4F6AA

High-resolution x-ray structure of the tetramutant of bh1408 protein from bacillus halodurans, northeast structural genomics consortium (nesg) target bhr182
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
156
structure length
156
Chain Sequence
MIIREATVQDYYEVARLHTQVHEAHVKERGDIFRSNEPTLNPSRFQAAVQGEKSTVLVFVDEREKIGAYSVIHLVQTPLLPTMQQRKTVYISDLCVDETRRGGGIGRLIFEAIISYGKAHQVDAIELDVYDFNERAKRFYHSLGMRCQKQTMELPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BH1408 protein
publication title Northeast Structural Genomics Consortium Target BhR182
rcsb
source organism Bacillus halodurans
molecule tags Transferase
total genus 46
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4f6aA00
3FYNA 4QC6A 2FSRA 4NF1A 1IYLA 2B4BA 4RI1A 5F49A 3EY5A 4ONUA 1NE9A 3EC4A 3EXNA 5H84A 2PSWA 2OU2A 1SQHA 2VXKA 4AG7A 4K30A 4XNHB 2PR8A 1YGHA 2Z0ZA 3IGRA 1I21A 5GCNA 4OADA 1QSTA 1PU9A 2IL4A 2EUIA 2VZZA 3PGPA 2O28A 1Q2CA 5KTCA 4LX9A 2PDOA 2QECA 2VZYA 4JWPA 1MJAA 4H89A 3ZZIA 1VHSA 4CAVA 4KOSA 4MHDA 3SXNA 4QVTA 3TO9A 1XE4A 4KOWA 4KOTA 2D4OA 1L0CA 4KLVA 5DWNA 4KUBA 5I0CA 1NMTA 2CY2A 2VBQA 3OWCA 3T9YA 4H6UA 3GY9A 3R95A 2FL4A 3LD2A 4AVAA 3V8IA 2VEZA 3W6XA 4AVCA 2HQYA 3DDDA 4M3SA 3N7ZA 4QUSA 1YK3A 3P2HA 1U6MA 4Y49C 4JJXA 4R57A 5CNPA 3BLNA 2WPXA 3JVNA 4L8AA 4JXQA 2G0BA 4MY3A 1I12A 1KUXA 3D8PA 4R3KA 2ZPAA 4UWJA 4R9MA 1MJ9A 1PUAA 3R9GA 4B5PB 3FIXA 5F47A 2P0WA 3D2PA 1YREA 5EBVA 1N71A 2GANA 3VWDA 4KOXA 1MK4A 1OZPA 2Z10A 2ZW7A 3F8KA 2QMLA 4MJ8A 3QB8A 2I00A 3R9EA 5J8CA 1BOBA 5F48A 2GE3A 3PZJA 2BUEA 1M4GA 4PSWA 3GKRA 1R57A 2Q0YA 2KCWA 3FRMA 4FD5A 1YLEA 4U9ZA 4JD6A 4F6AA 2NMTA 1NSLA 1Y7RA 3S6GA 2BEIA 4AVBA 5ISVA 2J8NA 1GHEA 4PK2A 2CNTA 3K9UA 4KOVA 4ORFA 2REEA 4YFJA 2G3TA 3B8GA 3LODA 1YR0A 5JPHA 3TT2A 4KVOE 2B5GB 3TCVA 4U9YA 2P6EA 3F0AA 4UBRA 5HMNA 