4F5ZA

Crystal structure of rhodococcus rhodochrous haloalkane dehalogenase mutant (l95v, a172v).
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
292
structure length
292
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEAVGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAFRTADVGRELIIDQNAFIEGVLPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPALHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering enzyme stability and resistance to an organic cosolvent by modification of residues in the access tunnel.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 103
structure length 292
sequence length 292
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f5zA00
4Y2VA 1QGED 2FUKA 3NUZA 4QEKA 2B61A 4UHBA 1XKLA 4IQ4A 3O4IA 4RGYA 2UZ0A 2BKLA 1LPSA 5K3FA 1SOMA 1O6GA 5CTAA 4HS9A 2WIGA 1VZ2A 3D2AA 3BIXA 4B0OA 5AI4A 2DFPA 4Q82A 3G0GA 4BE9A 2BCEA 4X92A 2JGJA 5JAPA 2Z3ZA 4X97A 1X70A 2WFZA 3MGAA 3I2KA 4DMFA 3BXPA 2D0DA 4GI1A 4C88A 4OYLA 3FWHA 4UBKA 2WLSA 2Z8ZA 5ALXA 3AIMA 1FJ2A 3I2GA 5ALQA 3ZLTA 2CBGA 3ICVA 3A70A 1YS2X 2OXEA 2W22A 3OOSA 4V2IA 4QLAA 4CIAA 3I1IA 2O2IA 3G0BA 1LPMA 5JARA 4FWBA 4J0KA 2XUIA 4DSZA 1USWA 4GW3A 4P92A 4KJXA 2WG2A 4QZVA 2OQIA 4BE4A 1HLGA 5AK4A 1G66A 1CIJA 2ECFA 2NW6A 5DYYA 2WUDA 3M3DA 4KR0A 2PUJA 1GKLA 2QUBA 5ALGA 4MQMA 2WG0A 1EH5A 5LZ5A 2PU5A 1ISPA 4HZGA 3H18A 4AO8A 4QDXA 3I2HA 1QJ4A 4P93A 2PSJA 1CFJA 4F21A 1F0NA 1L7QA 5AK5A 3QH4A 2I03A 4LHEA 5SYNA 4Q05A 1H23A 1UOOA 4BVJA 4W1PA 3V1MA 3T4UA 3M82A 4RPCA 3KSRA 4Y2YA 3KD2A 3S2ZA 1G5FA 3AZQA 2JGLA 4GBGA 4OUKX 1W75A 4X91A 3NGMA 3AZOA 3ILSA 3C6BA 5A71A 3AINA 1ORWA 5LZ9A 1QIIA 5AIBA 2PU7A 5LZ2A 2XMGA 4PSCA 3CN7A 2ZJ6A 4X71A 4LXIA 1UK9A 2XMQA 3WQHA 2HADA 3GBSA 1Z68A 5AHXA 3QYJA 2OPHA 1UWCA 2WHQA 2WIJA 3E0XA 4CFSA 1WB6A 3D4LA 4PV7A 1XQXA 4E11A 5K3AA 3C8HA 3YASA 2WG1A 4GXNA 3O95A 1LZKA 1XZHA 2DHCA 4JH0A 2XQGA 1CUZA 3AZPA 3FLBA 1ZIYA 3G0IA 2C5GA 4XVCA 4YPVA 3BJRA 3O0DA 3OTQA 2JGKA 2G63A 2JEYA 4N8DA 1TK3A 3LP5A 4H77A 1CUFA 4E15A 4W1QA 2XUGA 4J0GA 2PSDA 5J3JA 3L1IA 1BE0A 3WA6A 4X00A 5FKJA 4G4IA 4J3JA 1JU3A 3HACA 5EHQA 5AOCA 5FV4A 3HI4A 5IVKA 5EFZA 5C81A 5HCUA 1NU8A 2VJBA 1UXOA 5EHXA 3KDAA 3B12A 3EQ8A 2ZSHA 5BV7A 3W05A 1AURA 1XKTA 3FYUA 4DSAA 4EY8A 2J4CA 4LKOA 1XZCA 1DX4A 2HA0A 3SWWA 3FSGA 5ALDA 2BJHA 2HU5A 2RHWA 3BL8A 3E4DA 4J7AA 3HLKA 5I8PA 4UHDA 3ANSA 4DMCA 5JAUA 4INZA 1Y37A 2DQYA 3VISA 4DTCA 4Y2JA 3WZMA 4H7EA 1VKHA 1EX9A 2WU4A 3RKSA 2OQVA 2DR0A 2PPLA 4FHZA 4H7KA 3M81A 4K6GA 5EI5A 2AJ8A 2JGIA 3N0TA 1XZMA 5LZ7A 3C6ZA 4QDTA 2DSNA 4FLFA 5ALEA 1DT5A 5CW2A 4L3WA 3LIPA 1B6GA 3LLCA 1HKHA 4EA6A 2AJLI 2WFLB 3C43A 1QONA 4G1FA 3FYUC 4EBBA 2XB6A 5C8XA 1BU8A 2D5LA 2BGNA 1QIJA 3WK9A 3H1AA 3SX4A 4CCYA 1MX5A 4PQEA 5HFNA 4HRXA 3ZWQA 4N8EA 3NWOA 2PUHA 3I6YA 1XFDA 4N8SA 1QIEA 1VOTA 1YAHA 2Z8XA 4Q3LA 4B84A 4BZWA 1C7JA 2ZYRA 5ALRA 3G0CA 5KREA 3C5VA 5FLKA 1N8SA 3IVMA 1YA8A 5LKRA 1EI9A 2QVBA 4JNCA 3WIOA 1W1IA 5AIAA 4Y2XA 2WUFA 5CH8A 1MN6A 4O08A 2FX5A 2VATA 1QO9A 5AM3A 2V98A 2XLCA 1K8QA 5A62A 5DNVA 4N5IX 2ZJ7A 5DTJA 3DDUA 1R9MA 1CUBA 2GBIA 2JF0A 4AZ0A 1EINA 1T4MA 3STTA 5JADA 2PSFA 1YASA 4EY7A 3G9TA 1LBTA 5K3CA 5AKLA 1I6WA 1H2ZA 1QIMA 1WB4A 4BTLA 4DLNA 1C7IA 5DYTA 1P0MA 1NU6A 2GYVA 3I2JA 3H2GA 4DIUA 5AOAA 2XUOA 4BRSA 2Q0XA 3WKAA 4MEAA 5CT9A 5CT5A 1CUAA 1JI3A 1UKBA 4QWWA 2C5FA 3I2FA 4MWSA 5AI6A 1VJ5A 2WHPB 1NX9A 3V9AA 1EVQA 3O4HA 3T52A 5ALUA 5C8ZA 1FSSA 4IH1A 3LIIA 5AK3A 3IUMA 3QBJA 3TEJA 3E1GA 1LGYA 4OYYA 2H1IA 2GZSA 2IX9A 5H3HA 4UHHA 1EXWA 3H2IA 2G4LA 2HA6A 5CT6A 1A8UA 4FNGA 4AO6A 4EY5A 1DWQA 2OGTA 4IH9A 3BIWA 2EEPA 1XRPA 1QIDA 2CKMA 5BOVA 4MWTA 2HA7A 1CUXA 3QMVA 4C89A 5AH0A 2XQJA 5AKZA 3HRHA 4UFPA 4H7IA 4TGLA 2XT0A 3ESBA 5HQ3B 4AO7A 2QJRA 1XZKA 3FNBA 5K3EA 3PF9A 3KOOA 1AGYA 1P0PA 3DYIA 2GBCA 2RHTA 4X3CA 1JMKC 4G9EA 2XMCA 2XMZA 1R9NA 5AI5A 4DNFA 3D2BA 1JKMA 4QA9A 2XUKA 2QJWA 2GYWA 2HFJA 1IVYA 2PL5A 1MAHA 5JAHA 2J4FA 2O7VA 2WTNA 5E4TA 4XX1A 4X6UA 4YASA 1IZ7A 5LKAA 2RIPA 5AM4A 5A7GA 3FBWA 5JANA 2G5TA 4B7ZA 2QOEA 5JZBA 4HAIA 1E89A 2YXPX 4LIPD 1ACLA 1KU6A 2HFKA 1CLEA 1VZ3A 4BVKA 2QS9A 3F8SA 2CMFA 4X85A 4N5HX 5DYWA 5HF9A 3GROA 1X2EA 3IUJA 1EA5A 4B82A 4HRYA 1ZD4A 5JZSA 4C4XA 4Q3KA 2B4KA 4L72A 1CUSA 1F8UA 1QIGA 1BEEA 4WCVA 3HYSA 3LS2A 2RONA 5AM0A 4X7BA 4KAFA 3GZJA 5HF8A 1VXRA 1UZAA 2R11A 1WHSA 2QRUA 2RAUA 4OB6A 1CUEA 7YASA 4ZGBA 5I9IA 4IO0A 3WLAA 1H2XA 1EDEA 2XLBA 3GELA 3BWXA 1GQSA 4AMZA 1LPNA 1AZWA 3O9VA 1ZGBA 3C70A 4JYPA 5HF5A 4OPMA 4MYDA 4FTWA 5FDFA 5DNWA 1QFSA 3QZUA 3SC2A 1E3QA 5AKIA 2BFNA 5A6VA 2OCIA 6YASA 2J3QA 3G7NA 3FVRA 4B9EA 3G0DA 4AMYA 1DX6A 2ZSIA 1CUDA 1ZOIA 4UPDA 5FPQA 2ACKA 2ORYA 1QZ3A 5EHNA 2HA2A 3FCYA 5AK6A 1QIKA 5HFAA 2ZYIA 1JJFA 3VXKA 4W9RA 1IUOA 5ESRA 1BEZA 1LPAB 5CXXA 5ALHA 3CXUA 1CVLA 2VJCA 4FBLA 5C7YA 1SCIA 2ZYSA 5T4HA 1GGVA 4U2EA 4BP9A 2V97A 1LLFA 4PSUA 1W6RA 5CBKA 3R3WA 4U2GA 3OPMA 2XMBA 2YH2A 4PF1A 1TKRA 4BATA 3MUNA 4BB0A 1WPRA 4OCZA 5I7UA 4FDMA 1XZIA 1P0IA 4LYEA 4JUIA 4EY4A 3FLAA 2GYUA 3B3QA 4ZV9A 2XE4A 1WPXA 1E66A 2C7BA 2JGMA 1XZJA 1YAJA 2OCLA 4AZ3A 1SC9A 4X93A 4PO3X 3G9ZA 2QXUA 