4F5PA

Open ternary mismatch complex of r283k dna polymerase beta with a datp analog
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of dNTP Intermediate States during DNA Polymerase Active Site Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 106
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f5pA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4f5pA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4f5pA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4f5pA03
4KLHA 5KT3A 2W9MA 5J29A 8ICYA 5KG2A 1L5UA 4MEYA 1KLNA 8ICIA 5F9LA 3V7KA 4ED2A 9ICJA 5KG4A 3ZD9A 4TUPA 3FDSA 5KFGA 4ECVA 4DFKA 8ICOA 2M2VA 5KT7A 5J0XA 8ICWA 4BXOA 4RWQA 1B22A 4UAYA 1TV9A 2IHNA 4R64A 2ZH2A 4RNNA 2C2RA 1SKWA 7ICLA 1BGXT 1X9MA 4Z6FA 4YD2A 2XGPA 2KTQA 4DL7A 4X4VA 2DRBA 2XY5A 2W9CA 1ZQPA 5KFKA 4KLIA 3T5KA 1X2IA 4ELUA 4BWJA 4UBCA 2RDJA 1NKBA 3C1ZA 3V6JA 5KFTA 1N48A 2M2TA 1ZQHA 2J6SA 3IHQB 3PO5A 2P66A 1ZQYA 1S0VA 2HHQA 4YMOA 1JXLA 4YCXA 5KT6A 3G6VA 5HHHA 3RTVA 1D8YA 4KLQA 4KN7A 2ZH1A 5KFYA 2FPKA 3UXPA 1NK8A 4O5KA 2Q0ZX 5J0WA 4QWDA 1D9FA 3C1YA 3GIMA 1XU4A 3K4GA 3UPQA 3RJHA 4X4OA 4IRKA 1U9LA 3PR5B 4FH3A 5KFMA 1ZQWA 3C21A 3H8SA 4DL2A 4I27A 5JUMA 2UVWA 4TQSA 3UQ2A 4ED0A 1S0MA 1XSNA 1KRPA 1QTMA 5DBAA 9ICGA 5KG1A 4PPXA 5CWRA 1XSPA 8ICMA 1V9PA 2J6TA 4DQPA 2XY6A 4WC5A 4EZ9A 2WTFA 3PX6A 3RAQA 4EBEA 4EEYA 2AGOA 4E0DA 4LVSA 5EWFA 3PNCA 3C2MA 2V4QA 4EYHB 1ZQCA 4Z6CA 5HREA 4WC4A 9ICEA 4WC7A 4X4QA 3ORYA 2KFZA 4F4YA 2RFFA 2KN7A 4DLGA 4R8UA 2BQ3A 3AUOA 5KFHA 5BOMA 2BKEA 3GDXA 1ZETA 1ZQGA 2ZJ8A 3H4BA 4F50A 3Q8KA 5J2EA 5IIMA 4I2FA 4XQ8A 3WFPA 2ZUDA 3HW8A 1H38A 2MUTB 4ECSA 4ECQA 2BCQA 3PW5A 7ICQA 5KFSA 1ZQNA 4UD5A 1CEZA 1FA0A 2ALZA 5DEDA 1ZQUA 4B9LA 4JWMA 1QLNA 3OUYA 3EPGA 3T3FA 1JN3A 9ICVA 2NRZA 5J0YA 4S3NA 2O5AA 8ICFA 4QW8A 5KFWA 4RPXA 3KHGA 3HWTA 3MBYA 5DQIA 5J2FA 4FO6A 4QZCA 1KSPA 1TK5A 3H8JA 4UB4A 4M9NA 5HRFA 7ICUA 3QZ7A 1S10A 4PHPA 3ZD8A 4QWCA 4GC6A 3EWAA 3RJIA 3RH5A 1U4BA 1S0NA 9ICXA 5KFXA 3LQCB 3TFRA 5J0PA 3MFHA 4DSFA 1L3UA 1BNOA 2ZTCA 5IIJA 2FPMA 3MDCA 3EZ5A 4J9NA 3T5LA 4DFPA 9ICCA 2M2UA 4UD4A 2ID1A 3KHRA 3KTQA 4AT7A 2A1JB 1NO5A 3OVAA 4WBYA 4XA5A 3GIKA 4NY8A 1BPBA 1TVAA 3LK9A 4RNMA 2BCUA 1B43A 5J2AA 4F91B 4BWMA 5DB9A 2VANA 3MABA 4F5PA 1NJXA 5KFBA 4YXMA 1ZJMA 5CR0A 4ED1A 4ED7A 2Y1IA 8ICHA 1UT8A 4UB1A 2XC9A 4J9RA 1WCLA 4C8MA 1UA0A 1NKEA 5J2IA 3C5GA 3OJUA 1BPYA 1JIHA 4ELTA 2BPGA 4PH5A 1ZQEA 2KZ3A 3HT3A 1X9WA 9ICPA 4KLMA 2W9BA 1U48A 1NJYA 4KTQA 3PVXA 4M6WA 9ICWA 3GV8B 5KFDA 2JEJA 8ICRA 5KFAA 3V7LA 5J0SA 3JPPA 3V7JA 4YG2A 2ASLA 5DB7A 4O3NA 5DGBA 1L3VA 4RT3A 2ZH6A 5L1KA 4O3PA 5BOLA 3SYZA 3HPOA 4BDPA 4RQ6A 2J6UA 2DRAA 8ICXA 4NKTA 4MEXA 1XO1A 3V6HA 2R8IA 4F4ZA 1UT5A 3QEAZ 5L1IA 4F8RA 1XWLA 2VA2A 1C7YA 3UXNA 1L3SA 4I2HA 3M9NB 3QZ8A 4DL4A 1EXNA 4UAWA 4F5QA 5CA7A 3T5JA 8ICEA 3MDAA 4RQ5A 4ECXA 4RPYA 3JZ0A 4GLXA 2AQ4A 3SV4A 4M9GA 4O3SA 5KFZA 3RB3A 2P6UA 1ZQBA 4DOAA 2UVUA 2R8JA 5J2KA 1Q79A 1DGSA 4Q44A 4GC7A 4DL6A 2HHVA 5CHGA 5KT4A 3EYZA 4JV0A 3TAPA 2BHNA 3GV5B 4I2AA 4QZHA 1U49A 1T3NA 1BPDA 2R8GA 3PY8A 4ECRA 2HHUA 4LZDA 1NJWA 2M9NA 1ZQVA 5KFVA 1R89A 4E80A 4X5VA 2RDIA 1ZQLA 3H4DA 4M9LA 4P2HA 2DFLA 3C23A 2BR0A 4YP3A 1Z3EB 2DVIA 2C2EA 1RYRA 4QWAA 4KLGA 5KFIA 4EBJA 4C8NA 2PFOA 9ICAA 4QZ8A 2GWSA 4RQ1A 1MIVA 1XS9D 3GQCA 1Y88A 2HHTA 4YR2A 3H40A 4EBDA 3RR7A 5CB1A 4R63A 2H5XA 5IIKA 7ICJA 5HRIA 1ZQJA 4O5EA 4TURA 2JZBB 4AT9A 5HRBA 5KFLA 5EOZA 4I2CA 4YMNA 3PW0A 2KP7A 1ZQDA 4F5RA 5C5JA 4JV1A 9ICTA 3SZ2A 4XRHA 1SL2A 4DQRA 1ZQAA 1SL0A 3HIYA 3HJ4A 3JPSA 5HC9A 2DR5A 4DL5A 3LDAA 1QSSA 4KLFA 1IM4A 1NJZA 5HHIA 5J0OA 4M0AA 3OVSA 4M2YA 8ICZA 4RU9A 3RBEA 5DGAA 4F4KA 3NTUA 9ICSA 4F2SA 2O1PA 4F4WA 1NK0A 4EZ6A 4NM2A 4DSKA 1KFTA 4C8KA 1T8EA 1LV5A 4ECYA 1RXVA 4I2JA 4WC1A 5HNKA 5CJ7A 3MR3A 4MF8A 2W9BB 3MR2A 2IMWP 7ICFA 2PFQA 1KTQA 4J9PA 1U47A 4QWBA 1NK9A 3JPOA 2ZTEA 4DQIA 1MSWD 1NOMA 4RWNA 8ICLA 4QZFA 1ZQKA 4FHYA 3EW9A 2NRXA 4J9QA 3MFIA 5HRKA 2DPJA 4ECUA 1TKDA 9ICOA 2Y1JA 2LYHA 1WCNA 4G3IA 4WC2A 4GXJA 2F1JA 4ZH4A 4MFAA 3C66A 5DQGA 2R8KA 4KMUA 4DSLA 4NM1A 4UB3A 4P4MA 4M47A 4RWOA 5DDMA 2C2DA 2KFNA 3JYYA 5KFPA 2B21A 5HRLA 4F5OA 2DR7A 2BE3A 4P4PA 4RQ2A 1IXRA 1SKSA 8ICSA 1F5AA 3ZDCA 1MIWA 2FMQA 1D9DA 4FHWA 4QZGA 4F4XA 3FYHA 4QWEA 1L3TA 3GV7B 4M9JA 3PR4A 2W8KA 3BJYA 3PX4A 3M8SA 2HHSA 4DF8A 3RJJA 1Z00A 1ZQXA 3KHLA 1ZJNA 3PO4A 2AJQA 1WOTA 2NRKA 3KHHA 4YR0A 5EWGA 1RZTA 4BGDA 2FPLA 3AQNA 4EBCA 2ASJA 5DECA 3JPRA 1ZQQA 4BXOB 4X4UA 5DQHA 1JAJA 4KN4A 5J0QA 1S9FA 3OHBA 1ZQMA 2ZH5A 5DBBA 1NK4A 1YLQA 3AU6A 2VA3A 2PI4A 3GFKB 3M8RA 1QSLA 2DR8A 2W9CB 2ZUBA 2R8HA 4O3QA 4KLEA 4AT9B 9ICRA 4QZIA 3HJ1A 1MQ3A 2FLNA 3UPSA 4JWNA 4DSEA 1SL1A 2PFNA 4IQVA 2BQRA 1ZQTA 5KFCA 4M9HA 4QZBA 4IQWA 4K4IA 4Q43A 2HHWA 4DSJA 8ICNA 4DFMA 4C8LA 4NXZA 4GXIA 3WFQE 5KFEA 4QZ9A 3T5HA 3TQ1A 2IBKA 1ZYQA 4M5DA 5KG5A 4RT2A 4YD1A 1BPXA 1ZQSA 7ICIA 4YXJA 2C22A 4Z6DA 4RQ4A 4UAZA 3BQ0A 4DOCA 1NK7A 1BNPA 9ICNA 3V72A 3BQ2A 4IQUA 1PZNA 4J9LA 3GILA 3RRGA 3RJFA 4FS2A 1SZPA 3AQLA 4PGYA 2F1HA 8ICGA 4R66A 3ZDAA 2DR9A 3AQMA 1T4GA 5J0RA 3Q8MA 2FMSA 4JUZA 5DDYA 5HP4A 2DPIA 8ICVA 1JX4A 1BVSA 4IQTA 3HX0A 8ICUA 5DB8A 2XO7A 1TFWA 4WC6A 4X4RA 5J0UA 3Q8LA 2BCVA 1TK0A 7ICNA 7ICVA 1UETA 2I1QA 3ZDEA 3RH6A 4Q8EA 8ICQA 4B9VA 4RZRA 5L1JA 4FH5A 2HHXA 3MR5A 4R8UB 2ISPA 3M9MB 2AU0A 1RXWA 1PX5A 3M9OB 3MGIA 3B0YA 3BQ1A 4MF2A 4B9NA 8ICTA 1MIYA 4FHVA 2AQ0A 4DF4A 4EBKA 2ZH7A 3GIJA 4B9TA 2NRWA 4KLTA 2W9AA 4FBUA 3C5FA 4LZGA 2MAXA 4I2BA 1ZQFA 4AT8A 3PMLA 3RBDA 3OUYB 3C18A 7ICMA 4MFCA 4KLDA 4PHAA 2PI5A 5D49A 2ATLA 3L9DA 4IR1A 5KG0A 1DK3A 4I2IA 4NLKA 4O3OA 5J2JA 5IIIA 5DG8A 7ICGA 4UQGA 4I2GA 2HVHA 4WC3A 4ATBA 1TFYA 3OGUA 3B0XA 2IHMA 4IRCA 3BQTA 3RAXA 4E8FA 7ICRA 4I2EA 5KG6A 3ISBA 4K4HA 4ELVA 3SI8A 5TZVA 3IM1A 2W8LA 4KLSA 3NGDA 4J9OA 4EYIB 4DFJA 4E7XA 5KFJA 3LWMA 4M04A 4AT7B 5DLGA 1KFSA 5KFNA 4ED6A 4WC0A 4P4OA 3TI0A 1TAUA 5KFUA 3RB0A 1NK6A 1HUOA 4KLJA 4HYKA 9ICKA 5KTQA 4K4GA 1KNYA 3LWLA 2BPCA 3PV8A 1JQRA 3WFRE 4FBTA 2KZMA 2JEIA 4YVZA 2ZH3A 2A1JA 2ZUCA 4DWIA 4Q45A 7ICKA 3THVA 4YQWA 5DG9A 1MC8A 2ASDA 3H3AA 4QZEA 5J2CA 5KT2A 3RB4A 2FLPA 4PHDA 7ICEA 1S0OA 4F92B 4M6WB 4ED8A 5DKWA 3MGHA 2PXIA 4DL3A 4I29A 3AQKA 5IILA 4F5NA 1DOQA 4WCWA 3MR6A 1S76D 3PX0A 3ZDBA 1BPZA 1K1SA 3QEBZ 2ZHBA 5CP2A 3OVBA 1AROP 7ICHA 3N4MB 1U45A 1RYSA 8ICKA 4RUAA 1TK8A 4XQ7A 2UVVA 3G6XA 2P6RA 1A76A 2ZJ5A 5HMLA 1S97A 5L9XA 1KDHA 8ICCA 4TUSA 2BQUA 9ICLA 9ICMA 7ICPA 4CCHA 3RJGA 1QSYA 2F1IA 2BCRA 5DBCA 4ED3A 2XY7A 3H38A 5F2VO 2NRVA 4RWPA 2BDPA 2KZZA 2V4RA 2PFPA 4IG8A 2XGQA 1TAQA 4QW9A 3PW4A 2NRTA 2BPFA 2PBEA 3OJSA 4RPZA 2BGWA 3PW7A 1VFGA 4B9MA 3Q8SB 3N97B 2OWOA 3BDPA 1JXEA 4YMMA 3QE9Y 1MQ2A 5L1LA 2HW3A 4DOBA 2V9WA 2JEGA 4X4NA 5DB6A 5J0TA 3TANA 3NYBA 4YFKA 1HUZA 4AT8B 4C8OA 4PGXA 4X0AA 2BCSA 4ECTA 1A77A 1CUKA 4DS4A 1X9SA 1ZQRA 4PGQA 4Z6EA 5J2GA 4RQ3A 4IR9A 3RJEA 4DQQA 2AGPA 3TAQA 4QZAA 4NKUA 3H8WA 4DQSA 4KITB 3SV3A 4NLZA 5J2BA 4ATBB 4IRDA 1VJ7A 2FMPA 4O3RA 2VA8A 4O5CA 2ZH4A 3ETLA 8ICBA 5IIOA 9ICUA 1JMSA 4RQ8A 2ZHAA 4FHXA 1XC9A 4R65A 4QZDA 2XCAA 4NLNA 3G6YA 5KFFA 1ZQZA 4O0IA 3TFSA 3OSPA 4O9MA 8ICAA 2Q66A 4I2DA 3JPNA 1XSLA 9ICBA 1COOA 4KLOA 4JV2A 2JZBA 3OSNA 4DLEA 4Q8FA 3K75D 1TFRA 1UEUA 5KFRA 3RB6A 3UQ0A 3RR8A 1NZPA 4X4SA 3UXOA 2ISOA 4J9MA 5IINA 2JEFA 2UVRA 3E2EA 5KT5A 4TQRA 4ECZA 4UBBA 5DLFA 4EP7A 4DO9A 4DS5A 3RJKA 4GXKA 1KFDA 5DG7A 9ICIA 3OV7A 4PHEA 3EPIA 5HRDA 9ICHA 4X4TA 3H7IA 4LT6A 4B9SA 5KFOA 4F93B 3JPTA 4X4PA 5HRHA 3H37A 4X0BA 4NLGA 5BPCA 3PMNA 4RUCA 5HMMA 5KG3A 3ISDA 4MFFA 9ICQA 1Q78A 2ZH8A 3PW2A 5HRGA 3C2KA 1UA1A 3WFSC 4WBZA 4F2RA 1K1QA 5KG7A 4FHPA 1R8BA 2ZH9A 4ECWA 1T7PA 7ICSA 4RNOA 1SKRA 4FS1A 3TARA 4XUSA 3AU2A 4KLUA 1NK5A 1NKCA 4I28A 1LB2B 2HHPA 4YN4A 2XCPA 1OU5A 3RH4A 5KFQA 5EWEA 4F3OA 2C28A 1HJPA 5D4BA 1N56A 1R8CA 5F9NA 3OHAA 1R8AA 4RQ7A 3Q8QB 1ZQOA 1V4AA 2ZJAA 2IA6A 4B9UA 3ZDDA 4J9SA 4UB5A 3C2LA 2AGQA 7ICTA 2MUTA 3ISCA 3H39A 1S77D 5J2DA 2I9GA 1DK2A 1BPEA 4DEZA 2FLLA 4YR3A 3Q8RB 3HP6A 1KEJA 2HVIA 9ICFA 1UEVA 3JPQA 4J9KA 3Q8PB 3V6KA 1ZQIA 3WFOA 5HR9A 1Z00B 5J2HA 3GIIA 4JK1A 4KLLA 2M2WA 1RPLA 8ICJA 8ICPA 1D8LA 5D46A 4DSIA 2ZTDA 7ICOA 3RRHA 4TUQA 4UB2A 4RQ0A
chains in the Genus database with same CATH superfamily
