4F60A

Crystal structure of rhodococcus rhodochrous haloalkane dehalogenase mutant (t148l, g171q, a172v, c176f).
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
290
Chain Sequence
IGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARELFQAFRTADVGRELIIDQNAFIEQVLPKFVVRPLTEVEMDHYREPFLKPVDREPLWRFPNELPIAGEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESLPNCKTVDIGPGLHYLQEDNPDLIGSEIARWLPAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering enzyme stability and resistance to an organic cosolvent by modification of residues in the access tunnel.
pubmed doi rcsb
source organism Rhodococcus rhodochrous
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 104
structure length 290
sequence length 290
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2012-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f60A00
1GPLA 2WM2A 2HFJA 3E0XA 4DNQA 4UHHA 3DOHA 1MPXA 2ZYIA 3FLAA 2PL5A 4GEGA 3WK6A 3FAKA 1DU4A 5HKAA 2YXPX 3IUJA 3H2KA 3G02A 4Y2QA 5AI9A 1MNAA 2C5GA 3WYNA 4AN0A 1GPKA 2PSFA 2XQJA 2HA5A 3BE8A 3YASA 5AI0A 3HLKA 1DTEA 4INZA 3EQ7A 5AJHA 3U1TA 5FDFA 4FOLA 4DTCA 3PI6A 1CUCA 5D3ZA 2XMBA 1XZKA 4CCYB 1W75A 3W9UA 1SCQA 4Y2VA 3PFCA 4F0JA 5K3DA 1XZEA 3OPMA 3DLTA 3O95A 3B3QA 2QUBA 2Y2VA 1R1DA 2DHCA 5AK3A 3SK0A 1YB7A 1UK9A 1TCCA 1B41A 2E3JA 3AFIA 3PUHA 3DCNA 2OQVA 2Y1KA 4OD0A 5AKZA 3GFFA 3HSSA 3S8YA 1E3QA 4F60A 1DWQA 1QIMA 2XUDA 3G9XA 5ALLA 3RARA 3QMVA 4B0OA 1TKRA 2XMDA 3HABA 1AGYA 4UBOA 1CUSA 1CUAA 2J4FA 2VA9A 4H7DA 1N5MA 2WFLB 3WI7A 3MUNA 3K6KA 4BZWA 1UZAA 4YASA 4XJVA 3AIKA 3O4JA 4H0CA 2ZVDA 5AM2A 3BXPA 3FWHA 4FDMA 1XRQA 5DLPA 3BIWA 1AMNA 3WWPA 4FHZA 2OCLA 2WIGA 2ZYSA 3FYTA 4WFIA 1K5PA 1QGED 2XMGA 4BDTA 3M83A 3I1YA 2QT9A 3DEAA 3M82A 4DMCA 5LZ8A 4XIIA 2JEYA 5AI6A 2EDAA 4ETWA 3WWCA 4CG2A 1HDEA 2VAXA 4PNZA 3BDIA 1UKBA 5CBKA 3IULA 5CT9A 4W1QA 1LPPA 5KWIA 1WB5A 3KDAA 3F67A 2PSEA 1XZMA 4EUSA 5FRDA 1MAHA 1QIHA 1R4ZA 4GECA 1AC5A 4Q3KA 1R9MA 2GBCA 1VXOA 2XUOA 3OOSA 3FCYA 5FXMA 4Q82A 1WPXA 3EF3A 1ETHA 4B84A 3WL5A 1JT2A 5ALZA 5K3FA 4QLAA 2VEOA 1E8MA 2VJDA 2X8BA 1QZ3A 2FJPA 1CRLA 2P8SA 5H3HA 4J0JA 2BJHA 1CUBA 1QTIA 5I9IA 1SCIA 3V48A 2OCIA 5F4ZA 2Y6VA 5DYYA 4ITVA 2HDWA 2OCGA 2PSDA 1XZLA 2WU3A 4HXEB 2CKMA 4M0MA 2WFMA 4JUIA 1ZICA 2HIHA 2H7YA 5ALQA 3R3UA 1DX6A 1JKMA 4JNCA 4MXDA 2JF0A 5AM5A 4MWSA 2H7XA 1ISPA 4N8SA 3WL6A 1YAHA 4CG1A 4HAIA 3WK4A 4P9NA 2QRUA 2B20A 3L1JA 3NUZA 2HADA 2OGSA 4PQEA 4PV7A 3D2BA 4W1SA 2ACEA 3H19A 5YASA 4QA9A 2PSHA 5CXXA 5ALDA 5HF8A 2EDCA 1XKLA 5E4YA 5LKAA 5JARA 2XMCA 2OGTA 4N5IX 4KE6A 1JJFA 3I1IA 2ZYRA 3E4DA 4PW0A 3K9BA 3G9ZA 4EY5A 2XUIA 4GW3A 5LZ5A 3TGLA 3C6BA 2XUAA 3AZOA 4JYMA 4EBBA 5AI4A 4BB0A 1IUOA 1C4XA 3LLCA 2BUBA 2G4LA 3ESCA 4AB1A 3STUA 4WDRA 2XMQA 2Z8XA 2X5XA 2CB9A 4N5HX 4X90A 5CW2A 2PSJA 1CV2A 5AK6A 4Y7DA 5J3JA 3C43A 3VVMA 5KBYA 4UHEA 4OU5A 3VVLA 2PUHA 4UFNA 1QIDA 2WJ4A 3DJYA 1MTZA 1DQZA 5AI5A 3KWJA 4X95A 4BTLA 5AKXA 1J2EA 3CXUA 4Y2RA 2CJPA 3IUMA 4BVLA 5IKXA 4F21A 2OLEA 3R3VA 1QIFA 4J0HA 4BAUA 1LPNA 5A71A 3SWWA 1J1IA 2BAGA 3ED1A 3O0DA 5CURA 3DD5A 3F96A 2R8BA 4UBNA 2OQIA 5E4JA 4UBMA 4L72A 2VT7A 1R3DA 3D2CA 5FPQA 4XX1A 1A88A 4DNFA 5FV4A 1LPSA 2JBWA 3ZLUA 4A5SA 1X2BA 5LZ2A 3WKBA 3I6ZA 1YR2A 3O4GA 4FLFA 5HF6A 3H0CA 5T4HA 2AJ8A 1ZGBA 1E5TA 1W6RA 4QWWA 3IDAA 1R9NA 1USWA 5AKKA 2WJ6A 2ONCA 3C5WP 2ZSHA 4DSZA 2XQKA 3HZOA 3OC0A 1W1IA 4BAGA 4E14A 1XRLA 5HQ3B 4UPDA 1VLQA 3STTA 1VZ2A 4OUKX 1ZD2P 3D4LA 2BGNA 1THGA 4X71A 5AKEA 1BN7A 1A8SA 3I2FA 1ZI8A 5AKJA 6YASA 1QIKA 2ZSIA 3WWOA 5K3AA 3CCBA 3H2GA 4NS4A 2Z3ZA 3PFBA 4J0GA 3DYVA 4FFWA 4KE7A 3DYIA 1EB8A 1NU6A 3WZMA 4QDTA 3LIIA 2PBLA 4YK7A 5EFZA 3WJ2A 4K6KA 4B9EA 1ORVA 2XDWA 1EB9A 3AUKA 5DYWA 1XQWA 4K2AA 4KAJA 1MX5A 3KSRA 4FNGA 1H2YA 2B4KA 4DMHA 4PSUA 1YA8A 2K2QB 4C88A 4B7ZA 1P0PA 4G8DA 2AJCA 2HFKA 3R40A 5ALPA 3BIXA 3WKCA 3FVRA 5ALRA 3H2JA 3A2MA 3G0GA 1BE0A 5JASA 1CQWA 3NWOA 3TJMA 5EGNA 3I2IA 1BS9A 4BRZA 1AURA 2YYSA 3O9VA 1UK7A 1QO9A 4U2BA 4J7AA 4UBKA 1OILA 2C0PA 1QIJA 5EI5A 4OB7A 4X00A 1MJ5A 3UUEA 1GPNA 3VXKA 4WDQA 3L1HA 4W1RA 4X94A 2BCEA 4BCBA 4YX9A 2QXUA 2XI4A 3H18A 1RWQA 1NX9A 1MX9A 2WIDA 3C8DA 1O6FA 2ECFA 1EDBA 1L7QA 3QPCA 5LYYA 2VQ6A 4FWBA 3U0VA 1CUFA 4KRYA 3VJKA 1QIIA 3AZQA 5C81A 4EY4A 2AJBA 2GYWA 3WL8A 3ZPXA 4KACA 3I6YA 4G4GA 5CH8A 4BDSA 3IB3A 3STYA 2XQGA 4CI9A 4BVJA 2XUHA 2JGKA 3IA2A 3QBJA 4C4YA 2XQIA 4KYVA 2W22A 3HI4A 5A7HA 1K6EA 4H7JA 3QITA 4ZWNA 1QOZA 2XUFA 1YCDA 2PVSA 5IVIA 3RKSA 3MUOA 5AICA 3DDUA 2PPLA 1QIEA 1WHTA 1CUIA 4WY8A 3QVMA 4LXHA 2J3QA 5SYMA 4GWLA 1A7UA 5CTAA 3HEAA 3D2AA 4C01A 2YH2A 4BVKA 3N2ZB 4NMWA 4CCYA 4Y2YA 4KR0A 3KOOA 1FSSA 4BYMA 4K6GA 4JH0A 4LXIA 3CCCA 3VJMA 3FSGD 4MJ3A 2HU5A 1Q83A 1VA4A 4CFSA 2B9VA 4KJXA 4AMZA 3RK4A 2B61A 1CIJA 2AXEA 1BCRA 5I7UA 5HF5A 2GBGA 5IH7A 4OPMA 4I4CA 1O6GA 4C6HA 1Q0RA 1A8UA 2VJAA 1N1MA 4TPKA 4P92A 4J0IA 3PUIA 4Q34A 1CEXA 1PFQA 1XRNA 1EK2A 5AOCA 4BP9A 4BCCA 1B6GA 2XLCA 2OAEA 1R50A 2RGUA 2JGIA 3LS2A 3WL7A 4G8BA 4RPCA 4X91A 1W52X 3PF9A 1UOQA 4RGYA 1Z68A 4QDXA 4FNMA 1J06A 4UUQA 1G4HA 4NVRA 1XFDA 4KE9A 3FVTA 3IBTA 2GBFA 5K3BA 3IIIA 3WYDA 4HVTA 5FPPA 1ODCA 3D0KA 