4HNWB 4QB9A 1B6BA 1LRZA 4KLWA 2GIVA 3TO6A 5C82A 1KUVA 2BSWA 4XNHC 4XPDB 4YRHA 2ARHA 1P4NA 4B5PA 2Q44A 2PQ8A 2PR1A 3TO7A 2QIRA 4OLLA 2B3UA 4KORA 1S7NA 1XF8A 3BJ8A 4X5KA 4R3LA 4PSXA 4XPKA 3FXTA 1M4DA 1RO5A 2FIAA 2Q7BA 3TE4A 4I49A 4CAXA 1XEBA 5IV0A 3F5BA 3FB3A 1YX0A 4XPDC 1B87A 4E2AA 1QSOA 3P2FA 1IICA 3TOBA 2AJ6A 2PC1A 4MBUA 1BO4A 2A4NA 4E8OA 3FBUA 4IF5A 5FVJA 4CRZB 4PV6A 2AE6A 3I3GA 5J8FA 3D2MA 2WPWA 3VWEA 3W6SA 2Z11A 4UA3A 3PP9A 2Q04A 2REFA 3ZJ0A 4AB7A 1M1DA 2ZW4A 4KVXA 2ZXVA 3CXQA 2HV2A 2BL1A 2X7BA 1K4JA 4HNYB 3DR8A 4HKFA 4H6ZA 3GYAA 1QSMA 1ON0A 5EC4A 1S7FA 2VQYA 3R1KA 3S6KA 4UWIA 3C26A 2EVNA 1CM0A 2FS5A 3NE7A 4L89A 2J8RA 1XIXA 3R96A 3QAHA 3S6HA 2K5TA 1IB1E 3DR6A 3G8WA 2Q4YA 3TOAA 4CS0B 2JLMA 2B4DB 3EO4A 2OB0A 3E0KA 3KKWA 4YGOA 1S7KA 4XPLA 4E0AA 2FCKA 1J4JA 4R87A 2CNMA 2R7HA 2Y0MA 4CRYB 2H5MA 3CXSA 1Q2YA 2I79A 5E96A 3I9SA 3DNSA 3G3SA 2R1IA 3MGDA 3H4QA 4FD4A 3FNCA 2JDDA 3D3SA 1XMTA 2FIWA 4HNXB 3JUWA 2HUZA 4FD7A 3TTHA 3RYOA 3SHPA 1I1DA 4BMHA 1WK4A 2OZHA 1KUYA 3UY5A 3DSBA 5JQ4A 4QBJA 2Q4VA 2FE7A 2D4PA 3BJ7A 2R8VA 2ZW5A 1Y9KA 4KUAA 2DXQA 4CAWA 4MY0A 4AG9A 3EFAA 2ZW6A 1M4IA 4EVYA 2G3AA 4B5OA 4Y49B 2F5IA 3SXOA 2PRBA 4F0YA 5IB0A 4GS4A 3WR7A 1IIDA 1Z4RA 1QSNA 4DNCA 4FD6A 4LUAA 4NEXA 5IX3A 2FXFA 4IUSA 1UFHA 2RC4A 2B4DA 1WWZA 2P6GA 1KZFA 1S60A 2J8MA 1P0HA 4OAEA 4KOYA 2JEVA 4J3GA 4JXRA 2OZGA 1RXTA 4M85A 2CNSA 4ZBGA 3S6FA 2C27A 3CXPA 5KTDA 5HH1A 2ATRA 4PK3A 2OZUA 1M44A 2VI7A 4KVME 2R98A 4KOUA 1TIQA 1S3ZA 3R9FA 4NXYA 4NSQA 2B5GA 1Y9WA 1Z9UA 5DWMA 1Z4EA 2B3VA 5H86A 1CJWA 1VKCA 4MI4A 3T90A 1YVKA 5KTAA 2JDCA 1YVOA 4JLYA 5C88A 1Q2DA 2P6FA 3W91A 5F46A 1S5KA 1QSRA 3TFYA 4U5YA 3IWGA 4RS2A 1IYKA 1MJBA 2FT0A 4II9A 2OH1A 1FY7A 2B58A 1S7LA 1V0CA 4NCZA 4KZTA
chains in the Genus database with same CATH superfamily
