJS A;  3V7J A;  3SV3 A;  4C8O A;  4FBT A;  4O5C A;  2NRX A;  4PH5 A;  8ICI A;  5DG7 A;  4WC5 A;  1TFW A;  4F5Q A;  4J9L A;  2J6U A;  4ZH4 A;  4RQ8 A;  2BPC A;  4DQS A;  2BR0 A;  4DQI A;  2RDJ A;  5HRB A;  3PR4 A;  4QWB A;  3RB6 A;  2PBE A;  3OV7 A;  2AGQ A;  9ICA A;  2P6U A;  3LWM A;  1DK2 A;  5CB1 A;  7ICQ A;  2BDP A;  2R8G A;  1PX5 A;  4YR2 A;  5L1L A;  2LYH A;  2W9C A;  4YCX A;  4KN4 A;  3HT3 A;  3PW7 A;  2M2T A;  1WOT A;  4XRH A;  3UXN A;  3NGD A;  2XC9 A;  1N56 A;  3MBY A;  5KFM A;  3RJH A;  4F4K A;  5KG7 A;  4IRK A;  4I2A A;  3E2E A;  8ICQ A;  9ICE A;  2ISO A;  1Q78 A;  1LB2 B;  4X0A A;  4J9S A;  1D8L A;  3PO4 A;  3PW2 A;  1XWL A;  5DDM A;  4NLG A;  4M9N A;  4QZA A;  4TUR A;  4EBK A;  3Q8Q B;  2NRZ A;  4B9L A;  2V4Q A;  2W8K A;  4YP3 A;  4ECT A;  3JZ0 A;  5KT7 A;  4DL6 A;  1ZYQ A;  5F9L A;  5DQI A;  3RH6 A;  3V6H A;  2V9W A;  9ICR A;  1NOM A;  2FPM A;  4M9J A;  5J0X A;  4MEX A;  3BDP A;  3MDA A;  8ICE A;  4X0B A;  2HHS A;  1ZQG A;  4WCW A;  4XUS A;  5HMM A;  1B22 A;  2NRK A;  1ZQT A;  3TI0 A;  2MUT B;  4I2I A;  5J29 A;  4RQ2 A;  1HJP A;  3HW8 A;  1ZQP A;  2M2V A;  5J2B A;  4LVS A;  5KFC A;  5IIL A;  2FLP A;  2VA3 A;  1JAJ A;  1SKW A;  9ICH A;  2PFP A;  1DGS A;  5J2G A;  3RRG A;  4ELU A;  5J2D A;  1BNP A;  3WFR E;  7ICK A;  3GV5 B;  4TUP A;  4DF4 A;  4NKT A;  4PPX A;  4QZ8 A;  8ICB A;  2ID1 A;  4UB2 A;  3MDC A;  9ICG A;  5KFS A;  4UB1 A;  4JV1 A;  1BVS A;  3PNC A;  4B9N A;  3ZDE A;  2NRV A;  3PX6 A;  8ICO A;  8ICP A;  5HR9 A;  1BPD A;  2ZH5 A;  2HHT A;  1YLQ A;  4RPY A;  3SV4 A;  4PHP A;  3PVX A;  4DSK A;  3MGI A;  4EYH B;  5KFH A;  4DO9 A;  1TV9 A;  4XQ7 A;  5DEC A;  5J0O A;  3ZDA A;  3IHQ B;  3QZ8 A;  2XCA A;  4DSF A;  4DOA A;  4QW8 A;  2RDI A;  4O3O A;  4I2B A;  3PR5 B;  4NLK A;  3OVB A;  4ECU A;  1OU5 A;  3KTQ A;  7ICI A;  2KZ3 A;  4QZF A;  3UXP A;  4KLF A;  3MFH A;  3GFK B;  4DL3 A;  5KT2 A;  5DB9 A;  2XY5 A;  2V4R A;  5HRI A;  3EWA A;  3RJF A;  2AGO A;  2M9N A;  4EBD A;  1RZT A;  4M5D A;  3M9M B;  4F5N A;  3RBE A;  4KLG A;  4DL7 A;  4DL4 A;  2I9G A;  1TVA A;  4B9M A;  3EZ5 A;  1ZQF A;  3ZD9 A;  4PGX A;  4YR0 A;  2J6S A;  4DSE A;  2ZUD A;  3Q8K A;  1L5U A;  2C28 A;  1ZQL A;  4FH3 A;  1RXW A;  5KFZ A;  1MIV