5KT3A 4UAVA 1L5UA 4MEYA 2QLTA 3V7KA 4ED2A 5KG4A 3ZD9A 2KVCA 1TV9A 2IOHA 5AKEA 4R64A 4RNNA 1X9MA 3K1RB 1B0XA 2KTQA 4FFDA 1P7DA 2XY5A 2YY6A 5AK4A 4UBCA 1ZQHA 5B5EU 1S0VA 2HHQA 1JXLA 5KT6A 1D8YA 4KLQA 4C80A 2WAQF 2FPKA 4NJ8A 4QWDA 3GIMA 3GZFA 3RJHA 3UPQA 3PR5B 2B4VA 5KFMA 2UVWA 4ED0A 5KL1B 1QTMA 9ICGA 2XY6A 3WKBA 3RAQA 3L4PA 4K99A 3N7PD 3C2MA 5HREA 4X4QA 4DLGA 2BQ3A 3AUOA 5KFHA 4X0BA 4CE6A 2ZJ8A 5J2EA 4XQ8A 2ZUDA 5AM0A 4UD5A 1ZQUA 3C29A 3T3FA 4CGZA 8ICFA 1HEKA 4QW8A 4RPXA 1AQ6A 3MBYA 5DQIA 3HWTA 2W03A 4FO6A 4M9NA 4X4OA 3H8JA 4K9AA 4OAIZ 2CN1A 1TAMA 4PHPA 4X4TA 1S0NA 2RRDA 1PK1A 5AM3A 3MFHA 9ICCA 2D8CA 3GU3A 1F44A 3KTQA 5ALSA 4WBYA 1TVAA 2BCUA 5J2AA 4F5PA 2VANA 5KFBA 1ZQ1C 5CR0A 4ED1A 2XC9A 4C8MA 1UA0A 5J2IA 2HOFA 3C5GA 2BPGA 2EQYA 3HT3A 1ZQEA 2DGZA 3PVXA 4M6WA 3KD3A 3GV8B 2WAQC 1Q3VA 4YG2A 4O3NA 1L3VA 2FJ6A 2KK0A 3KFUF 4O3PA 2JH1A 4BDPA 3WKCA 2J6UA 2QARA 8ICXA 5CFUA 1ZD2P 4MEXA 1Z4NA 4F4ZA 3QEAZ 2IOFA 1XWLA 2Y9UA 3UXNA 2HBLA 5B3QA 1L7OA 3T5JA 3JZ0A 3SAGA 1ZQBA 2R8JA 5J2KA 2B6GA 3SD7A 4Q44A 2HHVA 5CHGA 5KT4A 2W3SA 4I2AA 4QZHA 1T3NA 4ECRA 1ZQVA 4X5VA 5AKKA 2RDIA 4LEVA 4M9LA 4P2HA 2DFLA 3C23A 3QYPA 4QWAA 5KFIA 4C7ZA 9ICAA 4RQ1A 1J97A 4YR2A 4UATA 5B3PA 7ICJA 5KNIA 1ZQJA 2JZBB 4AT9A 1JUDA 4I2CA 3N28A 2K4EA 2KP7A 4F5RA 4ZOHC 1ZQAA 2LBOA 3JPSA 3LDAA 3S6JA 1L6NA 2P35A 1NJZA 3FM9A 4U7CA 1JALA 3AM9A 3MR3A 2JRZA 1NK9A 4DQIA 2F77X 2ZTEA 5ALLA 1F0MA 4FHYA 3EW9A 2NRXA 4J9QA 2DPJA 4ECUA 2LYHA 1WCNA 4G3IA 3ONNA 4A8EA 3E0FA 2FDRA 1NI3A 4NM1A 2E5SA 4P4MA 4O69A 2HBKA 5HRLA 4FHWA 1IXRA 2A19A 1F5AA 2FMQA 1D9DA 2Q4TA 5ALMA 1QQ7A 3BJYA 4EX7A 3PX4A 1ZQXA 3PO4A 4XJEA 2HN1A 2KG5A 5EWGA 4EBCA 2ZIVB 4P0QB 3JPRA 1JAJA 2BBHA 3OHBA 1NK4A 2VA3A 2PI4A 3GFKB 2W9CB 3WKEA 4O3QA 1KKXA 3SENA 4QZIA 2FLNA 4JWNA 2PFNA 3DEEA 1WUDA 2Y0SF 2O6KA 3IP4B 3IV6A 2OXOA 5AKYA 5KG5A 1ZQSA 2YMMA 4YXJA 5GTIU 4RQ4A 3AQLA 1PZNA 1ECWA 2PKEA 3RFAA 8ICGA 4PL1A 3TKAA 2K4IA 5J0RA 4JUZA 3HX0A 1UETA 3WFRE 4Q8EA 1UCVA 4OAHA 2AU0A 2HOIA 2W7PA 1RXWA 3QU5A 3M9OB 3MGIA 3B0YA 8ICTA 4FHVA 2AQ0A 1ZOLA 2MAXA 4AT8A 1COKA 3C18A 3M6ZA 7ICMA 3F53A 4NLKA 4O3OA 5DG8A 4FZNA 2OCEA 1F5SA 4I2EA 1LKYA 1L7PA 4DFJA 4OO1J 5KFJA 4M04A 5KFNA 3QUTA 1TAUA 5KFUA 3RB0A 2BBJA 3WK6A 4QIWF 2A1JA 4Y2RA 1WWVA 5JU5A 3O0FA 4QZEA 3C28A 5J2CA 3RB4A 2FLPA 2Y0SC 7ICEA 4DL3A 1IV8A 2ZIUB 1S76D 1K1SA 1N63A 3QEBZ 2ZHBA 1AROP 2HCFA 8ICKA 1TK8A 4WQLA 4EEDA 1VLBA 1A76A 5L9XA 1KDHA 1WWUA 1IG6A 3NUQA 4DCCA 4CCHA 4KMOB 3WKAA 2YN4A 1QSYA 2XY7A 4ED3A 4NLBA 2BDPA 2PFPA 2GO7A 5AICA 2NRTA 2XVTA 2BGWA 2IOFK 3Q8SB 2OWOA 3QNMA 1JXEA 3BZKA 1MQ2A 2HW3A 5DB6A 1UHUA 2XICA 3NYBA 2DQNB 4X0AA 4FZLA 3BS7A 3LYSA 1VJ7A 3NWIA 1RQLA 4O3RA 2B0CA 4US8A 1GO3F 2E1EA 2K4HA 1XC9A 3CYMA 1X42A 4G9BA 4O6AA 3JPNA 4DLEA 3HILA 4QIWC 1MA7A 3E2EA 2JEFA 5DLFA 1L7MA 3MGVA 3T79A 5AM2A 4DO9A 4DS5A 4GXKA 1KFDA 1LVHA 2K4PA 5HRDA 2XIDA 3WK8A 3ETRA 4B9SA 2A1AA 2HN2A 2HBJA 2DBYA 3IRUA 1Q78A 5KG3A 3PW2A 3WFSC 4WBZA 1K1QA 4NLCA 4FHPA 4RNOA 1YZ6A 2WB1C 4EEKA 1SKRA 3TARA 4XUSA 3VCBA 4I28A 4K9BA 5KFQA 5J8YC 4U6PA 5ALNA 1ED1A 2KKVA 1R8AA 3Q8QB 1SXDA 4B9UA 2QB1A 5J2DA 1DK2A 2W7OA 1BPEA 4DEZA 4YR3A 3HP6A 9ICFA 4J9KA 2KOBA 1ZQIA 4O3MA 3GIIA 1X66A 2ZTDA 4NXXA 3SAFA 2W9MA 4ACOA 5EE1A 5J29A 1QCKA 2F44A 1KLNA 8ICIA 4TUPA 2EDUA 3KOOA 2YB1A 4BXOA 4RWQA 4Y2QA 4UAYA 2IHNA 2ZH2A 7ICLA 1WYGA 2AXTU 4OJPA 2JHDA 4EV6A 5KFKA 4KLIA 3KKAA 3N7SC 5KFTA 2P66A 1ZQYA 1JI7A 1B4FA 1VDVA 4YMOA 1L7NA 3NKUA 5HHHA 3RTVA 3UXPA 5J0WA 2WF9A 1D9FA 5KL8B 5A0LA 1ZQWA 3WKDA 2FCLA 3H8SA 4I27A 4Y2UA 2HSZA 1S0MA 5DBAA 2H3VA 4PPXA 4NV0A 1XSPA 8ICMA 5ALPA 2WF5A 4DQPA 4EZ9A 5ALFA 2H3ZA 4NL9A 2ZH6A 2V4QA 9ICEA 4F4YA 3SAHA 2RFFA 4R8UA 4NWIA 2KEYA 3GDXA 1ZETA 5IIMA 1H38A 2MUTB 3PW5A 5KFSA 1ZQNA 2ALZA 4B9LA 4JWMA 3OUYA 1OW5A 5J0YA 3UM9A 2O5AA 5KFWA 1A0PA 4UB4A 2KSOB 7ICUA 4QWCA 3RJIA 3EWAA 5ALIA 2W11A 9ICXA 1RQNA 3LQCB 1OUQA 1BNOA 3VC8A 4DFPA 2M2UA 4UD4A 2ID1A 3KHRA 4AT7A 3OVAA 4XA5A 2KHVA 1BPBA 4NY8A 3LK9A 4RNMA 1B43A 3MABA 1NZBA 3AQEA 8ICHA 4ED7A 1UT8A 4UB1A 1WCLA 4QJFB 3OJUA 3M6KA 4ELTA 4K96A 2KZ3A 9ICPA 4KLMA 5AK3A 2JEJA 8ICRA 5DB7A 5DGBA 4RT3A 5K4LA 3CRXA 5BOLA 3HPOA 4RQ6A 1UT5A 1C7YA 4WQKA 8ICEA 4ECXA 4GLXA 2CRXA 4O3SA 5KFZA 4DFDA 1Q79A 1DGSA 4GC7A 1JRPA 3QU7A 4OJ6A 2EAPA 2E8OA 2BHNA 3GV5B 1BPDA 4LZDA 1NJWA 1R89A 4E80A 1ZQLA 2JMGA 2BR0A 4YP3A 1Z3EB 2DVIA 1FO4A 5TISU 3BS5A 2HHTA 4HX0A 5HRBA 3PW0A 9ICTA 4XRHA 1SL2A 4DQRA 4MKPA 2DR5A 3PZPA 3OVSA 1Z1BA 4RU9A 3RBEA 9ICSA 2WFAA 3H0MB 4EZ6A 4I0UA 2NO5A 4DSKA 3DV9A 2ZIWA 1T8EA 1LV5A 1RXVA 2WF8A 2IMWP 7ICFA 2PFQA 3NVVA 8ICLA 1ZQKA 1Q46A 5ALXA 4PZNA 3AQFA 9ICOA 2Y1JA 3NVYA 3PSIA 1ZD4A 4UB3A 4M47A 5AI6A 3JYYA 2B21A 2DR7A 2BE3A 1MIWA 4QZGA 3FYHA 3GV7B 4P0PB 1SV0C 3M8SA 4DF8A 2EAMA 1ZJNA 5C0YA 4CF3A 3F2CA 4KM5A 3AQNA 3HRDD 1ZQQA 1URJA 4KN4A 2W54A 4OJLA 3F5AA 1ZQMA 5CFSA 5AI5A 2OHFA 3AU6A 3WK7A 2DR8A 1QSLA 2ZIXB 2R8HA 2ZUBA 4KLEA 4AT9B 4KX3A 2HOQA 4C7YA 3EUB2 3MC1A 1ZQTA 4Y2SA 4QZBA 2HHWA 4DFMA 4C8LA 3EF2A 1VJ5A 2Z7JA 2KJ5A 4Z6DA 4DOCA 1BNPA 9ICNA 3V72A 3CP8A 4IQUA 4J9LA 3GILA 3RJFA 4PGYA 2F1HA 3ZDAA 3AQMA 5JRTA 3Q8MA 2FMSA 2F76X 5DDYA 1JX4A 5ALOA 4IQTA 1TFWA 2NV3A 3Q8LA 7ICVA 3RH6A 8ICQA 2HHXA 4MF2A 4EBKA 2W9AA 4FBUA 4I2BA 4PHAA 2ATLA 5IIIA 7ICGA 4UW9A 2JR5A 1TFYA 3OGUA 2I5HA 3B0XA 5ALQA 2IHMA 3RAXA 4E8FA 7ICRA 3H8MA 5KG6A 3ISBA 4K4HA 5TZVA 2W8LA 3NGDA 4J9OA 1KQQA 3NS1A 3LWMA 1KFSA 4WC0A 1HUOA 1NK6A 1N5XA 4KLJA 4HYKA 1KNYA 5EE9A 4K4GA 3LWLA 1JQRA 4DWIA 5ALVA 1MC8A 3KKAC 1CRXA 5ALDA 4F92B 4ED8A 1V38A 3AQKA 4F5NA 3PX0A 4PZOA 3UMBA 7ICHA 1U45A 1TE2A 4EENA 2ESEA 3G6XA 1S97A 5HMLA 8ICCA 2BQUA 3RJGA 2F3NA 2BCRA 5DBCA 4IG8A 5JTIA 2KZZA 4NL9C 1TAQA 2W04A 4QW9A 5AKIA 1K5OA 3N97B 3QE9Y 2G5IB 5AI4A 4DOBA 2V9WA 5J0TA 4QNLA 3TANA 3WK5A 4AT8B 2BCSA 4DS4A 1X9SA 5J2GA 3IDWA 2AGPA 5D62A 3TAQA 4QZAA 4DQSA 5J2BA 4IRDA 4OCZA 2FMPA 1M6YA 4O5CA 3ETLA 2ZH4A 2GAFD 2GA9D 2GOLA 4C4SA 2KJ8A 4FHXA 4R65A 4PL2A 4IL6U 1ZQZA 2Q66A 1XSLA 1COOA 2KMDA 4KLOA 2JZBA 3OSNA 5KFRA 3RR8A 2RLTA 3UXOA 4J9MA 3F2BA 3RJKA 2K8CB 9ICIA 3OV7A 2CPRA 1ZD3A 4PHEA 3EPIA 2KD1A 3FAHA 3PMNA 1SWVA 2WF6A 5HMMA 4CNQA 9ICQA 3ERCC 2ZH8A 5AKGA 5HRGA 3C2KA 5KG7A 1R8BA 4ECWA 1T7PA 2F8LA 1NK5A 2WHEA 4YN4A 2XCPA 3OWGA 5AI9A 1HJPA 1N61A 1R8CA 5F9NA 3OHAA 1Z19A 2Y9TA 4RQ7A 1ZRMA 4J9SA 4UB5A 3C2LA 2AGQA 1KW4A 2I9GA 4Y2TA 1UEVA 2HVIA 1Z00B 5J2HA 4JK1A 2LKYA 8ICJA 3E58A 5G5HA 3RRHA 4UB2A 4CF4A 2JEGA 4KLHA 8ICYA 5KG2A 2HDOA 2K60A 9ICJA 2M2VA 4DFKA 1UQVA 2ZIVA 4P0QA 5J0XA 8ICWA 1B22A 3ALRA 3WK4A 2C2RA 1BGXT 4Z6FA 4YD2A 2XGPA 4DL7A 2DRBA 2W9CA 5AI0A 1ZQPA 3T5KA 4ELUA 3BZCA 2R18A 3C1ZA 3V6JA 3PO5A 2KICA 4YCXA 3G6VA 2F2AB 4O5KA 2Q0ZX 5EE0A 3C1YA 1XU4A 3K4GA 3PHZA 4FH3A 4DL2A 5JUMA 4TQSA 1KL9A 3UQ2A 2AH5A 5CWRA 1V9PA 2J6TA 4WC5A 2KV2A 2WTFA 4LVSA 5EWFA 3PNCA 4WC4A 4Z6CA 3ORYA 1QQ6A 4NXTA 2BKEA 4F50A 3Q8KA 4I2FA 3WFPA 1V97A 5GTHU 4ECSA 4ECQA 3IG5A 2BCQA 7ICQA 1CEZA 1FA0A 5DEDA 3EPGA 9ICVA 3NVOA 3KHGA 4QZCA 3QZ7A 2QB0A 1S10A 1FFUA 4GC6A 3RH5A 2E1FA 1U4BA 5KFXA 3TFRA 5J0PA 4DSFA 4BJQA 1L3UA 5IIJA 4J9NA 2FPMA 2ZXIA 2LPEA 3T5LA 5AKHA 4BWMA 5DB9A 4YXMA 1MN8A 1FFVA 1ZD5A 1NKEA 1BPYA 1JIHA 5AKLA 4PH5A 2JGAA 2W9BA 1U48A 1NJYA 9ICWA 4BX9C 1XNSA 5KFDA 2ZIUA 5B66U 5KFAA 3V7LA 3JPPA 2DF4B 2KE7A 2ASLA 2JXJA 5ALKA 3SYZA 1NNLA 1V85A 4AP9A 5ALEA 2R8IA 2DKZA 1L8OA 5L1IA 4I2HA 5ALRA 3QZ8A 5CA7A 3MDAA 4RPYA 2AQ4A 4O68A 2P6UA 3F2DA 2XI9A 2GLEA 4N7RA 2EAOA 5E79U 3PY8A 1N2XA 3CK6A 2M9NA 5KFVA 4LJXA 1X9XA 3H4DA 2FI1A 2DL0A 2OM6A 2KHQA 2EH9A 3I1YA 2C2EA 1RYRA 2LYAA 4KLGA 1Q3UA 4C8NA 2GWSA 2QKQA 1MIVA 3GQCA 1Y88A 4Y2XA 3H40A 5AM1A 2YB4A 1S5LU 4EBDA 3RR7A 2H5XA 5IIKA 5HRIA 4O5EA 1A6SA 2H3FA 5KFLA 2VKQA 4YMNA 5C5JA 3SZ2A 1QH9A 5CFTA 4J03A 1QSSA 4KLFA 1IM4A 5J0OA 8ICZA 5DGAA 2O1PA 4F2SA 1NK0A 4OAFA 2WF7A 1KFTA 2N1RA 2G06A 4I2JA 4WC1A 5CJ7A 4OJOA 1DXSA 1C20A 3JPOA 4RWNA 2B56A 4QZFA 3MFIA 5HRKA 3K7DA 4GXJA 2F1JA 4ZH4A 3C66A 3LVWA 5DQGA 2R8KA 4KMUA 4UARA 4OAGA 1SXEA 2KFNA 2W3RA 5KFPA 4P4PA 1SKSA 8ICSA 3ZDCA 2GH1A 4F4XA 4M9JA 3PR4A 2W8KA 2HHSA 3H0RB 3RJJA 3KHLA 3KHHA 2AHOB 4BGDA 5DECA 2ZXHA 4BUGA 5AIBA 2LHTA 3HJ1A 3UPSA 4DSEA 4IQVA 2L5YA 4M9HA 4IQWA 4K4IA 3QU4A 8ICNA 4DSJA 4NXZA 4GXIA 4QZ9A 2VJ4A 3TQ1A 2IBKA 1ZYQA 4M5DA 1BPXA 2ZIWB 4Y2YA 1DRGA 3SMVA 2YMLA 2E3TA 1SZPA 1CI4A 2DR9A 2DPIA 3B9JA 8ICUA 7ICNA 2I1QA 3KZIU 4B9VA 2ISPA 5ALUA 3WK9A 1PX5A 3QUBA 4B9NA 5CRXA 3GIJA 4B9TA 4KLTA 3NVWA 4LZGA 1ZQFA 3PMLA 2DUYA 2G08A 4KLDA 1DK3A 4UQGA 4I2GA 4ATBA 3BQ7A 2E8NA 4IRCA 2D3DA 1PK1B 1JROA 2RHFA 3SI8A 4KLSA 2HI0A 4EYIB 2KSOA 4E7XA 3UMGA 5DLGA 2KJ9A 9ICKA 5KTQA 5ALGA 2BPCA 4FBTA 3OPXA 3HJEA 4YVZA 2ZUCA 4WH5A 3THVA 5DG9A 3H3AA 1S0OA 4M6WB 2JH7A 3MGHA 1DOQA 1BPZA 2DKXA 5CP2A 3N4MB 1RYSA 4RUAA 2UVVA 2LM4A 2QARB 4NXWA 4TUSA 4UAUA 9ICMA 7ICPA 1SB3C 3HKZF 4RWPA 3PSTA 2NRVA 2XGQA 4C4RA 2BPFA 4RPZA 3PW7A 3BDPA 3IN5A 4X4NA 1PVPA 5CEHA 2KIVA 4YFKA 1ZQRA 4PGQA 4Z6EA 3RJEA 4DQQA 4USAA 4NKUA 3H8WA 1PVQA 3SV3A 5IIOA 2FE9A 1JMSA 4RQ8A 2D6FC 4NXUA 2ZHAA 2NYVA 4NLNA 5KFFA 4O0IA 4US9A 3OSPA 4O9MA 4I2DA 9ICBA 4AYBF 4JV2A 1UEUA 2YX8A 1TFRA 3K75D 3RB6A 3UQ0A 5IINA 2NO4A 4PJ0U 5KT5A 4TQRA 4EP7A 3QU9A 1SWWA 3A0HU 4IS7A 5DG7A 2YMQA 5ALTA 3H7IA 4LT6A 3OTQA 5KFOA 3JPTA 4X4PA 1RG6A 5BPCA 4MFFA 4EEBA 2RQ5A 1UA1A 3TADA 2ZH9A 2MA1A 3ZI4A 5AK5A 1Z1VA 2MRLA 3N7RC 3CW2C 3A0BU 3HKZC 3AMZA 4KLUA 1NKCA 2HHPA 2LMRA 1OU5A 3RH4A 1RDFA 2C28A 5J8YA 1ZQOA 3M1YA 2G0AA 3RF9A 2IA6A 3ZDDA 1V4AA 1KBUA 7ICTA 3ISCA 3H39A 3TACB 3AN1A 3Q8RB 3QX7A 2H3QA 5HR9A 4KLLA 2M2WA 1RPLA 3F5EA 4RQNA 1D8LA 8ICPA 3QUCA 2EANA 5D46A 4DSIA 4CDGA 4TUQA 4P0PA 4J9RA 