2RB7A 3B3VA 3FYNA 4QC6A 2FSRA 4NF1A 5AGEA 5JM6A 1IYLA 2B4BA 5AG6A 1PCAA 4RI1A 4B6ZA 2AFZA 1ZG9A 2GFQA 2WYRA 4WWVA 4LQ6A 5CBMA 1Z8LA 4X2TA 1ELMP 5K8OA 4UF4A 5F49A 3EY5A 4ONUA 1NE9A 1F57A 1TKJA 4A32A 3FEEA 3EC4A 4ZY2A 3EXNA 5H84A 2PSWA 2OU2A 3B35A 3V38A 1SQHA 6CPAA 2VXKA 2ZENA 3KL9A 4AG7A 4K30A 4R8FA 4XNHB 2PR8A 1YGHA 2F7VA 3N5FA 2Z0ZA 4MMOA 3IGRA 1I21A 2JBKA 3WT4A 3D7GA 3PB7X 5GCNA 4OADA 1QSTA 4M6GA 2HC9A 1YW6A 1IY7A 1PU9A 3LWUA 2IL4A 2EUIA 4MXUA 2VZZA 3PGPA 2Q4ZA 4FUUA 3TC8A 3B3SA 2O28A 1Q2CA 3D7DA 2XEGA 4R6TA 5KTCA 4LX9A 2PDOA 2QECA 2VZYA 3B3CA 1TKFA 4JWPA 1MJAA 3PBBA 4H89A 3ZZIA 3CPAA 4EFDA 2F8HA 4ZX8A 1Y0RA 1VHSA 4CYOA 1VIXA 4CAVA 4OC1A 2J9AA 1Y7EA 4KOSA 4CGMA 1OBRA 1RTQA 4MHDA 3SXNA 4QVTA 3TO9A 3B7IA 4OC5A 2YNCC 5AG5A 1XE4A 4C7IA 4CYPA 5BWAB 1Z8XA 3B2YA 4MFLA 5G20A 4KOWA 2Z3LA 5LYFA 3PFEA 4KOTA 2D4OA 1L0CA 4KLVA 4UFWA 4C68A 5DWNA 4Z65A 4KS9A 1YW4A 4KUBA 5I0CA 5LRJA 1NMTA 2CY2A 3SI1A 2AFXA 2VBQA 3OWCA 4UEFA 2C1CA 5J1QA 4PXEA 4P4EA 3PB8X 3T9YA 4H6UA 3BI0A 4NGNA 1FNOA 1VGYA 2XEJA 3GY9A 3R95A 4P6YA 2FL4A 3LD2A 3WABA 3GLJA 4AVAA 5K8MA 3V8IA 4W9YA 4DYOA 2VEZA 4IK2A 4MHNA 3W6XA 1ARLA 4AVCA 1XOVA 3JRUA 2HQYA 2Z3NA 3DDDA 4M3SA 3N7ZA 4OP4A 4QUSA 1YK3A 3P2HA 1LOKA 1U6MA 3NH8A 4Y49C 4JJXA 4R57A 5CNPA 3BLNA 2WPXA 3JVNA 4L8AA 4MHYA 4MFZA 3CT9A 4JXQA 2G0BA 4MY3A 1I12A 4PQAA 1VHEA 1KUXA 2ZEHA 3D8PA 5HVHA 4R3KA 2ZPAA 4UWJA 5EMIA 4NGSA 3KI9A 4R9MA 1MJ9A 2PJ2A 4B11A 1PUAA 2Z3KA 1BPMA 4G1PA 3D66A 2PJ4A 3R9GA 4CAFA 4B5PB 4ZX9A 3FIXA 5F47A 3RZAA 2P0WA 2EK8A 3PBEA 5AG7A 3D2PA 1CPXA 1YREA 4NGTA 5EBVA 1N71A 1DE4C 1X12A 2GANA 2QJ8A 4X3RA 1F2OA 5A28A 2GLJA 4MFKA 4MCQA 3VWDA 4KOXA 1MK4A 4DJLA 4UEEA 1OZPA 4OC3A 1YSJA 1ARMA 2Z10A 2ZEEA 2ZW7A 3F8KA 3GUXA 3H5ZA 2QMLA 4P4IA 4MJ8A 3QB8A 4A94A 2FVGA 4MHPA 1TXRA 2PJ0A 2I00A 2BO9A 4P4DA 3IU2A 1ZG7A 4BD9A 3BHXA 