2HA2A 4OB8A 3QH4A 1HL7A 1LBSA 4QZVA 1PV1A 5SYNA 4WJLA 4ZV9A 1BRTA 4DNPA 2O2GA 2X76A 4H7HA 2DQZA 2WILA 2DCMA 3HACA 1QO7A 4B80A 1EDDA 1EXWA 5JAUA 1TCAA 4GLBA 3DOIA 5T4EA 2WG2A 4W1PA 2VAVA 3WIBA 1XQYA 2Q0XA 1FJ2A 1GKKA 3T52A 4PSCA 3I2HA 5JZ9A 5BWBA 2BFNA 2WJ3A 2VATA 2QR5A 1H2ZA 3R0VA 2XE4A 3W06A 1CQZA 5AP9A 4BATA 5CH3A 5C8VA 1DT3A 1CR6A 4N8DA 3P2MA 5D6OA 3VDXA 2QVBA 5DJ5A 5BV7A 3FYUB 3EBLA 4E11A 5DTJA 2GYVA 3R3XA 1P0MA 2WHRA 1ZGCA 3A6ZA 4HRXA 4Q05A 4FKBA 2ZJFA 1MNQA 1N5RA 4BP8A 1XZHA 1EH5A 5C8XA 4UFOA 1QIGA 3HJUA 4FLMA 5AIAA 4MQMA 3GELA 4Q1VA 5JADA 2XT0A 2O7RA 2ROQA 5ALHA 2HA3A 5ALNA 2QTBA 5JAOA 2G5PA 4WCVA 5K5EA 1YAJA 4M0EA 3IVMA 5LZ9A 5CMLA 1T2NA 4B83A 3FSGA 4H77A 4HS9A 4CIAA 4XVCA 1HQDA 2WQZA 5HK8A 5K3CA 4G4JA 3UMJA 4ARBA 2JIDA 1XZJA 3SC2A 1AQLA 2CMFA 5DNUA 3G9UA 4IH1A 1UKAA 2WU4A 3ZI7A 3GUUA 3KD2A 1XRRA 3O4HA 1U2EA 4GI1A 1U65A 1FFCA 3D3NA 3H17A 3WK7A 3PICA 2QJRA 5KREA 1WOMA 3OTQA 4N8EA 4X85A 4RE5A 2BUCA 2ZJ7A 1VA5A 3N0TA 3D5EA 1JU3A 4DIUA 1SOMA 1SFRA 3E3AA 1QONA 5D7BA 4BC0A 4C89A 5EHQA 2BGRA 2WKWA 5JZSA 1Y7IA 1XLUA 4UFPA 4B9AA 3RLIA 1G66A 3STWA 3QMMA 4DM7A 4I19A 4H7IA 3DKKA 4EY7A 4OU4A 5LP1A 3C5VA 4I3FA 5EHZA 5A7GA 2HRQA 1CUEA 4DLNA 2OPHA 1YASA 3ZWQA 1JU4A 4LYDA 3BF8A 4MWTA 2Y6UA 5BOVA 4J0DA 5AKLA 3KWFA 5AO9A 2HA4A 3FCXA 3IURA 3G8YA 4J03A 1XQVA 1YS2X 1KU6A 4AZ0A 5ALSA 1LLFA 4ROTA 3ICVA 3D59A 1X2EA 2VF2A 2D0DA 2DFPA 1SCKA 4ZXFA 2VT6A 1QE3A 4C87A 3ICWA 5CT5A 2FJ0A 4S0XA 2BUAA 2ACKA 2WUGA 2V9ZA 5K3FB 5ALEA 4DNOA 1CUJA 5HQ3A 3WA6A 1UT6A 1XLWA 1CUZA 2VSQA 1GZ7A 3LIPA 3O9MA 2HU8A 5ALTA 4A16A 4AN1A 5JATA 5HFNA 2VJCA 1KEZA 4X6XA 2JGEA 3ZLVA 5EIHA 1HLGA 2QXTA 4FBLA 3AIOA 1HKHA 2WHQA 1CPYA 3QMWA 2WIKA 2CUTA 4AO8A 1DWPA 2PU7A 4OB6A 2PUJA 1TAHA 1G5FA 4Y2SA 2C4HA 1FFEA 2XMRA 2OG1A 2HA6A 2HHAA 4PF1A 4G9EA 4U2GA 1ACLA 4X97A 1ZD4A 4UBIA 4B85A 2Z5GA 3D7RA 4HTAA 4FBMA 2QM0A 1OXMA 4C4ZA 4Y2UA 1R88A 3LCRA 1WB6A 1TQHA 1WB4A 1HBJA 1C7IA 1XZCA 5AK4A 5EIEA 3LP5A 2XLBA 1GKLA 2O7VA 4ZI5A 1MT3A 4FFVA 2WLSA 3Q0TA 5CH5A 3BDVA 1EHYA 1ORWA 4JEIA 1UFOA 2I3DA 3A70A 4MQLA 4PO3X 1EK1A 5AOBA 3G7NA 1EVQA 4IH4A 1JJIA 4J3JA 2GBIA 2O2HA 5CRIA 3PE6A 3F9CA 1A8QA 3H2IA 1F8UA 3ANSA 4UBLA 1F0PA 2WTNA 2WUEA 1CLEA 3F97A 3WK8A 1CUDA 3I2GA 4G5XA 4Y9SA 4W63A 5C8ZA 3QYJA 3UUFA 3ESBA 1FFDA 1E66A 3T4UA 4X92A 2YASA 3EIOA 3H1AA 1MAAA 2DSNA 2JGLA 2RHTA 2WTMA 2H9YA 1UK8A 1UWCA 4QDZA 4AO7A 4D9JA 1Q84A 3K2IA 4BBZA 3VKFA 3BJMA 4RE6A 1JJBA 1IMJA 4HZGA 5HFAA 4CG3A 3HXKA 1BEZA 1AKNA 4B0PA 2AJDA 3VISA 5JAPA 5ALKA 3QPDA 2D5LA 2WG0A 1XQXA 2HRRA 3WA7A 4IO0A 3R3ZA 2JEZA 3JWEA 1EINA 2XUKA 2IITA 5AOAA 2IX9A 2QS9A 4B82A 2GYUA 5T4FA 1X70A 4WFKA 5DTIA 3GBSA 3VJLA 5JD5A 1CFJA 1WM1A 2I78A 3AZPA 3G0DA 4MEAA 4U2EA 4CCWA 4X6UA 3ILSA 4L0CA 4JYPA 1GQRA 3STXA 3WZLA 5I8PA 1U8EA 3M81A 1CVLA 5JAHA 1JMYA 5T4BA 1TK3A 1RP1A 2FUKA 2OCKA 1BN6A 5ISMA 3GROA 3I2KA 1C7JA 1VKHA 2WIJA 1CUVA 4MEBA 4X93A 2RONA 4U2DA 4V2IA 4BAZA 1ZJ5A 4ZV7A 3V1MA 2QKYA 1LBTA 1LGYA 1ZIYA 1LZKA 4H35A 1T4MA 1ZD3A 4W9RA 4UBJA 4A23A 2GZSA 3G9TA 1MX1A 1AX9A 3AJAA 4YPVA 2XUQA 1GT6A 3TRDA 5AM1A 1ODTC 5JANA 3BF7A 1U4NA 5ALVA 2ES4A 5K3EA 3ZLTA 4H7FA 3I6MA 5AM0A 4AX4A 5DNWA 4BE4A 3OURA 1OCEA 2HA7A 3HC7A 1XKTA 1CUWA 3DNMA 1TCBA 5FLKA 2PM8A 5A6VA 3WK5A 1GQSA 2WUDA 4BTVA 1EVEA 2RI6A 1F0NA 1MO2A 4LXGA 4IHAA 3QZUA 1IZ7A 4OSEA 3X3HA 5CT6A 5LKRA 4EY8A 2QJWA 3PF8A 4G8CA 1IUPA 1BCSA 4LHEA 2C0QA 3FLBA 4OCZA 2QOEA 4BC1A 3WLAA 5A7FA 5EIAA 4P08A 4GXNA 4OYYA 1W76A 3BWXA 1S8OA 4B6GA 1BROA 3QM1A 4Q3LA 1I6WA 1HPLA 4QNNA 3DQZA 2WFLA 4IH9A 4E46A 5ESRA 4ZREA 3I28A 4HXFB 2I03A 4OYLA 3AILA 1XLVA 2HL6A 1QTRA 5IVDA 1THTA 4DMKA 2XUPA 3DS8A 3NOXA 1TIBA 3DL4A 5AH0A 1IVYA 2W6CX 1AZWA 4DYHA 3A2LA 3W2TA 4EA6A 2ZYHA 5LZ4A 4AMYA 1ZJ4A 3AIMA 1DWOA 5AIBA 1H22A 1SC9A 2J4CA 2Y2UA 3QPAA 5ALXA 2V97A 4ARAA 2HU7A 4GBGA 1CUUA 1WHSA 5JD6A 4ZGBA 2V98A 2PKYX 5IVHA 5CT8A 1CUYA 2C5FA 3JYHA 4DMFA 2WIFA 1XROA 4E15A 5AM3A 5DYTA 4X6YA 3F98A 4LKOA 1GGVA 1EX9A 2IIVA 3C8HA 1UOOA 4AZ3A 4BCDA 4X7BA 2QZPA 3H1BA 3WKEA 1VJ5A 4KE8A 1ACJA 1FFBA 1YS1X 2BKLA 3O4IA 3V1LA 4DGQA 1QLWA 1E8NA 4UHFA 1LPBB 4B81A 2OGZA 1G42A 5JALA 1ZI9A 2AJLI 1WPRA 1K4YA 3G0IA 2RAUA 4HRYA 3W04A 2XUGA 1YSCA 5ALOA 2H7CA 5HF9A 4TVKA 3FBWA 3WJ1A 4QWMA 5FOQA 5EHXA 4QEKA 3V1NA 4EHBA 4NZZA 3HRHA 3C6ZA 2JGJA 1ZD5A 3M3DA 2LIPA 2H1IA 4Y2TA 1XZDA 7YASA 3WKAA 5AKHA 1XZBA 1K8QA 1LPAB 2G5TA 5CXUA 1Y37A 5ALMA 1EI9A 3FNBA 1DT5A 3GZJA 5AKYA 3WMRA 4QDUA 1ZOIA 3CN9A 2WFZA 5CT4A 5E2IA 2DR0A 3EQ8A 1MU0A 3EQ9A 2Z3WA 4H18A 1BU8A 3F8SA 5ALWA 3C87A 2WSLA 1MN6A 5FKJA 1DX4A 2XMZA 3H04A 4Y2JA 4BRSA 3CN7A 3DKRA 4EY6A 4AQDA 4AO6A 5LIPA 3NGMA 3WK9A 3IUNA 3H2HA 3FOBA 1XZAA 1H2XA 1CUHA 3R3YA 4F5ZA 1XZGA 3B5EA 3E1GA 2DHEA 1JMKC 1J07A 1EDEA 4WY5A 2OAGA 5ALFA 4LIPD 5C7YA 2I3ZA 3V9AA 1ZI6A 5EHNA 1IZ8A 2DQYA 3W05A 1AUOA 4MYDA 3V1KA 4GHWA 1H23A 4EB0A 2RIPA 2XMSA 1CUXA 5AKGA 1W4LA 4U2CA 2OXEA 4AXBA 3HYSA 2C7BA 2JGMA 1LPMA 3W9BA 4Q3OA 3STVA 4ZRDA 3ZV7A 1UKCA 5AM4A 3ESAA 1XZFA 3AINA 4IQ4A 4X3CA 3G0BA 4G4IA 3Q8WA 1VE7A 5AHXA 4WFJA 5DWDA 3R3WA 4K6HA 1P0QA 5E4TA 2QUAA 4FTWA 4DSAA 2HM7A 1XRMA 5ALUA 3A2NA 3WKDA 2JGFA 1BEEA 