3H17A 3U1TA 5D6OA 3UUFA 3QPDA 2Z5GA 3F67A 5KWJA 5HK9A 3AJAA 1P0QA 1IZ8A 4AX4A 5ALJA 4RNCA 4BC1A 5A2GA 3FLEA 2WSLA 2I3ZA 4Y2RA 5KBYA 4BAGA 3D2CA 2WFLA 5AO9A 3AIOA 1K4YA 1AUOA 3R3ZA 3C8DA 3AILA 1ETHA 4BDSA 5ALKA 1RP1A 3R41A 3K2IA 4FOLA 4CCYB 4J0CA 2W6CX 1ODSA 2Y2UA 4C4ZA 5HK8A 4A16A 4HXGA 1UK8A 5LZ8A 4UBLA 4W1RA 1THGA 4Y7DA 3ESAA 4F60A 3AIKA 4WJLA 1VA5A 5AICA 4GHWA 5F4ZA 2XMRA 4QNNA 4CG2A 2CB9A 3AUKA 5AP9A 3B5EA 1CUJA 2XDWA 1IUPA 3WKEA 2HU8A 3OG9A 4B0PA 4BC0A 4WY5A 4CIBA 1CUYA 1ZIXA 2RI6A 4GLBA 2BAGA 5FXMA 1Y7HA 4U2BA 3WL5A 3CCBA 4H7FA 4H0CA 3BF7A 4X6XA 2B9VA 1JFRA 1DWPA 2Y2VA 5ALWA 1ZI9A 1BN7A 4BZZA 3WIBA 4UHFA 1Y7IA 1E8NA 1QLWA 2ROQA 1BCRA 1C4XA 1S8OA 2XUAA 1H22A 3KXPA 1J07A 4I3FA 1TRHA 4UHCA 4LYDA 1PV1A 5K5EA 5LIPA 4Y2TA 4X90A 4BCCA 5ALOA 1SCQA 4Z49A 2JEZA 3HABA 4EUSA 4DNPA 3D3NA 4B83A 2Y6UA 4KE9A 4Y2PA 3JWEA 4B9AA 1UT6A 2HU7A 5SYMA 1EHYA 3VJKA 3VVLA 5LP1A 2DHDA 4AQDA 1BROA 1CRLA 2GBFA 2WTMA 4BTVA 3UUEA 2X5XA 1Q0ZA 2BUCA 2PSHA 2XMSA 2XUPA 5AJHA 4ARBA 3W06A 4BYMA 2QR5A 2QMQA 4W63A 5JASA 1ODTC 2XQKA 5CXUA 3M83A 1T2NA 2Y1KA 3W9UA 1LBSA 3VVMA 2JGFA 2VQ6A 3V1NA 2WUGA 1XRNA 5JYCA 1AMNA 4BRZA 1AKNA 3PUIA 1A88A 5IVDA 3STUA 4JYMA 3WK5A 5LZ4A 3H1BA 3HXKA 1J06A 3DQZA 2B20A 1BRTA 5JD6A 1ACJA 3W2TA 3PI6A 5AKXA 4KE8A 3WYNA 2LIPA 4OU5A 1MX1A 4QWMA 3FSGD 4M0EA 5K3BA 3WJ2A 1SCKA 2E3JA 4J0DA 1QIFA 1AX9A 5AKYA 2C0QA 2XMDA 1F0PA 4MQLA 2EDAA 1XZBA 3ZI7A 4Y2QA 3A6ZA 1ZICA 2HDWA 1ZJ4A 3A2MA 4KE7A 4WFJA 2XUHA 5LLSA 1J1IA 2HRRA 3BJMA 3RLIA 2DHEA 2QTBA 3WWEA 1DQZA 1ZI6A 4AN0A 2Y6VA 3RM3A 4FLEA 4H7HA 1PFQA 1XZEA 2OLEA 5ISMA 1JJIA 4IH4A 4Q1VA 3DEAA 2WJ3A 4MEBA 1E5TA 2WJ4A 3KWFA 3G02A 3JYHA 1KU0A 5JIBA 3FAKA 4P9NA 3DOHA 2DQZA 3WI7A 1QFMA 3STVA 5ALFA 3TRDA 1ORVA 2V96A 4QLOA 4F5ZA 1Q84A 4WDRA 4OB7A 1K63A 5CT4A 5AM2A 5JATA 1ZD2P 1VLQA 4OB8A 2ZYHA 3O9MA 2VAXA 4XJVA 1WM1A 2PBLA 3EBLA 1VE6A 5A7FA 4KRXA 4A5SA 4B6GA 1LZLA 3WZLA 3Q8WA 3VDXA 2WM2A 3PF8A 4B80A 3I6ZA 4ITVA 4UHEA 5LYYA 4C01A 3HZOA 5T4FA 4S0XA 5EIAA 3WK6A 4U2CA 4ZWNA 4A23A 1UK7A 1IUNA 3ZV7A 3VJLA 3QPAA 3R3XA 5E2IA 4DM7A 2OGZA 1BN6A 5ALIA 3ZLVA 3DL7A 3WYDA 4EHBA 3L1JA 1L7AA 4CCWA 1E8DA 3R40A 1XLWA 1FFEA 5AI9A 4UBIA 3WL8A 1H2YA 1FFDA 4DNOA 5EGNA 1XRLA 4DNQA 5ALLA 5T4BA 3TGLA 3V1LA 1RWQA 2O7RA 1BS9A 5FPPA 2OAGA 4J03A 4DGQA 4QDOA 2JGEA 1FFBA 1ZI8A 3EIOA 4KE6A 5K3FB 1QOZA 2XQIA 1JT2A 2VF2A 4ETWA 3BE8A 3EQ7A 2PVSA 3GA7A 4LXGA 3W9BA 4HXEB 4QE3A 5AKEA 2I78A 1R4ZA 2YASA 3STYA 5AKGA 2XQFA 5AM1A 1VA4A 5ALZA 1MX9A 1F6WA 1EDDA 1X2BA 2HA5A 1EK2A 3F98A 1LPOA 4GEGA 3WKCA 4ARAA 1DTEA 2IIVA 2XUQA 4W1SA 1XLVA 4CG1A 4BCDA 2BUBA 3WKDA 1EVEA 5E4JA 3PUHA 3EQ9A 2DCMA 3ESDA 1LNSA 3D7RA 4ROTA 1ZD3A 1B41A 1CR6A 1QO7A 2WKWA 1W4LA 1WB5A 4MJ3A 5AI8A 3QVMA 2ES4A 5CRIA 5BWBA 4AB1A 4OU4A 2HIHA 2ONCA 5D7BA 4ZI5A 2BGRA 4FMPA 4G8BA 2HM7A 2HA3A 2Z3WA 4H7JA 4OD0A 5FOQA 5JD5A 1GXSA 1Q0RA 4ZREA 4FLMA 1PJAA 2PSEA 2WHRA 3GFFA 1HBJA 5HKAA 1JMYA 1YSCA 3R0VA 2VA9A 4WDQA 1EK1A 3KWJA 3WL6A 5AKKA 1CUCA 1XRMA 4EB0A 4FKBA 3K6KA 3ICWA 3F96A 1G4HA 2P8SA 1R88A 4K2AA 3D0KA 1RYYA 1YB7A 4Y2SA 4J0HA 5D3ZA 2C0PA 4K5QA 2WIFA 4KRYA 1XRRA 5CT8A 5A7HA 4ZV7A 5DJ5A 2QZPA 4ZXFA 3HSSA 3IURA 2RGUA 4BBZA 1XZLA 4UFOA 4DYHA 3C6YA 1MNAA 4HTAA 1CPYA 3UMJA 5DNUA 5FRDA 1U8EA 1R1DA 1MAAA 5HKBA 1CUHA 1YB6A 1WHTA 1BCSA 2CZQA 2K2QB 2C58A 3WL7A 3WKBA 1QTIA 2OG1A 3H04A 1CUGA 1AQLA 2WFMA 1DQYA 4C4YA 4NMWA 4HVTA 4K6KA 4AXBA 1OXMA 3H0CA 3H19A 1YR2A 5FUMA 2ZJFA 3STWA 3DLTA 1UOPA 5CURA 4EZIA 2WHPA 1ZJ5A 3DJYA 3D59A 1CQWA 4G4JA 3MVEA 3ED1A 4KACA 1GKKA 4L0CA 3SK0A 2H7YA 3U0VA 3WK7A 3BF8A 3IB3A 3JW8A 1R3DA 1EDBA 1XQVA 5AKJA 2O2GA 1G42A 2H7XA 5ALNA 3QMMA 5HF6A 5BWCA 1J2EA 3HC7A 1GQRA 2HL6A 3C6XA 3P2MA 4K6HA 4BP8A 5ALTA 1AC5A 1LPPA 1GPLA 1DT3A 4E14A 3NOXA 5HZGA 1VXOA 3QPCA 5JALA 1SFRA 1U65A 5EIEA 1XLUA 3H2HA 4YK7A 3IA2A 4KEAA 4RE6A 2VT7A 4H18A 2OAEA 3G9UA 3W04A 4BDTA 3H2KA 4F0JA 3VJMA 1UOQA 4YX9A 1GT6A 3WMRA 1EB8A 3AFIA 1XZGA 3O4GA 3QMWA 3ZPXA 5YASA 4E46A 2WU3A 3DKKA 3PFBA 2WIKA 4BVLA 4WY8A 4NS4A 4I19A 5KWIA 4NZZA 5C8VA 2VT6A 3STXA 4C6HA 1FFAA 1YA4A 3FOBA 4TPKA 1K6EA 4FFVA 1DINA 5IVHA 3V48A 2GZRA 2X76A 5ALVA 3DNMA 2WIDA 4QDUA 4J0IA 3PDCA 4U2DA 3FVTA 2I3DA 2V9ZA 1A8QA 4UBOA 1YCDA 3O4JA 2JBWA 3WWDA 2QT9A 2WQZA 1GZ7A 2FJPA 1CUIA 4MYSA 1VE7A 2QM0A 3WA7A 1R50A 3BDVA 1L7RA 1O6FA 4CG3A 1THTA 5ALPA 4I4CA 5IKXA 2ACEA 4PW0A 3F9CA 4KAAA 1XRQA 2G5PA 5T4EA 1U2EA 3BDIA 3IUNA 4ZRDA 4NVRA 2AJBA 1FFCA 3HJUA 4C87A 2BUAA 3OURA 1YS1X 5CH5A 1ZGCA 3Q0TA 4D9JA 3R3YA 1TIBA 2XUFA 1A7UA 3E3AA 3HEAA 3FCXA 1WCYA 2H7CA 3IDAA 4WFIA 3I6MA 2VSQA 3WJ1A 2X8BA 3VKFA 1XROA 4P08A 2EDCA 2QXTA 4B85A 1CV2A 1UFOA 1XZDA 3FYUB 2VEOA 3IBTA 5JAOA 5ALSA 2OCGA 3I2IA 1TCCA 2R8BA 2AJCA 3IUQA 4B81A 3V1KA 2ZVDA 1M33A 3DD5A 4QDZA 1WOMA 4XWGA 2JIDA 4U2FA 5FP0A 3C45A 1Q83A 4DMHA 2CJPA 2H9YA 1HPLA 4Y9SA 4EY6A 2QKYA 4LXHA 1MU0A 4M0MA 1MPXA 1TAHA 3TJMA 4JEIA 4H35A 2OCKA 4BAZA 2PX6A 4UFNA 2YYSA 4CI9A 4UBJA 3F97A 3R3VA 1JJBA 2C4HA 4J0JA 3S8YA 5E4YA 3A2LA 5ALMA 3QM1A 3D5EA 1HDEA 4TVKA 4BAUA 5AM5A 3PFCA 1UKAA 2AXEA 2HHAA 2PM8A 4UUQA 3ZLUA 3IIIA 3RK4A 1TCBA 3QITA 4GDMA 