3R9EA 1BOBA 3V7ZA 5J8CA 5F48A 2GE3A 2XEIA 1HDQA 3IC1A 3PZJA 1CBXA 1XMBA 2BUEA 2GU2A 2PJ5A 1M4GA 5JH9A 1NSAA 3IEHA 4PSWA 2HB6A 1JQGA 4RUHA 3GKRA 2PVWA 8CPAA 1R57A 4A37A 5LYLA 2Q0YA 1XJOA 1ZLHA 2DEAA 2KCWA 3FRMA 4C7HA 2PVVA 4FD5A 1YLEA 2C6PA 4U9ZA 4JD6A 4F6AA 4EMEA 1BPNA 2NMTA 3SJEA 1NSLA 1R3NA 1Y7RA 2PIYA 3BXMA 4R76A 3NE8A 3NH5A 2BEIA 3S6GA 4ZY1A 4AVBA 4OIDA 2ZOFA 4UCNA 5ISVA 4PXBA 1PYTB 2J8NA 1F2PA 2ZOGA 1GHEA 2AFOA 3DGVA 4IAVA 4PK2A 4A30A 4ZYQA 4MFJA 3VATA 2CNTA 3K9UA 4KOVA 4ORFA 2REEA 1FT7A 1QMUA 5D29A 4YFJA 2G3TA 5LYDA 3B8GA 3LODA 3NA6A 4UEZA 1EE3P 3T8WA 1YR0A 4LQGA 4CGLA 2YNEA 4UCPA 5HVGA 3TX8A 3JTKA 5JPHA 3TT2A 4KVOE 2B5GB 2ZEOA 3IWWA 3VARA 3TCVA 2CXAA 2DPTA 2ODFA 2IMOA 2EK9A 4U9YA 4EWTA 5LRKA 2AFSA 2P6EA 2VL1A 4ZY0A 2PIZA 3F0AA 2PJAA 3WC7A 4Q36A 3L2NA 4UBRA 1KWMA 4FAIA 3FJUA 4NGRA 3SJGA 5HMNA 1Q7LA 4HNWB 4QB9A 1B6BA 2CTCA 3FF3A 1LRZA 4KLWA 1TKHA 2GIVA 3TO6A 4NGQA 3KHZA 1KUVA 1XRYA 2BSWA 5C82A 2WZNA 4XNHC 3SI2A 1IU8A 3D4UA 4XPDB 4YRHA 2ARHA 1P4NA 4B5PA 1DTDA 5LYIA 1HEEA 2Q44A 2PQ8A 3KR4A 4A38A 4JZ0A 2PR1A 2Z3OA 4YU9A 3TO7A 4WJBA 2DF5A 2QIRA 2Q51A 4PXDA 4FBEA 5F09A 4OLLA 1LAPA 2B3UA 4P4JA 4KORA 1Z8WA 1S7NA 1ELLP 1TF9A 1XF8A 3BJ8A 3I1UA 4X5KA 4C2YA 3SI0A 4R3LA 2AFUA 4PSXA 4AXVA 4XPKA 3FXTA 1M4DA 1RO5A 2FIAA 2Q7BA 3TE4A 1M4LA 5DS0A 3S9MA 3NH4A 4I49A 4CAXA 4OC0A 1XFOA 5G22A 1XEBA 3RAMA 1IGBA 2C6CA 1AUGA 5IV0A 3F5BA 3FB3A 1YX0A 1ZLIA 4XPDC 1B87A 4C2XA 2WUUA 2CF4A 2QVPA 1QSOA 3P2FA 4E2AA 4F9UA 2O4HA 1IICA 2POKA 3TOBA 1Z8TA 2AJ6A 2PC1A 4MBUA 1BO4A 2JBJA 4NFRA 4CYQA 2A4NA 3PB4X 3IIBA 4E8OA 3FBUA 4IF5A 3KASA 3QAYA 4KSFA 4OIWA 4PPZA 4UFVA 5FVJA 4CRZB 4PV6A 2AE6A 3I3GA 2YGWA 5J8FA 3D2MA 3BI1A 2Z3MA 4CGPA 1IOIA 2PJ3A 3PEIA 3S9LA 2WPWA 3VWEA 4MRIA 2YNCA 2Z11A 4UA3A 3PP9A 3W6SA 2JEWA 2Q04A 2REFA 3ZJ0A 1M1DA 4AB7A 