3L1IA 5AI8A 2DHDA 5FP0A 2WHPB 3C70A 3IUQA 1PJAA 2VJBA 4J0KA 4BE9A 2NW6A 2PX6A 3DL7A 3MVEA 1LZLA 4U2FA 3S2ZA 5AK5A 3FYUC 1LPOA 4EZIA 3OM8A 5FUMA 3ANTA 5LLSA 5JIBA 5JYCA 1KU0A 4H7EA 4J0CA 3G0CA 1F6WA 4TGLA 3B12A 4L9AA 1D07A 3I2JA 2ZJ6A 2FX5A 3MGAA 5HK9A 1L7RA 5ALIA 2UZ0A 4KAAA 3WWDA 2O2IA 1YA4A 4Y2PA 2C58A 4LYEA 1NU8A 4Z49A 1VOTA 5ALYA 1FFAA 3C45A 2PU5A 4QLOA 2WUFA 4KAFA 1QFSA 4M0FA 5ALGA 4L3WA 4FLEA 4C4XA 5A2GA 5HZGA 1E89A 5HCUA 1DQYA 4CIBA 1XZIA 3C6YA 3OG9A 1UXOA 1RYYA 5D3KA 4O08A 5LZ7A 1ZIXA 4H7KA 4UHCA 2WHPA 4HXGA 4KEAA 3WWEA 1P0IA 4QE3A 3C6XA 2EEPA 2Z8ZA 2ORYA 3WIOA 3SX4A 4QDOA 5KWJA 1DINA 2G63A 1JI3A 4MYSA 2XUJA 4UHBA 5IVKA 4G1FA 3KXPA 1GXSA 3TEJA 4G9GA 1XRPA 4P93A 2CEKA 1Q0ZA 1UOPA 4UHDA 2J3DA 4GDMA 1IUNA 5HKBA 1YB6A 2R11A 5BWCA 2XB6A 3JW8A 2V96A 4K5QA 2HA0A 5A62A 4Y2XA 4KRXA 2QMQA 2VTVA 2WG1A 3WQHA 1L7AA 1CUGA 4BZZA 2GZRA 5DNVA 5ALJA 3BL8A 1LNSA 1VXRA 1TRHA 3GA7A 5AKIA 4PSDA 1ODSA 1QFMA 3R41A 1E8DA 1JFRA 4FMPA 1VZ3A 1VE6A 1H2WA 3RM3A 5JZBA 1N8SA 1WCYA 3ESDA 3FYUA 1K63A 1Y7HA 3PDCA 1M33A 2CZQA 4RNCA 2XQFA 4XWGA 2RHWA 5JD4A 1QJ4A 3FLEA 2CBGA 3BJRA 1EA5A 1UK6A
chains in the Genus database with same CATH superfamily
4LBWA 5ER6A 1MX3A 4RMIA 5FL7A 3WYEA 5BYKA 2HFJA 1P3JA 4DIBA 4PBTA 3H9BA 3O5AA 3AERA 1UPBA 3I32A 4IFEA 2V3CC 3AVYA 3Q3IA 2IX3A 4WVLA 1W2WB 3FLAA 2VIIA 4GEGA 3W1EA 3T9BA 2J41A 3F7MA 4HPXB 1L5NA 3DBHA 1QRTA 2E5LB 1XA3A 2DXIA 5AVKA 1C9KA 1PFKA 3JTEA 4M76B 2P9JA 1JB1A 3DCYA 4FCCA 4R1PA 3RTBA 1UAAA 2NACA 1QFXA 2VJMA 4NZOA 1R4NB 1MNAA 2HTFA 5A3QA 4IIBA 4JX9A 4C30A 2XQJA 2QL7A 1IG0A 2CL6X 4GOXA 3UKJA 3OKPA 4BLVA 4INZA 5AJHA 1P44A 2A9KA 3RANA 2E6KA 2GHQA 4NATA 3VYUB 4RLHA 1QK4A 3KCNA 5BN3A 2N1BA 1GYPA 5AUNB 4TZ6A 2YZ2A 1I7LA 4YREA 2XTNA 3DE3X 1ZGJA 2HWYA 1JE1A 2WWXA 3V8MA 1L7VC 4FOLA 4NZPA 1ULBA 4FMCB 4TKZA 5DCWA 4C7VA 1R10A 3CSDA 1AKVA 2EFDB 2OGUA 1JPJA 2J08A 3TI9A 2IUUA 1UZLA 1K5DA 4E2FA 1SXJA 4IG9A 4HNAB 4B3CA 4DTCA 1BVHA 1SVSA 3PI6A 4IIVA 4LVCA 1K3UB 3K73O 3M5CA 3SHQA 2A94A 4BQNA 1CUCA 1DTWA 4EI9A 3H1EA 4MCAA 5FAKA 4X41A 3P9SA 2PGIA 3I92A 1BMTA 1WEHA 4UE2A 4A6PA 3SS9X 3SY8A 1XZKA 1N5IA 4CCYB 1T8RA 2JGNA 4KH1A 4HQFA 4D41A 4EARA 3W9UA 2HMSA 2GO7A 4DJEC 4ZI7F 1Q5PA 3ID6C 3BG5A 2HGZA 5H9VA 4P98A 4TL9A 4GOLD 1GR0A 3QKWA 1DOAA 4J4TA 1IQUA 2X5KO 2ORWA 3I0ZA 1KZ1A 2NTVA 2V5AA 3QVTA 4C0LA 1V71A 1AN0A 2FP4A 3LI2A 3WNVA 4F0JA 5HHTA 1N33B 1OX6A 3DLTA 1E59A 3PXUA 5A6SB 2VJOA 5E38A 3BM5A 3ZCUA 3JARB 4GR4A 2JAXA 3EMDA 3VKWA 3B36A 1DAEA 3D6FA 5FOUA 2JFVA 1XCLA 4KN6A 3WGOA 2G72A 4RZQA 1B41A 1JAZA 5D2CA 3AFIA 1ECCA 4ZT7A 2GZ3A 2H2FA 3E81A 4L2IA 2FY8A 3PEVA 4AUEA 2ZU0C 3G8DA 1DAHA 5BQOA 2UXBB 3BUSA 3K9WA 3LSTA 3OTWA 1A9OA 3AU8A 1VE5A 1UWKA 5K8JB 2R6DA 3A37A 3PPVA 4AYTA 1X7ZA 1FZQA 4WIAA 1HV8A 3DL0A 4GLLA 2NQ8A 4F60A 3BBPA 2ZJ3A 1AK9A 1XF1A 1YB1A 1LV8A 2CVZA 1SULA 1U0NA 3QMVA 3O90A 2CFCA 3LC7O 4XRRA 3CF6R 2XMDA 3F74A 3JQCA 5IZ4A 1OB2A 1YQQA 2OP1A 1AGYA 3C7TA 2BBOA 5LDGA 4INOA 1OXUA 2PGNA 3JQ9C 4WMLA 1CUAA 1O0CA 1ULSA 2QV0A 4L5IA 4KXFB 2RGXA 5AXCA 5CA0A 3KQVA 1JJ7A 4RZ3A 1S6YA 2VRCA 4RVCA 3BD7A 4YRFA 3F71A 1PQWA 3MWGA 3P96A 1QH8B 1RKUA 4I1OA 4OSPA 4TWRA 1V1JA 3MUNA 2JFZA 2XCTB 2J9FA 1G8AA 4NCJA 1JA1A 1ZSNA 1SBQA 1QHGA 5KTYA 5HKLA 3O4JA 3UH1A 2AT1A 4EA9A 2MWMA 3BXPA 2ZW9A 4QGFA 4ZVKA 5TR9A 2OHJA 3QFRA 4WLVA 2W9XA 3FWHA 4RMHA 4CCAA 3O03A 4MYHA 1HG0A 3WB0A 1F2DA 1XRQA 3PQ2A 4C0BA 2RK6A 2FHPA 3BIWA 5NLLA 1XDWA 1WHSB 5KJCA 3OWXA 2O5EA 4WADA 4YJGA 5FFNA 1YU9A 3E2IA 5CB4A 2WIGA 2HWKA 1K08A 5ED4A 3ZD8A 1H3EA 4ZZ2A 4CFZA 3QEKA 4CU5A 3AVPA 4A26A 3BGDA 3LG2A 3L6EA 3OQMA 2RGCA 1G3MA 2OVBA 3HWX1 4OOEA 3WL4A 5KMGA 5KQSA 3M82A 2IV2X 4DWWA 4DIMA 1YVRA 2WAAA 2P4QA 1CWUA 1D2MA 3K09C 3L8ZA 3O47A 5FCDA 4A91A 3P9RA 4BO2A 4KK3A 4C6SA 2XTJA 3MJCA 5CA0F 4KPYA 3OZBA 4M6WB 2Z2XA 4BNGA 4M7WA 3QRWA 2OMEA 2VS1A 3PQDA 4MW0A 1GARA 3PFNA 1E98A 4PONA 2B92A 3ZKAA 3LC2O 1U81A 3VBCA 3BDIA 1PJTA 2WTBA 1UKBA 3AUFA 1Y5MA 3GQBA 3KYDA 2DH5A 4PTLA 4XX0A 3FKSD 3TQRA 2XCSB 1O4VA 3N8HA 2NGRA 2AKYA 2FPXA 3E35A 4OAPA 3JARA 2VEDA 3QX9A 1X1SA 2NU6A 4P33A 4AZ3B 3GJXC 4IRUB 5AQEA 5I4CA 3B8EA 2JBHA 4DCNA 1CB7A 5L7TA 1KIMA 1I4DD 1XZMA 3LT5A 3DHYA 2BDEA 1L5GB 4Z1MD 2OBNA 3GNSA 3PE4A 3CUWA 1ZO8A 1Z7EA 3C7AA 1AC5A 3DMHA 4BKOA 1A9QA 1L3BA 1I2DA 2G0NA 3OZWA 5HIIA 3V7WA 2W4QA 2J6BA 2EP7A 2XUOA 5AVSA 4B44A 2JIBA 3SSAA 1A97A 1AKQA 1D2AA 2QTAA 4BNMA 4CKWB 4GU5A 2IYFA 4Q82A 3THOA 3RT7A 1WPXA 3OCVA 3IJPA 4ID9A 3D8TA 4K81B 1ADYA 5CX1A 4YRJA 2KHZA 3QNWA 1ETHA 1M54A 4S3MA 4B84A 2ZRPA 2V7VA 4OXKA 1JSLA 3BGSA 4YPFA 5IXYA 4HQKA 1NBHA 5L7YA 5LA6A 1TUBB 4RQAA 1R2QA 2DTXA 4QLAA 2W70A 3TRJA 1YDWA 3L4BC 2VJDA 4BO1A 3S8MA 1QZ3A 2VUTA 2X8LA 1P1HA 4GR9A 3ZHYA 1AQNA 2FJPA 3PQ6A 1RAFA 3TLAA 3V2HA 2JFWA 3ETEA 3PDJA 3PR2B 1K6MA 4I66A 4RK5A 1J5EB 3E82A 4IIEA 3K9NA 2P8SA 1LXCA 4AZSA 1NT4A 4CW7A 1CUBA 3WOHA 1QTIA 5EMJA 3FTFA 3I83A 1GNRA 3EEIA 5KNDD 1SCIA 3D54D 3IP1A 3GJQA 1P4AA 1YJ5A 5HBGA 4P4LA 5F4ZA 4ALNA 4BMCA 4DSTA 4CDRA 2MR5A 3WXMA 3C3WA 1RMQA 4LTDA 5KYVA 3UJCA 1N0IA 2Y6VA 2ZIAA 3JQAA 4V39A 3TTXA 1SCDA 2P9HA 4BFVA 3WBJA 5FBLB 3SSOA 4N48A 1GZ4A 3I6IA 