4Q3OA 3WK8A 3OC0A 2VJAA 1CQZA 4Q34A 4OSEA 2CEKA 1MTZA 4M0FA 3C5WP 3G8YA 1MT3A 4RE5A 2WUEA 5AKHA 3I1YA 1QTRA 1XZAA 1TCAA 3CN9A 1JU4A 1CUVA 1A8SA 1CUUA 3WWPA 1EB9A 5CH3A 3WWOA 2WILA 1N5RA 5AI0A 3DOIA 2IITA 1XQWA 2OGSA 5EHZA 3EF3A 2J3DA 4DMKA 3DKRA 5EIHA 5D3KA 1HL7A 3DCNA 1XZFA 2XUDA 4UBMA 4X6YA 5DLPA 2AJDA 1IMJA 5ALYA 4KYVA 1N1MA 2QUAA 1MO2A 5JZ9A 3H2JA 5IVIA 3I28A 1CEXA 1MJ5A 1U4NA 4X94A 1DU4A 4FFWA 4G8DA 3X3HA 3L1HA 3N2ZB 4IHAA 1KEZA 4PSDA 4X95A 4HXFB 1QE3A 1E8MA 1LPBB 4UBNA 3DYVA 2XUJA 2GBGA 2HA4A 2XI4A 3K9BA 3C87A 5K3DA 4FBMA 1D07A 3CCCA 1MNQA 4BCBA 1ODCA 4WFKA 3DL4A 3LCRA 4G4GA 4KAJA 5JD4A 3ANTA 3PICA 3WK4A 1XQYA 3OM8A 5HQ3A 4GECA 4G5XA 5DWDA 3GUUA 5AOBA 4MXDA 1UKCA 1HQDA 4H7DA 3R3UA 3ESCA 1W52X 4G8CA 5DTIA 1N5MA 3A2NA 4AN1A 1UK6A 3FYTA 2WJ6A 1DWOA 3RARA 3G9XA 1GPKA 1QIHA 2HRQA 4GWLA 1OILA 5CMLA 1GPNA 1H2WA 5IH7A 3PE6A 2VAVA 1ZD5A 3IULA 4FNMA 2FJ0A 2PKYX 2O2HA 3MUOA 4XIIA 1W76A 4G9GA 1CUWA 2VTVA 2CUTA 1K5PA 3DS8A 3WWCA 4Y2UA 2VJDA 4PNZA 4L9AA 1OCEA 1TQHA
chains in the Genus database with same CATH superfamily
4FEGA 2AUTA 1G8YA 2F1KA 3DBHB 3OJWA 4Y2VA 3DNPA 3DC7A 1NYLA 1SIBE 3PXUA 1VB5A 3AI3A 1I3KA 1A9PA 1KJIA 2B61A 4IJMA 2E6KA 1Y5LA 3M4XA 1DFGA 1VSVA 1D2MA 4AJJA 2I2BA 1BSVA 2PZAA 3IP9A 1N6LA 2QD1A 2PFGA 1NP6A 2C5BA 3JQAB 4GZ5A 3OQMA 2BM1A 1RMYA 2CYAA 1CDOA 2BFOA 5KVQA 2BKLA 4F46A 2BISA 1L4BA 2ZSUA 1M6HA 3WLFA 1SU4A 4PVDA 1MQ8B 1M34A 1ADCA 1O6GA 1N92A 1VRVA 1Y3HA 2V7XA 1XG5A 3CRNA 1VKNA 2VH2A 3D2AA 3L41A 4HS9A 4B0OA 3X1DA 5F9HA 3TZLA 3FAZA 4M89A 3AONB 5D8DA 3E0QA 1UDCA 3AHDA 4U5QA 3ROEA 2CW5A 4Z4QA 3GA0A 1E6CA 4MUGA 3RASA 4BMDA 3RT7A 1V9CA 2PKCA 3C3XA 3RS8A 1TDJA 3B2EA 2QP3A 3MWJA 3PFIA 3MNFA 4OSOA 2E7ZA 5M7EA 4X6LA 1KS9A 4UE3S 1X70A 4HADA 3MGAA 1ZNXA 4DMFA 4K88A 5DM60 3R5FA 2KLHA 3I9V1 3DLPX 3R7LA 4IILA 3BXPA 5KX5A 2IOYA 1RLOA 1J70A 3UTCA 3ONVA 3AF0A 1A0OA 3R5SA 3D5QA 2JHAA 3CRQA 4K0KB 1PJ8A 3S7ZA 2CN1A 3NRBA 3EIEA 2WLSA 3LHSA 2CFCA 4C7JA 4XWWA 1AF7A 4UTOA 3MMNA 3NP7A 4B76A 3VYVA 3GW8A 1HZZA 2FW9A 3UC5A 1U3CA 4R68A 3QXGA 1B7GO 1I30A 2W22A 3JYOA 2ZDGA 3TQOA 2XD4A 4ONEA 4V2IA 5JJKA 1DTWA 3D1VA 1Z38A 1PNOA 1Z7YA 1NWHA 2K5UA 5KZMB 1XJ0A 3L06A 2ORVA 4FJ2A 2G6TA 5FUQA 5EQJB 1WXHA 5IABA 5JCZA 3TSCA 1I0ZA 1O9HA 3EXFA 3MXOA 3FTEA 1HTBA 1XN1A 1YZUA 3AVQA 3PXAA 4J0KA 2H17A 5THXA 3ELBA 2HXSA 2IOFA 3IT3A 4F3YA 5E8JA 4P92A 1GNPA 4NCIA 4Y1GA 4KJXA 4L2IB 2YVQA 3TL2A 4OOFA 3VU3A 2OV4A 2HWWA 5EMHA 3UXHA 2V65A 1HLGA 1U9YA 4XQEA 1C3OB 2ZJZA 3AW8A 1WXDA 3AB3A 4LZZA 3CNQS 4MW0A 3AL0C 4JY7A 3GEDA 1FFXA 2X3YA 2YJ6A 3OZRA 1HNXB 3K0BA 4AY4A 2OFPA 2YFYA 4P36A 4CF7A 2YWDA 3QELA 4HJRA 5K99A 3EEBA 1DTWB 1SU7A 2QVYX 4XFDA 4XYEA 3DAPA 3VR4D 3IHLA 4D46A 1ZINA 1TA4A 4G0VA 4DV6B 3TOZA 2PUJA 5FR2A 4KBYA 4PEVA 4JT4A 4QNMA 1EFVB 1PE0A 4I5EA 4JL6A 3GLVA 1P3DA 3KQWA 1FX0A 3QU5A 4II7A 4UMDA 4WZAE 5G1NA 1C8BA 3IQIX 1G1MA 4OL0A 4Q4AA 2PU5A 4NS1A 1T8UA 5ILGA 3AJ9A 1W581 3WGKA 4HZGA 3WLNA 1TKBA 3SJ7A 4DADA 4EJSB 5IHXA 3E1KA 3B1WA 4HPWA 3UHFA 4CPDA 4IUBS 2AZ4A 4L4ZA 3PIDA 1E5VA 1GPYA 3IAS6 1TGYA 4J6FA 1O96B 2PSJA 1P31A 4F21A 3FW1A 3EJWA 1A5AB 4U6QA 1G8GA 2G4CA 1Z45A 4DLXA 3CZMA 1UKVY 3S5JA 1I7SB 4JT8A 1A72A 3LX6A 4X45A 1RLJA 4J49A 4JBXA 2I03A 4LHEA 2WY2D 2JKZA 3HKBA 1HDYA 1OB5A 3MINA 4YUWA 1EGVB 1L5FA 2C2GA 2CHUA 3QU9A 4HCJA 4F4HA 4MB0A 1FDWA 1CLUA 3MYYA 1Z4IA 2D2VA 5B36A 3NOQA 5PNTA 1T2EA 1PJ3A 1X7YB 4RH3A 3QHQA 3EYWA 3ZWNA 1ARZA 4HNAB 4D0RA 4YJ3F 2PGOA 1NPYA 1ZVQA 2X2FA 3KQLA 4X91A 3RUAA 1B93A 1GRCA 3NGMA 1J0AA 2VJLA 3OEHD 2I7TA 3LZ6A 3QW4B 1ISHA 4Q9HA 4OGWA 1E9RA 2C0CA 3G8DA 3U16A 3C3DA 4V2UA 2AFIB 3T9EA 1QIIA 5AIBA 2R48A 4OGGA 2PU7A 3OHSX 4DJAA 4YO7A 1K7YA 1O4WA 1F5SA 2V7TA 2ZE8A 2CL7X 1C80A 4IL5A 1UMCB 2O0HA 4PSCA 1HNZB 1BXKA 4YP0A 4LXIA 1GEEA 3FNQA 1XEXA 4GEKA 1AV7A 3PDUA 2B36A 2OGUA 1U3DA 4OY3A 4IXMA 1OOEA 3MOGA 5KQRA 1Z68A 3OESA 3KDPA 1CJUC 2NO6A 2YMMA 5A3VA 3EXIA 5AW6A 3R7WA 1RIIA 1YR3A 1AD2A 2YZKA 2ZIWB 3I01M 3P1JA 3ZV6A 3D4LA 3LBAA 3OUZA 2O5CA 4UEWA 1JR3D 3K72B 3TLAA 4Z6KA 4U7FA 1HNWB 1SBTA 3YASA 4CIWA 2WG1A 1MFPA 4EM6A 3BULA 3R9WA 4MINA 2WQ6A 3G68A 2PJDA 2YRXA 4LMRA 3NDBB 5CLLA 4E1AA 3GH1A 3VAAA 1XZHA 3JQPA 4WEQA 1KIMA 3NHPA 1ZHOA 5EWMB 3L93A 3AW9A 3OPYA 2KBFA 4LDQA 1EPUA 4F71A 2XQGA 2XBUA 4ASUA 3QFFA 1CUZA 2V55B 4A1OA 3O6VA 3AVOA 3FLBA 1ZIYA 2UZIR 1M5RA 1A82A 2C5GA 4XVCA 3B3JA 3KCQA 4YPVA 4DV2B 2JGKA 1GUAA 2BRUA 2G63A 3JWJA 1VDMA 4LQLA 4XIYA 4JLSA 1JAHA 1Q1AA 4YP5A 4FHEA 4OLJA 1RXCA 2Y9PB 1HLDA 2GKSA 4V1CA 3KLPX 3ZWBA 3DTNA 1EWYA 2WDPA 3KQKA 1P9OA 1RRKA 2UVDA 3D0QA 3IAM1 3WAGA 1GFZA 5T57A 4Y0NA 1PS8A 4HGRA 5CG1A 5JMWA 2W71A 4NFLA 4LTNA 4JDUA 3D8RA 4RFSA 1NSTA 3RIYA 4EI7A 4EB3A 2APJA 3H5LA 1W1WA 4JSRA 2YYZA 1EFAA 4DKJA 1BMFD 1YONA 2JZNA 1H9BA 2P6NA 1QB7A 2UYYA 3BORA 3H1GA 4X00A 3VHQA 3WA6A 4BO1A 1T3LA 2EZ8A 4G4IA 3KV3O 2FOLA 4LJKA 5FV4A 3PGVA 1F2TA 1KO4A 4RKWA 3FDZB 2C61A 1JHAA 4TXJA 3CVXA 2YQ4A 5EFZA 2YWEA 1IL0A 3AHEA 1KK0A 3CUEF 4L28A 4B44A 3LKDA 2EZUA 5C81A 2HDNB 5H5JA 4ZJPA 4L4UA 3BXFA 3O1IC 2HQOA 5EHXA 4YRZA 3I6BA 3NYWA 1TUBB 2BGUA 3T06B 2CFRA 2C03A 2H2AA 3AY6A 3ETLA 4HNRA 