5K8PA 3PB9X 2ZW4A 5CPAA 4HPSA 3SJFA 4KVXA 2ZXVA 4UCMA 1TF8A 3CXQA 2HV2A 3H8GA 2BL1A 5I4MA 2X7BA 1K4JA 4M6HA 4MCRA 3WC6A 4HNYB 3DR8A 4UIAA 4HKFA 4H6ZA 3GYAA 4FWUA 2WSAA 3LMSA 1LAMA 1ON0A 1QSMA 5EC4A 1ZO0A 1S7FA 3CPXA 2VQYA 3D7HA 3ISXA 3R1KA 5ELYA 3S6KA 1HDUA 4UWIA 4F9VA 3C26A 2EVNA 1CM0A 2FS5A 3NE7A 3ISZA 4P45A 1YMEA 2J8RA 4L89A 1XIXA 3R96A 3QAHA 4GXHA 3S6HA 3HUVA 2ZELA 2K5TA 1IB1E 1YQEA 3QNVA 2ZEFA 3SJXA 2RFHA 3DR6A 3G8WA 3PFOA 2Q4YA 2PJBA 1Y0YA 3TOAA 2BCOA 3LACA 1JWQA 2JLMA 4UFXA 2B4DB 4CS0B 2GREA 3EO4A 2OB0A 3E0KA 3KKWA 4YGOA 1S7KA 2PJ9A 4Q38A 4XPLA 1BLLE 4E0AA 4MCSA 2FCKA 1J4JA 4A31A 4R87A 2CNMA 7CPAA 2R7HA 2Y0MA 4O23A 2AFWA 3K2KA 1H8LA 4CRYB 2H5MA 4ONWA 4B12A 4OKOA 3CXSA 1Q2YA 2I79A 5E96A 3RNZA 3GB0A 3I9SA 3DNSA 3G3SA 2R1IA 4F0XA 3MGDA 5HXDA 3H4QA 4FD4A 1Z2LA 4ZGYB 3FNCA 2JDDA 4CPAA 2OR4A 3PRTA 3D3SA 1LANA 1XMTA 2Q43A 3A9LA 4A33A 5THWA 2FIWA 4HNXB 4K3NA 3JUWA 4YWYA 2V8GA 4JYWA 2CIJA 3FMCA 5HVFA 2ANPA 1X10A 2HUZA 4FD7A 2Q7SA 4KSIA 3TTHA 3RYOA 3H8FA 3SHPA 4A2ZA 1I1DA 2YNDA 2Z3PA 1WK4A 4BMHA 5K8NA 2OZHA 3K9TA 4MFPA 2PJCA 1KUYA 3FH4A 4MHZA 3UY5A 4CYNA 1VHOA 3D68A 4R7MA 1IOFA 2IJZA 3DSBA 5JQ4A 2V8DA 4QBJA 4NJQA 2ZEPA 2PJ1A 2Q4VA 2FE7A 4ZI6A 2CTBA 2D4PA 3BJ7A 2R8VA 2ZW5A 1Y9KA 4RN7A 4KUAA 3VH9A 1AYEA 1A2ZA 2PE3A 4F8ZA 2DXQA 4CAWA 4MY0A 2OOTA 1LCPA 4P4FA 3H8EA 4Q7AA 4AG9A 4CAEA 2C6GA 2PRQA 3EFAA 2ZW6A 1M4IA 2G9DA 3DLJA 3B3WA 4NJRA 4OMEA 2PJ7A 4X8IA 2ZEDA 4OC2A 5G1ZA 4H2KA 4EVYA 2G3AA 2ZEGA 4B5OA 3FECA 4Y49B 2F5IA 5G21A 3SXOA 5IB9A 2EWBA 2PRBA 2O53A 4F0YA 1QQ9A 5IB0A 4GS4A 3WR7A 1XBUA 1IIDA 1Z4RA 3B3TA 1CP7A 1QSNA 4B10A 4CGNA 1R43A 2ABZA 2V8HA 4DNCA 1ZG8A 3IFEA 4FD6A 4LUAA 4NEXA 5A27A 3IJ3A 5IX3A 4IHMA 2IQ6A 2FXFA 4GM5A 1UFHA 4IUSA 2RC4A 4P4BA 4OC4A 2B4DA 3PB6X 1GYTA 2GLFA 4TNUA 2V77A 1WWZA 2P6GA 2NSMA 1KZFA 1S60A 