3MA0A 4G3XA 4C0QC 3E5HA 2OCGA 4EFNA 4EI2A 1WQ3A 2AN4A 4NEHB 2A4MA 4K9LA 5I3CA 3BTVA 5DHTA 4IXWA 1KY3A 3QMPA 4EB3A 1T29A 4CR8A 2H7YA 2BTEA 1DX6A 1W19A 2XVZA 1X80A 5L95A 6GPBA 1C9YA 3TYXA 4DR1B 4GM0A 3IXLA 3ZW9A 5I45A 2XYRA 5J4KA 2QRHA 4PLFA 2GOYA 3F4KA 3HBMA 2QTCA 3SBDA 3OHPA 5AM5A 1PEDA 1LJLA 5JCJA 2OLJA 2A9OA 1VB5A 3REQA 4CDMA 1PGPA 3WL6A 4UAJA 3URMA 2AS0A 3IT1A 3RC9A 4CG1A 3G1TA 3Q72A 1OWOA 4NBUA 2FDXA 3IUPA 4QU8A 4ZAVA 3WK4A 1PBTA 4K0KB 1H0SA 2G7ZA 2QRUA 4D43A 3JPYA 4EJSA 2LDXA 5FBQB 2B20A 3L1JA 3H5NA 4A8JB 3NUZA 2R3SA 5AVZA 2HADA 4NBKA 4PQEA 5JSUA 4PV7A 1JQJC 2BSQA 1DOHA 2ZUDA 3KDSE 3RYHB 4YT5A 4BU1A 3NTLA 3D5TA 3EMVA 2ZBQA 3ZGLA 4IM7A 3U48A 3BEOA 4BNIA 4NE2A 3H19A 1JQEA 4KDEA 4BVEA 3G17A 3BX1A 5EJ6A 1II8B 5FTJA 1ITZA 1EFCA 4MV8A 4EG0A 4B3TB 2SCUB 1UC5B 2QD1A 5HF8A 4OHUA 1FS5A 1XKLA 1Z0ZA 3AF3A 5E4YA 4EPXA 2IS2A 3WL3A 1E2LA 5G02A 1N8TA 2R6R1 3ZQJA 2OGTA 4CQLB 4WESA 1KZ4A 4X44A 2ZB3A 1KWGA 4Q6WA 4KE6A 3JVIA 4Q18A 1DQPA 5J2TA 1V7PC 2PDAA 1EM8A 1FMLA 1FYVA 3VR3A 2WNSA 4LCBA 5FUXA 1AGNA 3HRKA 3K9BA 4EY5A 1E2BA 3RIYA 4KQXA 3HB1A 1DWUA 2LIVA 4L57A 4BZPA 3TGLA 3C6BA 4O5AA 1C1HA 4K9KA 4OJNA 3E4CA 2K5UA 3A7EA 2NOAA 3ZZTA 2J0SA 4JYMA 4LYFA 3THWA 3TCXB 3I9JA 4CRWB 1WE2A 1EGAA 3H97A 1JEYB 4X1YB 4KQHA 5AI4A 5J63A 3WBKA 3AHEA 1IIRA 3GU3A 2YC4C 1QC5B 1IUOA 1UP4A 3CZCA 1JDZA 3OE7A 3LLCA 3Q85A 4I55F 3I53A 4TTVA 4ADSG 1FSFA 1XX6A 1JA0A 2EBUA 1O5OA 1OWPA 1NW9B 1U1EA 2HSDA 3FZYA 4JOBA 4YJFA 1I36A 5DB4A 3T7SA 3STUA 3I01A 1HKUA 2I0FA 2XMQA 4HAYA 2WYVA 4MUKA 3TUJC 2K7FA 1V4BA 4HZUA 1SY7A 1SQ5A 4DN6A 5LD2B 4X90A 4PHFA 2ZQ5A 2C2WA 4DV2B 5AK6A 3KG2A 4DBLC 5TF0A 5CCBA 4G5HA 5J3JA 3JD1A 1VC2A 4B3IA 1S8AA 3SKVA 4OXRA 5COQA 1SQ0A 2V4ZA 2JASA 1U6IA 4ZYTA 3VGJA 1Z0JA 3DMRA 3C3AA 2GX6A 2WPNA 1XYGA 2PLNA 2Q5FA 4O4IB 4JI4B 4KFCA 3QE4A 1Y3IA 3P71T 2G04A 2VYCA 3MWYW 3VPAA 3JD3A 5JTUA 1L5RA 4NYIQ 5CX1B 4ZO6A 2C92A 1FX0A 2BZGA 2LCQA 5IXJA 4WGFA 1JVSA 2CB0A 4ZCSA 3WXBA 1XCMA 3CXUA 3ZVNA 4KIUA 4TS9A 2WAXA 1NXQA 2P11A 1TJ3A 4OJYA 1NVVR 2CJPA 3O74A 1ZVMA 4LJ6A 4DLZA 4BVLA 3R7DA 4F21A 4OQYA 3IHLA 2OLEA 2RAPA 2Z5LA 2GZDA 5B53A 2GILA 3LY7A 3OQHA 3CVOA 2QMHA 2QD4A 2NXCA 4ESOA 3VX4A 4J0HA 3DO6A 2C3OA 1DNPA 3ELUA 2AEEA 4RVHA 4O3MA 1XE3A 1B23P 1LPNA 3I09A 3QU9A 4M9QA 2BDTA 4GOOD 1XEWX 3DYBA 4ZOLB 3RF7A 4ZKDA 1WUHS 4WZAE 2HWWA 2VXYA 4FD3A 3ZEIA 3TFOA 1ID8A 5KPJA 3GLQA 2A5FA 4DQKA 4V03A 1PR0A 3DD5A 3Q5GA 4I8DA 2OUKA 3F96A 3DMNA 5IKPA 2B94A 4UBNA 4RZXA 5LYJB 1JDBC 3LPCA 2OQIA 3HUFA 3B8HA 4UBMA 5E4JA 2HBRA 4MJXA 4C06A 4F3KA 4FHCA 4J4HA 3K0HA 2DWQA 5FPQA 2ZT6A 2Q4TA 2PUTA 1I5OA 1ZZEA 2BZ1A 4YRDA 4IFIA 2LZ0A 3VHLB 1TE2A 1NR1A 2E89A 1NW6A 4ZO9A 5TMEA 5M3BA 4IJKA 2QNIA 1XA0A 3E23A 1LPSA 3M3HA 3PVZA 5TT0A 2NU9B 1I7SB 4BNYA 1JHOA 4BV2A 2QSUA 3RGGA 1IAVA 4G9BA 4X54A 4YPOA 5JQWA 5CYOA 3S28A 1D2NA 2HEIA 3DDNA 3N87A 1K6JA 2C61A 1PLJA 2GPWA 2Q5QA 2RAFA 1LLCA 3I6ZA 4MPTA 4MO9A 3PIRA 3O4GA 2GHRA 1LBQA 3ZHBA 3NDBB 1B8PA 2GFQA 4FLFA 5CFOA 2PS9A 3COZA 4PNPA 1ZGBA 3KZXA 3LL4A 4YJ3F 1NBOA 1W6RA 2C04A 3HDVA 4BNWA 3IR5A 2P9BA 3F4BA 4QWWA 4XKJA 4BQFA 2QX7A 3MGKA 1KH2A 1DBSA 2ECOA 4I9UA 5HQTA 1USWA 2ODPA 1XDSA 3A3KA 1DHTA 5J5VA 1Z9BA 3B1YA 4ETIA 2R6AA 1FNCA 5K0FA 3T7KA 3C5WP 1Y5IA 1QP0A 3ZY6A 2RHLA 1Y34E 3C24A 3CLVA 2H59A 3D0OA 5DBOA 3SNHA 4CKEA 2QRKA 4WUVA 2O52A 4YRIA 4QPCA 4FVTA 4C1NA 4RM2A 2ECPA 1SUIA 4HB3A 3TBKA 3SLGA 1VLHA 1W1IA 1WP4A 2H1RA 4G65A 4Q00A 4TN5A 1Q0QA 2IEZA 1XRLA 5E3IA 4CEJA 2PZMA 4UPDA 4BEBA 1HYEA 1M5UA 2CNWD 3S6JA 3HA3A 1JR6A 3OPYA 5K0GA 4K40A 2C8VA 1GNQA 2OFOA 3U17A 1J23A 1Z36A 1O95A 3NAGA 2RBGA 4O33A 1T9KA 3F5QA 3H4IA 3D4NA 4M6WA 2B6HA 5B3JA 4K26A 5JCZA 1THGA 4XQGA 3EE6A 4V0ME 5AKEA 2FMKA 5EPEA 4CFYA 4H08A 4BNNA 5JFTA 3A6PC 3MILA 2QLFA 1Y3HA 2FRXA 2MYTA 1ZI8A 2G3YA 2PX2A 4NULA 3KOYA 4X1YA 3U7EB 2O5RA 6YASA 3SIPA 1PFUA 1QIKA 2HMWA 2VHEA 5FTNA 1Q74A 2VFAA 1L6RA 2R1ZA 4LI0A 3LPDA 3DBIA 1ESCA 2XBUA 2ZB2A 1H4SA 3R0ZA 1OFGA 2XPCA 4NS4A 5LWHA 3I4CA 3DYVA 3QEMA 3MWLA 1KDVA 2HLNA 3EZ2A 3L40A 1P0FA 4JLPA 4O4IA 5COAA 1WZNA 3HDTA 3VUFA 3I5MA 1J7KA 5C52B 2Q3BA 4KE7A 4EJSC 5AVVA 4FHGA 2PT7A 4IO1A 4OH1A 4DUZB 2MOKA 3OHMA 3TMKA 4QDTA 2W71A 2I4TA 1OFUX 3UA3A 3KKMA 4RTJA 2QLBA 2P3LA 1KMMA 1SJ9A 3PNKA 3PHBE 4HDKA 4K6KA 3HBAA 2GWRA 4G5GA 5EP1A 5KYUA 3SAJA 3C8ZA 4B9EA 1PK9A 5BQPA 3AUKA 3NRCA 5HQJA 1J39A 2B1IA 4NMLA 2XGGA 3A4NA 1N0HA 3FPKA 4IDHA 1KH1A 2PFGA 3K4QA 521PA 4LDZA 1SHTX 1BWRA 2Z83A 3QUSA 2ACVA 3JZFA 1KEWA 2Q46A 4FNGA 1Z74A 2B4KA 1QQ6A 3ND7A 2G80A 4AWXA 1UBOS 3ASVA 4O4HB 4G5QA 4CMIA 4PSUA 1PK8A 1A69A 3MCTA 4MB6A 5I9NA 1KI7A 1RQLA 2K2QB 2OBFA 1I7PA 3ZWOA 3HEBA 4FIZA 3QLVA 3I5UA 3U3DA 1KIFA 4KYUA 3TIVA 5CDGA 5BR1A 2B99A 3E9QA 1XU7A 3A6JA 2ZT7A 4JY7A 2XDAA 1KZHA 1E9BA 2R48A 3AHDA 4P3YA 3E1KA 2BD0A 2ONJA 4ZHQB 3JALA 3WKCA 2GD6A 2HU2A 2K6GA 3RIHA 2QVXX 3IVCA 4B3JA 3IP9A 1QTNA 3A2MA 4AWAA 2IY8A 3LUAA 3AEUA 3G0GA 3DEFA 3L0BA 1BE0A 5H81A 4R2KA 4CM4B 1G8MA 3JZIA 4F4UA 3IXMA 1ORIA 1BDMA 1IEWA 5JASA 2UZ4A 3OIUA 1CQWA 3OAAD 2CXXA 3HCBA 5EGNA 2A86A 1YS7A 2XZPA 3I2IA 5EXPA 3SX2A 1RAGA 3TL2A 3LTNC 3RC3A 2Q4DA 3GVPA 1XTJA 5FO1A 4CLEA 3IOBA 