4R66A 4FZMA 2M0NA 2IUBA 2LYBA 5F9LA 4LEZA 4GFJA 8ICOA 3FDSA 5AI8A 5KFGA 4ECVA 5KT7A 3H0LB 2G5HB 4AYBC 1SKWA 1DGJA 4MHVA 4X4VA 2ZIXA 2BZFA 3ER9B 2W55A 1X2IA 4BWJA 3LVVA 2RDJA 1NKBA 2YTUA 1RM6C 3QUQA 1N48A 2M2TA 2J6SA 3IHQB 3JCFA 2ZH1A 4KN7A 5KFYA 3D2SA 2MU2A 1NK8A 3WU2U 4K8VA 4IRKA 1U9LA 5AKXA 3C21A 4UASA 3L3FX 3SR6A 3K1ZA 1UPHA 1XSNA 1KRPA 5KG1A 5ALZA 5KAIU 3PX6A 4EBEA 1RYUA 4EEYA 2AGOA 3SQIA 4E0DA 1ZQCA 1L8LA 4EYHB 4WC7A 5AM5A 2KFZA 2KN7A 1ZQGA 5BOMA 4X4UA 3H4BA 1X6IA 3HW8A 5ALWA 4LEWA 1QLNA 5AHXA 1JN3A 2NRZA 4S3NA 7ICSA 5J2FA 1KSPA 5HRFA 1TK5A 1LKYB 3ZD8A 2RP5A 3NRZA 2ZTCA 3EZ5A 3MDCA 3D2QA 2A1JB 1NO5A 3GIKA 2BCVA 4F91B 1NJXA 1FEZA 1Z4OA 2LI6A 2YQEA 1ZJMA 2Y1IA 1OXJA 2E8PA 4C0ZA 3NRWA 2KVSA 1X9WA 4KTQA 2K89A 2OEHA 5HR6A 3V7JA 5J0SA 2ZG6A 5L1KA 2DRAA 4NKTA 1XO1A 3V6HA 5AKJA 4F8RA 2VA2A 5KAFU 1L3SA 3M9NB 4DL4A 1EXNA 4UAWA 4F5QA 4RQ5A 3SV4A 2K8AA 4M9GA 3RB3A 3ED5A 4DOAA 2UVUA 2HMXA 4DL6A 1XO0A 3EYZA 4JV0A 3TAPA 4UB6U 2R8GA 1U49A 2HHUA 4OD0A 3NASA 4RQMA 4OJ5A 2LM1A 2EWRA 1N62A 4EBJA 2PFOA 4QZ8A 1XS9D 4KX5A 5G5GA 3AEVA 4Y2VA 4CRXA 5CB1A 4R63A 2QB0B 1IIPA 4TURA 5EOZA 4C4TA 3SEIA 5HR7A 1PUZA 5F3XB 1ZQDA 4JV1A 2OYYA 1QQ5A 1SL0A 3HIYA 3HJ4A 5HC9A 4DL5A 3M7DA 5HHIA 4M0AA 2KNJA 4M2YA 1N60A 3MCRA 2EZXA 5L1MA 4F4KA 3NTUA 4F4WA 4NM2A 4C8KA 4ECYA 2F8KA 5HNKA 2W9BB 4MF8A 2KIWA 3MR2A 1O08A 1KTQA 5ALYA 4J9PA 1U47A 4QWBA 2H3IA 1MSWD 4K98A 1NOMA 4Y2PA 5T14A 2G09A 3R9KA 1TKDA 2OH2A 4O67A 4WC2A 2WB1F 4MFAA 4DSLA 1PK3A 2VIXA 2A3VA 4RWOA 5DDMA 1PVRA 4CF5A 2C2DA 3U26A 4F5OA 4RQ2A 4ICAA 2HBMA 4JMUA 3ICXA 2BDUA 3D6JA 3IG8A 4QWEA 1L3TA 4EX6A 2AJQA 1Z00A 2NRKA 1WOTA 4JLZA 1RZTA 3KZXA 4YR0A 2FPLA 2ASJA 1SV0A 1J2NA 1YT3A 2W43A 5ALHA 4BXOB 5DQHA 5J0QA 1S9FA 2I6XA 2ZH5A 5DBBA 4WJ3B 1YLQA 3L5KA 1SGGA 3M8RA 1HIWA 9ICRA 1X6JA 1MQ3A 5JTGA 1SL1A 2BQRA 5KFCA 2JV3A 1J2MA 2VJ5A 4Q43A 1T94A 2DWQA 3WFQE 5KFEA 3T5HA 1SIJA 4RT2A 4YD1A 7ICIA 2C22A 3BQ0A 4UAZA 3QXGA 1NK7A 2EZZA 5AKZA 3BQ2A 1FIQA 3RRGA 3TADC 4FS2A 1D8BA 2B51A 1T4GA 1N5WA 8ICVA 4F71A 5HP4A 5ALJA 5D63A 1BVSA 5DB8A 2XO7A 4WC6A 4X4RA 5J0UA 1TK0A 1S8OA 3ZDEA 4FH5A 4RZRA 5L1JA 4NXVA 3MR5A 4R8UB 1YZ7A 3M9MB 3BQ1A 1MIYA 4DF4A 2ZH7A 2NRWA 2ES6A 3C5FA 3I76A 3OUYB 3RBDA 4MFCA 2PI5A 5D49A 3L9DA 4IR1A 5KG0A 4I2IA 5J2JA 2HVHA 3KBBA 4WC3A 3QU2A 3BQTA 1ZRNA 4ELVA 3IM1A 5AK6A 4AT7B 4ED6A 4P4OA 3TI0A 1Q8KA 3PV8A 4IC9A 2KZMA 2JEIA 2ZH3A 1X40A 4Q45A 1O03A 2KKPA 3AL0B 7ICKA 4YQWA 2ASDA 5KT2A 4PHDA 5DKWA 2PXIA 4I29A 5IILA 4WCWA 3MR6A 3ZDBA 3OVBA 2K8BB 1ZXIA 4XQ7A 2P6RA 2ZJ5A 2IHOA 9ICLA 2ODGA 2F1IA 5F2VO 3H38A 4LEYA 2CXYA 2V4RA 5FP0A 4JB3A 4EELA 3PW4A 2PBEA 3OJSA 1VFGA 4B9MA 4YMMA 5L1LA 4F72A 4JLXA 2PMZF 1HUZA 4K97A 4C8OA 3ER8C 4PGXA 4ECTA 1A77A 1CUKA 3DDHA 4RQ3A 4IR9A 1SV4A 3J81j 4KITB 3BS5B 4UB8U 4NLZA 4ATBB 2VA8A 8ICBA 9ICUA 4QZDA 2XCAA 3G6YA 2E8MA 8ICAA 3TFSA 1KN5A 5H2FU 2G07A 4Q8FA 4FE3A 4B6JA 4X4SA 1NZPA 1SZHA 2ISOA 2UVRA 3UMCA 4ECZA 2MSNA 4UBBA 5D61A 3NVZA 4KB6A 9ICHA 4F93B 5HRHA 3H37A 4NLGA 2EZYA 4RUCA 3ISDA 1T3QA 2YMPA 5EE3A 4Y2JA 4F2RA 4FS1A 3PSPA 1WG8A 3D2NA 3AU2A 3CNHA 3FC4A 1LB2B 5CHEA 5EWEA 4F3OA 5D4BA 1N56A 4WOYA 2ZJAA 4EGWA 2MUTA 1S77D 4GIBA 2FLLA 2PMZC 1KEJA 3JPQA 5AIAA 3Q8PB 3V6KA 3WFOA 3PSFA 4HAIA 1GPJA 4FO1A 3I28A 7ICOA 5AM4A 4RQ0A
chains in the Genus database with same CATH topology
4KLHA 5KT3A 2W9MA 5J29A 8ICYA 5KG2A 1L5UA 4MEYA 1KLNA 8ICIA 5F9LA 3V7KA 4ED2A 9ICJA 5KG4A 3ZD9A 4TUPA 3FDSA 5KFGA 4ECVA 4DFKA 8ICOA 2M2VA 5KT7A 5J0XA 8ICWA 4BXOA 4RWQA 1B22A 4UAYA 1TV9A 2IHNA 4R64A 2ZH2A 4RNNA 2C2RA 1SKWA 7ICLA 1BGXT 1X9MA 4Z6FA 4YD2A 2XGPA 2KTQA 4DL7A 4X4VA 2DRBA 2XY5A 2W9CA 1ZQPA 5KFKA 4KLIA 3T5KA 1X2IA 4ELUA 4BWJA 4UBCA 2RDJA 1NKBA 3C1ZA 3V6JA 5KFTA 1N48A 2M2TA 1ZQHA 2J6SA 3IHQB 3PO5A 2P66A 1ZQYA 1S0VA 2HHQA 4YMOA 1JXLA 4YCXA 5KT6A 3G6VA 5HHHA 3RTVA 1D8YA 4KLQA 4KN7A 2ZH1A 5KFYA 2FPKA 3UXPA 1NK8A 4O5KA 2Q0ZX 5J0WA 4QWDA 1D9FA 3C1YA 3GIMA 1XU4A 3K4GA 3UPQA 3RJHA 4X4OA 4IRKA 1U9LA 3PR5B 4FH3A 5KFMA 1ZQWA 3C21A 3H8SA 4DL2A 4I27A 5JUMA 2UVWA 4TQSA 3UQ2A 4ED0A 1S0MA 1XSNA 1KRPA 1QTMA 5DBAA 9ICGA 5KG1A 4PPXA 5CWRA 1XSPA 8ICMA 1V9PA 2J6TA 4DQPA 2XY6A 4WC5A 4EZ9A 2WTFA 3PX6A 3RAQA 4EBEA 4EEYA 2AGOA 4E0DA 4LVSA 5EWFA 3PNCA 3C2MA 2V4QA 4EYHB 1ZQCA 4Z6CA 5HREA 4WC4A 9ICEA 4WC7A 4X4QA 3ORYA 2KFZA 4F4YA 2RFFA 2KN7A 4DLGA 4R8UA 2BQ3A 3AUOA 5KFHA 5BOMA 2BKEA 3GDXA 1ZETA 1ZQGA 2ZJ8A 3H4BA 4F50A 3Q8KA 5J2EA 5IIMA 4I2FA 4XQ8A 3WFPA 2ZUDA 3HW8A 1H38A 2MUTB 4ECSA 4ECQA 2BCQA 3PW5A 7ICQA 5KFSA 1ZQNA 4UD5A 1CEZA 1FA0A 2ALZA 5DEDA 1ZQUA 4B9LA 4JWMA 1QLNA 3OUYA 3EPGA 3T3FA 1JN3A 9ICVA 2NRZA 5J0YA 4S3NA 2O5AA 8ICFA 4QW8A 5KFWA 4RPXA 3KHGA 3HWTA 3MBYA 5DQIA 5J2FA 4FO6A 4QZCA 1KSPA 1TK5A 3H8JA 4UB4A 4M9NA 5HRFA 7ICUA 3QZ7A 1S10A 4PHPA 3ZD8A 4QWCA 4GC6A 3EWAA 3RJIA 3RH5A 1U4BA 1S0NA 9ICXA 5KFXA 3LQCB 3TFRA 5J0PA 3MFHA 4DSFA 1L3UA 1BNOA 2ZTCA 5IIJA 2FPMA 3MDCA 3EZ5A 4J9NA 3T5LA 4DFPA 9ICCA 2M2UA 4UD4A 2ID1A 3KHRA 3KTQA 4AT7A 2A1JB 1NO5A 3OVAA 4WBYA 4XA5A 3GIKA 4NY8A 1BPBA 1TVAA 3LK9A 4RNMA 2BCUA 1B43A 5J2AA 4F91B 4BWMA 5DB9A 2VANA 3MABA 4F5PA 1NJXA 5KFBA 4YXMA 1ZJMA 5CR0A 4ED1A 4ED7A 2Y1IA 8ICHA 1UT8A 4UB1A 2XC9A 4J9RA 1WCLA 4C8MA 1UA0A 1NKEA 5J2IA 3C5GA 3OJUA 1BPYA 1JIHA 4ELTA 2BPGA 4PH5A 1ZQEA 2KZ3A 3HT3A 1X9WA 9ICPA 4KLMA 2W9BA 1U48A 1NJYA 4KTQA 3PVXA 4M6WA 9ICWA 3GV8B 5KFDA 2JEJA 8ICRA 5KFAA 3V7LA 5J0SA 3JPPA 3V7JA 4YG2A 2ASLA 5DB7A 4O3NA 5DGBA 1L3VA 4RT3A 2ZH6A 5L1KA 4O3PA 5BOLA 3SYZA 3HPOA 4BDPA 4RQ6A 2J6UA 2DRAA 8ICXA 4NKTA 4MEXA 1XO1A 3V6HA 2R8IA 4F4ZA 1UT5A 3QEAZ 5L1IA 4F8RA 1XWLA 2VA2A 1C7YA 3UXNA 1L3SA 4I2HA 3M9NB 3QZ8A 4DL4A 1EXNA 4UAWA 4F5QA 5CA7A 3T5JA 8ICEA 3MDAA 4RQ5A 4ECXA 4RPYA 3JZ0A 4GLXA 2AQ4A 3SV4A 4M9GA 4O3SA 5KFZA 3RB3A 2P6UA 1ZQBA 4DOAA 2UVUA 2R8JA 5J2KA 1Q79A 1DGSA 4Q44A 4GC7A 4DL6A 2HHVA 5CHGA 5KT4A 3EYZA 4JV0A 3TAPA 2BHNA 3GV5B 4I2AA 4QZHA 1U49A 1T3NA 1BPDA 2R8GA 3PY8A 4ECRA 2HHUA 4LZDA 1NJWA 2M9NA 1ZQVA 5KFVA 1R89A 4E80A 4X5VA 2RDIA 1ZQLA 3H4DA 4M9LA 4P2HA 2DFLA 3C23A 2BR0A 4YP3A 1Z3EB 2DVIA 2C2EA 1RYRA 4QWAA 4KLGA 5KFIA 4EBJA 4C8NA 2PFOA 9ICAA 4QZ8A 2GWSA 4RQ1A 1MIVA 1XS9D 3GQCA 1Y88A 2HHTA 4YR2A 3H40A 4EBDA 3RR7A 5CB1A 4R63A 2H5XA 5IIKA 7ICJA 5HRIA 1ZQJA 4O5EA 4TURA 2JZBB 4AT9A 5HRBA 5KFLA 5EOZA 4I2CA 4YMNA 3PW0A 2KP7A 1ZQDA 4F5RA 5C5JA 4JV1A 9ICTA 3SZ2A 4XRHA 1SL2A 4DQRA 1ZQAA 1SL0A 3HIYA 3HJ4A 3JPSA 5HC9A 2DR5A 4DL5A 3LDAA 1QSSA 4KLFA 1IM4A 1NJZA 5HHIA 5J0OA 4M0AA 3OVSA 4M2YA 8ICZA 4RU9A 3RBEA 5DGAA 4F4KA 3NTUA 9ICSA 4F2SA 2O1PA 4F4WA 1NK0A 4EZ6A 4NM2A 4DSKA 1KFTA 4C8KA 1T8EA 1LV5A 4ECYA 1RXVA 4I2JA 4WC1A 5HNKA 5CJ7A 3MR3A 4MF8A 2W9BB 3MR2A 2IMWP 7ICFA 2PFQA 1KTQA 4J9PA 1U47A 4QWBA 1NK9A 3JPOA 2ZTEA 4DQIA 1MSWD 1NOMA 4RWNA 8ICLA 4QZFA 1ZQKA 4FHYA 3EW9A 2NRXA 4J9QA 3MFIA 5HRKA 2DPJA 4ECUA 1TKDA 9ICOA 2Y1JA 2LYHA 1WCNA 4G3IA 4WC2A 4GXJA 2F1JA 4ZH4A 4MFAA 3C66A 5DQGA 2R8KA 4KMUA 4DSLA 4NM1A 4UB3A 4P4MA 4M47A 4RWOA 5DDMA 2C2DA 2KFNA 3JYYA 5KFPA 2B21A 5HRLA 4F5OA 2DR7A 2BE3A 4P4PA 4RQ2A 1IXRA 1SKSA 8ICSA 1F5AA 3ZDCA 1MIWA 2FMQA 1D9DA 4FHWA 4QZGA 4F4XA 3FYHA 4QWEA 1L3TA 3GV7B 4M9JA 3PR4A 2W8KA 3BJYA 3PX4A 3M8SA 2HHSA 4DF8A 3RJJA 1Z00A 1ZQXA 3KHLA 1ZJNA 3PO4A 2AJQA 1WOTA 2NRKA 3KHHA 4YR0A 5EWGA 1RZTA 4BGDA 2FPLA 3AQNA 4EBCA 2ASJA 5DECA 3JPRA 1ZQQA 4BXOB 4X4UA 5DQHA 1JAJA 4KN4A 5J0QA 1S9FA 3OHBA 1ZQMA 2ZH5A 5DBBA 1NK4A 1YLQA 3AU6A 2VA3A 2PI4A 3GFKB 3M8RA 1QSLA 2DR8A 2W9CB 2ZUBA 2R8HA 4O3QA 4KLEA 4AT9B 9ICRA 4QZIA 3HJ1A 1MQ3A 2FLNA 3UPSA 4JWNA 4DSEA 1SL1A 2PFNA 4IQVA 2BQRA 1ZQTA 5KFCA 4M9HA 4QZBA 4IQWA 4K4IA 4Q43A 2HHWA 4DSJA 8ICNA 4DFMA 4C8LA 4NXZA 4GXIA 3WFQE 5KFEA 4QZ9A 3T5HA 3TQ1A 2IBKA 1ZYQA 4M5DA 5KG5A 4RT2A 4YD1A 1BPXA 1ZQSA 7ICIA 4YXJA 2C22A 4Z6DA 4RQ4A 4UAZA 3BQ0A 4DOCA 1NK7A 1BNPA 9ICNA 3V72A 3BQ2A 4IQUA 1PZNA 4J9LA 3GILA 3RRGA 3RJFA 4FS2A 1SZPA 3AQLA 4PGYA 2F1HA 8ICGA 4R66A 3ZDAA 2DR9A 3AQMA 1T4GA 5J0RA 3Q8MA 2FMSA 4JUZA 5DDYA 5HP4A 2DPIA 8ICVA 1JX4A 1BVSA 4IQTA 3HX0A 8ICUA 5DB8A 2XO7A 1TFWA 4WC6A 4X4RA 5J0UA 3Q8LA 2BCVA 1TK0A 7ICNA 7ICVA 1UETA 2I1QA 3ZDEA 3RH6A 4Q8EA 8ICQA 4B9VA 4RZRA 5L1JA 4FH5A 2HHXA 3MR5A 4R8UB 2ISPA 3M9MB 2AU0A 1RXWA 1PX5A 3M9OB 3MGIA 3B0YA 3BQ1A 4MF2A 4B9NA 8ICTA 1MIYA 4FHVA 2AQ0A 4DF4A 4EBKA 2ZH7A 3GIJA 4B9TA 2NRWA 4KLTA 2W9AA 4FBUA 3C5FA 4LZGA 2MAXA 4I2BA 1ZQFA 4AT8A 3PMLA 3RBDA 3OUYB 3C18A 7ICMA 4MFCA 4KLDA 4PHAA 2PI5A 5D49A 2ATLA 3L9DA 4IR1A 5KG0A 1DK3A 4I2IA 4NLKA 4O3OA 5J2JA 5IIIA 5DG8A 7ICGA 4UQGA 4I2GA 2HVHA 4WC3A 4ATBA 1TFYA 3OGUA 3B0XA 2IHMA 4IRCA 3BQTA 3RAXA 4E8FA 7ICRA 4I2EA 5KG6A 3ISBA 4K4HA 4ELVA 3SI8A 5TZVA 3IM1A 2W8LA 4KLSA 3NGDA 4J9OA 4EYIB 4DFJA 4E7XA 5KFJA 3LWMA 4M04A 4AT7B 5DLGA 1KFSA 5KFNA 4ED6A 4WC0A 4P4OA 3TI0A 1TAUA 5KFUA 3RB0A 1NK6A 1HUOA 4KLJA 4HYKA 9ICKA 5KTQA 4K4GA 1KNYA 3LWLA 2BPCA 3PV8A 1JQRA 3WFRE 4FBTA 2KZMA 2JEIA 4YVZA 2ZH3A 2A1JA 2ZUCA 4DWIA 4Q45A 7ICKA 3THVA 4YQWA 5DG9A 1MC8A 2ASDA 3H3AA 