3D7FA 3GIUA 2J8MA 4UIBA 1P0HA 4OAEA 2JEVA 1BAVA 4J3GA 4JXRA 4KOYA 2OZGA 3S9NA 1CG2A 1RXTA 4M85A 2CNSA 3CZXA 4ZBGA 2PJ6A 1YLOA 2ZEMA 3S6FA 2XEFA 3KHXA 2C27A 4BINA 1CX8A 3CXPA 4A95A 5KTDA 3FVLA 2ATRA 1CP6A 3CDXA 4PK3A 5HH1A 1LFWA 2OZUA 2NYQA 1M44A 3KZWA 3WC5A 4CGOA 2VI7A 3RBUA 5LRGA 3FX6A 4KVME 2R98A 3D67A 1TIQA 1S3ZA 4KOUA 3R9FA 4NXYA 4NSQA 3KQZA 4A39A 1AMPA 2B5GA 3FEDA 4PXCA 1Y9WA 4P10A 2I3CA 5JGFA 3KGQA 4TWEA 2EO8A 3IU1A 3MRUA 1Z9UA 5DWMA 1Z4EA 2B3VA 5H86A 3RO0A 5D8NA 1CJWA 1VKCA 3IO1A 4MI4A 4NGPA 1YVKA 3T90A 5KTAA 4MCPA 2JDCA 1YVOA 4JLYA 5C88A 4B13A 4NGMA 1Q2DA 3MN8A 2PCUA 4KSAA 4M6IA 4P44A 4C2ZA 2P6FA 3W91A 5F46A 2PJ8A 1S5KA 1QSRA 2AFMA 3TFYA 4U5YA 4DUKA 3IWGA 4RS2A 3KR5A 3NFZA 1IYKA 1MJBA 2FT0A 1CPSA 3KQXA 4II9A 2OH1A 1UWYA 3IWEA 1FY7A 4B14A 2B58A 2BOAA 1S7LA 2EBJA 1Z5RA 1V0CA 2V8VA 4MFQA 3HLPA 2QYVA 4NCZA 4BBHA 5AG4A 2DPSA 4KZTA
chains in the Genus database with same CATH topology
3FYNA 4QC6A 2FSRA 4NF1A 5AGEA 1IYLA 2B4BA 5AG6A 4RI1A 5F49A 3EY5A 4ONUA 1NE9A 4A32A 3EC4A 3EXNA 5H84A 2PSWA 2OU2A 1SQHA 2VXKA 4AG7A 4K30A 4XNHB 2PR8A 1YGHA 2Z0ZA 3IGRA 1I21A 5GCNA 4OADA 1QSTA 1PU9A 2IL4A 2EUIA 2VZZA 3PGPA 2O28A 1Q2CA 5KTCA 4LX9A 2PDOA 2QECA 2VZYA 4JWPA 1MJAA 4H89A 3ZZIA 1VHSA 4CYOA 4CAVA 4KOSA 4CGMA 4MHDA 3SXNA 4QVTA 3TO9A 2YNCC 5AG5A 1XE4A 4C7IA 4CYPA 5BWAB 4MFLA 5G20A 4KOWA 2Z3LA 4KOTA 2D4OA 1L0CA 4KLVA 4UFWA 4C68A 5DWNA 4KS9A 4KUBA 5I0CA 1NMTA 2CY2A 2VBQA 3OWCA 3T9YA 4H6UA 3GY9A 3R95A 2FL4A 3LD2A 4AVAA 3V8IA 2VEZA 3W6XA 4AVCA 2HQYA 2Z3NA 3DDDA 4M3SA 3N7ZA 4QUSA 1YK3A 3P2HA 1U6MA 4Y49C 4JJXA 4R57A 5CNPA 3BLNA 2WPXA 3JVNA 4L8AA 4MFZA 4JXQA 2G0BA 4MY3A 1I12A 1KUXA 3D8PA 4R3KA 2ZPAA 4UWJA 4R9MA 1MJ9A 4B11A 1PUAA 2Z3KA 3R9GA 4CAFA 4B5PB 3FIXA 5F47A 2P0WA 5AG7A 3D2PA 1YREA 5EBVA 1N71A 2GANA 5A28A 4MFKA 3VWDA 4KOXA 