A;  5CR0 A;  4M2Y A;  2KZZ A;  5BPC A;  1ZQH A;  3ETL A;  4KMU A;  2F1J A;  1UEV A;  4P4M A;  4I2H A;  5DQG A;  4I2C A;  2BCS A;  1ZET A;  4KLU A;  4RNM A;  5J0Q A;  3H37 A;  2JEJ A;  4KLJ A;  3PW4 A;  4R66 A;  1WCN A;  3ZDC A;  3GIJ A;  1KRP A;  3MR6 A;  3C5F A;  3GV8 B;  2ZH8 A;  2PI4 A;  7ICR A;  4QZE A;  7ICG A;  1CEZ A;  3H8S A;  4I27 A;  3PW5 A;  3G6X A;  5HHI A;  3C23 A;  5J2K A;  9ICJ A;  2ZH6 A;  4X4O A;  3V6K A;  3K75 D;  3V7K A;  1S0N A;  2PFO A;  5KFB A;  3HP6 A;  5L9X A;  4B9S A;  4JV2 A;  8ICS A;  3RH4 A;  5D46 A;  1C7Y A;  1D9F A;  3AQM A;  4ELT A;  5KFO A;  3MR2 A;  4F8R A;  3ZDB A;  1Z3E B;  4DWI A;  4K4H A;  5DKW A;  4M9G A;  3H38 A;  4AT8 A;  8ICG A;  2R8I A;  2F1H A;  2AQ4 A;  5L1J A;  2JEF A;  4QZG A;  1UA0 A;  3M9O B;  4TUS A;  4NM1 A;  3OSP A;  4ED7 A;  4I2E A;  2DPJ A;  5DBB A;  5J0P A;  5KG0 A;  3PY8 A;  4TQS A;  4M6W A;  2HHW A;  2IA6 A;  1BGX T;  1RYR A;  7ICT A;  2M2U A;  4IR9 A;  7ICE A;  4JUZ A;  4KLD A;  5DG9 A;  4TUQ A;  5J0U A;  1TKD A;  4YMO A;  1EXN A;  4GLX A;  1XSN A;  1A77 A;  2FMQ A;  2ZHA A;  9ICB A;  5EWF A;  4DS4 A;  1U47 A;  4RNO A;  2P66 A;  4C8M A;  3ZD8 A;  2FPK A;  1UT8 A;  4YFK A;  2W9B B;  4ED1 A;  3JPT A;  5J0T A;  1S0M A;  4I29 A;  3MFI A;  3JPO A;  4ED3 A;  1MC8 A;  4F5P A;  4QWE A;  1SL1 A;  1JN3 A;  4PGY A;  4F92 B;  2J6T A;  2XO7 A;  2A1J B;  4F3O A;  4DQP A;  4M9L A;  2KN7 A;  4X4S A;  4Z6F A;  4YD1 A;  5KG1 A;  3UXO A;  5EWE A;  3Q8R B;  2ZH1 A;  1ZQC A;  9ICK A;  3M8R A;  4IR1 A;  8ICW A;  2BQR A;  4AT9 B;  2DR7 A;  1KTQ A;  1T4G A;  1X9S A;  2ZTC A;  1X9M A;  4ECZ A;  3EPI A;  4CCH A;  1JQR A;  4X5V A;  3BQT A;  4ECY A;  5HP4 A;  4MEY A;  2PXI A;  1BPB A;  9ICI A;  3G6V A;  2DVI A;  4LT6 A;  5KG4 A;  1KNY A;  8ICX A;  4FBU A;  3BJY A;  3THV A;  8ICF A;  8ICA A;  4RT3 A;  4GC7 A;  4C8K A;  8ICZ A;  2DFL A;  4Q8F A;  5KT6 A;  1X2I A;  1BPX A;  4P2H A;  1U49 A;  9ICV A;  3TAR A;  1NO5 A;  1COO A;  4F2S A;  2Y1I A;  7ICP A;  4C8L A;  4ECW A;  3UQ0 A;  1U9L A;  2ASJ A;  1ZQQ A;  1FA0 A;  4FHV A;  1NK6 A;  4QZB A;  1V9P A;  4DLE A;  2R8J A;  7ICL A;  1IXR A;  1TAQ A;  4EBJ A;  1BPY A;  5J2I A;  1R89 A;  3RBD A;  4BDP A;  9ICU A;  4ED6 A;  4R8U B;  2BHN A;  3H4B A;  