4QZEA 5J2CA 5KT2A 3RB4A 2FLPA 4PHDA 7ICEA 1S0OA 4F92B 4M6WB 4ED8A 5DKWA 3MGHA 2PXIA 4DL3A 4I29A 3AQKA 5IILA 4F5NA 1DOQA 4WCWA 3MR6A 1S76D 3PX0A 3ZDBA 1BPZA 1K1SA 3QEBZ 2ZHBA 5CP2A 3OVBA 1AROP 7ICHA 3N4MB 1U45A 1RYSA 8ICKA 4RUAA 1TK8A 4XQ7A 2UVVA 3G6XA 2P6RA 1A76A 2ZJ5A 5HMLA 1S97A 5L9XA 1KDHA 8ICCA 4TUSA 2BQUA 9ICLA 9ICMA 7ICPA 4CCHA 3RJGA 1QSYA 2F1IA 2BCRA 5DBCA 4ED3A 2XY7A 3H38A 5F2VO 2NRVA 4RWPA 2BDPA 2KZZA 2V4RA 2PFPA 4IG8A 2XGQA 1TAQA 4QW9A 3PW4A 2NRTA 2BPFA 2PBEA 3OJSA 4RPZA 2BGWA 3PW7A 1VFGA 4B9MA 3Q8SB 3N97B 2OWOA 3BDPA 1JXEA 4YMMA 3QE9Y 1MQ2A 5L1LA 2HW3A 4DOBA 2V9WA 2JEGA 4X4NA 5DB6A 5J0TA 3TANA 3NYBA 4YFKA 1HUZA 4AT8B 4C8OA 4PGXA 4X0AA 2BCSA 4ECTA 1A77A 1CUKA 4DS4A 1X9SA 1ZQRA 4PGQA 4Z6EA 5J2GA 4RQ3A 4IR9A 3RJEA 4DQQA 2AGPA 3TAQA 4QZAA 4NKUA 3H8WA 4DQSA 4KITB 3SV3A 4NLZA 5J2BA 4ATBB 4IRDA 1VJ7A 2FMPA 4O3RA 2VA8A 4O5CA 2ZH4A 3ETLA 8ICBA 5IIOA 9ICUA 1JMSA 4RQ8A 2ZHAA 4FHXA 1XC9A 4R65A 4QZDA 2XCAA 4NLNA 3G6YA 5KFFA 1ZQZA 4O0IA 3TFSA 3OSPA 4O9MA 8ICAA 2Q66A 4I2DA 3JPNA 1XSLA 9ICBA 1COOA 4KLOA 4JV2A 2JZBA 3OSNA 4DLEA 4Q8FA 3K75D 1TFRA 1UEUA 5KFRA 3RB6A 3UQ0A 3RR8A 1NZPA 4X4SA 3UXOA 2ISOA 4J9MA 5IINA 2JEFA 2UVRA 3E2EA 5KT5A 4TQRA 4ECZA 4UBBA 5DLFA 4EP7A 4DO9A 4DS5A 3RJKA 4GXKA 1KFDA 5DG7A 9ICIA 3OV7A 4PHEA 3EPIA 5HRDA 9ICHA 4X4TA 3H7IA 4LT6A 4B9SA 5KFOA 4F93B 3JPTA 4X4PA 5HRHA 3H37A 4X0BA 4NLGA 5BPCA 3PMNA 4RUCA 5HMMA 5KG3A 3ISDA 4MFFA 9ICQA 1Q78A 2ZH8A 3PW2A 5HRGA 3C2KA 1UA1A 3WFSC 4WBZA 4F2RA 1K1QA 5KG7A 4FHPA 1R8BA 2ZH9A 4ECWA 1T7PA 7ICSA 4RNOA 1SKRA 4FS1A 3TARA 4XUSA 3AU2A 4KLUA 1NK5A 1NKCA 4I28A 1LB2B 2HHPA 4YN4A 2XCPA 1OU5A 3RH4A 5KFQA 5EWEA 4F3OA 2C28A 1HJPA 5D4BA 1N56A 1R8CA 5F9NA 3OHAA 1R8AA 4RQ7A 3Q8QB 1ZQOA 1V4AA 2ZJAA 2IA6A 4B9UA 3ZDDA 4J9SA 4UB5A 3C2LA 2AGQA 7ICTA 2MUTA 3ISCA 3H39A 1S77D 5J2DA 2I9GA 1DK2A 1BPEA 4DEZA 2FLLA 4YR3A 3Q8RB 3HP6A 1KEJA 2HVIA 9ICFA 1UEVA 3JPQA 4J9KA 3Q8PB 3V6KA 1ZQIA 3WFOA 5HR9A 1Z00B 5J2HA 3GIIA 4JK1A 4KLLA 2M2WA 1RPLA 8ICJA 8ICPA 1D8LA 5D46A 4DSIA 2ZTDA 7ICOA 3RRHA 4TUQA 4UB2A 4RQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLH A;  5KT3 A;  2W9M A;  5J29 A;  8ICY A;  5KG2 A;  1L5U A;  4MEY A;  1KLN A;  8ICI A;  5F9L A;  3V7K A;  4ED2 A;  9ICJ A;  5KG4 A;  3ZD9 A;  4TUP A;  3FDS A;  5KFG A;  4ECV A;  4DFK A;  8ICO A;  2M2V A;  5KT7 A;  5J0X A;  8ICW A;  4BXO A;  4RWQ A;  1B22 A;  4UAY A;  1TV9 A;  2IHN A;  4R64 A;  2ZH2 A;  4RNN A;  2C2R A;  1SKW A;  7ICL A;  1BGX T;  1X9M A;  4Z6F A;  4YD2 A;  2XGP A;  2KTQ A;  4DL7 A;  4X4V A;  2DRB A;  2XY5 A;  2W9C A;  1ZQP A;  5KFK A;  4KLI A;  3T5K A;  1X2I A;  4ELU A;  4BWJ A;  4UBC A;  2RDJ A;  1NKB A;  3C1Z A;  3V6J A;  5KFT A;  1N48 A;  2M2T A;  1ZQH A;  2J6S A;  3IHQ B;  3PO5 A;  2P66 A;  1ZQY A;  1S0V A;  2HHQ A;  4YMO A;  1JXL A;  4YCX A;  5KT6 A;  3G6V A;  5HHH A;  3RTV A;  1D8Y A;  4KLQ A;  4KN7 A;  2ZH1 A;  5KFY A;  2FPK A;  3UXP A;  1NK8 A;  4O5K A;  2Q0Z X;  5J0W A;  4QWD A;  1D9F A;  3C1Y A;  3GIM A;  1XU4 A;  3K4G A;  3UPQ A;  3RJH A;  4X4O A;  4IRK A;  1U9L A;  3PR5 B;  4FH3 A;  5KFM A;  1ZQW A;  3C21 A;  3H8S A;  4DL2 A;  4I27 A;  5JUM A;  2UVW A;  4TQS A;  3UQ2 A;  4ED0 A;  1S0M A;  1XSN A;  1KRP A;  1QTM A;  5DBA A;  9ICG A;  5KG1 A;  4PPX A;  5CWR A;  1XSP A;  8ICM A;  1V9P A;  2J6T A;  4DQP A;  2XY6 A;  4WC5 A;  4EZ9 A;  2WTF A;  3PX6 A;  3RAQ A;  4EBE A;  4EEY A;  2AGO A;  4E0D A;  4LVS A;  5EWF A;  3PNC A;  3C2M A;  2V4Q A;  4EYH B;  1ZQC A;  4Z6C A;  5HRE A;  4WC4 A;  9ICE A;  4WC7 A;  4X4Q A;  3ORY A;  2KFZ A;  4F4Y A;  2RFF A;  2KN7 A;  4DLG A;  4R8U A;  2BQ3 A;  3AUO A;  5KFH A;  5BOM A;  2BKE A;  3GDX A;  1ZET A;  1ZQG A;  2ZJ8 A;  3H4B A;  4F50 A;  3Q8K A;  5J2E A;  5IIM A;  4I2F A;  4XQ8 A;  3WFP A;  2ZUD A;  3HW8 A;  1H38 A;  2MUT B;  4ECS A;  4ECQ A;  2BCQ A;  3PW5 A;  7ICQ A;  5KFS A;  1ZQN A;  4UD5 A;  1CEZ A;  1FA0 A;  2ALZ A;  5DED A;  1ZQU A;  4B9L A;  4JWM A;  1QLN A;  3OUY A;  3EPG A;  3T3F A;  1JN3 A;  9ICV A;  2NRZ A;  5J0Y A;  4S3N A;  2O5A A;  8ICF A;  4QW8 A;  5KFW A;  4RPX A;  3KHG A;  3HWT A;  3MBY A;  5DQI A;  5J2F A;  4FO6 A;  4QZC A;  1KSP A;  1TK5 A;  3H8J A;  4UB4 A;  4M9N A;  5HRF A;  7ICU A;  3QZ7 A;  1S10 A;  4PHP A;  3ZD8 A;  4QWC A;  4GC6 A;  3EWA A;  3RJI A;  3RH5 A;  1U4B A;  1S0N A;  9ICX A;  5KFX A;  3LQC B;  3TFR A;  5J0P A;  3MFH A;  4DSF A;  1L3U A;  1BNO A;  2ZTC A;  5IIJ A;  2FPM A;  3MDC A;  3EZ5 A;  4J9N A;  3T5L A;  4DFP A;  9ICC A;  2M2U A;  4UD4 A;  2ID1 A;  3KHR A;  3KTQ A;  4AT7 A;  2A1J B;  1NO5 A;  3OVA A;  4WBY A;  4XA5 A;  3GIK A;  4NY8 A;  1BPB A;  1TVA A;  3LK9 A;  4RNM A;  2BCU A;  1B43 A;  5J2A A;  4F91 B;  4BWM A;  5DB9 A;  2VAN A;  3MAB A;  4F5P A;  1NJX A;  5KFB A;  4YXM A;  1ZJM A;  5CR0 A;  4ED1 A;  4ED7 A;  2Y1I A;  8ICH A;  1UT8 A;  4UB1 A;  2XC9 A;  4J9R A;  1WCL A;  4C8M A;  1UA0 A;  1NKE A;  5J2I A;  3C5G A;  3OJU A;  1BPY A;  1JIH A;  4ELT A;  2BPG A;  4PH5 A;  1ZQE A;  2KZ3 A;  3HT3 A;  1X9W A;  9ICP A;  4KLM A;  2W9B A;  1U48 A;  1NJY A;  4KTQ A;  3PVX A;  4M6W A;  9ICW A;  3GV8 B;  5KFD A;  2JEJ A;  8ICR A;  5KFA A;  3V7L A;  5J0S A;  3JPP A;  3V7J A;  4YG2 A;  2ASL A;  5DB7 A;  4O3N A;  5DGB A;  1L3V A;  4RT3 A;  2ZH6 A;  5L1K A;  4O3P A;  5BOL A;  3SYZ A;  3HPO A;  4BDP A;  4RQ6 A;  2J6U A;  2DRA A;  8ICX A;  4NKT A;  4MEX A;  1XO1 A;  3V6H A;  2R8I A;  4F4Z A;  1UT5 A;  3QEA Z;  5L1I A;  4F8R A;  1XWL A;  2VA2 A;  1C7Y A;  3UXN A;  1L3S A;  4I2H A;  3M9N B;  3QZ8 A;  4DL4 A;  1EXN A;  4UAW A;  4F5Q A;  5CA7 A;  3T5J A;  8ICE A;  3MDA A;  4RQ5 A;  4ECX A;  4RPY A;  3JZ0 A;  4GLX A;  2AQ4 A;  3SV4 A;  4M9G A;  4O3S A;  5KFZ A;  3RB3 A;  2P6U A;  1ZQB A;  4DOA A;  2UVU A;  2R8J A;  5J2K A;  1Q79 A;  1DGS A;  4Q44 A;  4GC7 A;  4DL6 A;  2HHV A;  5CHG A;  5KT4 A;  3EYZ A;  4JV0 A;  3TAP A;  2BHN A;  3GV5 B;  4I2A A;  4QZH A;  1U49 A;  1T3N A;  1BPD A;  2R8G A;  3PY8 A;  4ECR A;  2HHU A;  4LZD A;  1NJW A;  2M9N A;  1ZQV A;  5KFV A;  1R89 A;  4E80 A;  4X5V A;  2RDI A;  1ZQL A;  3H4D A;  4M9L A;  4P2H A;  2DFL A;  3C23 A;  2BR0 A;  4YP3 A;  1Z3E B;  2DVI A;  2C2E A;  1RYR A;  4QWA A;  4KLG A;  5KFI A;  4EBJ A;  4C8N A;  2PFO A;  9ICA A;  4QZ8 A;  2GWS A;  4RQ1 A;  1MIV A;  1XS9 D;  3GQC A;  1Y88 A;  2HHT A;  4YR2 A;  3H40 A;  4EBD A;  3RR7 A;  5CB1 A;  4R63 A;  2H5X A;  5IIK A;  7ICJ A;  5HRI A;  1ZQJ A;  4O5E A;  4TUR A;  2JZB B;  4AT9 A;  5HRB A;  5KFL A;  5EOZ A;  4I2C A;  4YMN A;  3PW0 A;  2KP7 A;  1ZQD A;  4F5R A;  5C5J A;  4JV1 A;  9ICT A;  3SZ2 A;  4XRH A;  1SL2 A;  4DQR A;  1ZQA A;  1SL0 A;  3HIY A;  3HJ4 A;  3JPS A;  5HC9 A;  2DR5 A;  4DL5 A;  3LDA A;  1QSS A;  4KLF A;  1IM4 A;  1NJZ A;  5HHI A;  5J0O A;  4M0A A;  3OVS A;  4M2Y A;  8ICZ A;  4RU9 A;  3RBE A;  5DGA A;  4F4K A;  3NTU A;  9ICS A;  4F2S A;  2O1P A;  4F4W A;  1NK0 A;  4EZ6 A;  4NM2 A;  4DSK A;  1KFT A;  4C8K A;  1T8E A;  1LV5 A;  4ECY A;  1RXV A;  4I2J A;  4WC1 A;  5HNK A;  5CJ7 A;  3MR3 A;  4MF8 A;  2W9B B;  3MR2 A;  2IMW P;  7ICF A;  2PFQ A;  1KTQ A;  4J9P A;  1U47 A;  4QWB A;  1NK9 A;  3JPO A;  2ZTE A;  4DQI A;  1MSW D;  1NOM A;  4RWN A;  8ICL A;  4QZF A;  1ZQK A;  4FHY A;  3EW9 A;  2NRX A;  4J9Q A;  3MFI A;  5HRK A;  2DPJ A;  4ECU A;  1TKD A;  9ICO A;  2Y1J A;  2LYH A;  1WCN A;  4G3I A;  4WC2 A;  4GXJ A;  2F1J A;  4ZH4 A;  4MFA A;  3C66 A;  5DQG A;  2R8K A;  4KMU A;  4DSL A;  4NM1 A;  4UB3 A;  4P4M A;  4M47 A;  4RWO A;  5DDM A;  2C2D A;  2KFN A;  3JYY A;  5KFP A;  2B21 A;  5HRL A;  4F5O A;  2DR7 A;  2BE3 A;  4P4P A;  4RQ2 A;  1IXR A;  1SKS A;  8ICS A;  1F5A A;  3ZDC A;  1MIW A;  2FMQ A;  1D9D A;  4FHW A;  4QZG A;  4F4X A;  3FYH A;  4QWE A;  1L3T A;  3GV7 B;  4M9J A;  3PR4 A;  2W8K A;  3BJY A;  3PX4 A;  3M8S A;  2HHS A;  4DF8 A;  3RJJ A;  1Z00 A;  1ZQX A;  3KHL A;  1ZJN A;  3PO4 A;  2AJQ A;  1WOT A;  2NRK A;  3KHH A;  4YR0 A;  5EWG A;  1RZT A;  4BGD A;  2FPL A;  3AQN A;  4EBC A;  2ASJ A;  5DEC A;  3JPR A;  1ZQQ A;  4BXO B;  4X4U A;  5DQH A;  1JAJ A;  4KN4 A;  5J0Q A;  1S9F A;  3OHB A;  1ZQM A;  2ZH5 A;  5DBB A;  1NK4 A;  1YLQ A;  3AU6 A;  2VA3 A;  2PI4 A;  3GFK B;  3M8R A;  1QSL A;  2DR8 A;  2W9C B;  2ZUB A;  2R8H A;  4O3Q A;  4KLE A;  4AT9 B;  9ICR A;  4QZI A;  3HJ1 A;  1MQ3 A;  2FLN A;  3UPS A;  4JWN A;  4DSE A;  1SL1 A;  2PFN A;  4IQV A;  2BQR A;  1ZQT A;  5KFC A;  4M9H A;  4QZB A;  4IQW A;  4K4I A;  4Q43 A;  2HHW A;  4DSJ A;  8ICN A;  4DFM A;  4C8L A;  4NXZ A;  4GXI A;  3WFQ E;  5KFE A;  4QZ9 A;  3T5H A;  3TQ1 A;  2IBK A;  1ZYQ A;  4M5D A;  5KG5 A;  4RT2 A;  4YD1 A;  1BPX A;  1ZQS A;  7ICI A;  4YXJ A;  2C22 A;  4Z6D A;  4RQ4 A;  4UAZ A;  3BQ0 A;  4DOC A;  1NK7 A;  1BNP A;  9ICN A;  3V72 A;  3BQ2 A;  4IQU A;  1PZN A;  4J9L A;  3GIL A;  3RRG A;  3RJF A;  4FS2 A;  1SZP A;  3AQL A;  4PGY A;  2F1H A;  8ICG A;  4R66 A;  