1KK2A 1AURA 4C05A 1AQIA 3OPYB 4FKMA 2PVCA 2YXEA 4RFVA 4V3BA 4EHFA 5EZSA 2PUBA 1QVVA 4G23A 3SYNA 2O8BA 1R8QA 3MS7A 5B1HA 3TLGA 1ND5A 3K1AB 4U2BA 1Q1GA 1CR1A 4PPNA 5IC4A 3MC1A 1TU3A 4E5NA 2GUGA 3H0EA 1B4DA 1LJ8A 2O3RA 4OB7A 4P7GA 3MPUA 3IT3A 3U26A 4F3TA 1ZQ1A 4YRZA 4S1TA 2ZUTA 3N7TA 1Z4OA 4W1RA 2YIDA 3VYTB 4WK2B 4YR7A 3LYAA 3HM2A 4ZDWA 1XO1A 3PFWO 2OD7A 4TV8B 1E3WA 5JSKA 1O4WA 4BLWA 4EJSB 4YI5A 1JECA 3H18A 4Z8XA 4D7AA 1Y8RA 3L1UA 4DBVO 1OLSA 2JIMA 1NX9A 3UG7A 4DABA 1EJ6A 4F6RB 3G2QA 1TRKA 2ECFA 2H3EA 3DFZA 2JLWA 1ZVKA 4L9WA 2VUSA 4MVJH 3KVNA 4O5OA 1P18A 4MSUA 2IUYA 3DM5A 5LYYA 2RGRA 3BK7A 5SZJA 2Q6IA 2ET6A 4FWBA 1Q2XA 2IYTA 4KU4A 3S4YA 4K9SA 5T57A 1UJMA 3BOSA 5L9AA 1GO2A 2FR8A 5GOTA 4KRYA 1C7RA 3V00A 1MRSA 3VJKA 4AQYB 3O93A 1QIIA 1YQTA 2PXXA 2W37A 1F4VA 1GTMA 2WNHA 2GYWA 3PU6A 4HQOA 4Q01A 3ZPXA 4RF2A 2XOKA 1FLDA 3MJ4A 4BJ1A 4LXXA 4G4GA 5CH8A 4YMSA 2CHEA 3IB3A 4MW9A 1P2DA 2FV8A 3OPNA 4IXDA 4TYPA 5KKAA 1T2AA 1NF9A 4JEMA 4BVJA 5T3UA 3ZBPA 2JGKA 4RZ2A 4DZRA 2D0IA 1S7GA 4YEDA 4QD3A 5ENVA 3ORHA 2MSNA 2XQIA 1E9SA 1QFJA 3BIJA 3OLXA 1H4VB 1V5IA 1WSWA 5C9ZA 3HI4A 1R6DA 5AJVB 1IC6A 6Q21A 1G3RA 4ZPJA 3UT6A 5CM9C 1ML3A 3GMDA 4YXWD 2VPZA 2HHCA 3A3OA 3D6HA 3JVDA 1QOZA 5G2OA 2RHMA 4ZWNA 3ZY5A 1I51A 1VI6A 3H8SA 4Z4GA 5D87A 1DX9A 1M10A 1ZSVA 4ZU1X 2JG3A 1P2BA 5IVIA 5SZHB 2INGX 2WTEA 5D85A 2A92A 3UQZA 2PPLA 3AEQA 3FNQA 1TW2A 4UAUA 1CUIA 4DMMA 2FSSA 1DAOA 4PLTA 1Z5OA 4MJ7A 3NT2A 5I48A 3VSCA 3PDIA 2I9PA 3UC9A 1WTCA 3E9YA 4HF7A 1FXWF 4UD6A 3IAM6 4B35A 4HRVA 3BAFA 4YQEA 4RTPA 4QASA 3NEYA 4NMWA 1OAAA 4M83A 4PG4A 1PJ8A 1ST2A 3SS7X 2FWAA 2B4RO 2OZLA 2YW2A 4NV0A 2FF5A 4MS1A 1J09A 4LE1A 2FN7A 4KR0A 5DM2A 2ZSDA 3BWDD 2BCJQ 1FSSA 2EXXA 3P5BA 3RV4A 1KVSA 4DB2A 1GAEO 4LXIA 1L4BA 3CCCA 5GGYA 1CJSA 1JMVA 2W0MA 5E7MA 3KPYA 3L7DA 5IARA 3RFCA 3F5MA 3F3SA 1A9RA 3VR0A 5EZQA 3DAYA 3L8DA 5U4XA 4V0KA 1NE2A 3GH3A 4TWJA 1T0UA 3F7NA 1LRLA 3I9V1 4KJXA 4YB8A 1FJXA 2C7OA 1DEXA 2FU5C 1EVIA 2X7HA 1NVVQ 3RK4A 4H4CA 2B61A 2FWRA 4AJIA 2TSYB 3PFGA 2AXEA 1NMSA 2BI8A 2R4UA 1KFKB 5DSZA 2XXAB 3C97A 3MJVA 4ETMA 6REQA 1GAQA 1JNYA 1O6GA 4C6HA 1Q0RA 4H6WA 2NT3A 2FCRA 2O05A 7GPBA 4ACBA 1XAHA 1X1EA 2H6EA 2AQHA 5EZYF 5JH7A 5HUQA 4NENA 1CEXA 1KO5A 2XNHA 1PFQA 1M6NA 1PD0A 3ICPA 1PNTA 3SR0A 4D81A 1MC4A 1NFQA 1IBSA 2IW3A 3C1TA 4KGXA 3WGQA 3DUWA 3IEVA 4KMMA 4M54A 4MPPA 3TB4A 2OAEA 1DFGA 4Y6RA 5CVTA 3WL7A 3LS2A 1N2BA 3QKSA 2PUAA 3G13A 4MLPA 1YNSA 1KC1A 1KI8A 3EJ6A 3KQLA 2UVDA 4B3MB 3RBXA 4YAKA 3AEYA 3D3WA 3NP9A 3OQ6A 1P31A 2HK9A 1IPEA 3GAMA 1EK5A 4XFJA 3ADCA 3KEFA 3O3OB 4J0EA 4MITA 1Z68A 3ASUA 4Z2AA 2I6FA 1H0HA 4YRQA 3ORQA 1FFXA 1Q20A 1X3LA 2VSFA 2NUTA 4FNMA 2VHQA 5EINA 4WXYB 5EJ2A 3OE5A 3W77A 3TUZC 3ES9A 4AK9A 3FTEA 4KE9A 5E9WA 2PKCA 4YMIA 3L7BA 1IVNA 3ZDRA 3IIIA 2FHSA 3K0EA 4UOZA 1Q1AA 5AVJA 4GUAA 1C8VB 1DQNA 1ZOOA 1M7HA 1USIA 2C3PA 1HFEL 4PG7A 4X9XA 3GP5A 4QQNA 1T35A 2WZDA 2IEDA 4H3SA 2YWJA 4BO7A 1FDIA 4JIMA 3S2EA 1PCXA 2VUIB 4AURA 3HFJA 1L8QA 1N7IA 2OECA 1MKYA 4DNPA 4EG3A 3E9DA 2JFXA 3KTAA 4FT4A 1ZL0A 2JZOA 4NYIR 4QXRA 5TE9A 3NM5A 3L1KA 3TNDA 3I4LA 16PKA 2WILA 1UKVY 2QHXA 3O73A 1DAFA 1YRLA 2Q8NA 4G86A 4HAVA 5REQB 3ZE0B 2R8RA 3ZBUA 3ZWMA 1DIBA 2GXSA 2EW8A 1QO7A 2H4FA 1JQDA 1SC1A 3BFJA 4HCJA 5DN9A 1HURA 4ONEA 5E1BA 4JLDA 1W0KA 1EDDA 3TB6A 3BREA 2VRWA 1W49A 3K0AB 3R9KA 4R54A 2IC5A 1TLLA 2ZRGA 1IOLA 3T15A 3L46A 5CEJA 4EH1A 1M2EA 1RJ9B 3K8QA 3DF7A 3PNQA 4ERXA 4UCFA 3P9YA 1UP7A 2OM6A 4PY2A 4IMRA 1JB9A 1Z83A 5FTWA 5H59A 4E5MA 3K6RA 2ZAOA 4JASB 1C2TA 2GPJA 1NN0A 2W6PA 1TYAE 2QTGA 4YYEA 2GARA 4C3UA 3U44A 3V4VB 2VAVA 3T5GA 4J0FA 3IVXA 1H93A 2TMDA 3RRXA 2GASA 1YDHA 3HR8A 4RIEA 4BLSA 4PSCA 4X0EA 4KBFA 5CBPA 3UQYS 4HG2A 1Y1QA 3I2HA 3CZ5A 3QQPA 5JZ9A 3C3MA 3JYNA 5AVYA 1YZGA 2WJ3A 1RE1A 1H2ZA 5GJWC 4FZRA 3FFXA 2YV4A 5JI3E 2A5DA 3UT5A 4R98A 3TECE 3IPXA 1QHYA 3F46A 3GP3A 3LY9A 1MRZA 3V4PB 1QPZA 1KP3A 4XUDA 5F78A 2PKWA 2GRAA 4KIWA 4OV6B 2WJIA 4O8CA 1U2QA 4FJ0A 4XPIA 3ZJYA 2IZ6A 1KAOA 1DT3A 2HR1A 1TA4A 1G3QA 2J0EA 1FDRA 3VDMA 1PZMA 4I3HA 1SU8A 3GBVA 2V58A 3HJCA 1ILEA 1IPHA 1W8DA 3TLXA 1I3KA 4ICIA 4DLKA 1IUKA 2ZBUA 3RBVA 3D3WB 1G20B 2VTEA 1QHSA 3FYUB 4FSXA 3EW9A 5CLJA 3D8SA 4DKXA 5BP7A 3WRXC 1J00A 2PEZA 3OX2A 3AUUA 3TTSA 3ZQKA 1XCBA 4IEIA 3TOVA 4M7RA 3F6YA 4OQLA 4FD2A 1F60A 2HJWA 3R3XA 4IWNA 3CSSA 2WHRA 2XCRB 4D4KA 2GM3A 1ICEA 4AYXA 3KOZA 4QTUB 3FRIA 2J7KA 2V45A 4HRXA 4WL0A 3T9DA 3NV7A 2QX6A 3VA7A 3THYA 2MR6A 2CFIA 2JJ1D 3C16C 4NFSA 4E31A 2Q50A 5JAZA 1C0LA 1U0OC 2EWMA 2O0LA 1LKZA 3MWDA 4NG4A 1EH5A 3L0PA 4C29A 3KB2A 1RJFA 4QECA 4RY0A 2B3TA 2J46A 4ZQEA 4UVHA 2ZM6B 4OHPA 4IJVA 3LK6A 4IMJB 2LVBA 3V4ZA 4FONA 4D80A 4NTZA 2W2KA 4LFCB 1K2WA 4A36A 4FLMA 2XITA 4D5GA 2YWEA 4V38A 3PC3A 5KOHB 2RKWA 1W5EA 3V8VA 5FX2A 3A9UA 2VPQA 3BA6A 3EXIB 2O7RA 4M55A 5IUKC 5LQJA 4DA0A 3GFPA 1FFSA 2TRSB 2NN3C 4IMPA 2WT9A 1DC4A 2FOLA 2FI1A 4WCVA 4F1WA 4LZPA 3I0NA 1EE2A 4EG6A 5HRAA 4JC5A 3GNQA 1SBCA 1I4TD 3DQPA 3SC3A 3V1TC 4NBTA 1T2NA 5IBCA 2HHHB 3FSGA 1KJ8A 2H52A 5FORA 1BRMA 5KVSA 3QVJA 2GLUA 1Z2EA 2B5OA 2RBKA 3NC0C 3X1ZA 2QBYA 4KI7A 1R0XA 4HZIA 4QBIA 3WGYA 1R7RA 1T91A 4E7PA 3CEHA 4QXQA 