4WNCA 4FM9A 3OOHA 2QNIA 2ZB2A 3Q8MA 1ZIOA 4HOYA 1KP2A 5IPFA 1AURA 3AEUA 4H2DA 3FYUA 1DEAA 2ZATA 4WLFA 4CV2A 1XZCA 3C8ZA 1DX4A 1T6BY 4OKIA 5D86A 4DWWA 5I8WA 2R00A 1JYSA 2N47A 4ZOLB 4BZPA 5KOHA 1Q1EA 5FPYA 3FSGA 3HJNA 3QFSA 5FD8A 5ALDA 1TVKA 9ATCA 2BJHA 5KYWB 4D3YA 1W4CA 1RJ9B 1Y8RA 3ACBA 3BL8A 4LE1A 1G41A 3E4DA 3B7PA 4NYIQ 3SKXA 2AW5A 5JYBA 2HUNA 3IR5A 1GZUA 1Q95A 4MQ6A 3HBFA 3R6LA 2SKEA 3X1ZA 3CLUD 1EFTA 4D3DA 4RMIA 3PIIA 1AQYA 3DO6A 3QYAA 4KQ2A 3JASB 1E3LA 3DL2A 3KQMA 4FU0A 4KN6A 4O33A 3P96A 1OI3A 1XQ6A 2VXOA 3F6EX 5J23A 4C3VA 2GK3A 1BD4A 2FZEA 1ACMA 1M54A 3TLMA 4HGQA 3SICE 2EHJA 3HN7A 1BDBA 1L4EA 4NOJA 4DTCA 3AUAA 4Y2JA 2GEUA 3K1TA 5IVPA 5M5BA 1N3BA 2LRHA 3ID6C 2A33A 2UZ1B 1TM7E 2PV0A 4M9UA 4DJDC 5MFZA 3KK0A 5EXDA 5KNBH 1R12A 2OQVA 4ADSG 3PFHA 4J2HA 4L27A 2HBQA 1FTQA 4R8SA 5AXDA 3GUVA 2AT1A 4UJ5A 4R51A 1OH7A 1KZ1A 3Q85A 4OP1A 3WSVA 2PRYA 3NT2A 3FIJA 3ORYA 3TOVA 4ACAA 5JOQA 1CP2A 4AZSA 4N01A 2OM6A 5EI5A 3UG7A 2D5BA 3DHWC 3MEQA 4ND2A 5KU1A 3FUWA 1SK9A 2AC2A 1CETA 2P7IA 3PJDA 1E61A 4CDGA 2JGIA 3G17A 4KQWA 4CF3A 1LJLA 1BMFA 1GZ5A 1QFZA 3C6ZA 3N0RA 5CJPA 2WA2A 3LI2A 2DWUA 2R65A 2ZIXB 4YIKA 1X19A 4UCWA 1XA4A 3V4SA 2DSNA 5ILQA 5F5XA 1Y5MA 1GARA 4ZO6A 4EKEA 5ALEA 1R8XA 1O9GA 4R40A 1V7PC 1BQEA 4L3WA 3RC3A 4C07A 1B6GA 3R5KA 2IOHA 4LDNA 3T7TA 1FMFA 1P1KA 3JRNA 4EA6A 1QBKC 3OFNA 4MQBA 4NEGA 1GZ6A 5HZKA 1CR4A 2Q3JA 3QVUA 2F8LA 3D8NA 4QU9A 4DCUA 2IJGX 5FAKA 3THWB 1Y3BE 1Y5IA 1E2IA 1RM3A 2FHSA 2NU7A 2QDXA 4L7VA 4MW7A 4RPHA 3RR2A 3TX6A 3EXIB 4ZHQA 3A4LA 4G0ZA 3RUDA 4PZUA 1C0LA 3P5SA 1HA3A 1C8KA 2LPMA 5A5EA 3U5TA 4KDFA 5E6RB 4BO7A 4UEJA 2DSTA 4EJSA 1FFGA 1T1SA 4G5OA 2D5LA 1E2GA 1MX5A 3E23A 1A5ZA 4BASA 3I9MA 3PFNA 1TC1A 3BHJA 4KPUA 3JVVA 4LRSB 4AP6A 1SELA 4EB6A 3ZJUA 3RYCA 3ZWMA 2L69A 1K75A 5G0WA 1K6MA 1NR1A 4Y1EA 3CO0S 1ZS9A 3IEIA 4PX3A 3OBIA 2JBHA 4S24A 1KAEA 2R3SA 3BC1A 3RSQA 4N3NA 5K4AA 3RVBA 4FW9A 3DT6A 5MF6A 4YRCA 4I55A 1VOTA 2ZUFA 1YAHA 5HVNA 2ENUA 4QRDA 5DSXA 2Z8XA 5TGDA 3C5EA 3EK2A 4V3CA 4XXHA 1G5RA 1Z63A 4B45A 1Y42X 3DH0A 2PVCA 2RK4A 3PV0A 1EUDA 2Q6OA 2C3YA 3FVWA 5AVXA 1X42A 3I9NA 1U6IA 1FVFA 1IWBB 2AR0A 3L4BC 3IVMA 1YA8A 2HC9A 6REQB 3O1LA 4BS9A 3P52A 1FY2A 6AT1A 1QCZA 2ZBRA 2XMPA 4JUBA 5KQLA 4LHYA 3EZ9A 4ZCPA 5I7RA 1W1IA 2V5AA 4PU0A 1TF7A 3P9XA 3TZCA 3JRWA 3OWHA 4G4SP 5AIAA 4NBUA 1UFVA 3Q9SA 2WUFA 2UUAB 3VDMA 1IHDA 1MN6A 1KKUA 1LDGA 1U9IA 1CDEA 2EOAA 2YN2A 2BE9A 3M9XA 4XVHA 1AUPA 4HLUA 4OL9A 4EKNB 1SULA 3CH4B 4O6VA 2HJHA 4LRTB 4NBLA 1BHO1 5A62A 1XNQB 1HRKA 1I33A 2ZJ7A 3EJ6A 3GB9A 4KKXB 3LWNA 4OBWA 4GE0A 2WSSA 3L01A 4IZIA 5DTJA 1K06A 3RHTA 3MQ2A 1QTQA 2HWYA 4JJAA 1BE8A 4PX9A 4X20B 5I47A 1KO5A 5JVDA 1TFRA 3JQ8A 2OBYA 1QRRA 4QBHA 5ESWA 2A5FA 2QHXA 2DR3A 2Q49A 4MYHA 4YUVA 1KZYC 3U7FB 4QC2A 2R87A 4YP9A 2C7PA 4Q1BA 2YIVX 4MQ4A 5A9TA 3RU3A 1P80A 4Q9DA 4Q4HB 2AMFA 1G2PA 2NTJA 3MJ4A 4NDZA 4TRMA 2J09A 5CXSA 1MH1A 1R66A 4UM5A 3QXCA 1WW2A 3PCXA 4NICA 1SXJA 1I6WA 3LUCA 1VKOA 1JKJB 4ZVTA 3ND8A 5EZ6B 3D7NA 5GADl 1TI7A 4GPEA 4BMNA 1ZIDA 2DWCA 2XDAA 4EHDA 2XUOA 2IHUA 3FCOA 2OAQ1 3HSKA 5FI3A 4JIGA 3RTEA 5BORA 2IGTA 1DC7A 2ZJ3A 5IZ4A 1RKXA 3IE0A 1WDLA 2HBYA 3NH9A 3WKAA 3AUYA 1BFKA 4O1HA 3PLAE 1XTUA 3VU8A 4TMFA 3PDIA 2FR0A 2PKWA 4MLDA 2VXBA 1HDOA 4AY5A 1Z6TA 5FHQA 4AIIA 5A9RA 2O8CA 4MGYR 4ZN6A 4WGGA 5AI6A 1XD2A 1VJ5A 2WHPB 4RJLA 1ABFA 3IHTA 3UWKA 3V9AA 4DXAA 2QUZA 2JGRA 2O8FB 4CKBA 3TINA 3K92A 5LQAA 4EJMA 1YJXA 4IDNA 1OA1A 1PT7A 1B43A 3K0FA 5ALUA 5KAMA 3ZHOA 3FM9A 3ZDQA 2ODTX 4M46A 2PX4A 4OHPA 3VO9A 4HPXB 3TEJA 1K5DA 4BV2A 3OUUA 1I4EB 3LBIA 4H9GA 3O31A 1LGYA 4OXXA 3PSHA 1XWWA 2YJGA 4L73A 2B4YA 3C4QA 4OYYA 5JWOA 2X0IA 2C2XA 3F5SA 3QOFA 4RHXA 1YXMA 3I52A 3N8IA 3O3CA 5CU7A 4RTJA 3GJZA 3Q1KA 3LWZA 3VPHA 3AESB 3H2IA 4DLVA 2QTAA 5JC8A 3PC8C 2LD4A 3VPFA 3E81A 1Z06A 1M6VA 3LUAA 4BLTA 4A15A 2IUYA 2Y0BA 3QKUA 4P6VF 4GOJA 2Q3DA 5CT6A 3NB0A 3PC6A 5EMJA 3WYBA 1MXFA 4ZAZA 4C08A 1A8IA 2H7VA 1W4RA 3O7WA 1A50B 4CUZA 4UNQA 4RH1A 2M1XA 4S2EA 5AJUA 4MV0A 1QAOA 1OF1A 2OA0A 4HDKB 4W5RA 2CVZA 2IKSA 3WGHA 4A73A 4GMDA 4Z1OA 2ZTSA 3EQZA 3K0EA 1EFPB 4QDJA 3MWDA 5BOVA 1XFAA 3DNFA 2HA7A 4K9PA 4MWTA 1V8DA 3F47A 4TRNA 5EG5A 5ERXA 4OBEA 5A4FS 5CG2A 2JJ8A 1I7NA 3GK3A 4RZUA 1NI4A 1VPEA 3LBNA 4TTQA 4H7IA 1JXAA 3RHZA 3DMHA 2CXSA 4QQNA 3U62A 3ESBA 3JQDA 1U8YA 3T61A 1P44A 1X92A 5HQ3B 5H0IA 1IBRA 5JCOA 3GFSA 1NJ6A 2XIQA 4WZBA 5U9CA 5LA6F 2OYRA 5CFLA 2ID8A 2QTCA 5CX1B 3KOOA 1AGYA 2HD4A 2D7DA 3L0IB 1NQWA 2FPPA 4Y3UA 3MS7A 5K3OA 2TMGA 2YQZA 4DQDA 1BH2A 1RDFA 2FSHA 2ZWOA 2IEGA 1R9NA 3A05A 3KWLA 5FFFA 4B5LA 5J59A 1V4VA 2R8OA 3SS7X 5TPWA 3RAFC 3D2BA 3F8TA 3LUPA 4Y30A 1JKMA 2BFWA 3EISA 3RF7A 3RRBA 4C7OA 4Q47A 4QA9A 4C0BA 4CL2A 4BUCA 4JS0A 2C04A 3QK7A 4GBED 3DFUA 5IAGA 2M6KA 3EXAA 3MTGA 5G2OA 2P6MA 3TTSA 2ZRPA 1IWOA 1JW9B 1KPHA 3WLPA 4C6RA 3HO1A 5F1OA 5DGIA 2CLHB 2E4ZA 2PL5A 1YVEI 3CT6A 1JQEA 4D3FA 2NZXA 5JISA 1R9GA 2Q3BA 3DDSA 3PLRA 4A8JA 3GEMA 3W6OA 3F4LA 4X6UA 4YASA 3FROA 1V4BA 3X1XA 2EP7A 2RIPA 3SQOA 1SKAA 4OGFA 5A7GA 3TLGA 4LVUA 3K0KA 5JANA 1PIWA 2X9VA 5E1OA 2CLCX 2DFLA 4CMEA 2V6FA 4MW9A 2NUPA 2Q2WA 3MMZA 2QTZA 