3ZDA A;  2DR9 A;  3AQM A;  1T4G A;  5J0R A;  3Q8M A;  2FMS A;  4JUZ A;  5DDY A;  5HP4 A;  2DPI A;  8ICV A;  1JX4 A;  1BVS A;  4IQT A;  3HX0 A;  8ICU A;  5DB8 A;  2XO7 A;  1TFW A;  4WC6 A;  4X4R A;  5J0U A;  3Q8L A;  2BCV A;  1TK0 A;  7ICN A;  7ICV A;  1UET A;  2I1Q A;  3ZDE A;  3RH6 A;  4Q8E A;  8ICQ A;  4B9V A;  4RZR A;  5L1J A;  4FH5 A;  2HHX A;  3MR5 A;  4R8U B;  2ISP A;  3M9M B;  2AU0 A;  1RXW A;  1PX5 A;  3M9O B;  3MGI A;  3B0Y A;  3BQ1 A;  4MF2 A;  4B9N A;  8ICT A;  1MIY A;  4FHV A;  2AQ0 A;  4DF4 A;  4EBK A;  2ZH7 A;  3GIJ A;  4B9T A;  2NRW A;  4KLT A;  2W9A A;  4FBU A;  3C5F A;  4LZG A;  2MAX A;  4I2B A;  1ZQF A;  4AT8 A;  3PML A;  3RBD A;  3OUY B;  3C18 A;  7ICM A;  4MFC A;  4KLD A;  4PHA A;  2PI5 A;  5D49 A;  2ATL A;  3L9D A;  4IR1 A;  5KG0 A;  1DK3 A;  4I2I A;  4NLK A;  4O3O A;  5J2J A;  5III A;  5DG8 A;  7ICG A;  4UQG A;  4I2G A;  2HVH A;  4WC3 A;  4ATB A;  1TFY A;  3OGU A;  3B0X A;  2IHM A;  4IRC A;  3BQT A;  3RAX A;  4E8F A;  7ICR A;  4I2E A;  5KG6 A;  3ISB A;  4K4H A;  4ELV A;  3SI8 A;  5TZV A;  3IM1 A;  2W8L A;  4KLS A;  3NGD A;  4J9O A;  4EYI B;  4DFJ A;  4E7X A;  5KFJ A;  3LWM A;  4M04 A;  4AT7 B;  5DLG A;  1KFS A;  5KFN A;  4ED6 A;  4WC0 A;  4P4O A;  3TI0 A;  1TAU A;  5KFU A;  3RB0 A;  1NK6 A;  1HUO A;  4KLJ A;  4HYK A;  9ICK A;  5KTQ A;  4K4G A;  1KNY A;  3LWL A;  2BPC A;  3PV8 A;  1JQR A;  3WFR E;  4FBT A;  2KZM A;  2JEI A;  4YVZ A;  2ZH3 A;  2A1J A;  2ZUC A;  4DWI A;  4Q45 A;  7ICK A;  3THV A;  4YQW A;  5DG9 A;  1MC8 A;  2ASD A;  3H3A A;  4QZE A;  5J2C A;  5KT2 A;  3RB4 A;  2FLP A;  4PHD A;  7ICE A;  1S0O A;  4F92 B;  4M6W B;  4ED8 A;  5DKW A;  3MGH A;  2PXI A;  4DL3 A;  4I29 A;  3AQK A;  5IIL A;  4F5N A;  1DOQ A;  4WCW A;  3MR6 A;  1S76 D;  3PX0 A;  3ZDB A;  1BPZ A;  1K1S A;  3QEB Z;  2ZHB A;  5CP2 A;  3OVB A;  1ARO P;  7ICH A;  3N4M B;  1U45 A;  1RYS A;  8ICK A;  4RUA A;  1TK8 A;  4XQ7 A;  2UVV A;  3G6X A;  2P6R A;  1A76 A;  2ZJ5 A;  5HML A;  1S97 A;  5L9X A;  1KDH A;  8ICC A;  4TUS A;  2BQU A;  9ICL A;  9ICM A;  7ICP A;  4CCH A;  3RJG A;  1QSY A;  2F1I A;  2BCR A;  5DBC A;  4ED3 A;  2XY7 A;  3H38 A;  5F2V O;  2NRV A;  4RWP A;  2BDP A;  2KZZ A;  2V4R A;  2PFP A;  4IG8 A;  2XGQ A;  1TAQ A;  4QW9 A;  3PW4 A;  2NRT A;  2BPF A;  2PBE A;  3OJS A;  4RPZ A;  2BGW A;  3PW7 A;  1VFG A;  4B9M A;  3Q8S B;  3N97 B;  2OWO A;  3BDP A;  1JXE A;  4YMM A;  3QE9 Y;  1MQ2 A;  5L1L A;  2HW3 A;  4DOB A;  2V9W A;  2JEG A;  4X4N A;  5DB6 A;  5J0T A;  3TAN A;  3NYB A;  4YFK A;  1HUZ A;  4AT8 B;  4C8O A;  4PGX A;  4X0A A;  2BCS A;  4ECT A;  1A77 A;  1CUK A;  4DS4 A;  1X9S A;  1ZQR A;  4PGQ A;  4Z6E A;  5J2G A;  4RQ3 A;  4IR9 A;  3RJE A;  4DQQ A;  2AGP A;  3TAQ A;  4QZA A;  4NKU A;  3H8W A;  4DQS A;  4KIT B;  3SV3 A;  4NLZ A;  5J2B A;  4ATB B;  4IRD A;  1VJ7 A;  2FMP A;  4O3R A;  2VA8 A;  4O5C A;  2ZH4 A;  3ETL A;  8ICB A;  5IIO A;  9ICU A;  1JMS A;  4RQ8 A;  2ZHA A;  4FHX A;  1XC9 A;  4R65 A;  4QZD A;  2XCA A;  4NLN A;  3G6Y A;  5KFF A;  1ZQZ A;  4O0I A;  3TFS A;  3OSP A;  4O9M A;  8ICA A;  2Q66 A;  4I2D A;  3JPN A;  1XSL A;  9ICB A;  1COO A;  4KLO A;  4JV2 A;  2JZB A;  3OSN A;  4DLE A;  4Q8F A;  3K75 D;  1TFR A;  1UEU A;  5KFR A;  3RB6 A;  3UQ0 A;  3RR8 A;  1NZP A;  4X4S A;  3UXO A;  2ISO A;  4J9M A;  5IIN A;  2JEF A;  2UVR A;  3E2E A;  5KT5 A;  4TQR A;  4ECZ A;  4UBB A;  5DLF A;  4EP7 A;  4DO9 A;  4DS5 A;  3RJK A;  4GXK A;  1KFD A;  5DG7 A;  9ICI A;  3OV7 A;  4PHE A;  3EPI A;  5HRD A;  9ICH A;  4X4T A;  3H7I A;  4LT6 A;  4B9S A;  5KFO A;  4F93 B;  3JPT A;  4X4P A;  5HRH A;  3H37 A;  4X0B A;  4NLG A;  5BPC A;  3PMN A;  4RUC A;  5HMM A;  5KG3 A;  3ISD A;  4MFF A;  9ICQ A;  1Q78 A;  2ZH8 A;  3PW2 A;  5HRG A;  3C2K A;  1UA1 A;  3WFS C;  4WBZ A;  4F2R A;  1K1Q A;  5KG7 A;  4FHP A;  1R8B A;  2ZH9 A;  4ECW A;  1T7P A;  7ICS A;  4RNO A;  1SKR A;  4FS1 A;  3TAR A;  4XUS A;  3AU2 A;  4KLU A;  1NK5 A;  1NKC A;  4I28 A;  1LB2 B;  2HHP A;  4YN4 A;  2XCP A;  1OU5 A;  3RH4 A;  5KFQ A;  5EWE A;  4F3O A;  2C28 A;  1HJP A;  5D4B A;  1N56 A;  1R8C A;  5F9N A;  3OHA A;  1R8A A;  4RQ7 A;  3Q8Q B;  1ZQO A;  1V4A A;  2ZJA A;  2IA6 A;  4B9U A;  3ZDD A;  4J9S A;  4UB5 A;  3C2L A;  2AGQ A;  7ICT A;  2MUT A;  3ISC A;  3H39 A;  1S77 D;  5J2D A;  2I9G A;  1DK2 A;  1BPE A;  4DEZ A;  2FLL A;  4YR3 A;  3Q8R B;  3HP6 A;  1KEJ A;  2HVI A;  9ICF A;  1UEV A;  3JPQ A;  4J9K A;  3Q8P B;  3V6K A;  1ZQI A;  3WFO A;  5HR9 A;  1Z00 B;  5J2H A;  3GII A;  4JK1 A;  4KLL A;  2M2W A;  1RPL A;  8ICJ A;  8ICP A;  1D8L A;  5D46 A;  4DSI A;  2ZTD A;  7ICO A;  3RRH A;  4TUQ A;  4UB2 A;  4RQ0 A; 
#chains in the Genus database with same CATH topology
 5KT3 A;  4UAV A;  1L5U A;  4MEY A;  2QLT A;  3V7K A;  4ED2 A;  5KG4 A;  3ZD9 A;  2KVC A;  1TV9 A;  2IOH A;  5AKE A;  4R64 A;  4RNN A;  1X9M A;  3K1R B;  1B0X A;  2KTQ A;  4FFD A;  1P7D A;  2XY5 A;  2YY6 A;  5AK4 A;  4UBC A;  1ZQH A;  5B5E U;  1S0V A;  2HHQ A;  1JXL A;  5KT6 A;  1D8Y A;  4KLQ A;  4C80 A;  2WAQ F;  2FPK A;  4NJ8 A;  4QWD A;  3GIM A;  3GZF A;  3RJH A;  3UPQ A;  3PR5 B;  2B4V A;  5KFM A;  2UVW A;  4ED0 A;  5KL1 B;  1QTM A;  9ICG A;  2XY6 A;  3WKB A;  3RAQ A;  3L4P A;  4K99 A;  3N7P D;  3C2M A;  5HRE A;  4X4Q A;  4DLG A;  2BQ3 A;  3AUO A;  5KFH A;  4X0B A;  4CE6 A;  2ZJ8 A;  5J2E A;  4XQ8 A;  2ZUD A;  5AM0 A;  4UD5 A;  1ZQU A;  3C29 A;  3T3F A;  4CGZ A;  8ICF A;  1HEK A;  4QW8 A;  4RPX A;  1AQ6 A;  3MBY A;  5DQI A;  3HWT A;  2W03 A;  4FO6 A;  4M9N A;  4X4O A;  3H8J A;  4K9A A;  4OAI Z;  2CN1 A;  1TAM A;  4PHP A;  4X4T A;  1S0N A;  2RRD A;  1PK1 A;  5AM3 A;  3MFH A;  9ICC A;  2D8C A;  3GU3 A;  1F44 A;  3KTQ A;  5ALS A;  4WBY A;  1TVA A;  2BCU A;  5J2A A;  4F5P A;  2VAN A;  5KFB A;  1ZQ1 C;  5CR0 A;  4ED1 A;  2XC9 A;  4C8M A;  1UA0 A;  5J2I A;  2HOF A;  3C5G A;  2BPG A;  2EQY A;  3HT3 A;  1ZQE A;  2DGZ A;  3PVX A;  4M6W A;  3KD3 A;  3GV8 B;  2WAQ C;  1Q3V A;  4YG2 A;  4O3N A;  1L3V A;  2FJ6 A;  2KK0 A;  3KFU F;  4O3P A;  2JH1 A;  4BDP A;  3WKC A;  2J6U A;  2QAR A;  8ICX A;  5CFU A;  1ZD2 P;  4MEX A;  1Z4N A;  4F4Z A;  3QEA Z;  2IOF A;  1XWL A;  2Y9U A;  3UXN A;  2HBL A;  5B3Q A;  1L7O A;  3T5J A;  3JZ0 A;  3SAG A;  1ZQB A;  2R8J A;  5J2K A;  2B6G A;  3SD7 A;  4Q44 A;  2HHV A;  5CHG A;  5KT4 A;  2W3S A;  4I2A A;  4QZH A;  1T3N A;  4ECR A;  1ZQV A;  4X5V A;  5AKK A;  2RDI A;  4LEV A;  4M9L A;  4P2H A;  2DFL A;  3C23 A;  3QYP A;  4QWA A;  5KFI A;  4C7Z A;  9ICA A;  4RQ1 A;  1J97 A;  4YR2 A;  4UAT A;  5B3P A;  7ICJ A;  5KNI A;  1ZQJ A;  2JZB B;  4AT9 A;  1JUD A;  4I2C A;  3N28 A;  2K4E A;  2KP7 A;  4F5R A;  4ZOH C;  1ZQA A;  2LBO A;  3JPS A;  3LDA A;  3S6J A;  1L6N A;  2P35 A;  1NJZ A;  3FM9 A;  4U7C A;  1JAL A;  3AM9 A;  3MR3 A;  2JRZ A;  1NK9 A;  4DQI A;  2F77 X;  2ZTE A;  5ALL A;  1F0M A;  4FHY A;  3EW9 A;  2NRX A;  4J9Q A;  2DPJ A;  4ECU A;  2LYH A;  1WCN A;  4G3I A;  3ONN A;  4A8E A;  3E0F A;  2FDR A;  1NI3 A;  4NM1 A;  2E5S A;  4P4M A;  4O69 A;  2HBK A;  5HRL A;  4FHW A;  1IXR A;  2A19 A;  1F5A A;  2FMQ A;  1D9D A;  2Q4T A;  5ALM A;  1QQ7 A;  3BJY A;  4EX7 A;  3PX4 A;  1ZQX A;  3PO4 A;  4XJE A;  2HN1 A;  2KG5 A;  5EWG A;  4EBC A;  2ZIV B;  4P0Q B;  3JPR A;  1JAJ A;  2BBH A;  3OHB A;  1NK4 A;  2VA3 A;  2PI4 A;  3GFK B;  2W9C B;  3WKE A;  4O3Q A;  1KKX A;  3SEN A;  4QZI A;  2FLN A;  4JWN A;  2PFN A;  3DEE A;  1WUD A;  2Y0S F;  2O6K A;  3IP4 B;  3IV6 A;  2OXO A;  5AKY A;  5KG5 A;  1ZQS A;  2YMM A;  4YXJ A;  5GTI U;  4RQ4 A;  3AQL A;  1PZN A;  1ECW A;  2PKE A;  3RFA A;  8ICG A;  4PL1 A;  3TKA A;  2K4I A;  5J0R A;  4JUZ A;  3HX0 A;  1UET A;  3WFR E;  4Q8E A;  1UCV A;  4OAH A;  2AU0 A;  2HOI A;  2W7P A;  1RXW A;  3QU5 A;  3M9O B;  3MGI A;  3B0Y A;  8ICT A;  4FHV A;  2AQ0 A;  1ZOL A;  2MAX A;  4AT8 A;  1COK A;  3C18 A;  3M6Z A;  7ICM A;  3F53 A;  4NLK A;  4O3O A;  5DG8 A;  4FZN A;  2OCE A;  1F5S A;  4I2E A;  1LKY A;  1L7P A;  4DFJ A;  4OO1 J;  5KFJ A;  4M04 A;  5KFN A;  3QUT A;  1TAU A;  5KFU A;  3RB0 A;  2BBJ A;  3WK6 A;  4QIW F;  2A1J A;  4Y2R A;  1WWV A;  5JU5 A;  3O0F A;  4QZE A;  3C28 A;  5J2C A;  3RB4 A;  2FLP A;  2Y0S C;  7ICE A;  4DL3 A;  1IV8 A;  2ZIU B;  1S76 D;  1K1S A;  1N63 A;  3QEB Z;  2ZHB A;  1ARO P;  2HCF A;  8ICK A;  1TK8 A;  4WQL A;  4EED A;  1VLB A;  1A76 A;  5L9X A;  1KDH A;  1WWU A;  1IG6 A;  3NUQ A;  4DCC A;  4CCH A;  4KMO B;  3WKA A;  2YN4 A;  1QSY A;  2XY7 A;  4ED3 A;  4NLB A;  2BDP A;  2PFP A;  2GO7 A;  5AIC A;  2NRT A;  2XVT A;  2BGW A;  2IOF K;  3Q8S B;  2OWO A;  3QNM A;  1JXE A;  3BZK A;  1MQ2 A;  2HW3 A;  5DB6 A;  1UHU A;  2XIC A;  3NYB A;  2DQN B;  4X0A A;  4FZL A;  3BS7 A;  3LYS A;  1VJ7 A;  3NWI A;  1RQL A;  4O3R A;  2B0C A;  4US8 A;  1GO3 F;  2E1E A;  2K4H A;  1XC9 A;  3CYM A;  1X42 A;  4G9B A;  4O6A A;  3JPN A;  4DLE A;  3HIL A;  4QIW