1MK4A 1OZPA 2Z10A 2ZW7A 3F8KA 3H5ZA 2QMLA 4MJ8A 3QB8A 2I00A 3IU2A 3R9EA 5J8CA 1BOBA 5F48A 2GE3A 3PZJA 2BUEA 1M4GA 4PSWA 3GKRA 1R57A 2Q0YA 4C7HA 2KCWA 3FRMA 4FD5A 1YLEA 4U9ZA 4JD6A 4F6AA 2NMTA 1NSLA 1Y7RA 3S6GA 2BEIA 4AVBA 4UCNA 5ISVA 2J8NA 1GHEA 4PK2A 4A30A 4MFJA 2CNTA 3K9UA 4KOVA 4ORFA 2REEA 4YFJA 2G3TA 3B8GA 3LODA 1YR0A 4CGLA 2YNEA 4UCPA 3JTKA 5JPHA 3TT2A 4KVOE 2B5GB 3TCVA 2CXAA 2DPTA 4U9YA 2P6EA 3F0AA 4Q36A 4UBRA 5HMNA 4HNWB 4QB9A 1B6BA 1LRZA 4KLWA 2GIVA 3TO6A 5C82A 1KUVA 2BSWA 4XNHC 4XPDB 4YRHA 2ARHA 1P4NA 4B5PA 2Q44A 2PQ8A 2PR1A 2Z3OA 3TO7A 2QIRA 4OLLA 2B3UA 4KORA 1S7NA 1XF8A 4C2YA 3BJ8A 4X5KA 4R3LA 4PSXA 4XPKA 3FXTA 1M4DA 1RO5A 2FIAA 2Q7BA 3TE4A 4I49A 4CAXA 5G22A 1XEBA 5IV0A 3F5BA 3FB3A 1YX0A 4XPDC 1B87A 4C2XA 2WUUA 4E2AA 1QSOA 3P2FA 1IICA 3TOBA 2AJ6A 2PC1A 4MBUA 1BO4A 4CYQA 2A4NA 4E8OA 3FBUA 4IF5A 4KSFA 4UFVA 5FVJA 4CRZB 4PV6A 2AE6A 3I3GA 2YGWA 5J8FA 3D2MA 2Z3MA 4CGPA 2WPWA 3VWEA 3W6SA 2YNCA 2Z11A 4UA3A 3PP9A 2Q04A 2REFA 3ZJ0A 4AB7A 1M1DA 2ZW4A 4KVXA 2ZXVA 4UCMA 3CXQA 2HV2A 2BL1A 2X7BA 1K4JA 4HNYB 3DR8A 4HKFA 4H6ZA 3GYAA 2WSAA 1QSMA 1ON0A 5EC4A 1ZO0A 1S7FA 2VQYA 3R1KA 3S6KA 4UWIA 3C26A 2EVNA 1CM0A 2FS5A 3NE7A 4L89A 2J8RA 1XIXA 3R96A 3QAHA 3S6HA 2K5TA 1IB1E 3DR6A 3G8WA 2Q4YA 3TOAA 4CS0B 4UFXA 2JLMA 2B4DB 3EO4A 2OB0A 3E0KA 3KKWA 4YGOA 1S7KA 4Q38A 4XPLA 4E0AA 2FCKA 1J4JA 4A31A 4R87A 2CNMA 2R7HA 2Y0MA 4CRYB 2H5MA 4B12A 3CXSA 1Q2YA 2I79A 5E96A 3I9SA 3DNSA 3G3SA 2R1IA 4F0XA 3MGDA 3H4QA 4FD4A 4ZGYB 3FNCA 2JDDA 3D3SA 1XMTA 4A33A 3A9LA 2FIWA 4HNXB 3JUWA 2HUZA 4FD7A 3TTHA 3RYOA 3SHPA 4A2ZA 1I1DA 2YNDA 2Z3PA 1WK4A 4BMHA 2OZHA 4MFPA 1KUYA 3UY5A 4CYNA 3DSBA 5JQ4A 4QBJA 2Q4VA 2FE7A 2D4PA 3BJ7A 2R8VA 2ZW5A 1Y9KA 4KUAA 2DXQA 4CAWA 4MY0A 4AG9A 4CAEA 3EFAA 2ZW6A 1M4IA 5G1ZA 4EVYA 2G3AA 4B5OA 4Y49B 2F5IA 5G21A 3SXOA 2PRBA 