3D7LA 3GZNB 1DC8A 5UKDA 1N1EA 1C4WA 1L9XA 1XU7A 3LY9A 4QREA 1N2CE 2YMPA 3CZQA 2B3DA 2ZIGA 4YC7A 3S4YA 5F2EA 3WLIA 2EZTA 1CLEA 1VZ3A 2GMWA 4D2IA 1PYDA 4WAUA 3UQZA 3G82C 1QC5A 1X14A 1WY5A 2XZLA 4M7WA 2RGBA 2O07A 3B85A 3MHPA 2O2YA 4NZMA 2Y0CA 4F9GA 2EQ5A 2NSLA 4EB6B 2NLOA 2X4GA 1EFUA 3C1AA 1BNCA 1CF2O 3CMMA 3GROA 3KVNA 1X2EA 5D5QA 5AW9A 4K86A 2CEAA 2PQ0A 3B8HA 1D4FA 3DMTA 1W94A 1PBTA 1XBTA 2PMCA 4HDSB 4HRYA 5IUKC 5AW5A 4B82A 3BWEA 2NXCA 3IDOA 3NNSA 4JCOA 1V47A 3ZU2A 1P7CA 4YV2A 5K0LA 4BQIA 3N86A 3KUXA 1VTKA 2V03A 4IMJB 4K28A 1H1TA 3ZK7A 1F8UA 1MENA 3MCZA 2XPCA 1S2MA 1QIGA 1Q3HA 3HYLA 4LDRA 4QPZA 3FTDA 1T8YA 5FPSA 1QQBA 3HU5A 1OHHD 4J7UA 4RZ2A 4BU0A 4DR4B 4DB4A 1P2DA 1RI4A 3RUCA 3SZOA 3NPMA 4ZU6X 5IT0A 2ODAA 3EWNA 5GIPE 2YXNA 3X1YA 1XEWY 4RTOA 5BV1A 3OM9A 3GLGE 2WIAA 2AD1A 4WBXC 4QGHA 1Y8CA 1H9AA 3I8SA 1CDZA 3CUTA 4KXXA 1Y4AE 1WXQA 5I4IA 1TJ4A 1Y9ZA 3P0JA 3WFIA 1ZZGA 2ZVJA 1X7ZB 2BELA 4MS1A 5COAA 1OI2A 3S2IA 2RKWA 4ALIA 4B1FA 5JNSA 4X65B 3AI1A 4HDAA 1R0ZA 1T3HA 1TM3E 4MOWA 4GPBA 3UNXA 3RYCB 2WKRA 4J1QA 7YASA 4C9BA 2QG9A 3QENA 3SS9X 4UULA 4RZ3A 3V55A 3IV6A 3CZAA 3E9MA 4YRBA 2IS2A 4PM4A 5JZMA 3RREA 1VHLA 2HSEA 1X80A 1TU3A 1BZYA 4HVLA 3LKBA 3BWXA 1QGDA 1BDMA 1E4YA 1ISIA 1GQSA 1Z7GA 1CIPA 1AZWA 1LPNA 2A1TR 2UUOA 3L2OB 1PWYE 3DO5A 1ZGBA 3ZJ5A 1W30A 2VDRB 5B3JC 1E2KA 2OO7A 5BWMA 4OPMA 3MWLA 3CWCA 4ZAYA 2BGWA 3NETA 3QEMA 5FDFA 4FXPA 1QFSA 3DMRA 2J8ZA 2GRJA 4DBZA 3QZUA 2PXXA 1N5KA 3H05A 5ECGC 1CJMA 3HI6A 1E3QA 2F43A 4MVJA 3M9WA 3PPXA 1S7GA 5HDBB 4AJKA 3SNHA 5A6VA 9LDTA 1S3FA 4YT8A 4BP1A 5JCJD 2OCIA 3HDTA 2VSOA 4TTTS 3CGWA 4XOIA 2J3QA 4WN9A 3C3EA 3R9IA 2PPVA 5J2TB 2IXTA 7REQB 4ERXA 1ICEA 4GI7A 3FVRA 4IS2A 4B9EA 5JEDA 2OD9A 2FPMA 4AMYA 4DG5A 3WBFA 1ENPA 3QU7A 3ELDA 2ZSIA 4HDRB 3T3MB 1W59A 1XJ5A 1CUDA 2AOUB 4KZPA 4RM3A 4ROSA 3RF6A 1ZOIA 1MP0A 2ORIA 2VJOA 3PITA 5DMXA 1U2TA 4KSYA 5FPQA 4UU8A 4JXXA 1SQSA 3LC2O 3LUDA 1YDHA 3QHPA 2LDBA 4HQ6A 1USGA 4KLNA 1X7XA 2A5LA 5DP1A 5EHNA 3ZGXA 1L4GA 2F4VB 2P0AA 4MS3B 4QYSA 5DHUA 3RRFA 1X1BA 1HT2E 4EGAA 1VHTA 4B3FX 4Z4FA 1ULSA 3L8FA 1KTVA 5C35A 2J6CA 4IIHA 2HREA 2VYQA 3VXKA 2QBYA 4RHEA 4YCLA 1ZW1A 3LXXA 4B3RB 4DV0B 4KUHA 3TE6A 5J58A 3G8AA 4TZTA 4CDRA 1SA0B 3JZMA 4Q4LA 1Y82A 4EL5A 4RYLA 1UWKA 3UATA 3CXUA 5F5LA 2N1BA 5BSMA 3PQ6A 5ARBA 3MCUA 4AAYA 4C2UA 1TJNA 4BO4A 1UANA 3IS3A 2E4WA 5B64A 3MD9A 1SVOA 2LCIA 1SCIA 1U5AA 2IP2A 3DZIA 3GUHA 3F4BA 4AS1A 4CGYA 3D7KA 2IVZA 2FQ1A 4KWIA 1V8PA 3GVIA 3MINB 5I7AA 3RFXA 1LLFA 4ZCLA 4UNPA 1TEZA 1BS2A 2O23A 3Q88A 1P9LA 3D8HA 2WA1A 1IQPA 1WMAA 2QL9A 1PDVA 4AYXA 4WX2B 3JR7A 2WJJA 2C2HA 1EU1A 1UT5A 4U2GA 4ZOLA 5C32A 4X7RA 3X2SA 1NF3A 2B5VA 1BE6A 2YH2A 3GO4A 4C3ZA 3B5IA 3EIFA 4DZRA 1B6SA 2WM9B 4DREA 4EGFA 1N77A 2ESRA 5EWMA 1GPMA 3DOCA 1DKNA 4PRKA 3MUNA 1Y80A 3FFAA 4MWDA 4UPVA 1VJ0A 2C4KA 3DBOB 3BGWA 2VAWA 2HKIA 1OXUA 3G49A 3AM4A 5LP6A 1MCZA 1L5VA 2OM2A 1QYWA 4OCZA 2HQ1A 3DZFA 3FHJA 3WMEA 4B43A 5IEJA 4ZPJA 1JA1A 3L0YA 4WADA 2OB1A 3W6NA 5DNCA 1XEAA 2JFUA 1GGKA 2VDJA 3HMQA 4FDMA 4AZVA 1SXPA 2I3GA 1JAZA 4YGXB 1JBQA 4R83A 4B6FA 4G24A 1RU3A 4I4TB 4CL8A 3T1YB 4MKIA 3VR0A 3DBLB 4MI6A 4OGLA 4DY4A 2IOFK 4A26A 5CM8B 3BILA 4GRAA 4FWTA 1EEHA 3GX1A 4IR7A 1U0JA 3NG1A 2I0FA 3WYGA 1M9NA 2JGMA 1N6KA 3JYNA 2OCLA 2QLTA 2Q7OE 1DBIA 5TPWB 4NOMA 4KMSA 3UUFA 5D6OA 3ZC3A 5JSKA 5SZKB 5EYPB 2AZDA 4JASB 4TUYB 4JI7B 3BIJA 5JY6A 1X1QA 2MR5A 4H59A 4L4XA 3U4DA 3AJAA 4L6IA 3WBKA 1I2AA 5DSZA 3U17A 1YMQA 4LXQA 3II6X 2EKDA 3OP1A 1J99A 3PFGA 1RYNA 2B2CA 1KEPA 1U8CB 3CG4A 5HTOA 2WSIA 4RQAA 1IZ8A 1Y3AA 3ELYA 4FR0A 4Z8XA 4AX4A 5KHLB 4I4LA 4MQEB 3QBEA 3DV0A 1T26A 3OICA 2SECE 4RHUA 5I7SA 5IDQA 4FSDA 5LBIA 3REGA 2FRDA 4INOA 4OK3A 3RFCA 3NVMB 2YWHA 2O54A 4BNWA 4C4SA 2WFLA 3U2QA 2C9BA 1KEVA 3FIUA 5ED4A 1LCIA 4QG7A 1TA0A 5HW0A 4R1PA 1FJHA 3C8DA 3HUDA 5F7OA 1MA3A 3P2EA 3S2EA 3QW2A 1C41A 1G9TA 2R7KA 3GGSA 4G36A 5EZYF 2R4QA 1WZEA 2M6LA 3TW4A 1U6JA 4CM4B 3TVDA 1N6RA 3WNZA 2OD2A 3L7NA 3NBKA 3S6JA 3K2IA 5JNTA 4LJYA 5AXBA 2IZ0A 4JROA 2FWNA 4EO4A 4BQOA 1N2OA 2Y2UA 1PUJA 1IJKA 1GLGA 4BLQA 2GZ3A 1CVIA 1MUUA 3PQDA 4C4ZA 5DI3B 1VCMA 2GPJA 5KNCA 2QV0A 5L9AA 3UAZA 1CQXA 1U9CA 2RGWA 1PJQA 3RYIA 5KNCD 2ZUTA 3RTBA 2VZEA 3ROXA 1SIOA 1UC9A 3LHFA 4UCFA 3HG7A 3REOA 1NVVR 3CEHA 4EKGA 3A3NA 4KDCA 1VG9B 4RA9B 4DA8A 1UADA 1IOZA 2CE7A 3NYIA 1Z4PX 3R5TA 2QU7A 4GFDA 4P3XA 4QXPA 1E9VA 2A14A 2WF5A 4U0JA 2CLSA 5DHFA 1YZYA 1TT5B 4MUFA 4JJKA 1UMBB 5F4ZA 1ZJ6A 3WGGA 5DI9A 5FWNA 5CD1A 3THWA 3KR1A 4MW5A 3HA3A 6REQA 3G89A 5KJFA 1ST3A 4I8XA 4CMHA 3N53A 1M1YE 2E48A 4HEHA 3WRYA 2XDWA 2DUWA 4M0PA 3HBJA 3MT9A 3SBXA 1HK7A 1JR6A 4X7MA 4DQUA 3WKEA 1G3MA 3K09A 2G8LA 3QKRA 2OZVA 3J7TA 3KXIA 2HU8A 2FY8A 3MOIA 2Q5OA 3OG9A 2R1VA 2QLFA 3OZXA 1FQOA 3VR2A 4B09A 1QR6A 4B0PA 1EXVA 3H9CA 3ZI0A 4LV8B 4ZQBA 5H80A 4B35A 1NVDA 2WICA 3TQRA 3ZV4A 1CUYA 1V9LA 3RTDA 2FR8C 4FI3C 4JITA 2QAIA 2RI6A 4GLBA 4RGQA 4DLPA 4UAVA 4EJSC 1NJ1A 1L8OA 5FBZA 1ZGAA 1AGPA 2BAGA 2Z5LA 1M8GA 4MQ5A 4R0NA 5FXMA 1XUOA 3HJBA 5BT9A 1YU6A 1CE8B 1GU1A 3WL5A 1GPJA 1F7VA 3A6GA 1ZEJA 3TZHA 1L5HB 1L4NA 5BMVB 4GSLA 2BFEB 4LOKA 1XF1A 2B9VA 