C;  1MA7 A;  3E2E A;  2JEF A;  5DLF A;  1L7M A;  3MGV A;  3T79 A;  5AM2 A;  4DO9 A;  4DS5 A;  4GXK A;  1KFD A;  1LVH A;  2K4P A;  5HRD A;  2XID A;  3WK8 A;  3ETR A;  4B9S A;  2A1A A;  2HN2 A;  2HBJ A;  2DBY A;  3IRU A;  1Q78 A;  5KG3 A;  3PW2 A;  3WFS C;  4WBZ A;  1K1Q A;  4NLC A;  4FHP A;  4RNO A;  1YZ6 A;  2WB1 C;  4EEK A;  1SKR A;  3TAR A;  4XUS A;  3VCB A;  4I28 A;  4K9B A;  5KFQ A;  5J8Y C;  4U6P A;  5ALN A;  1ED1 A;  2KKV A;  1R8A A;  3Q8Q B;  1SXD A;  4B9U A;  2QB1 A;  5J2D A;  1DK2 A;  2W7O A;  1BPE A;  4DEZ A;  4YR3 A;  3HP6 A;  9ICF A;  4J9K A;  2KOB A;  1ZQI A;  4O3M A;  3GII A;  1X66 A;  2ZTD A;  4NXX A;  3SAF A;  2W9M A;  4ACO A;  5EE1 A;  5J29 A;  1QCK A;  2F44 A;  1KLN A;  8ICI A;  4TUP A;  2EDU A;  3KOO A;  2YB1 A;  4BXO A;  4RWQ A;  4Y2Q A;  4UAY A;  2IHN A;  2ZH2 A;  7ICL A;  1WYG A;  2AXT U;  4OJP A;  2JHD A;  4EV6 A;  5KFK A;  4KLI A;  3KKA A;  3N7S C;  5KFT A;  2P66 A;  1ZQY A;  1JI7 A;  1B4F A;  1VDV A;  4YMO A;  1L7N A;  3NKU A;  5HHH A;  3RTV A;  3UXP A;  5J0W A;  2WF9 A;  1D9F A;  5KL8 B;  5A0L A;  1ZQW A;  3WKD A;  2FCL A;  3H8S A;  4I27 A;  4Y2U A;  2HSZ A;  1S0M A;  5DBA A;  2H3V A;  4PPX A;  4NV0 A;  1XSP A;  8ICM A;  5ALP A;  2WF5 A;  4DQP A;  4EZ9 A;  5ALF A;  2H3Z A;  4NL9 A;  2ZH6 A;  2V4Q A;  9ICE A;  4F4Y A;  3SAH A;  2RFF A;  4R8U A;  4NWI A;  2KEY A;  3GDX A;  1ZET A;  5IIM A;  1H38 A;  2MUT B;  3PW5 A;  5KFS A;  1ZQN A;  2ALZ A;  4B9L A;  4JWM A;  3OUY A;  1OW5 A;  5J0Y A;  3UM9 A;  2O5A A;  5KFW A;  1A0P A;  4UB4 A;  2KSO B;  7ICU A;  4QWC A;  3RJI A;  3EWA A;  5ALI A;  2W11 A;  9ICX A;  1RQN A;  3LQC B;  1OUQ A;  1BNO A;  3VC8 A;  4DFP A;  2M2U A;  4UD4 A;  2ID1 A;  3KHR A;  4AT7 A;  3OVA A;  4XA5 A;  2KHV A;  1BPB A;  4NY8 A;  3LK9 A;  4RNM A;  1B43 A;  3MAB A;  1NZB A;  3AQE A;  8ICH A;  4ED7 A;  1UT8 A;  4UB1 A;  1WCL A;  4QJF B;  3OJU A;  3M6K A;  4ELT A;  4K96 A;  2KZ3 A;  9ICP A;  4KLM A;  5AK3 A;  2JEJ A;  8ICR A;  5DB7 A;  5DGB A;  4RT3 A;  5K4L A;  3CRX A;  5BOL A;  3HPO A;  4RQ6 A;  1UT5 A;  1C7Y A;  4WQK A;  8ICE A;  4ECX A;  4GLX A;  2CRX A;  4O3S A;  5KFZ A;  4DFD A;  1Q79 A;  1DGS A;  4GC7 A;  1JRP A;  3QU7 A;  4OJ6 A;  2EAP A;  2E8O A;  2BHN A;  3GV5 B;  1BPD A;  4LZD A;  1NJW A;  1R89 A;  4E80 A;  1ZQL A;  2JMG A;  2BR0 A;  4YP3 A;  1Z3E B;  2DVI A;  1FO4 A;  5TIS U;  3BS5 A;  2HHT A;  4HX0 A;  5HRB A;  3PW0 A;  9ICT A;  4XRH A;  1SL2 A;  4DQR A;  4MKP A;  2DR5 A;  3PZP A;  3OVS A;  1Z1B A;  4RU9 A;  3RBE A;  9ICS A;  2WFA A;  3H0M B;  4EZ6 A;  4I0U A;  2NO5 A;  4DSK A;  3DV9 A;  2ZIW A;  1T8E A;  1LV5 A;  1RXV A;  2WF8 A;  2IMW P;  7ICF A;  2PFQ A;  3NVV A;  8ICL A;  1ZQK A;  1Q46 A;  5ALX A;  4PZN A;  3AQF A;  9ICO A;  2Y1J A;  3NVY A;  3PSI A;  1ZD4 A;  4UB3 A;  4M47 A;  5AI6 A;  3JYY A;  2B21 A;  2DR7 A;  2BE3 A;  1MIW A;  4QZG A;  3FYH A;  3GV7 B;  4P0P B;  1SV0 C;  3M8S A;  4DF8 A;  2EAM A;  1ZJN A;  5C0Y A;  4CF3 A;  3F2C A;  4KM5 A;  3AQN A;  3HRD D;  1ZQQ A;  1URJ A;  4KN4 A;  2W54 A;  4OJL A;  3F5A A;  1ZQM A;  5CFS A;  5AI5 A;  2OHF A;  3AU6 A;  3WK7 A;  2DR8 A;  1QSL A;  2ZIX B;  2R8H A;  2ZUB A;  4KLE A;  4AT9 B;  4KX3 A;  2HOQ A;  4C7Y A;  3EUB 2;  3MC1 A;  1ZQT A;  4Y2S A;  4QZB A;  2HHW A;  4DFM A;  4C8L A;  3EF2 A;  1VJ5 A;  2Z7J A;  2KJ5 A;  4Z6D A;  4DOC A;  1BNP A;  9ICN A;  3V72 A;  3CP8 A;  4IQU A;  4J9L A;  3GIL A;  3RJF A;  4PGY A;  2F1H A;  3ZDA A;  3AQM A;  5JRT A;  3Q8M A;  2FMS A;  2F76 X;  5DDY A;  1JX4 A;  5ALO A;  4IQT A;  1TFW A;  2NV3 A;  3Q8L A;  7ICV A;  3RH6 A;  8ICQ A;  2HHX A;  4MF2 A;  4EBK A;  2W9A A;  4FBU A;  4I2B A;  4PHA A;  2ATL A;  5III A;  7ICG A;  4UW9 A;  2JR5 A;  1TFY A;  3OGU A;  2I5H A;  3B0X A;  5ALQ A;  2IHM A;  3RAX A;  4E8F A;  7ICR A;  3H8M A;  5KG6 A;  3ISB A;  4K4H A;  5TZV A;  2W8L A;  3NGD A;  4J9O A;  1KQQ A;  3NS1 A;  3LWM A;  1KFS A;  4WC0 A;  1HUO A;  1NK6 A;  1N5X A;  4KLJ A;  4HYK A;  1KNY A;  5EE9 A;  4K4G A;  3LWL A;  1JQR A;  4DWI A;  5ALV A;  1MC8 A;  3KKA C;  1CRX A;  5ALD A;  4F92 B;  4ED8 A;  1V38 A;  3AQK A;  4F5N A;  3PX0 A;  4PZO A;  3UMB A;  7ICH A;  1U45 A;  1TE2 A;  4EEN A;  2ESE A;  3G6X A;  1S97 A;  5HML A;  8ICC A;  2BQU A;  3RJG A;  2F3N A;  2BCR A;  5DBC A;  4IG8 A;  5JTI A;  2KZZ A;  4NL9 C;  1TAQ A;  2W04 A;  4QW9 A;  5AKI A;  1K5O A;  3N97 B;  3QE9 Y;  2G5I B;  5AI4 A;  4DOB A;  2V9W A;  5J0T A;  4QNL A;  3TAN A;  3WK5 A;  4AT8 B;  2BCS A;  4DS4 A;  1X9S A;  5J2G A;  3IDW A;  2AGP A;  5D62 A;  3TAQ A;  4QZA A;  4DQS A;  5J2B A;  4IRD A;  4OCZ A;  2FMP A;  1M6Y A;  4O5C A;  3ETL A;  2ZH4 A;  2GAF D;  2GA9 D;  2GOL A;  4C4S A;  2KJ8 A;  4FHX A;  4R65 A;  4PL2 A;  4IL6 U;  1ZQZ A;  2Q66 A;  1XSL A;  1COO A;  2KMD A;  4KLO A;  2JZB A;  3OSN A;  5KFR A;  3RR8 A;  2RLT A;  3UXO A;  4J9M A;  3F2B A;  3RJK A;  2K8C B;  9ICI A;  3OV7 A;  2CPR A;  1ZD3 A;  4PHE A;  3EPI A;  2KD1 A;  3FAH A;  3PMN A;  1SWV A;  2WF6 A;  5HMM A;  4CNQ A;  9ICQ A;  3ERC C;  2ZH8 A;  5AKG A;  5HRG A;  3C2K A;  5KG7 A;  1R8B A;  4ECW A;  1T7P A;  2F8L A;  1NK5 A;  2WHE A;  4YN4 A;  2XCP A;  3OWG A;  5AI9 A;  1HJP A;  1N61 A;  1R8C A;  5F9N A;  3OHA A;  1Z19 A;  2Y9T A;  4RQ7 A;  1ZRM A;  4J9S A;  4UB5 A;  3C2L A;  2AGQ A;  1KW4 A;  2I9G A;  4Y2T A;  1UEV A;  2HVI A;  1Z00 B;  5J2H A;  4JK1 A;  2LKY A;  8ICJ A;  3E58 A;  5G5H A;  3RRH A;  4UB2 A;  4CF4 A;  2JEG A;  4KLH A;  8ICY A;  5KG2 A;  2HDO A;  2K60 A;  9ICJ A;  2M2V A;  4DFK A;  1UQV A;  2ZIV A;  4P0Q A;  5J0X A;  8ICW A;  1B22 A;  3ALR A;  3WK4 A;  2C2R A;  1BGX T;  4Z6F A;  4YD2 A;  2XGP A;  4DL7 A;  2DRB A;  2W9C A;  5AI0 A;  1ZQP A;  3T5K A;  4ELU A;  3BZC A;  2R18 A;  3C1Z A;  3V6J A;  3PO5 A;  2KIC A;  4YCX A;  3G6V A;  2F2A B;  4O5K A;  2Q0Z X;  5EE0 A;  3C1Y A;  1XU4 A;  3K4G A;  3PHZ A;  4FH3 A;  4DL2 A;  5JUM A;  4TQS A;  1KL9 A;  3UQ2 A;  2AH5 A;  5CWR A;  1V9P A;  2J6T A;  4WC5 A;  2KV2 A;  2WTF A;  4LVS A;  5EWF A;  3PNC A;  4WC4 A;  4Z6C A;  3ORY A;  1QQ6 A;  4NXT A;  2BKE A;  4F50 A;  3Q8K A;  4I2F A;  3WFP A;  1V97 A;  5GTH U;  4ECS A;  4ECQ A;  3IG5 A;  2BCQ A;  7ICQ A;  1CEZ A;  1FA0 A;  5DED A;  3EPG A;  9ICV A;  3NVO A;  3KHG A;  4QZC A;  3QZ7 A;  2QB0 A;  1S10 A;  1FFU A;  4GC6 A;  3RH5 A;  2E1F A;  1U4B A;  5KFX A;  3TFR A;  5J0P A;  4DSF A;  4BJQ A;  1L3U A;  5IIJ A;  4J9N A;  2FPM A;  2ZXI A;  2LPE A;  3T5L A;  5AKH A;  4BWM A;  5DB9 A;  4YXM A;  1MN8 A;  1FFV A;  1ZD5 A;  1NKE A;  1BPY A;  1JIH A;  5AKL A;  4PH5 A;  2JGA A;  2W9B A;  1U48 A;  1NJY A;  9ICW A;  4BX9 C;  1XNS A;  5KFD A;  2ZIU A;  5B66 U;  5KFA A;  3V7L A;  3JPP A;  2DF4 B;  2KE7 A;  2ASL A;  2JXJ A;  5ALK A;  3SYZ A;  1NNL A;  1V85 A;  4AP9 A;  5ALE A;  2R8I A;  2DKZ A;  1L8O A;  5L1I A;  4I2H A;  5ALR A;  3QZ8 A;  5CA7 A;  3MDA A;  4RPY A;  2AQ4 A;  4O68 A;  2P6U A;  3F2D A;  2XI9 A;  2GLE A;  4N7R A;  2EAO A;  5E79 U;  3PY8 A;  1N2X A;  3CK6 A;  2M9N A;  5KFV A;  4LJX A;  1X9X A;  3H4D A;  2FI1 A;  2DL0 A;  2OM6 A;  2KHQ A;  2EH9 A;  3I1Y A;  2C2E A;  1RYR A;  2LYA A;  4KLG A;  1Q3U A;  4C8N A;  2GWS A;  2QKQ A;  1MIV A;  3GQC A;  1Y88 A;  4Y2X A;  3H40 A;  5AM1 A;  2YB4 A;  1S5L U;  4EBD A;  3RR7 A;  2H5X A;  5IIK A;  5HRI A;  4O5E A;  1A6S A;  2H3F A;  5KFL A;  2VKQ A;  4YMN A;  5C5J A;  3SZ2 A;  1QH9 A;  5CFT A;  4J03 A;  1QSS A;  4KLF A;  1IM4 A;  5J0O A;  8ICZ A;  5DGA A;  2O1P A;  4F2S A;  1NK0 A;  4OAF A;  2WF7 A;  1KFT A;  2N1R A;  2G06 A;  4I2J A;  4WC1 A;  5CJ7 A;  4OJO A;  1DXS A;  1C20 A;  3JPO A;  4RWN A;  2B56 A;  4QZF A;  3MFI A;  5HRK A;  3K7D A;  4GXJ A;  2F1J A;  4ZH4 A;  3C66 A;  3LVW A;  5DQG A;  2R8K A;  4KMU A;  4UAR A;  4OAG A;  1SXE A;  2KFN A;  2W3R A;  5KFP A;  4P4P A;  1SKS A;  8ICS A;  3ZDC A;  2GH1 A;  4F4X A;  4M9J A;  3PR4 A;  2W8K A;  2HHS A;  3H0R B;  3RJJ A;  3KHL A;  3KHH A;  2AHO B;  4BGD A;  5DEC A;  2ZXH A;  4BUG A;  5AIB A;  2LHT A;  3HJ1 A;  3UPS A;  4DSE A;  4IQV A;  2L5Y A;  4M9H A;  4IQW A;  4K4I A;  3QU4 A;  8ICN A;  4DSJ A;  4NXZ A;  4GXI A;  4QZ9 A;  2VJ4 A;  3TQ1 A;  2IBK A;  1ZYQ A;  4M5D A;  1BPX A;  2ZIW B;  4Y2Y A;  1DRG A;  3SMV A;  2YML A;  2E3T A;  1SZP A;  1CI4 A;  2DR9 A;  2DPI A;  3B9J A;  8ICU A;  7ICN A;  2I1Q A;  3KZI U;  4B9V A;  2ISP A;  5ALU A;  3WK9 A;  1PX5 A;  3QUB A;  4B9N A;  5CRX A;  3GIJ A;  4B9T A;  4KLT A;  3NVW A;  4LZG A;  1ZQF A;  3PML A;  2DUY A;  2G08 A;  4KLD A;  1DK3 A;  4UQG A;  4I2G A;  4ATB A;  3BQ7 A;  2E8N A;  4IRC A;  2D3D A;  1PK1 B;  1JRO A;  2RHF A;  3SI8 A;  4KLS A;  2HI0 A;  4EYI B;  2KSO A;  4E7X A;  3UMG A;  5DLG A;  2KJ9 A;  9ICK A;  5KTQ A;  5ALG A;  2BPC A;  4FBT A;  3OPX A;  3HJE A;  4YVZ A;  2ZUC A;  4WH5 A;  3THV A;  5DG9 A;  3H3A A;  1S0O A;  4M6W B;  2JH7 A;  3MGH A;  1DOQ A;  1BPZ A;  2DKX A;  5CP2 A;  3N4M B;  1RYS