1ZQS A;  9ICQ A;  4Q8E A;  4E80 A;  1TFY A;  2NRW A;  9ICT A;  3QE9 Y;  5DB8 A;  1NZP A;  2PFN A;  1HUZ A;  4UBC A;  2IBK A;  3OHB A;  4FS2 A;  4EBE A;  8ICY A;  1TK8 A;  2C2R A;  5KFX A;  4KN7 A;  2RFF A;  3GIM A;  4RQ7 A;  1SZP A;  4Q44 A;  4MFC A;  3KHL A;  1DOQ A;  3ZDD A;  2MUT A;  5KFF A;  4DQR A;  2KTQ A;  3GIL A;  3AQL A;  4BWJ A;  1ZQA A;  4F4Y A;  1ZQK A;  4FHX A;  1LV5 A;  2WTF A;  4NLN A;  3MGH A;  1MIY A;  3ORY A;  1BPE A;  4E7X A;  4WC1 A;  2Q0Z X;  3RRH A;  5CHG A;  4RWP A;  3QEB Z;  1PZN A;  3H40 A;  3Q8M A;  1NK0 A;  2BPG A;  1CUK A;  5KG6 A;  1QSY A;  2UVW A;  8ICL A;  2KFZ A;  2KP7 A;  3L9D A;  3JYY A;  2ATL A;  5DLG A;  3RJI A;  5J2C A;  4YMN A;  4QZI A;  2C2D A;  2JEG A;  2OWO A;  7ICU A;  3WFS C;  4X4V A;  1S0O A;  4GC6 A;  1V4A A;  5HC9 A;  3FYH A;  4PHE A;  3RTV A;  4J9M A;  3N97 B;  2FLN A;  2FMP A;  4KLO A;  7ICN A;  4DFP A;  4ECV A;  4DSI A;  1XSP A;  2MAX A;  1NKE A;  1WCL A;  2DPI A;  2AJQ A;  1NJX A;  3OGU A;  4DOB A;  1XS9 D;  1ZQE A;  4ECQ A;  1L3S A;  5J0S A;  3TFR A;  1L3T A;  4B9V A;  9ICO A;  1SL0 A;  8ICC A;  5HRE A;  4DFM A;  2XGQ A;  1QTM A;  9ICS A;  3FDS A;  1L3V A;  1K1Q A;  2BKE A;  4J9R A;  4F5R A;  4GXJ A;  3C1Z A;  4ELV A;  4B9T A;  4I2D A;  3C2L A;  2KZM A;  1BNO A;  4X4N A;  3PML A;  1D8Y A;  4WC0 A;  9ICP A;  5CJ7 A;  1XC9 A;  3HIY A;  4NLZ A;  3C21 A;  1SL2 A;  4R63 A;  5EOZ A;  7ICO A;  5DGB A;  1ZQY A;  4YG2 A;  4RQ1 A;  3BQ0 A;  4KLE A;  3OUY A;  2AGP A;  4I28 A;  4KLH A;  5III A;  4X4R A;  4MF2 A;  1XU4 A;  2R8H A;  4F2R A;  3GDX A;  4AT7 A;  4O3S A;  5CWR A;  3K4G A;  5DB7 A;  2ASD A;  4DEZ A;  3C66 A;  4IQT A;  1XO1 A;  3JPN A;  7ICS A;  3C2K A;  2BE3 A;  4X4P A;  4RPZ A;  3QZ7 A;  4EZ9 A;  3H7I A;  1U45 A;  3WFQ E;  3N4M B;  9ICX A;  4NXZ A;  3QEA Z;  5IIK A;  4JV0 A;  4X4Q A;  3HJ1 A;  5L1K A;  3RJE A;  4MFF A;  4K4G A;  4QWD A;  4O5K A;  2ZH7 A;  4FHP A;  2BCR A;  4YR3 A;  3GII A;  3JPQ A;  4M04 A;  7ICF A;  2ZH3 A;  4HYK A;  1KEJ A;  4BXO B;  2Q66 A;  1S0V A;  1KFT A;  2O1P A;  5CP2 A;  4F91 B;  2W9A A;  5J0W A;  4KLT A;  5KFA A;  5DG8 A;  2JZB B;  5HRF A;  7ICJ A;  5KFE A;  1XSL A;  4F93 B;  4UAY A;  8ICH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...