4V0OA 3H2YA 4A2WA 1ZPDA 2YV2A 1DWPA 1EX7A 2BMJA 1E1KA 2XB9A 3QOYA 3GN2A 4Z8YA 2W2LD 4ENRA 1KS2A 5JTTA 4B4OA 2IS1A 4UM9D 1JQLB 1O0SA 4M37A 4P0TA 2YJ3A 2D1YA 2RAPA 5FO1A 2NU9A 4Q15A 5DK6A 4LDJA 2ROQA 3BG5A 3UGJA 4MMYB 5IT9A 4CT0A 1ISJA 2IVFA 1RRMA 5GQSA 2FR1A 2GZAA 2YWGA 4ZAVA 1RXWA 4A6PA 3QXHA 1T3TA 4PRYA 2GBPA 3B3AA 4UHCA 5CP8A 5HM8A 1PR2A 3PEUA 1U2QA 5EVCA 3B7GA 1X7WB 3AVUA 2GASA 5K5EA 5LIPA 4BCCA 1M2WA 2R4UA 4L0QA 4DCOA 4TVBA 1FNMA 3BXOA 1DZIA 3BH6A 4Z49A 2WE7A 1RC1A 3KXDA 5A4MS 1RWXA 3WMFA 1Z18A 1BMDA 3D3NA 4JDPA 5CGZA 4IAOA 1SVLA 3ZQJA 3RYFA 1ZH4A 2Y6UA 3QWAA 5AXCA 4E5UA 1FSGA 3G2LA 4KE9A 3WWZA 4BNDB 4ND8B 4AP9A 3WGJA 3BFJA 3ZJYA 2W8BB 5BNWA 1XO1A 4Y2PA 9MHTA 3D4OA 4ND3A 4Z7NB 3I6QA 4FYYA 1NW5A 4MVJM 2DCUA 3CVVA 1WW8A 5CB8A 1JR2A 2HU7A 4MPJA 1O58A 1NM5A 2CNWD 2QZ9A 5ESXA 2FEWB 3VJKA 3VVLA 1L6RA 3AR9A 2DHDA 2OHVA 1BROA 4MZDA 3SZUA 4DT1B 1V16B 4AW9A 3HYRA 5H68A 4BTVA 1VHDA 2PEYA 1TMKA 3ZDRA 5JFOA 1YZHA 1UWLA 2C9ZA 4Y2HA 3F7MA 3TJRA 1VPTA 1XP8A 3EXHA 3LDAA 4JOBA 2EKBA 1F60A 1TOAA 1E1LA 2XMSA 5FWAA 2XUPA 4QUGA 1OXVA 3QY0A 1CR2A 2H2GA 1CJSA 3TR6A 5CNJA 1Z17A 5AJHA 1A77A 2YHBA 1V11A 2WAOA 4WW0A 3W06A 4BYMA 3EGWA 2QMQA 2E49A 3GLQA 4WZAA 2VAMA 1KKLA 4ES6A 5H9VA 2BGMA 3QPUA 3UJDA 4Q6BA 5EWLB 2GF9A 3LTNC 4CT5A 2J41A 1IBKB 1RHKA 2FWAA 3QF7A 5CYGA 1QCCA 4JX9A 1YGYA 3OI7A 3ZCXA 3V3TA 5AVVA 3ILVA 1QG6A 2XSZA 2JGFA 4CLHA 1YHZA 4JVLA 1SHKA 3EXG2 5HCIA 5IJ0B 1XMOB 5CX4A 3JQAA 2HSGA 1KMHA 3HP4A 2FPUA 3V1NA 3FOEC 3DVAB 3RAGA 1QHHA 1AKNA 1QHEA 1DJMA 3PUIA 1B26A 3HXLA 4ANFA 3STUA 1P17A 3NNNA 1UOEA 2DXIA 1MD9A 3AR7A 4WK6A 5K03A 3W3AH 3V4OA 4EYGA 3GIWA 4ALKA 3F2IA 4Q7MB 2C00A 2DETA 4GLLA 5JD6A 3WBBA 4D4LA 3W2TA 1YB2A 3X1KA 5GM1A 3IVXA 4L9SA 1W2GA 4KE8A 1VYTA 2V4ZA 4PIMA 5B37A 5I9TA 1QH1B 3WYNA 4LC9A 4YRKA 4OU5A 4QWMA 4MMXB 4TYMA 2MMCA 2AFVA 2P8JA 3EGCA 3GDGA 4UAUA 2FLVA 3M4JA 3MD0A 3H5IA 2QM8A 5K3BA 2FPLA 1CVRA 5IF3A 2FN9A 1TMGE 3A06A 3OY2A 4QOJA 4E32A 3DOEA 2XCSB 3T1OA 3EPLA 4J0DA 1QIFA 5AKYA 5A05A 3MJDA 1UMCA 3NHMA 2CLFB 3SXJA 4ZYYA 2JFGA 3L7MA 3LT0A 3ZWCA 4MQLA 4KSCA 2BHLA 4G5QA 1ZD8A 4ZVRA 4RK0A 1K98A 1K97A 4COOA 5BV0A 2D62A 2VP0A 1UH5A 1ZNWA 3CUUA 4A0HA 3K0SA 5DGCA 1OU4A 2YWBA 4JMPA 2C1XA 3K5PA 1ZICA 2HDWA 3N2EA 3CZ4A 4I4TA 2ET6A 2GUGA 4D02A 5CA1A 3KPUA 2YJ4A 3VZCA 2PO5A 2FZLA 3JWHA 4KE7A 2OFFA 2AYYA 3ZWYA 2WPDD 1J8DA 3PR3A 3LG2A 1ORTA 5AQ1A 1OMOA 1R4NA 4RKRA 3RIEA 3OJEA 1UZUA 2I2AA 4A2CA 4YDSA 4KITB 4FVTA 3OSZA 4NCKA 1TUGA 2IYUA 3K2BA 3SQNA 1CQJA 1N5DA 5GVRA 4G67A 4XFJA 5K4GA 3WWEA 3LC0A 4A0QA 1UMBA 2YN0A 4AN0A 3SU8A 4CBVA 2CXOA 5KHAA 1FUYB 1A3CA 1MB2A 1XZEA 2C7QA 4RLHA 4BMXA 4JGGA 3OO0A 4IH4A 4RPIA 4U7PB 5ISMA 1FJGB 2ZIEA 1PFUA 3VNBA 7AT1A 1AKRA 4PG6A 4MEBA 4RY8A 2ZIZA 3HNPA 4XB2A 2CXQA 1JZTA 2DT8A 1V11B 4TT3D 4OYHA 1K7XB 3K6SB 4TTAA 4C0SA 4ARIA 3GVHA 3RTAA 3A9SA 4JOCA 4KO1S 1KU0A 2DFNA 3CRW1 4NH4A 2HHCA 4WK0B 4ZAWA 4EO9A 1PQUA 1AHNA 1KAHA 2D13A 2J30A 1SJ9A 1RQXA 1NFRA 3N6VA 5AVOA 3TAUA 3DOHA 1GAWA 4BNGA 3CV3A 5LCXA 4Y8VA 2X3UA 3INYA 4LDAA 2HWXA 2AMJA 2BFBB 3PX2A 3QE9Y 1XRJA 1YA6A 3HJTA 2O0LA 2W37A 4QSHA 5HIMA 2G07A 5ALFA 2OORA 2AKYA 3PDIB 5JXWA 5ER6A 1T25A 2Y27A 1F38A 4M99A 1TYBE 1AO0A 1CX9B 1UBTS 3BJIC 1SCJA 3SXUB 2BI8A 2PTGA 5FWXB 3MCTA 2PWYA 4RC9A 2ECPA 2W70A 1J8YF 3H6GA 4O3MA 2NPIA 1T9DA 5JCOC 3E9RA 2FPGA 4DCGA 5CT4A 3PJEA 5T67A 3ROKA 4P86A 1JHUA 4S3MA 5JATA 3FWYA 4EMUA 1MAUA 4ESOA 1ZD2P 3ETEA 1QV9A 1UJCA 1YRAA 2A1UB 4JGIA 4HEA1 4XJVA 4B6OA 4DMRA 3CA8A 2ZSAA 3GFQA 2GCEA 3FFBA 1FU4A 3TLYA 5AVQA 3KVRA 4S05A 5DN9A 1U9ZA 3TKAA 3RHFA 3N9IA 8GPBA 3DT8A 2ZR7A 4QFDA 2ZTVA 3BVPA 3TW8B 5LXTB 4Y6GB 1EXDA 8OHMA 3P9YA 1SUSA 1XA0A 1YNSA 2BDEA 2JVJA 5TQJA 5HJEA 1VE6A 3EDOA 2Q1TA 1J0BA 1UBSB 1IBMB 3QE3A 4EPXA 1Y3IA 4U39A 2ZETA 1I10A 2C3OA 4PS0A 1CERA 1NQUA 3QX7A 5A7FA 2XNKA 1E5LA 4HTFB 3TFQA 5TY0A 1I2DA 1G6KA 1GTRA 2GXUA 3RS2A 1KDYA 5T7BA 2W2TA 1NE2A 3FA2A 4AN4A 2XJ4A 1U3WA 4A5SA 3LTEA 2PAAA 3PXEA 3NLLA 4NYIR 1QH9A 5BRJA 2OC4A 1UEJA 2ZUEA 5I4CA 1HTTA 1T36A 1FUIA 1Z3IX 3ELWA 5CUQA 1ZM7A 4FFOA 4CLOB 2CVPA 1SY7A 2GR9A 2QSUA 3A4TA 4O4JA 1UJ5A 4ZEVA 4NX2A 5AVWA 3HVRA 2WM2A 2O06A 5D01A 1RXSA 5LQNA 4ITVA 2NP7A 4JC4A 1Q0UA 5LYYA 4RS4A 3AUFA 1HE4A 5C8YA 3VSDA 2GHQA 2GFQA 3T0FA 3TM5A 4EA7A 5EIAA 2O7QA 3QVKA 4IVNA 4MB6A 1L4UA 1KMCA 1CZLA 3X2EA 3NTQA 1UK7A 2FSFA 2EQBA 4M9ZA 4JU8A 4GYJA 2FFHA 3HB5X 5HJ2A 1TK9A 2CLOB 1JEOA 2QAGB 3E35A 4XB6B 4CV1A 4AG3A 1XJCA 1E4OA 1JQAA 3RDPA 4HWRA 2P9TA 4YCBA 3GLFB 1CEYA 1JYEA 2ZPTX 4IIVA 3T3IA 2JIZD 2QMEA 3DOFA 2VQ3A 3ZLVA 5C18A 1S2NA 3DL7A 4GC9A 3WYDA 3ZIDA 4LF4B 3NVKI 4S04A 2WJZB 3KJEA 2YV3A 5C5EA 4CCWA 4FYVA 1E1MA 3E58A 3IXMA 3JSXA 4TKLA 4YCSA 2FVXA 3RQIA 2GAJA 1GUYA 3DAHA 2Q2OA 2Z6AA 5DX8A 3NHBA 3R40A 2NTNA 3CNOA 5DT2A 2WWXA 4BNXA 3PXXA 5AJVB 4DS3A 4Z7QB 1FLAA 3VOBA 1JEYB 1M2HA 5EAIA 2FWPA 2A88A 3CE9A 5AI9A 1OC2A 1USKA 4XOUA 4NNPA 5AVUA 1RWOA 1J6UA 3RO7A 4YT5A 4KMMA 1X15A 2BMWA 3DO8A 3K5WA 4OHVA 3WL8A 4IX1A 3A6EA 1H2YA 4WZ6A 5JRZA 3HY6A 4N5DA 4UMVA 1XRLA 3PHCA 2P5SA 4QTXA 1VBKA 1M1YB 3UENA 5B4TA 1QH1A 3QVLA 3V00A 4Z7OB 1A8PA 2VRNA 3SN6A 5KYUA 