5EIOA 1VIVA 3G2LA 4IJQA 5CTJA 1EK0A 5CVEA 4M7PA 3IHKA 2JNWA 4X45A 2I87A 3WP0A 2YS7A 4HBZA 1QLHA 1QPGA 4FFMA 4D9MA 4EPWA 5LR6A 1SG9A 4KDRA 4OI4A 1L5VA 4ARBA 2ZWPA 2I80A 4RFSA 5LMZA 3IBSA 4CR6A 1RHMA 2X8JB 3OZEA 1LTKA 3TTVA 1Z4QA 1TD9A 4BOYA 4IOKA 4KRGA 2H85A 2JI9A 3G9UA 1RZRA 4IH1A 1RACA 3L9WA 3ZNOA 4AW9A 2WU4A 1T25A 1CZHA 1O89A 2HMVA 3NJRA 2X0FA 4LGCA 3RVJA 4UE6A 1E5VA 4MLCA 1KYXA 3L0ZA 1ZJZA 2WZQA 2ODWA 5EWLA 1RYNA 3U7QA 4DB4A 4GI1A 1U65A 3HVUA 2ORIA 4EGSA 2Q9UA 2UDPA 3UT5B 1I4OA 2EQBA 2ATIA 4I36A 1TMKA 4HYEA 4TV8F 1VBNA 3OTQA 4JBNA 1Z28A 4JMLA 1LDMA 2KYRA 4DYVA 1U11A 2D0PB 3OU6A 2G6TA 1IG3A 2A0XA 2XT6A 4QL3A 4EAAA 2CHFA 3D5EA 1BWSA 3OT5A 1JU3A 3N7AA 1E3EA 5A06A 3TSYA 1PJ4A 3ETJA 5M7EA 2R0QC 4EY3A 3DLIA 1UDAA 4MW7A 1IJBA 3IAAA 4AI6A 2D74A 3V34A 1NTOA 3CX6A 4JBIA 1QONA 1QMPA 1G3IA 3VPXA 4DA7A 2XBMA 2PBFA 4N65A 3NGXA 3MUEA 5F3DA 4C7OA 3ZDCA 1R8XA 4LRXA 3ASZA 1IPFA 1TECE 1WMEA 3FGPA 4KREA 2BMJA 2XYVA 3L4JA 1CRZA 2CFTA 1QFYA 2HXYA 2WKWA 3P52A 1KTIA 1GXSB 1NY6A 4TXHA 2IOHA 4UFPA 2QTNA 3RLIA 2D1FA 1EVZA 3L1VA 1WCWA 2PUVA 3HCCA 4H7IA 4LFBB 1EFRD 4G24A 4AM8A 4WTOA 3IXQA 4EY7A 1GR1A 3C5VA 1CRPA 2O4UX 4TZ0A 1XTRA 2VNHA 1Y89A 2YVLA 3BH7A 4Z4HA 4CM9D 1V8BA 5AJXA 1I4WA 3CRVA 4WLOA 2HRQA 1CUEA 2ZIVB 3D8BA 5A7GA 5BUSA 1KI1A 5MN4A 4F04A 1SURA 4YJ3A 3GFVA 2O07A 4XCVA 1Z6GA 1UJ6A 1EVLA 2UZIR 3E9ZA 4MQUA 5KJEA 4BXOA 4AP5A 1J7JA 4B2YA 4J0DA 5KNDH 3KYJB 5B3LA 3FYSA 2W4MA 4EW3A 1UDRA 4CKYA 4RSHA 1ABFA 5I7FA 1YOBA 2JA1A 3MRTA 4IJWA 4MWBA 2A0UA 4B2LA 4DJDC 5AO9A 5DYGA 5IYZA 2IXBA 3QNUA 3FCXA 4ZVLA 1QP4A 1EGQA 5JO0A 4R71A 2QBYB 2POCA 1WPGA 1NXTA 2OK7A 1QG0A 1I0ZA 3GJTA 1KHTA 3NNDA 4J03A 1OV4A 5ECGC 1KU6A 4PLGA 5AW7A 1PQUA 1OYOA 3KK0A 1P2VA 3AL2A 4EHKA 3OZVA 5L7WA 1ORTA 2ASVA 2PD6A 3MGGA 1UPAA 2HB6A 2QVZX 5ALSA 1EP1B 5GV7A 4GFDA 2YNMA 3FM9A 1TUGA 3ZUPA 5JC1A 1R5OA 2Y9PB 1DXYA 1VPEA 2E2WA 3O84A 3ZU2A 5ESXA 5BUZA 2ZLBA 1YTLA 2WM8A 4EUKA 4UTNA 1JPVA 1YE3A 2AG0A 3WS7A 2C5BA 3E3NA 2WABA 3N2KB 3D59A 5JQGA 5LD2C 1ZOLA 4LHYA 4EMUA 1R6XA 3NIFB 3ORSA 4M0CA 1AUPA 4O0LA 4ZRNA 5HZMA 5K4HA 3KSUA 5C37A 2ZSAA 3RFXA 3PEFA 1W35A 1GITA 2HNKA 4L5BA 4WKOA 3TIXB 4YWJA 1FQKA 1R16A 2ZI9A 4IDQA 1KAEA 2I4OA 1D1PA 1SCKA 4H4EA 5KOHA 4PO8A 1QE3A 1QKJA 4C87A 4QULA 4BIIA 2FJ0A 1MXHA 2YNMC 4S0XA 4DMCA 1FEZA 1LF0A 4JJIA 2BRUC 3CVYA 3X1WA 1FYFA 4GZ3A 1O7JA 1GZSA 1M2KA 2VKQA 2ANCA 1XTPA 5K3FB 3RNLA 2AEMA 1NONA 1SKBA 3G2NA 5DT2A 2P0YA 5JU6A 4FIDA 3INRA 4D0NA 5CNKA 4O3FA 3RS0A 4EFDA 5C1OA 2EFHB 4MVJE 3ZZUA 1B43A 1EWRA 1ZKMA 3QEBZ 3PP8A 2IIPA 4UTPA 1XLWA 1CUZA 4EYKA 1J0XO 1M0TA 2JHPA 1GZ7A 3AESA 1I1OA 4J0QA 3TSWA 3GFGA 3M2PA 4JJ8A 5CFNA 2OZVA 3TZQA 3O9MA 1Z16A 1E5QA 4TXNA 1JSZA 2HU8A 1M76A 5ALTA 4A16A 2VLIA 4AN1A 2CZGA 4IIJF 1KFCB 3AKCA 4GMDA 2TMYA 3TTTA 2Z5VA 3B1VA 1FTQA 1KEZA 2C4MA 2ZBGA 4M98A 1Y4SA 3CT6A 4X6XA 4CV3A 4JXZA 1SOAA 1S96A 1HLGA 1C3OB 3VOTA 1JHUA 4K9DA 1HO3A 2BHSA 3H83A 4OP3A 4C6RA 1LJUA 1HTBA 2FR1A 1CPYA 2ZRQA 3NW9A 4M8LA 2I1LA 2WIKA 3CO0S 5I9SA 2PKQP 1DB3A 2CUTA 3TR0A 2ZU6A 4J3NA 2X8AA 1P5HA 5LFAA 1KSHA 3TD2A 5KYUB 2VPPA 4B6SA 3DZFA 3ZR4B 3C3CA 4BV9A 3DSRA 3DNFA 1TAHA 2X0JA 4HMPA 3OLVA 2NO6A 4OI0A 3DLCA 2GD0A 2EJWA 4RSRA 3I58A 2A3RA 4WN9B 1RDFA 3OTGA 2MT9A 2EKQA 5F5NA 1PX0A 3R77A 3OZDA 2QNBA 2PBRA 1ZONA 3O1LA 2J7PA 4TMTA 1LWNA 1RTKA 3D5QA 4Q9IA 7REQA 1M5RA 1GZUA 2WE8A 3K0AA 5BWOA 4A03A 4JHXA 3D7RA 2QSZA 4WECA 2XTZA 1MW8X 3D3KA 2PUGA 4KGZA 4DXDA 2HKIA 1D2GA 4DR4B 3HWWA 3ZDEA 3NONA 4RUKA 4Y2UA 2W2VA 1Z4JA 1Q3TA 3LRTA 5AW4A 4MV9A 5IDXA 3QFSA 1MB3A 2NO0A 3CWCA 2ZTVA 3FI0A 3HNRA 3VO1A 3LCRA 2IKQA 4I50F 4JLNA 1AB6A 1DFHA 1S2GA 3O8LA 3N59A 3ROMA 1J49A 4DLBA 3RUHA 3AG5A 3W9SA 3LKDA 1XZCA 4GSLA 3GB9A 3H9GA 5EIBD 2IZZA 4N7BA 1E3DA 1O0SA 1OTXA 2VQ3A 3KAQA 4K8OA 1CQJA 4ZVNA 3U3MA 4YJHA 3ASYA 4CE6A 2IHUA 5F2KA 5KDLA 1VLVA 4ZI5A 1MT3A 3BJEA 5JBNA 1X14A 2JKYA 3H3JA 3ODGA 4FFVA 1J22A 4WI1A 1W9HA 1J2YA 4LMAA 3Q0TA 2VP3A 3X1YA 3AM1A 2FFRA 1KZ6A 1WWKA 3EPPA 1Z29A 1RPTA 3P0FA 4JEIA 1IK4A 1E9AA 1NI5A 2HNBA 2P9FA 3NT4A 2APJA 4IDNA 4MQLA 3WYFA 3VYRB 3Q2OA 1V2HE 5J2UA 1VHJA 1ZWKA 1L7EA 1JHYA 1JKIA 1DKPA 5I9MA 2X4LA 1EVQA 2PLRA 1C0IA 2D4AA 5DI9A 1NR5A 3ODPA 3E5RA 4OUDB 3CJRA 4ZU6X 4BJ3A 2HWXA 2G77B 2X2PA 5ABPA 2CLDX 1A8QA 2CUKA 5JRJA 4BFYA 1FU7A 2FH5B 3H2IA 3UUGA 4Q9JA 1YKGA 4Y6OA 3IBCA 4BQOA 3AJ9A 3T1HB 2JA2A 3C3XA 1LC0A 1S02A 4HGPA 1KBQA 3BTSA 1F0PA 2WTNA 3FUUA 1Z0FA 2WUEA 1L8OA 2FMHA 2IRWA 5K09A 1CLEA 1MT0A 1N2CE 3FWKA 4I4TF 1XDDA 4IKEA 2MINA 5EXEA 2ZJ8A 1CUDA 3MZ0A 3N8GA 1D03A 5IJAA 1TYZA 4DQDA 3RSOA 1OC4A 5C8ZA 2CMHA 4YJGB 1ZM3A 2VRCD 1XVVA 3H4MA 1IRIA 1NPDA 1RYEA 3LQRA 4Y67A 4B7UA 2UXDB 1E66A 3DO5A 4JKIA 4FEEA 3T4UA 2XTMA 3EIOA 4BVAA 1JEOA 1MAAA 2XMPA 3HN2A 4RZHA 5CIQA 2RHTA 4P81A 1K7SN 4C0HA 4DCJA 4KWHA 3RAGA 4QDZA 3IAXA 2CMKA 4REQA 5CVCA 2OBXA 3PXGA 5I7AA 1UBSB 4JCOA 4A8TA 1F12A 4AJNA 1UMDA 4BN4A 2FVXA 3RADC 4RC9A 1UFQA 3U4DA 1IMJA 1U2SA 3MTAA 4RTKA 4HZGA 4C43A 3ZLBA 2VQEB 3OZTA 4K28A 1AB5A 2O1SA 2VHJA 1O9HA 4PCLA 2XRMA 3HXKA 4L6AA 4IRXA 5FHQA 3SYMA 3FIUA 3I5AA 3FPHA 5BQXA 4PGMA 3SD7A 4E08A 4D9BA 2Z9BA 3Q2IA 3H9CA 3JYOA 1WZ2A 