A;  4RUA A;  2UVV A;  2LM4 A;  2QAR B;  4NXW A;  4TUS A;  4UAU A;  9ICM A;  7ICP A;  1SB3 C;  3HKZ F;  4RWP A;  3PST A;  2NRV A;  2XGQ A;  4C4R A;  2BPF A;  4RPZ A;  3PW7 A;  3BDP A;  3IN5 A;  4X4N A;  1PVP A;  5CEH A;  2KIV A;  4YFK A;  1ZQR A;  4PGQ A;  4Z6E A;  3RJE A;  4DQQ A;  4USA A;  4NKU A;  3H8W A;  1PVQ A;  3SV3 A;  5IIO A;  2FE9 A;  1JMS A;  4RQ8 A;  2D6F C;  4NXU A;  2ZHA A;  2NYV A;  4NLN A;  5KFF A;  4O0I A;  4US9 A;  3OSP A;  4O9M A;  4I2D A;  9ICB A;  4AYB F;  4JV2 A;  1UEU A;  2YX8 A;  1TFR A;  3K75 D;  3RB6 A;  3UQ0 A;  5IIN A;  2NO4 A;  4PJ0 U;  5KT5 A;  4TQR A;  4EP7 A;  3QU9 A;  1SWW A;  3A0H U;  4IS7 A;  5DG7 A;  2YMQ A;  5ALT A;  3H7I A;  4LT6 A;  3OTQ A;  5KFO A;  3JPT A;  4X4P A;  1RG6 A;  5BPC A;  4MFF A;  4EEB A;  2RQ5 A;  1UA1 A;  3TAD A;  2ZH9 A;  2MA1 A;  3ZI4 A;  5AK5 A;  1Z1V A;  2MRL A;  3N7R C;  3CW2 C;  3A0B U;  3HKZ C;  3AMZ A;  4KLU A;  1NKC A;  2HHP A;  2LMR A;  1OU5 A;  3RH4 A;  1RDF A;  2C28 A;  5J8Y A;  1ZQO A;  3M1Y A;  2G0A A;  3RF9 A;  2IA6 A;  3ZDD A;  1V4A A;  1KBU A;  7ICT A;  3ISC A;  3H39 A;  3TAC B;  3AN1 A;  3Q8R B;  3QX7 A;  2H3Q A;  5HR9 A;  4KLL A;  2M2W A;  1RPL A;  3F5E A;  4RQN A;  1D8L A;  8ICP A;  3QUC A;  2EAN A;  5D46 A;  4DSI A;  4CDG A;  4TUQ A;  4P0P A;  4J9R A;  4R66 A;  4FZM A;  2M0N A;  2IUB A;  2LYB A;  5F9L A;  4LEZ A;  4GFJ A;  8ICO A;  3FDS A;  5AI8 A;  5KFG A;  4ECV A;  5KT7 A;  3H0L B;  2G5H B;  4AYB C;  1SKW A;  1DGJ A;  4MHV A;  4X4V A;  2ZIX A;  2BZF A;  3ER9 B;  2W55 A;  1X2I A;  4BWJ A;  3LVV A;  2RDJ A;  1NKB A;  2YTU A;  1RM6 C;  3QUQ A;  1N48 A;  2M2T A;  2J6S A;  3IHQ B;  3JCF A;  2ZH1 A;  4KN7 A;  5KFY A;  3D2S A;  2MU2 A;  1NK8 A;  3WU2 U;  4K8V A;  4IRK A;  1U9L A;  5AKX A;  3C21 A;  4UAS A;  3L3F X;  3SR6 A;  3K1Z A;  1UPH A;  1XSN A;  1KRP A;  5KG1 A;  5ALZ A;  5KAI U;  3PX6 A;  4EBE A;  1RYU A;  4EEY A;  2AGO A;  3SQI A;  4E0D A;  1ZQC A;  1L8L A;  4EYH B;  4WC7 A;  5AM5 A;  2KFZ A;  2KN7 A;  1ZQG A;  5BOM A;  4X4U A;  3H4B A;  1X6I A;  3HW8 A;  5ALW A;  4LEW A;  1QLN A;  5AHX A;  1JN3 A;  2NRZ A;  4S3N A;  7ICS A;  5J2F A;  1KSP A;  5HRF A;  1TK5 A;  1LKY B;  3ZD8 A;  2RP5 A;  3NRZ A;  2ZTC A;  3EZ5 A;  3MDC A;  3D2Q A;  2A1J B;  1NO5 A;  3GIK A;  2BCV A;  4F91 B;  1NJX A;  1FEZ A;  1Z4O A;  2LI6 A;  2YQE A;  1ZJM A;  2Y1I A;  1OXJ A;  2E8P A;  4C0Z A;  3NRW A;  2KVS A;  1X9W A;  4KTQ A;  2K89 A;  2OEH A;  5HR6 A;  3V7J A;  5J0S A;  2ZG6 A;  5L1K A;  2DRA A;  4NKT A;  1XO1 A;  3V6H A;  5AKJ A;  4F8R A;  2VA2 A;  5KAF U;  1L3S A;  3M9N B;  4DL4 A;  1EXN A;  4UAW A;  4F5Q A;  4RQ5 A;  3SV4 A;  2K8A A;  4M9G A;  3RB3 A;  3ED5 A;  4DOA A;  2UVU A;  2HMX A;  4DL6 A;  1XO0 A;  3EYZ A;  4JV0 A;  3TAP A;  4UB6 U;  2R8G A;  1U49 A;  2HHU A;  4OD0 A;  3NAS A;  4RQM A;  4OJ5 A;  2LM1 A;  2EWR A;  1N62 A;  4EBJ A;  2PFO A;  4QZ8 A;  1XS9 D;  4KX5 A;  5G5G A;  3AEV A;  4Y2V A;  4CRX A;  5CB1 A;  4R63 A;  2QB0 B;  1IIP A;  4TUR A;  5EOZ A;  4C4T A;  3SEI A;  5HR7 A;  1PUZ A;  5F3X B;  1ZQD A;  4JV1 A;  2OYY A;  1QQ5 A;  1SL0 A;  3HIY A;  3HJ4 A;  5HC9 A;  4DL5 A;  3M7D A;  5HHI A;  4M0A A;  2KNJ A;  4M2Y A;  1N60 A;  3MCR A;  2EZX A;  5L1M A;  4F4K A;  3NTU A;  4F4W A;  4NM2 A;  4C8K A;  4ECY A;  2F8K A;  5HNK A;  2W9B B;  4MF8 A;  2KIW A;  3MR2 A;  1O08 A;  1KTQ A;  5ALY A;  4J9P A;  1U47 A;  4QWB A;  2H3I A;  1MSW D;  4K98 A;  1NOM A;  4Y2P A;  5T14 A;  2G09 A;  3R9K A;  1TKD A;  2OH2 A;  4O67 A;  4WC2 A;  2WB1 F;  4MFA A;  4DSL A;  1PK3 A;  2VIX A;  2A3V A;  4RWO A;  5DDM A;  1PVR A;  4CF5 A;  2C2D A;  3U26 A;  4F5O A;  4RQ2 A;  4ICA A;  2HBM A;  4JMU A;  3ICX A;  2BDU A;  3D6J A;  3IG8 A;  4QWE A;  1L3T A;  4EX6 A;  2AJQ A;  1Z00 A;  2NRK A;  1WOT A;  4JLZ A;  1RZT A;  3KZX A;  4YR0 A;  2FPL A;  2ASJ A;  1SV0 A;  1J2N A;  1YT3 A;  2W43 A;  5ALH A;  4BXO B;  5DQH A;  5J0Q A;  1S9F A;  2I6X A;  2ZH5 A;  5DBB A;  4WJ3 B;  1YLQ A;  3L5K A;  1SGG A;  3M8R A;  1HIW A;  9ICR A;  1X6J A;  1MQ3 A;  5JTG A;  1SL1 A;  2BQR A;  5KFC A;  2JV3 A;  1J2M A;  2VJ5 A;  4Q43 A;  1T94 A;  2DWQ A;  3WFQ E;  5KFE A;  3T5H A;  1SIJ A;  4RT2 A;  4YD1 A;  7ICI A;  2C22 A;  3BQ0 A;  4UAZ A;  3QXG A;  1NK7 A;  2EZZ A;  5AKZ A;  3BQ2 A;  1FIQ A;  3RRG A;  3TAD C;  4FS2 A;  1D8B A;  2B51 A;  1T4G A;  1N5W A;  8ICV A;  4F71 A;  5HP4 A;  5ALJ A;  5D63 A;  1BVS A;  5DB8 A;  2XO7 A;  4WC6 A;  4X4R A;  5J0U A;  1TK0 A;  1S8O A;  3ZDE A;  4FH5 A;  4RZR A;  5L1J A;  4NXV A;  3MR5 A;  4R8U B;  1YZ7 A;  3M9M B;  3BQ1 A;  1MIY A;  4DF4 A;  2ZH7 A;  2NRW A;  2ES6 A;  3C5F A;  3I76 A;  3OUY B;  3RBD A;  4MFC A;  2PI5 A;  5D49 A;  3L9D A;  4IR1 A;  5KG0 A;  4I2I A;  5J2J A;  2HVH A;  3KBB A;  4WC3 A;  3QU2 A;  3BQT A;  1ZRN A;  4ELV A;  3IM1 A;  5AK6 A;  4AT7 B;  4ED6 A;  4P4O A;  3TI0 A;  1Q8K A;  3PV8 A;  4IC9 A;  2KZM A;  2JEI A;  2ZH3 A;  1X40 A;  4Q45 A;  1O03 A;  2KKP A;  3AL0 B;  7ICK A;  4YQW A;  2ASD A;  5KT2 A;  4PHD A;  5DKW A;  2PXI A;  4I29 A;  5IIL A;  4WCW A;  3MR6 A;  3ZDB A;  3OVB A;  2K8B B;  1ZXI A;  4XQ7 A;  2P6R A;  2ZJ5 A;  2IHO A;  9ICL A;  2ODG A;  2F1I A;  5F2V O;  3H38 A;  4LEY A;  2CXY A;  2V4R A;  5FP0 A;  4JB3 A;  4EEL A;  3PW4 A;  2PBE A;  3OJS A;  1VFG A;  4B9M A;  4YMM A;  5L1L A;  4F72 A;  4JLX A;  2PMZ F;  1HUZ A;  4K97 A;  4C8O A;  3ER8 C;  4PGX A;  4ECT A;  1A77 A;  1CUK A;  3DDH A;  4RQ3 A;  4IR9 A;  1SV4 A;  3J81 j;  4KIT B;  3BS5 B;  4UB8 U;  4NLZ A;  4ATB B;  2VA8 A;  8ICB A;  9ICU A;  4QZD A;  2XCA A;  3G6Y A;  2E8M A;  8ICA A;  3TFS A;  1KN5 A;  5H2F U;  2G07 A;  4Q8F A;  4FE3 A;  4B6J A;  4X4S A;  1NZP A;  1SZH A;  2ISO A;  2UVR A;  3UMC A;  4ECZ A;  2MSN A;  4UBB A;  5D61 A;  3NVZ A;  4KB6 A;  9ICH A;  4F93 B;  5HRH A;  3H37 A;  4NLG A;  2EZY A;  4RUC A;  3ISD A;  1T3Q A;  2YMP A;  5EE3 A;  4Y2J A;  4F2R A;  4FS1 A;  3PSP A;  1WG8 A;  3D2N A;  3AU2 A;  3CNH A;  3FC4 A;  1LB2 B;  5CHE A;  5EWE A;  4F3O A;  5D4B A;  1N56 A;  4WOY A;  2ZJA A;  4EGW A;  2MUT A;  1S77 D;  4GIB A;  2FLL A;  2PMZ C;  1KEJ A;  3JPQ A;  5AIA A;  3Q8P B;  3V6K A;  3WFO A;  3PSF A;  4HAI A;  1GPJ A;  4FO1 A;  3I28 A;  7ICO A;  5AM4 A;  4RQ0 A; 
#chains in the Genus database with same CATH homology
 4KLH A;  5KT3 A;  2W9M A;  5J29 A;  8ICY A;  5KG2 A;  1L5U A;  4MEY A;  1KLN A;  8ICI A;  5F9L A;  3V7K A;  4ED2 A;  9ICJ A;  5KG4 A;  3ZD9 A;  4TUP A;  3FDS A;  5KFG A;  4ECV A;  4DFK A;  8ICO A;  2M2V A;  5KT7 A;  5J0X A;  8ICW A;  4BXO A;  4RWQ A;  1B22 A;  4UAY A;  1TV9 A;  2IHN A;  4R64 A;  2ZH2 A;  4RNN A;  2C2R A;  1SKW A;  7ICL A;  1BGX T;  1X9M A;  4Z6F A;  4YD2 A;  2XGP A;  2KTQ A;  4DL7 A;  4X4V A;  2DRB A;  2XY5 A;  2W9C A;  1ZQP A;  5KFK A;  4KLI A;  3T5K A;  1X2I A;  4ELU A;  4BWJ A;  4UBC A;  2RDJ A;  1NKB A;  3C1Z A;  3V6J A;  5KFT A;  1N48 A;  2M2T A;  1ZQH A;  2J6S A;  3IHQ B;  3PO5 A;  2P66 A;  1ZQY A;  1S0V A;  2HHQ A;  4YMO A;  1JXL A;  4YCX A;  5KT6 A;  3G6V A;  5HHH A;  3RTV A;  1D8Y A;  4KLQ A;  4KN7 A;  2ZH1 A;  5KFY A;  2FPK A;  3UXP A;  1NK8 A;  4O5K A;  2Q0Z X;  5J0W A;  4QWD A;  1D9F A;  3C1Y A;  3GIM A;  1XU4 A;  3K4G A;  3UPQ A;  3RJH A;  4X4O A;  4IRK A;  1U9L A;  3PR5 B;  4FH3 A;  5KFM A;  1ZQW A;  3C21 A;  3H8S A;  4DL2 A;  4I27 A;  5JUM A;  2UVW A;  4TQS A;  3UQ2 A;  4ED0 A;  1S0M A;  1XSN A;  1KRP A;  1QTM A;  5DBA A;  9ICG A;  5KG1 A;  4PPX A;  5CWR A;  1XSP A;  8ICM A;  1V9P A;  2J6T A;  4DQP A;  2XY6 A;  4WC5 A;  4EZ9 A;  2WTF A;  3PX6 A;  3RAQ A;  4EBE A;  4EEY A;  2AGO A;  4E0D A;  4LVS A;  5EWF A;  3PNC A;  3C2M A;  2V4Q A;  4EYH B;  1ZQC A;  4Z6C A;  5HRE A;  4WC4 A;  9ICE A;  4WC7 A;  4X4Q A;  3ORY A;  2KFZ A;  4F4Y A;  2RFF A;  2KN7 A;  4DLG A;  4R8U A;  2BQ3 A;  3AUO A;  5KFH A;  5BOM A;  2BKE A;  3GDX A;  1ZET A;  1ZQG A;  2ZJ8 A;  3H4B A;  4F50 A;  3Q8K A;  5J2E A;  5IIM A;  4I2F A;  4XQ8 A;  3WFP A;  2ZUD A;  3HW8 A;  1H38 A;  2MUT B;  4ECS A;  4ECQ A;  2BCQ A;  3PW5 A;  7ICQ A;  5KFS A;  1ZQN A;  4UD5 A;  1CEZ A;  1FA0 A;  2ALZ A;  5DED A;  1ZQU A;  4B9L A;  4JWM A;  1QLN A;  3OUY A;  3EPG A;  3T3F A;  1JN3 A;  9ICV A;  2NRZ A;  5J0Y A;  4S3N A;  2O5A A;  8ICF A;  4QW8 A;  5KFW A;  4RPX A;  3KHG A;  3HWT A;  3MBY A;  5DQI A;  5J2F A;  4FO6 A;  4QZC A;  1KSP A;  1TK5 A;  3H8J A;  4UB4 A;  4M9N A;  5HRF A;  7ICU A;  3QZ7 A;  1S10 A;  4PHP A;  3ZD8 A;  4QWC A;  4GC6 A;  3EWA A;  3RJI A;  3RH5 A;  1U4B A;  1S0N A;  9ICX A;  5KFX A;  3LQC B;  3TFR A;  5J0P A;  3MFH A;  4DSF A;  1L3U A;  1BNO A;  2ZTC A;  5IIJ A;  2FPM A;  3MDC A;  3EZ5 A;  4J9N A;  3T5L A;  4DFP A;  9ICC A;  2M2U A;  4UD4 A;  2ID1 A;  3KHR A;  3KTQ A;  4AT7 A;  2A1J B;  1NO5 A;  3OVA A;  4WBY A;  4XA5 A;  3GIK A;  4NY8 A;  1BPB A;  1TVA A;  3LK9 A;  4RNM A;  2BCU A;  1B43 A;  5J2A A;  4F91 B;  4BWM A;  5DB9 A;  