3TGLA 3NTRA 3KQNA 3KQVA 3KU4A 4PAOA 2P69A 3HDYA 2Q3LA 1RWQA 1BS9A 3CEJA 1PR9A 2WF9A 1RNLA 2IQIA 4PC2A 5EIWA 1E60A 4PC1A 2F17A 4DGQA 2D6FA 2JD1A 4ZJYA 1QKJA 3PC8A 2Q6LA 2JGEA 2WU8A 4GAEA 1ZI8A 4QDOA 3EIOA 5I9MA 3MWFA 2NU8B 4NBVA 4QGAA 3TQHA 3H2SA 3KKPA 5EE5B 5FWYB 1WEKA 3I45A 3QKWA 2XYGA 4PTZA 4F45A 3HHPA 3UAOA 4CKXA 1YZVA 1D1PA 2M1ZA 5IM5A 4E33A 5IW8A 2I67A 3ZVLA 3EQ7A 2E4UA 3RVJA 3SBDA 2GWRA 1GJRA 2H0RA 3GA7A 4G97A 3RSHA 4LXGA 3ZH9B 1YC5A 4QE3A 1LF5A 1MABB 5AKEA 3RHSA 4MPPA 4RY0A 3E9DA 1V1RB 3OA0A 3QOXA 1T9AA 2TMDA 2QAJA 2IBMA 1B8PA 4GG1A 2OV3A 1ADBA 1VA4A 1XMXA 4NOLA 5ALZA 4EG5A 3NBZC 4XKJA 1UP6A 3KG2A 2PFKA 1E6LA 4Y67A 2VHQA 2ZUDA 5ARDA 3WP0A 1F51E 1WU8A 3WLMA 1JQ3A 3WICA 1X2BA 3IBCA 2C31A 4C2TA 1H8HD 3WDMA 1EK2A 2B8NA 3EUAA 4MCJA 3VYUB 1UAYA 1G5HA 4NYMQ 3AHCA 3NCHA 4K9NA 4YLYA 2RIRA 1F4LA 5K8JB 1XD9A 2DJ5A 3GT0A 4GEGA 1HC7A 1XDZA 2JGDB 3QWHA 3WKCA 3WY9A 4B2YA 1J00A 2XYQA 2JFNA 1ULBA 4MKFA 2HLHA 2YC4C 4MA5A 1DIBA 5TNXA 1QZUA 3H13A 1C50A 3UJCA 3W4KA 4TKUA 4ZCRA 2AN9A 5EESA 4DFDA 4M1ZA 1QP0A 3V7FA 4ZYVA 2P35A 3LW7A 1D04A 1Q0HA 3R23A 4GPTA 4H6PA 4JLDA 1Z0SA 3KJQA 2CFIA 4HDNA 1LNSA 1UQUA 3D7RA 4GXQA 5GWXA 3MLBA 2CLMB 3O2QB 5CYOA 3CPSA 4INJA 5CIYA 4B84A 3N7TA 1ZD3A 3SJCA 4GP6A 1RHJA 1QBGA 4S1OA 1CR6A 1NFFA 1YR8A 2G76A 1R15A 4S35A 4LWPA 2F90A 3AKZA 3PI7A 2WKWA 4Z4EA 2G0AA 1W4LA 1WB5A 3OIFA 3QEMB 4J4TA 4A82A 3AF2A 2X8JB 3E05A 4V3BA 5A9SA 1PFVA 5MHTA 4TV9F 2BEJA 4LOJA 1OZFA 4C4RA 2VHEA 1W47A 5C9ZA 4JYAB 2W58A 3Q2IA 3TDKA 5JUWA 1GNSA 3W7VA 2BGRA 4O4JB 2EJVA 3ZH2A 1IQUA 3CSUA 4P0QB 2VHJA 3O90A 3MS2A 3R7SA 5MGBA 2J3KA 1GU0A 3DQPA 3B1VA 3IX7A 4UE6A 3UV6A 1JDBB 4AK9A 1VPDA 4ZVSA 4NK5A 2BKUA 2FPWA 5E95A 1PLKA 1ZNZA 3CG0A 4DA4A 4IIJB 4LSMA 4JB8A 2WJWA 4LWQA 4NCXA 4W7IA 4K6CA 3BQNB 4FLMA 2H1RA 4OIFA 2PSEA 3HFSA 3CCFA 2WHRA 3WX0A 1HBJA 2ZPAA 1T15A 2FK7A 3CNLA 3TPCA 5C5DA 5IFLA 2VP4A 3SLKA 4TMKA 3ZS8A 1B2RA 2FGJA 3P7MA 3HFGA 1U04A 1VBFA 4FIZA 4WDQA 5B30A 3HB1A 4IMRA 4JLUA 4QHTA 5I6DA 1I1HA 4E6EA 1P75A 4GL4A 4WEOA 2D1FA 4FK8A 2RGAA 4EB0A 2A1UA 5E9JA 4ZDKA 4O2LA 4ENSA 4PLFA 4FKBA 4P84A 4F9EA 3G0HA 3SJBA 1KFEB 1G8FA 2IUFA 2PUAA 2ZWMA 3RYFB 2ZQZA 1ZRMA 2JIMA 4TL7A 4TYNA 1YBFA 1R18A 2J9YB 4MV7A 1WX1A 4K2AA 1IBSA 1NKSA 2I7DA 4NIMA 3LD9A 4ZT3A 3DF7A 2FU5C 4D4KA 1YB7A 4Y2SA 1Z4JA 2V7WA 2YXDA 3GJQA 3GMSA 5D3ZA 3HGTA 3UMMA 2MINA 3EDRA 1RJWA 1S3IA 3QPBA 2QLMA 2NU6A 4K5QA 4ON9A 2UU9B 2XD9A 3DVLA 4HGZA 5CLIA 1C3EA 3U7IA 3KEMA 4BN4A 5LLDA 3CLSC 1SB9A 4AUMA 1EQAA 2ZT5A 3GUCA 4FZ5A 4YP7A 4YT4A 4AULA 1FYEA 4YRNA 2Q9UA 2QTVA 2Z8YA 3D9QX 2Q3HA 3HSSA 4CMGA 5L4SA 5JH7A 3IURA 2RGUA 5FI1B 2RHCA 2B6HA 1BYIA 3TQCA 3LQ1A 1FRNA 4KLZA 2BJWA 2EJWA 2YWRA 1HX7A 1XMVA 2Q8QA 2WJVA 2MDTA 3NEJA 3MCAA 3QQPA 4HTAA 3JVUA 2ZJBA 3LHIA 1AT1A 5FRDA 1P81A 2E1RA 4MV9A 3ZDAA 4BLWA 4Q5IA 4DCVA 2OO3A 3BWDD 1R1DA 5BNIA 2DFKB 5BSUA 2VTDA 3BE5A 5HKBA 1CUHA 2YXBA 1KI2A 2QMZA 2X7HA 2PDAA 1M34B 1QYVA 3KS9A 3USCS 2UAGA 4NXMB 3TOCA 3TR0A 2G9NA 2FRXA 4IHKA 1X1TA 2HF7A 3EF1A 4MNTA 2P27A 2ZRGA 1JVBA 2HGZA 2K2QB 2QN6A 3CC8A 3V2HA 4EI2A 4Q19A 4PZPA 5BSVA 1XDSA 1YOVB 3B1JA 2X2PA 3ASYA 3KX2A 5IJZA 5KPJA 4DV5B 5JNVA 3H04A 3FPSA 4I99A 2YHIA 2OKCA 1DQYA 3GV0A 3HYTA 2I3AA 4MWOA 4TV9A 3UJ8A 3HEMA 2Q2VA 1BXRA 4QFBA 1KI1A 1OXMA 1ZN7A 4RA9A 2OV6A 1JV2B 3H19A 3JWGA 3OZ7A 3ZHSA 1W0JA 2ZJFA 2Q5LA 2CB0A 5BR4A 4REOA 1D4AA 1QR2A 3MMSA 5E7IA 2H6EA 4EYKA 2R85A 1YK1A 4GQBA 4BZQA 4ZCSA 2ZWAA 2BTQA 2P9CA 3QU4A 4C0AC 5SY4A 4EABA 1Q1GA 2XT6A 3HDJA 2QX7A 4U7JA 3D59A 1E9DA 2ECKA 3V8VA 4CEJA 1IRIA 2ZTMA 5F12A 2BFAA 2OO5A 1NZJA 4TL8A 3P45A 2WVGA 4UUPA 1FNSA 2WAMA 3U0VA 3V4ZA 3O73A 1GAXA 5A1JA 4DCCA 3ZK8A 1F7UA 3E4CA 4HGYA 2V4UA 4XVRA 2QPTA 1E1YA 4B3XA 4KODA 2RGNA 1TK2A 3A7DA 4ER0A 5HBRA 1LFDB 2O2GA 2G9QA 5CDGA 2H7XA 3UB2A 1KAQA 4KI7A 3C3YA 2OILA 4LF7B 1L4FA 3CZCA 3VPSA 3EUWA 4ND6A 1NJSA 4JWKA 2XXAA 1MZPA 4FGSA 4I3HA 1J2EA 2NXNA 2QPOA 4DZZA 1ADJA 1GD1O 3ZWWA 3K71B 5CTJA 1S1MA 2YW2A 2RGXA 4IW3B 3D5TA 1SUIA 4EA8A 4K6HA 2OK7A 2GPBA 3HUUA 2XA1A 3NHYA 4TSRA 5ALTA 3FSRA 4U4AA 4C6TB 2YR0A 1R10A 2V45A 3D0RA 2WWFA 4QTYA 4WNIA 2W6OA 2AKEA 1E1DA 4F6RA 4X62B 1I1OA 2PH5A 3CF2A 3NOXA 4X3OA 3MJTA 1NT2A 5EWLA 2ID7A 4FFDA 4WN3A 3RJMA 4EJ0A 3MFQA 5FTNA 1RLIA 3DZ8A 4DKXA 1Y98A 2CFSA 2NQ8A 1WXGA 1IZZA 1SHJA 5BSTA 1NBAA 3EC1A 4KEAA 3RVRA 2J3EA 3EIHA 1S96A 1QHXA 2E21A 4COKA 4DB2A 4R1SA 4CQMA 3W04A 4B79A 1B23P 4DPLA 3KHKA 3QVJA 1ETUA 3ADPA 4HAYA 3A3PA 1LSUA 3SG0A 2I6TA 4J2OA 1KK1A 3QXJA 1RKBA 4Y1RA 3UHAA 4TWZA 4N76A 1CYEA 1XZGA 3AUUA 2R1ZA 4B2PA 3EIWA 1LA2A 3DEIA 3L4BA 2JJYA 3B9QA 4UARA 2PO7A 1SAYA 2X58A 4M9CA 1YCFA 4DUGD 3PEEA 2O3QA 2RAFA 1V43A 3C8UA 3NTXA 2BVNA 3NMUF 4I19A 4ENQA 1T8WA 3HN2A 5KWIA 4RABA 1KWKA 4FZJA 4CXMA 2ZANA 2BTOA 1B74A 1YCHA 2I4RA 2F8MA 2VT6A 3STXA 1FFAA 4B6EA 1E1QD 3OT5A 4YJGA 3P2YA 1US8A 4YP1A 2J3HA 1K6EA 3GJ8A 4TPKA 3SVTA 1DINA 2EWMA 2BC9A 3AFNA 4YHBA 3ORHA 1CS0A 4G0UA 3ESQA 2I71A 4JBHA 3V48A 1DIAA 4HSGA 4I1YA 3DNMA 3C41J 2EGGA 2R5NA 5KTMA 5J4HA 1JKIA 3T5CA 3H65A 4D8WA 2QP4A 4JLJA 1XTRA 1YVDA 1D2RA 2GNAA 3E2IA 2C83A 4FGUA 4MWCA 1JEQB 2XNDD 4DIDA 