3FRJA 1AD2A 1OV6A 4LSGA 4EYEA 1QS0B 2PRZA 3T7CA 1T6ZA 2DMRA 4C76A 5A9SB 4OTZA 3WJAA 1G60A 4TXJA 4HZUB 2D5LA 1NVEA 4BFCA 3AUAA 2OBYA 2GN4A 4LBYA 1XQXA 2HRRA 1MC1A 2YIJA 4KUEA 2YZNA 5DBHX 4FXPA 4IO0A 4M8KA 3CEPB 4DG5A 3TZKA 2JEZA 3GDHA 1IBKB 2HJVA 5KQRA 2J3MA 1TVMA 2JLRA 3COJA 3AX6A 1L4NA 2L19A 5COBA 1Q1EA 2I6TA 3ETHA 3JWEA 1Q6ZA 4LI3X 4MV5A 2C88A 1IY8A 4FXOA 3AI7A 2IITA 3MFQA 2V9CA 1Y80A 1QH8A 4QBTA 2IX9A 4ZAXA 4H0NA 2JPDA 2FSVC 3QI7A 2JAOA 2QS9A 4CLDA 5C46F 2JCGA 4B82A 3P19A 1HE8B 4YFYA 3HYNA 1EFUA 5FIUA 3S0JA 2YOGA 5J4VA 5A4MS 5DLDA 3GBSA 3RRFA 1NOKA 2YVAA 5T3YA 1CFJA 2NZWA 4NFHA 2VWHA 2OXTA 2QK4A 3RSLA 3WBFA 1PF7E 1JLLB 4MKZA 2O7NA 4N3CA 1L1EA 2ZCUA 3G0DA 4MEAA 4EUHA 5K99A 3W3AH 1HMYA 1X7YB 1QK3A 4X65B 4WOJA 3VVCA 3VNAA 4R2JA 3ESQA 3ZJ4A 1NL3A 1Z56C 5JXGA 4JYPA 1HNXB 1KJWA 3R4VA 1YMVA 5CB4F 2L42A 1L6IA 1RBZA 3VTAA 1GKYA 3KAPA 3W4JA 1I3MA 1F5SA 2PANA 4TL8A 5EPOA 2P9QA 3WWYA 5TS3A 1ZIOA 1VDMA 3GCZA 1RRVA 1FDSA 1SVOA 2JLBA 1EUDA 1J6UA 1WZCA 3C7KA 4C7XA 5DGIA 1S2NA 3CLUC 3LW8A 4ZYZA 3AEQB 2XA1A 5J40A 5IZCC 2J33A 4G0MA 4DPMA 3MMSA 4ENWA 3D6VA 4C5AA 1T5OA 4U0JA 1I1QB 3FHTA 3LQFA 5ISMA 1VYTA 1OGYA 2JLCA 5LA6F 2WJAA 3OOYA 1NKVA 3G2PA 4BB6A 4WACA 1NJGA 4B3FX 1IM2A 1JXQA 2GQ0A 3FFWA 2P7HA 4MEBA 4NPHA 4X93A 4ZD6A 4JYAB 1N6HA 3NHWA 3TKAA 1K5HA 4D42A 1JJVA 1ADCA 1R5NA 3UANA 4RK7A 1TZMA 4UAVA 1JFVA 3D1LA 1LBTA 1ZL2A 4BV3A 1X1CA 1KQFA 1Q17A 4LGYA 2I8LA 1M8JA 4D92A 3KQPA 4L5AA 2DVMA 2F55A 4H35A 3IDQA 4ZO8A 1ZD3A 3NETA 2X5NA 2PVPA 1LK5A 1MO4A 4G63A 5EJGA 4CV0A 2PXAA 3W2FA 1WIWA 3FFBA 5LQAA 4J49A 5IEBA 1GT6A 1HE3A 3QBVA 3LCMA 2EKZA 4KAXA 3ONEA 3SMVA 3MTGA 4ZZ1A 5IJWA 3HY6A 1UR5A 1I33A 2EKBA 2DBQA 2QF7A 3BF7A 2HIAA 1KY2A 1PDVA 2CJYA 4ZEMA 5ALVA 5JROA 5K3EA 3R9XA 2HBYA 5L3RA 3A6KA 2ZUSA 3Q7IA 4GX2A 1FS6A 2BT4A 1C5KA 2C4NA 2D3WA 2W8ZA 3DXZA 3HPRA 4TQAA 5DNWA 4AX4A 2BTOA 1QHIA 3NVKI 3PXXA 2UYOA 1WSBA 4RMGA 3AF6A 4DSUA 3FUCA 3FTPA 4F2WA 3NBKA 2QTTA 3LKZA 3MOIA 3TD9A 5FLKA 4I9NA 1QDEA 1U9CA 4HC4A 2WYOA 1UZMA 2HYIC 3KJHA 4MWCA 3ZE1B 3DAHA 4Y9RA 2PAAA 4DA8A 3CR7A 1A9XB 1PFVA 3OCWA 4HH4A 4BFWA 5KIAA 5J43A 3I39X 3WK5A 4CHGA 3GMSA 4X64B 2WUDA 5LL6P 3NMUF 2LW7A 2I3BA 3AW9A 3DB1A 3QXJA 4A27A 4LXGA 4GPTA 3PGXA 3FVVA 1T8YA 2QV7A 3AY0A 3IT2A 3QZUA 4YDHB 1O3YA 1DC6A 3N70A 4JIGA 1XRJA 5TQ0B 1U0BB 1MLDA 2AG5A 3KPJA 4O2BB 4GOND 4Y1RB 4C0AC 2NYRA 4I3GA 4EY8A 4URVR 1Y9DA 2O0MA 2VRBA 2QN8A 3ZWAA 4RADA 5I7VA 4QGAA 4TLDA 2NU7A 1KY4A 3UF0A 1PR5A 1XT6A 2VP0A 3M34A 1BCSA 1RJ9A 2C0QA 3AOGA 3NH6A 2ZE6A 4HAWA 3K31A 5DI3B 2P6RA 3OQIB 1M1ZA 1KA9H 3H7IA 3Q9SA 1HSOA 2EBWA 4OHCA 2B1JA 4OQPA 4AJKA 5TQ2A 3WLAA 1IULA 3C3JA 1EAYA 1PWEA 2EJTA 4ZOAA 5A7FA 3RYCB 1OXVA 1Y9EA 2QZJA 3E9MA 4NYJR 5K51A 5DTRA 3H4TA 2F9FA 3S55A 3HKDA 4UXJA 5TS2A 4LVOA 4B3GA 1NUSA 1Z2OX 2WF6A 1BX1A 1O96A 3QE2A 4US0R 3TR6A 2I6GA 3HY3A 3IAFA 2PZGA 1QOQB 4JBYA 1S8OA 4ZVUA 4DSOA 1P5JA 2R7KA 4GRDA 2WD7B 4NE9A 4CMIB 1HPLA 4QNNA 3UAZA 3VU8A 4F38A 1B2LA 1G9XA 3TOCA 5BWMA 4RDHA 2O06A 3DQZA 5K8IA 2R7LA 2XSZD 4J76A 3JAWB 1ZRNA 4E46A 1VKZA 3G8CA 2C5HA 3NASA 3B5IA 4WCFC 3ZY2A 2QUJA 5HUHA 4I55B 3TWOA 2O2CA 3SJUA 4ND6A 4QJ4A 3TNJA 2Q4BA 4AKSA 2VK2A 3U3ZA 2IH4A 4YMGA 4LBVA 4GQIA 2OC9A 3ENQA 1QCCA 1QTRA 2HL6A 1ZS9A 5KYWA 2C2HA 2GJ8A 2OO3A 4LX8A 1X8LA 3NOXA 5AMXA 1BYUA 5LB4A 2BOVA 3AM3A 3QVVA 5CVUA 2W6CX 1Z4PX 2VTBA 1AZWA 1ZUHA 1TCVA 5F2EA 5TQJA 4ERNA 1E3LA 1TIKA 1N6LA 1WJGA 1E79A 3AUYA 1RHUA 4K3UA 3KFXA 4MV3A 1ZJ4A 1GQOA 4KX5A 1TJPB 1DWOA 1LS6A 2J5RA 3EXIA 5ECWA 2OHGA 5SYAA 4IDGA 4RKFA 3B5JA 3MTIA 3UC5A 4E5KA 3THYB 1E9DA 1H0KA 2IE0A 1T5LA 4P32A 3R5FA 2AX4A 3HBNA 3HKBB 3K5PA 1GDDA 3N9IA 2NNWB 4B46A 2VTKA 3EN0A 2KBEA 1CHNA 3C14C 3N3BC 1I01A 2V97A 1T0JB 2HU7A 4HN9A 5GONB 3FDZA 2TS1A 4JVSB 2YHUA 2BFOA 2H06A 4AZVA 1JHXA 2J3EA 4Q39A 4DDKA 5JNTA 1GPH1 2A9RA 3OKCA 3AVUA 2C8JA 1RCFA 1Z47A 2NSYA 2QU8A 1AGPA 5F64A 4NJMB 2ZWVA 1IEQA 2GXUA 5HEKA 1PKEA 2ECQA 4R69A 3I9KA 5CLIA 4ZK2A 4ND8A 4E15A 2XW6A 1A8HA 3KTFA 4QGBA 3X43A 1AUXA 4BMOB 2ZRFA 3QVKA 4LGMA 2QY6A 1FX1A 3NHKA 2J85A 1U7HA 5FJIA 3MT7A 3LWDA 3M6IA 4G0QA 2Q07A 2E37A 1MQSA 4IOJA 4Y6GB 3RO7A 2QVLA 2QPLA 2KI5A 2XB9A 3ZE9A 4F7DA 1GZHB 3LFUA 4URFA 1OTYA 3MTEA 4CMEC 2FEWB 4HATA 4Y1GA 4IYJA 3I52A 4R5MA 3AHFA 4WNYA 4BFSA 2GPBA 4G41A 3LQYA 4F6RA 2XOKD 2WVJA 4N7JA 2IGBA 4X7BA 4BCDA 1KZYC 2GN9A 2QZPA 2YWFA 3C3BA 3DBLA 2VHWA 4RULA 3DMTA 3II6X 3SZMA 3O8DA 4C03A 5G0UA 3RUAA 4CHTA 1W36B 3GZNB 2AZTA 1JAYA 1BW9A 2QL6A 3JYPA 5HJ5A 5ELMA 5KC9A 1J0CA 4XZ3A 3RSHA 4CETA 3T9FA 4B3XA 1WDWB 1O97C 4HMQA 3VPFA 1DKNA 1UKZA 4HDMB 3SZRA 2PMCA 4QGSA 1BDBA 4OQXA 4X8OA 2QMYA 2V6JA 4JOSA 3DOCA 4RYLA 5D3QA 4CL3A 1DKLA 5TMPA 4S35A 1ZAYA 2V55B 4O4IF 2V74B 2G88A 4C7MA 3QE0A 5SZIA 3T4XA 5EMKA 1XKQA 3EZGA 3CEJA 3A4LA 1FSGA 2ZYDA 3PGLA 4YRCA 5TQ2B 1VMKA 4DRXA 5JALA 2O50A 1RXWA 4PO1A 4JJZA 3W6NA 9ABPA 3VFDA 1WPRA 2QE7A 4F85A 1XMQB 4IMIB 1KAQA 3SZLA 4RJIA 3K9LA 1ZK0A 5LN1A 2Q2QA 4O0MA 2X8JA 4OQZA 4OQEA 2GCEA 3SJBA 3G2OA 3W6OA 3WLLA 4EG4A 5A3RA 1PT6A 3ADPA 3LHDA 3GD5A 2WZCA 3SQOA 2E49A 1E20A 3CX8A 2K2WA 3HVHA 2DFTA 1PL8A 3AGQA 5AW0A 5EWJA 1DCTA 1G18A 4DDHA 3KKKA 