2VAN A;  3MAB A;  4F5P A;  1NJX A;  5KFB A;  4YXM A;  1ZJM A;  5CR0 A;  4ED1 A;  4ED7 A;  2Y1I A;  8ICH A;  1UT8 A;  4UB1 A;  2XC9 A;  4J9R A;  1WCL A;  4C8M A;  1UA0 A;  1NKE A;  5J2I A;  3C5G A;  3OJU A;  1BPY A;  1JIH A;  4ELT A;  2BPG A;  4PH5 A;  1ZQE A;  2KZ3 A;  3HT3 A;  1X9W A;  9ICP A;  4KLM A;  2W9B A;  1U48 A;  1NJY A;  4KTQ A;  3PVX A;  4M6W A;  9ICW A;  3GV8 B;  5KFD A;  2JEJ A;  8ICR A;  5KFA A;  3V7L A;  5J0S A;  3JPP A;  3V7J A;  4YG2 A;  2ASL A;  5DB7 A;  4O3N A;  5DGB A;  1L3V A;  4RT3 A;  2ZH6 A;  5L1K A;  4O3P A;  5BOL A;  3SYZ A;  3HPO A;  4BDP A;  4RQ6 A;  2J6U A;  2DRA A;  8ICX A;  4NKT A;  4MEX A;  1XO1 A;  3V6H A;  2R8I A;  4F4Z A;  1UT5 A;  3QEA Z;  5L1I A;  4F8R A;  1XWL A;  2VA2 A;  1C7Y A;  3UXN A;  1L3S A;  4I2H A;  3M9N B;  3QZ8 A;  4DL4 A;  1EXN A;  4UAW A;  4F5Q A;  5CA7 A;  3T5J A;  8ICE A;  3MDA A;  4RQ5 A;  4ECX A;  4RPY A;  3JZ0 A;  4GLX A;  2AQ4 A;  3SV4 A;  4M9G A;  4O3S A;  5KFZ A;  3RB3 A;  2P6U A;  1ZQB A;  4DOA A;  2UVU A;  2R8J A;  5J2K A;  1Q79 A;  1DGS A;  4Q44 A;  4GC7 A;  4DL6 A;  2HHV A;  5CHG A;  5KT4 A;  3EYZ A;  4JV0 A;  3TAP A;  2BHN A;  3GV5 B;  4I2A A;  4QZH A;  1U49 A;  1T3N A;  1BPD A;  2R8G A;  3PY8 A;  4ECR A;  2HHU A;  4LZD A;  1NJW A;  2M9N A;  1ZQV A;  5KFV A;  1R89 A;  4E80 A;  4X5V A;  2RDI A;  1ZQL A;  3H4D A;  4M9L A;  4P2H A;  2DFL A;  3C23 A;  2BR0 A;  4YP3 A;  1Z3E B;  2DVI A;  2C2E A;  1RYR A;  4QWA A;  4KLG A;  5KFI A;  4EBJ A;  4C8N A;  2PFO A;  9ICA A;  4QZ8 A;  2GWS A;  4RQ1 A;  1MIV A;  1XS9 D;  3GQC A;  1Y88 A;  2HHT A;  4YR2 A;  3H40 A;  4EBD A;  3RR7 A;  5CB1 A;  4R63 A;  2H5X A;  5IIK A;  7ICJ A;  5HRI A;  1ZQJ A;  4O5E A;  4TUR A;  2JZB B;  4AT9 A;  5HRB A;  5KFL A;  5EOZ A;  4I2C A;  4YMN A;  3PW0 A;  2KP7 A;  1ZQD A;  4F5R A;  5C5J A;  4JV1 A;  9ICT A;  3SZ2 A;  4XRH A;  1SL2 A;  4DQR A;  1ZQA A;  1SL0 A;  3HIY A;  3HJ4 A;  3JPS A;  5HC9 A;  2DR5 A;  4DL5 A;  3LDA A;  1QSS A;  4KLF A;  1IM4 A;  1NJZ A;  5HHI A;  5J0O A;  4M0A A;  3OVS A;  4M2Y A;  8ICZ A;  4RU9 A;  3RBE A;  5DGA A;  4F4K A;  3NTU A;  9ICS A;  4F2S A;  2O1P A;  4F4W A;  1NK0 A;  4EZ6 A;  4NM2 A;  4DSK A;  1KFT A;  4C8K A;  1T8E A;  1LV5 A;  4ECY A;  1RXV A;  4I2J A;  4WC1 A;  5HNK A;  5CJ7 A;  3MR3 A;  4MF8 A;  2W9B B;  3MR2 A;  2IMW P;  7ICF A;  2PFQ A;  1KTQ A;  4J9P A;  1U47 A;  4QWB A;  1NK9 A;  3JPO A;  2ZTE A;  4DQI A;  1MSW D;  1NOM A;  4RWN A;  8ICL A;  4QZF A;  1ZQK A;  4FHY A;  3EW9 A;  2NRX A;  4J9Q A;  3MFI A;  5HRK A;  2DPJ A;  4ECU A;  1TKD A;  9ICO A;  2Y1J A;  2LYH A;  1WCN A;  4G3I A;  4WC2 A;  4GXJ A;  2F1J A;  4ZH4 A;  4MFA A;  3C66 A;  5DQG A;  2R8K A;  4KMU A;  4DSL A;  4NM1 A;  4UB3 A;  4P4M A;  4M47 A;  4RWO A;  5DDM A;  2C2D A;  2KFN A;  3JYY A;  5KFP A;  2B21 A;  5HRL A;  4F5O A;  2DR7 A;  2BE3 A;  4P4P A;  4RQ2 A;  1IXR A;  1SKS A;  8ICS A;  1F5A A;  3ZDC A;  1MIW A;  2FMQ A;  1D9D A;  4FHW A;  4QZG A;  4F4X A;  3FYH A;  4QWE A;  1L3T A;  3GV7 B;  4M9J A;  3PR4 A;  2W8K A;  3BJY A;  3PX4 A;  3M8S A;  2HHS A;  4DF8 A;  3RJJ A;  1Z00 A;  1ZQX A;  3KHL A;  1ZJN A;  3PO4 A;  2AJQ A;  1WOT A;  2NRK A;  3KHH A;  4YR0 A;  5EWG A;  1RZT A;  4BGD A;  2FPL A;  3AQN A;  4EBC A;  2ASJ A;  5DEC A;  3JPR A;  1ZQQ A;  4BXO B;  4X4U A;  5DQH A;  1JAJ A;  4KN4 A;  5J0Q A;  1S9F A;  3OHB A;  1ZQM A;  2ZH5 A;  5DBB A;  1NK4 A;  1YLQ A;  3AU6 A;  2VA3 A;  2PI4 A;  3GFK B;  3M8R A;  1QSL A;  2DR8 A;  2W9C B;  2ZUB A;  2R8H A;  4O3Q A;  4KLE A;  4AT9 B;  9ICR A;  4QZI A;  3HJ1 A;  1MQ3 A;  2FLN A;  3UPS A;  4JWN A;  4DSE A;  1SL1 A;  2PFN A;  4IQV A;  2BQR A;  1ZQT A;  5KFC A;  4M9H A;  4QZB A;  4IQW A;  4K4I A;  4Q43 A;  2HHW A;  4DSJ A;  8ICN A;  4DFM A;  4C8L A;  4NXZ A;  4GXI A;  3WFQ E;  5KFE A;  4QZ9 A;  3T5H A;  3TQ1 A;  2IBK A;  1ZYQ A;  4M5D A;  5KG5 A;  4RT2 A;  4YD1 A;  1BPX A;  1ZQS A;  7ICI A;  4YXJ A;  2C22 A;  4Z6D A;  4RQ4 A;  4UAZ A;  3BQ0 A;  4DOC A;  1NK7 A;  1BNP A;  9ICN A;  3V72 A;  3BQ2 A;  4IQU A;  1PZN A;  4J9L A;  3GIL A;  3RRG A;  3RJF A;  4FS2 A;  1SZP A;  3AQL A;  4PGY A;  2F1H A;  8ICG A;  4R66 A;  3ZDA A;  2DR9 A;  3AQM A;  1T4G A;  5J0R A;  3Q8M A;  2FMS A;  4JUZ A;  5DDY A;  5HP4 A;  2DPI A;  8ICV A;  1JX4 A;  1BVS A;  4IQT A;  3HX0 A;  8ICU A;  5DB8 A;  2XO7 A;  1TFW A;  4WC6 A;  4X4R A;  5J0U A;  3Q8L A;  2BCV A;  1TK0 A;  7ICN A;  7ICV A;  1UET A;  2I1Q A;  3ZDE A;  3RH6 A;  4Q8E A;  8ICQ A;  4B9V A;  4RZR A;  5L1J A;  4FH5 A;  2HHX A;  3MR5 A;  4R8U B;  2ISP A;  3M9M B;  2AU0 A;  1RXW A;  1PX5 A;  3M9O B;  3MGI A;  3B0Y A;  3BQ1 A;  4MF2 A;  4B9N A;  8ICT A;  1MIY A;  4FHV A;  2AQ0 A;  4DF4 A;  4EBK A;  2ZH7 A;  3GIJ A;  4B9T A;  2NRW A;  4KLT A;  2W9A A;  4FBU A;  3C5F A;  4LZG A;  2MAX A;  4I2B A;  1ZQF A;  4AT8 A;  3PML A;  3RBD A;  3OUY B;  3C18 A;  7ICM A;  4MFC A;  4KLD A;  4PHA A;  2PI5 A;  5D49 A;  2ATL A;  3L9D A;  4IR1 A;  5KG0 A;  1DK3 A;  4I2I A;  4NLK A;  4O3O A;  5J2J A;  5III A;  5DG8 A;  7ICG A;  4UQG A;  4I2G A;  2HVH A;  4WC3 A;  4ATB A;  1TFY A;  3OGU A;  3B0X A;  2IHM A;  4IRC A;  3BQT A;  3RAX A;  4E8F A;  7ICR A;  4I2E A;  5KG6 A;  3ISB A;  4K4H A;  4ELV A;  3SI8 A;  5TZV A;  3IM1 A;  2W8L A;  4KLS A;  3NGD A;  4J9O A;  4EYI B;  4DFJ A;  4E7X A;  5KFJ A;  3LWM A;  4M04 A;  4AT7 B;  5DLG A;  1KFS A;  5KFN A;  4ED6 A;  4WC0 A;  4P4O A;  3TI0 A;  1TAU A;  5KFU A;  3RB0 A;  1NK6 A;  1HUO A;  4KLJ A;  4HYK A;  9ICK A;  5KTQ A;  4K4G A;  1KNY A;  3LWL A;  2BPC A;  3PV8 A;  1JQR A;  3WFR E;  4FBT A;  2KZM A;  2JEI A;  4YVZ A;  2ZH3 A;  2A1J A;  2ZUC A;  4DWI A;  4Q45 A;  7ICK A;  3THV A;  4YQW A;  5DG9 A;  1MC8 A;  2ASD A;  3H3A A;  4QZE A;  5J2C A;  5KT2 A;  3RB4 A;  2FLP A;  4PHD A;  7ICE A;  1S0O A;  4F92 B;  4M6W B;  4ED8 A;  5DKW A;  3MGH A;  2PXI A;  4DL3 A;  4I29 A;  3AQK A;  5IIL A;  4F5N A;  1DOQ A;  4WCW A;  3MR6 A;  1S76 D;  3PX0 A;  3ZDB A;  1BPZ A;  1K1S A;  3QEB Z;  2ZHB A;  5CP2 A;  3OVB A;  1ARO P;  7ICH A;  3N4M B;  1U45 A;  1RYS A;  8ICK A;  4RUA A;  1TK8 A;  4XQ7 A;  2UVV A;  3G6X A;  2P6R A;  1A76 A;  2ZJ5 A;  5HML A;  1S97 A;  5L9X A;  1KDH A;  8ICC A;  4TUS A;  2BQU A;  9ICL A;  9ICM A;  7ICP A;  4CCH A;  3RJG A;  1QSY A;  2F1I A;  2BCR A;  5DBC A;  4ED3 A;  2XY7 A;  3H38 A;  5F2V O;  2NRV A;  4RWP A;  2BDP A;  2KZZ A;  2V4R A;  2PFP A;  4IG8 A;  2XGQ A;  1TAQ A;  4QW9 A;  3PW4 A;  2NRT A;  2BPF A;  2PBE A;  3OJS A;  4RPZ A;  2BGW A;  3PW7 A;  1VFG A;  4B9M A;  3Q8S B;  3N97 B;  2OWO A;  3BDP A;  1JXE A;  4YMM A;  3QE9 Y;  1MQ2 A;  5L1L A;  2HW3 A;  4DOB A;  2V9W A;  2JEG A;  4X4N A;  5DB6 A;  5J0T A;  3TAN A;  3NYB A;  4YFK A;  1HUZ A;  4AT8 B;  4C8O A;  4PGX A;  4X0A A;  2BCS A;  4ECT A;  1A77 A;  1CUK A;  4DS4 A;  1X9S A;  1ZQR A;  4PGQ A;  4Z6E A;  5J2G A;  4RQ3 A;  4IR9 A;  3RJE A;  4DQQ A;  2AGP A;  3TAQ A;  4QZA A;  4NKU A;  3H8W A;  4DQS A;  4KIT B;  3SV3 A;  4NLZ A;  5J2B A;  4ATB B;  4IRD A;  1VJ7 A;  2FMP A;  4O3R A;  2VA8 A;  4O5C A;  2ZH4 A;  3ETL A;  8ICB A;  5IIO A;  9ICU A;  1JMS A;  4RQ8 A;  2ZHA A;  4FHX A;  1XC9 A;  4R65 A;  4QZD A;  2XCA A;  4NLN A;  3G6Y A;  5KFF A;  1ZQZ A;  4O0I A;  3TFS A;  3OSP A;  4O9M A;  8ICA A;  2Q66 A;  4I2D A;  3JPN A;  1XSL A;  9ICB A;  1COO A;  4KLO A;  4JV2 A;  2JZB A;  3OSN A;  4DLE A;  4Q8F A;  3K75 D;  1TFR A;  1UEU A;  5KFR A;  3RB6 A;  3UQ0 A;  3RR8 A;  1NZP A;  4X4S A;  3UXO A;  2ISO A;  4J9M A;  5IIN A;  2JEF A;  2UVR A;  3E2E A;  5KT5 A;  4TQR A;  4ECZ A;  4UBB A;  5DLF A;  4EP7 A;  4DO9 A;  4DS5 A;  3RJK A;  4GXK A;  1KFD A;  5DG7 A;  9ICI A;  3OV7 A;  4PHE A;  3EPI A;  5HRD A;  9ICH A;  4X4T A;  3H7I A;  4LT6 A;  4B9S A;  5KFO A;  4F93 B;  3JPT A;  4X4P A;  5HRH A;  3H37 A;  4X0B A;  4NLG A;  5BPC A;  3PMN A;  4RUC A;  5HMM A;  5KG3 A;  3ISD A;  4MFF A;  9ICQ A;  1Q78 A;  2ZH8 A;  3PW2 A;  5HRG A;  3C2K A;  1UA1 A;  3WFS C;  4WBZ A;  4F2R A;  1K1Q A;  5KG7 A;  4FHP A;  1R8B A;  2ZH9 A;  4ECW A;  1T7P A;  7ICS A;  4RNO A;  1SKR A;  4FS1 A;  3TAR A;  4XUS A;  3AU2 A;  4KLU A;  1NK5 A;  1NKC A;  4I28 A;  1LB2 B;  2HHP A;  4YN4 A;  2XCP A;  1OU5 A;  3RH4 A;  5KFQ A;  5EWE A;  4F3O A;  2C28 A;  1HJP A;  5D4B A;  1N56 A;  1R8C A;  5F9N A;  3OHA A;  1R8A A;  4RQ7 A;  3Q8Q B;  1ZQO A;  1V4A A;  2ZJA A;  2IA6 A;  4B9U A;  3ZDD A;  4J9S A;  4UB5 A;  3C2L A;  2AGQ A;  7ICT A;  2MUT A;  3ISC A;  3H39 A;  1S77 D;  5J2D A;  2I9G A;  1DK2 A;  1BPE A;  4DEZ A;  2FLL A;  4YR3 A;  3Q8R B;  3HP6 A;  1KEJ A;  2HVI A;  9ICF A;  1UEV A;  3JPQ A;  4J9K A;  3Q8P B;  3V6K A;  1ZQI A;  3WFO A;  5HR9 A;  1Z00 B;  5J2H A;  3GII A;  4JK1 A;  4KLL A;  2M2W A;  1RPL A;  8ICJ A;  8ICP A;  1D8L A;  5D46 A;  4DSI A;  2ZTD A;  7ICO A;  3RRH A;  4TUQ A;  4UB2 A;  4RQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...