4C22A 4OP3A 3QBVA 4WECA 3PEVA 2IYVA 4JOSA 5KKCA 2WW8A 4CDNA 3RKRA 1Z73A 2DQSA 4OREX 5K6RA 8MHTA 1PQ4A 4C20A 3U80A 1U7PA 2EFGA 4B4DA 2CLDX 4IIXA 4UPEA 2QT9A 3IPLA 1EVJA 1FLVA 2GN6A 2OL4A 4AI6A 3RIGA 3V32A 2FJPA 3JAMA 1QX4A 4HLUC 1CUIA 1TCVA 2O7NA 1HDZA 5E9WA 5KAPA 4E5DA 2JLQA 4GKBA 2QM0A 4Q9LA 3AIIA 1OTYA 5D7NA 1Y9DA 2AHRA 2WBLC 5JDIA 3ZTTA 4I2NA 4ENWA 5JC1A 1J4AA 3NKVA 2XCLA 4E4RA 5KBYA 4UD2A 3T3EA 2H1LA 4FP9A 2JIPA 1WUKS 2HDHA 1BDJA 1IPEA 1NXQA 3ANNA 4ID3A 4E5PA 1WMFA 4PTYA 4I4CA 4K3VA 5IKXA 1NUQA 1PTJA 2PANA 4D9HA 3AP3A 3PNPA 4QHYA 2C5SA 5L3QB 3H8VA 5T4EA 1T4DA 2G5PA 2XOKD 3BL5A 2O3UA 4GOMD 3NHZA 1E58A 1U2EA 3BDIA 1G291 2QW8A 3IUNA 4GR4A 4LGCA 1I6LA 4EF5A 821PA 3AOGA 3FZYA 4G84A 3GVXA 3GLIA 3ETDA 4K9DA 1O03A 1ZVJA 3AYZB 3F46A 5K51A 4C87A 1P2TA 1VGVA 2AQ8A 4ZA2A 2DTDA 3OURA 2ZLBA 4XD2A 3MJHA 3LKZA 1NJGA 5CH5A 2E4AA 2QJTA 1O8CA 1ESEA 3BM5A 2JCYA 5TRTA 4TKVB 2QZZA 4CMJA 1JXOA 4D9JA 4WKOA 2IYQA 4TTVA 4HN9A 3JVDA 5KJ6A 5LWHA 1K8ZB 3UJHA 1YDFA 3E3AA 1M0WA 2NX2A 4FE3A 1Z6GA 2YCBA 3OZCA 4F2HA 4ZFNA 2NSJA 2VNHA 3EN0A 1SZCA 2OBXA 3BXEA 1W5EA 2H7CA 3IDAA 3MBIA 4N1AA 2I3BA 2R2GA 3I6MA 3S0JA 3JZDA 4PN3A 1BU5A 3ZHUA 4CKEA 2ADOA 4EFMA 2DFDA 4D25A 2RHLA 4Z0PA 4FIDA 4RVHA 3QHAA 3GFVA 3VKFA 2G83A 3R5HA 1Q0SA 1RM5A 4WXPA 2A84A 4DHWA 1GADO 1EWTA 2WTEA 4P08A 3R75A 3GP8A 2EDCA 5EZ5A 2QRLA 3HFJA 1BOOA 1KQNA 1UC8A 2Q5QA 1GRVA 2X0RA 4DCTA 4F4DA 5LBTA 1BGXT 2ZTUA 5L7WA 1I5OA 5IWCA 2GZHA 4J4BA 3OQ6A 4LFCB 3KYCB 1NMQA 2NXWA 1FB5A 4P4TA 2DEUA 2IIQA 3LH5A 5BQFA 4LSGA 5FUYA 2OCGA 3CY6A 3OIYA 3M2PA 2AI2A 3BX1A 2AJCA 4CEIB 5HFJA 1GAJA 2UYCA 4LQCA 2WZBA 4WXRA 1SZJG 1M33A 3KJFA 1XELA 3PP8A 1T4CA 4JT9A 4QDZA 4C0JA 4H16A 1DKPA 1NVVQ 5JCXA 1QP8A 2E4VA 2JIDA 4U2FA 1EUDB 1YTLA 3C45A 5FP0A 3J81A 1JEYA 2JAPA 3PK0A 3ICCA 1R5OA 4XM1A 2N3ZA 5A0TA 2CJPA 4IDAA 3DL0A 1RTKA 4TLDA 4ZCIA 4FCCA 1KGSA 3QVVA 1SHZA 2CMGA 3JQGA 4MYUA 4F6CA 2I2DA 1QP4A 1UPAA 2ADFA 4XVUA 2QKYA 4G0XA 2VLIA 4L02A 4LRXA 5ELXA 3GC6A 4M7OA 3HCNA 2FH5B 1TZBA 2ZI4A 3W8EA 3VR3D 2J67A 3KKKA 3D43A 3IBYA 1NN5A 1R6UA 4RIGA 3DDNA 2IPLA 2H08A 3PJGA 3VR4H 2JAOA 3ML1A 4JIMA 3P0FA 3KLNA 3A4NA 4JEIA 4MKXA 4H35A 2W42A 3M6MD 4F9FA 4QYTA 3A3YA 5L7YA 2Y67A 1CQJB 1YH3A 3NZEA 2JPDA 2RGYA 3KZOA 3RJTA 3UUWA 4RL4A 3ZGYA 4DOMA 4HT3B 4IHJB 4DR3B 2UV8A 2C57A 1IJBA 2J3LA 2LR0A 2G36A 1XDGA 2BZ0A 2AX4A 2VYND 2YJZA 3GXOA 3P9ZA 5DWQA 3FOCA 4QT0A 2HMTA 2ZUSA 2EBUA 4ZU3A 2CLLB 3LMKA 2JA2A 4MJLA 2X5JO 4BAUA 3IEMA 5AM5A 5CNKA 3PFCA 4TSFD 4YRJA 1UKAA 4EWLA 1XHFA 2AXEA 1B8NA 1QV6A 1MW9X 3F74A 4P53A 3KIPA 1LXCA 2HPHA 2XTZA 4OXNA 4O2AB 3ZLUA 4YRMA 3QVTA 3HM2A 3I9KA 4MIKA 4PRLA 3EY4A 2BFFB 2VLBA 4KCGA 1YVRA 3DPUA 4GDMA 4ZOBA 3ZG6A 5G0UA 3ZVMA 3OC0A 2GO7A 1V3TA 2AFHB 1ZOOA 4X54A 2XT9A 2C2BA 2WTXA 4JT2A 2ZBPA 3OZEA 4AF8A 3PHJA 4E2XA 3GL9A 2P2ZA 3ET5A 4C7MA 5K0GA 2VUUA 3RNOA 5LSAA 2CMHA 4OSEA 5CCDA 1OI7A 4PZLA 2LNDA 2ZR9A 4M0FA 1JHMA 1PNVA 2WABA 4BEWA 4QDKA 3QEKA 2EKZA 3HBLA 3G8YA 1XAGA 3H6HA 4B7CA 1EJ6A 3AK4A 4IDGA 1QKKA 4NKRA 3TFOA 1HOTA 4IV0A 1PG0A 2WUEA 4PPFA 4NENB 3Q4GA 2OMKA 4RIEA 4R0MA 3PX3A 1AB5A 2NGRA 2NZUG 5DBFA 2ZYGA 4CVNA 4DMKA 3IJEB 3TEMA 1P45A 2C5HA 2Q4BA 3EGIA 3HUTA 3NKFA 4EG0A 1CUUA 3WWPA 1ZSYA 1IVNA 3CEAA 1E1CB 1DC3A 3EG9B 3I5AA 1IM5A 1N5RA 4I50F 2ZR0A 4S1NA 5DCLA 2YXEA 4YRAA 5IHPA 3MPUA 1F14A 2FW7A 1ZX1A 4P3KA 2DPLA 1K7EB 1T0UA 1NT4A 2D1TA 2X6TA 3DKRA 4XTCS 3N8KA 3NQ41 3T7EA 4O4LF 2FZ5A 2IYNA 3BGDA 3DCNA 3EMKA 1OH5A 2BMDA 2IXDA 1CZNA 3K9NA 5BW8A 4JK3A 2GJ4A 2PKRA 3DVQX 3ETGA 4P7FA 5KVAA 1E32A 1SXJB 2B98A 5LD2B 2CF5A 5DLPA 1E0KA 1H3FA 2CZGA 1ECCA 1O5OA 1ZJJA 2HSJA 2PD3A 3TEFA 2I4IA 1KI6A 3VI3B 1CULC 4P1ZA 3VI4B 3VHXB 2G77B 1ONBA 3QLTA 3ZOZA 4FHFA 5GONF 2Q4EA 4J1TA 5LQJA 3AERB 4Y6LA 4XM0A 5IVIA 2CV0A 3V6LA 3V7NA 1M5TA 2G17A 3C7CB 4Z9YA 4Z1MA 5KKAA 2QN7A 3RS4A 2H5EA 2WNIA 1OI4A 3D7SA 3DZDA 3ZE6A 1WCIA 2E5LB 3IAAA 3D8UA 2ATVA 1XL1A 3OFVA 3U3JA 4MQFB 3B5JA 1CB7A 4X94A 4G0WA 4KXQA 4FFWA 4G8DA 4ZHQF 4GLOA 1LSSA 3KSMA 1N6IA 2WKSA 3FPLA 3L84A 3GPCA 5E1MA 2DERA 1A97A 4X95A 3DV0B 4CCAA 1L5MA 3LY7A 1BWQA 3C4JA 3FPEA 3FJ1A 4HXFB 3WO0A 1HT0A 2BGLA 2R62A 4UBNA 1KARA 3DYVA 4F7WA 3NDPA 5BURA 5L3QA 3W4IA 3OAAA 2EKQA 4I55B 4KIJA 2QMUA 1WW3A 3ROMA 3D54D 5JS1A 3IIJA 4WKPA 3KD3A 4BN0A 1D6SA 1M75A 5GOZA 2H57A 3G3EA 5LR6A 4JX8A 2VWHA 1BGWA 5HRCA 3JQ9C 4FBMA 2WF7A 3CYFA 2Z2KA 4MTLA 4TKZA 3DW3X 4OM8A 2VRCD 4DIFA 4EG8A 2IBSA 1U0EA 3ABRB 3BH7A 2GEFA 3QF4A 3TTXA 4D92A 4CL0A 1L7PA 4E22A 1ODCA 3GNQA 2MMGA 2BE7A 4O8CA 4R98A 1K8XB 2FSSA 1LRLA 3T7DA 2ZYWX 4G4GA 5JD4A 2GD6A 1ID8A 1GCOA 3LPMA 4HTFA 4HAUA 1M0SA 4DRXA 3PICA 4XUGB 4GPD1 4NFYA 3T15A 4D79A 1P33A 2E89A 1IXRC 3N2IA 4I50B 3OM8A 1WMDA 3WK4A 3ZZ1A 5HQ3A 1G1AA 1VL0A 2O14A 3AHJA 3ZZTA 3SYMA 3HXPA 3JYQA 2C8JA 3DUFA 1KFJB 3JAWA 4G09A 5H83A 4FOSA 3VR6D 1OKKD 3WLHA 1EGQA 3R3UA 5KIAA 2AB0A 4RIHA 3ESCA 2N42A 2QRQA 1DDIA 4G37A 4G8CA 3BN3A 4FT4A 1KWGA 1QXSA 3O2JA 3ZCSA 1NPDA 2BW0A 3S40A 3LP6A 3BD6A 4Q3DA 1NXPA 4PBRA 2WYWA 3K7EA 4WKBA 4Y6OA 3DG9A 4JFAA 3G6KA 1RCUA 5KJCA 3QEBZ 4F8YA 3U9LA 5IG2A 1O5IA 1JBEA 4GL2A 3MZ0A 3V1TC 3K5IA 4E13A