3UJ9A 5EIBC 4NZZA 4HDRA 3OJXA 2XNCA 1MXFA 1H2RS 1L4FA 1LVUA 1NN5A 3FDZB 1K8YB 1L8LA 3SIWA 1KARA 2CCGA 1ZD5A 4D8UA 2H1IA 4BN0A 2JFOA 2WFAA 4F06A 5DMXA 3QELA 4MUXA 4R0NA 4IIXA 4LYHA 4Y2TA 2G4VA 2O3TA 2IYRA 2KPOA 3DEYX 2WF5A 1UMCA 3AUTA 1XWWA 4WEOA 5CYPA 3CZQA 4BMNA 3MHPA 3ZCRA 3QVUA 1LPAB 1VE9A 2FZKA 4ZFNA 1LLQA 3P4YA 4KSYA 1C1DB 4UQLA 4MK4A 5JC8A 2YJNA 1L7NA 3UCXA 3HPQA 3VZPA 1Y37A 2SECE 4D9KA 5CU7A 1EI9A 3N86A 4A7PA 3R5KA 4GUDA 4KGDA 5AKYA 4KXMA 3ZI4A 1MGOA 3RJMA 4RTMA 4NQZA 3WMRA 2AZ4A 5K0JA 2DR2A 2JLVA 1K7FB 3URKA 2HZBA 2XYPA 4KQKA 3CN9A 1UXGA 2POQX 1FNBA 2Q1SA 2Q5OA 4RTSA 3UJ3X 1ZHOA 4G85A 4JV5B 2DR0A 4LCJA 2GR9A 1WPQA 5AESA 1MU0A 4XQCA 4NBNA 3QEOA 3V8BA 4EUEA 1XG5A 2AMLA 2FZEA 1CY0A 1JLRA 1PIWA 2PGOA 1GGEA 4BFXA 3ROPA 4BNZA 1NNUA 5I3ZA 4YT8A 2WMYA 4LOAA 5KYNA 5ALWA 3VR4H 2FFHA 1L4GA 2D1YA 4KQ6A 1M1YA 4NJMA 2E4ZA 2PEYA 2BW0A 2BFBA 3E7DA 1KOGA 2JAPA 3H5VA 4R3NA 2J48A 4OF4A 5IZCA 5KSOA 2CVHA 2Q2OA 1SEPA 4ARIA 1YBVA 2D2EA 3BWEA 4PBSA 1Z4LA 4Y0AA 2D5CA 5C35A 2UVPB 2WF7A 2AR0A 2P4SA 5G1PA 3Q3GE 3H04A 4DEXA 3NUGA 2C1ZA 2P2DA 2ZDGA 3O83A 4FN5A 3Q3JB 1QVZA 1YXMA 4I6EA 4R1UA 4UMFA 4WXEA 1XFAA 1VFPA 3RTEA 4BRWA 4YMVA 2F67A 1YOVB 4MW2A 3UK7A 1YCFA 2AOTB 1BXZA 2DQKA 3LPAA 4D1YA 2PL3A 4I5IA 4QXAA 3BXEA 4CVNA 1JFSA 3BZUA 3H2HA 5EJMA 5ITVA 1PBNA 3FOBA 2H4YA 1XTIA 4E70A 1H2XA 1CUHA 3A4YA 4JVOA 1LVHA 2Z3VA 3E1GA 3VUEA 4Y3UA 3OAAA 1JMKC 5H3CA 4O6VA 4F4FA 4RHUA 1E3SA 1RWXA 2QUHA 3DDSA 1L3CA 1FP6A 5CA1A 4LIPD 4GMKA 3GUHA 4CPDA 4D3XA 5C7YA 2V5UA 3DKVA 3ZBTA 2GVNA 3V9AA 3M1IA 1LX6A 3W5AA 2QP3A 2WU0A 2FSPA 5DN6A 1IZ8A 1EQUA 3H11B 3G59A 3M6LA 4U6QA 1EFRA 1XA4A 1H5UA 1AUOA 2FEMA 1THZA 3U5TA 5F77A 1D04A 3R6TA 1DQSA 4FOOA 1NBWB 2H8GA 1NUQA 2PKRA 2ZSKA 3JQRA 2P40A 1OREA 5LIRA 4MKXA 2AA3A 5ERGB 3LD9A 4BMSA 3MNFA 1AK2A 4L4RA 2NO4A 1L1RA 2CW5A 3HYSA 2E48A 4MV6A 4UEJA 5HSGA 4G36A 5A4JA 2R7NA 3HCWA 4GEKA 4H31A 2QROA 3STVA 1WV0A 2V4MA 3NEPX 4AP9A 4DDVA 5GONF 5DCLA 1IHDA 3MTDA 1R0CA 3P9QA 5IH3A 1P75A 1KJNA 4BEVA 2I2WA 3K72B 5DXFA 5HVNA 1X38A 4AY2A 3DFUA 5IAEA 3WHPA 1XZFA 3N5KA 2REBA 2F90A 5EAIA 1Z2CA 1N2HA 1V4VA 3QJ5A 1V25A 5JCPA 2NQTA 3K9GA 2H0QA 1A72A 3U44B 1D6NA 5HA5A 2BN4A 4RL4A 4G4IA 2W6MA 4O2AF 1VE7A 1Z2PX 2FG7C 3ZWXA 2M1XA 4WFJA 2YFYA 1IXSB 4BS9A 3LLMA 1ZH4A 3LQKA 4FSDA 3IP3A 1H6AA 1Z4IA 1IB6A 2BGJA 4HFJA 2E4VA 4LV6A 4YJHB 4B40A 4C5CA 4Q0MA 1YGYA 1GUBA 1JG1A 1SCNE 2VAPA 3R3WA 4TWAA 2IH2A 3B3FA 2QUAA 5JJ5A 2BEVB 4OIMA 2VDUE 3EOZA 5ALUA 1P9OA 4UM5A 2A84A 3FNRA 3OETA 3WKDA 2B4AA 4HDSB 3K05A 4Q4DA 4YO8A 4RO0A 1SVIA 3OWOA 3VR4A 5AI8A 3SF8A 2NTJA 3VU9A 4O25A 3LHIA 2FSFA 2DSTA 3JD0A 4E1VA 5K3OA 1DCFA 3LT4A 2WHPB 4S1NA 3ZJTA 2QORA 5F76A 4QJIA 4J0KA 2J5QA 1EBFA 2CV1A 4YI3A 2FAXA 3CLTD 1J56A 3QA3E 4TKUA 4FYYA 5IAAA 1YQEA 4DPKA 3LT0A 3CONA 2JI4A 1QQ7A 2N75A 4RVDA 5KSZA 1JDBB 1P74A 2ZANA 1PN3A 4ZOLF 1WRBA 3GV0A 4BL5A 2O4CA 1QSGA 3B38A 1H2BA 1RAIA 4JSYA 4U2FA 3DVRX 2AHRA 1QG4A 2HCJB 1EGHA 3FYUC 4N49A 4PEVA 3WMXA 2IW1A 3DZHA 4EZIA 3BGIA 3MWFA 3ONDA 1ZNYA 3A1DA 3OSZA 1G4UR 2Z8YA 3HB9A 4GI7A 4E2ZA 1IU9A 3FDFA 3G82C 4IPTA 4UEOA 3CW8X 4X7MA 4OHKA 4TTIA 4HGNA 3DOUA 4CDNA 2FQQA 1AQUA 1F3LA 5G4LA 4AAYA 5JIBA 1MORA 5E1OA 1UP6A 2YWXA 2V1UA 2VAWA 2VKTA 2W11A 1VSQA 5JSQA 5LWQA 3C3KA 4J0CA 3CRNA 1YZYA 3TUIC 3D7NA 4IUBS 4HX9A 2HRBA 3B12A 2ZTHA 3UGJA 1O94C 5IPFA 3CF4G 4HNHA 4DCMA 5KCZA 4L9AA 3LDUA 1ES9A 2M6KA 2R8ZA 1OXXK 3CWZA 2F62A 2QG6A 3Q0IA 3ZTYA 3HJBA 1V35A 4K0RA 3SJCA 4CM8A 2ZS8A 3UZUA 1VSUA 2IYLD 1AZTA 1TO6A 5EQFA 4W8HA 4O59O 3W90A 4FW9A 1G7CA 3D3QA 3GOHA 4JOCA 2DY0A 4ZXPA 2ZRLA 3KSMA 1OBFO 2CXHA 2BGKA 5EQTA 3EEYA 1L4EA 1WW2A 4M1OA 5KYXB 4IDPA 3Q41A 4KMOA 1JHZA 1P80A 3AK4A 721PA 2C9YA 1HFWA 2O2IA 2YY6A 2R47A 2XAUA 3G5TA 2H65A 5FNVA 5CA1B 1P2UA 1O94A 2R8PA 2P9TA 2VSNA 1PW7A 2W8BB 3GQBB 1Q7GA 5CVVA 4Z7QB 5BUQA 3QX3A 1ZUNB 1RQGA 2HUNA 4ZQBA 1EXNA 4JR2A 3PE3A 3FROA 1QS0A 1ECJA 4FCVA 5IKOA 1W73A 2XYGA 3A04A 3C45A 3PWZA 3V7YA 2H4WA 4ECEA 4Z7NB 2PU5A 4PANA 2V59A 3ROQA 1SPXA 3NYRA 1OXKB 3LT2A 2N3ZA 3MJEA 3PRKE 4KAFA 1QR2A 3EEQA 4M0FA 1RRGA 1KZGB 1VLMA 3WLTA 1PNRA 5FYDA 1HYGA 3MBKA 1XN1A 1LQUA 4QQ8A 4XFKA 3LXMA 1YDEA 3QLEA 4GMHA 4C4XA 3L8FA 5IRCD 3OUTA 3SM9A 2O8CA 2Y4NA 1YULA 1E2JA 2QTLA 3NVDA 5CDYA 3OG9A 1S9DA 5DASA 2P9CA 2EWWA 4KI0A 1JFTA 3VR5A 1Q0LA 2PIDA 2BC9A 5A9SA 2W6OA 1PL6A 2R2AA 4DDUA 4IHQA 4EZEA 3K09A 2L0XA 1ZMOA 4I7EA 3SN6A 4J94A 1ZIXA 4UHCA 1NA5A 4P2GA 4J9VA 4YRRA 2Z6UA 1MIOB 3ABQB 1PJ3A 2NSJA 3NWJA 3AL3A 1V6SA 1XMIA 5LUBA 4EO4A 4GKJB 1GN8A 1JSXA 1TW3A 4RNDB 3WIOA 2J5XA 4C04A 2J4DA 3CO5A 4MUEA 2ZDQA 1JSCA 3QOXA 4XLTA 4L7VA 4CV1A 5KWJA 3BFKA 4ALLA 3EK2A 1W87A 4TTPA 4FZ3A 1DINA 1QH0A 2G63A 1XTTA 5K8CA 1BU5A 1TPYA 1JI3A 5EYPB 2CXTA 1F2UB 3W2EA 4RU1A 2VA8A 2X8WA 3D6MA 1I10A 1T8SA 2BONA 2XAAA 2XUJA 2HAEA 3AFMA 3BD8A 3KT0A 4FS8A 4YLYA 3IESA 4F86A 2X1VA 3QEJA 4OKSA 1FU8A 1A95A 2C5EA 1OVMA 2YHSA 3A0RB 1GXSA 3BRCA 2H7VA 4QKQA 3GLIB 1Y48E 3HBJA 4MYUA 1Q1BA 2Y1WA 2GETA 5EWMB 4YV1A 1XP5A 2Q9AA 4H59A 4UUBA 4MP8A 4FGUA 1FTGA 3R2JA 4N0DA 1WV1A 3TQFA 4BGVA 7MDHA 1L4LA 2RK3A 3IP8A 2A57A 1UBUS 4KW7A 3UYLA 2PWPA 1L9KA 3JQDA