4F0YA 5IB0A 4GS4A 3WR7A 1IIDA 1Z4RA 1QSNA 4B10A 4CGNA 4DNCA 4FD6A 4LUAA 4NEXA 5A27A 5IX3A 2FXFA 4IUSA 1UFHA 2RC4A 2B4DA 1WWZA 2P6GA 1KZFA 1S60A 2J8MA 1P0HA 4OAEA 2JEVA 4J3GA 4KOYA 4JXRA 2OZGA 1RXTA 4M85A 2CNSA 4ZBGA 3S6FA 2C27A 3CXPA 4A95A 5KTDA 5HH1A 2ATRA 4PK3A 2OZUA 1M44A 4CGOA 2VI7A 4KVME 2R98A 4KOUA 1TIQA 1S3ZA 3R9FA 4NXYA 4NSQA 2B5GA 1Y9WA 3IU1A 1Z9UA 5DWMA 1Z4EA 2B3VA 5H86A 1CJWA 1VKCA 4MI4A 3T90A 1YVKA 5KTAA 2JDCA 1YVOA 4JLYA 5C88A 4B13A 1Q2DA 4KSAA 4C2ZA 2P6FA 3W91A 5F46A 1S5KA 1QSRA 3TFYA 4U5YA 3IWGA 4RS2A 1IYKA 1MJBA 2FT0A 4II9A 2OH1A 3IWEA 4B14A 1FY7A 2B58A 1S7LA 1V0CA 4MFQA 4NCZA 4BBHA 5AG4A 2DPSA 4KZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FYN A;  4QC6 A;  2FSR A;  4NF1 A;  1IYL A;  2B4B A;  4RI1 A;  5F49 A;  3EY5 A;  4ONU A;  1NE9 A;  3EC4 A;  3EXN A;  5H84 A;  2PSW A;  2OU2 A;  1SQH A;  2VXK A;  4AG7 A;  4K30 A;  4XNH B;  2PR8 A;  1YGH A;  2Z0Z A;  3IGR A;  1I21 A;  5GCN A;  4OAD A;  1QST A;  1PU9 A;  2IL4 A;  2EUI A;  2VZZ A;  3PGP A;  2O28 A;  1Q2C A;  5KTC A;  4LX9 A;  2PDO A;  2QEC A;  2VZY A;  4JWP A;  1MJA A;  4H89 A;  3ZZI A;  1VHS A;  4CAV A;  4KOS A;  4MHD A;  3SXN A;  4QVT A;  3TO9 A;  1XE4 A;  4KOW A;  4KOT A;  2D4O A;  1L0C A;  4KLV A;  5DWN A;  4KUB A;  5I0C A;  1NMT A;  2CY2 A;  2VBQ A;  3OWC A;  3T9Y A;  4H6U A;  3GY9 A;  3R95 A;  2FL4 A;  3LD2 A;  4AVA A;  3V8I A;  2VEZ A;  3W6X A;  4AVC A;  2HQY A;  3DDD A;  4M3S A;  3N7Z A;  4QUS A;  1YK3 A;  3P2H A;  1U6M A;  4Y49 C;  4JJX A;  4R57 A;  5CNP A;  3BLN A;  2WPX A;  3JVN A;  4L8A A;  4JXQ A;  2G0B A;  4MY3 A;  1I12 A;  1KUX A;  3D8P A;  4R3K A;  2ZPA A;  4UWJ A;  4R9M A;  1MJ9 A;  1PUA A;  3R9G A;  4B5P B;  3FIX A;  5F47 A;  2P0W A;  3D2P A;  1YRE A;  5EBV A;  1N71 A;  2GAN A;  3VWD A;  4KOX A;  1MK4 A;  1OZP A;  2Z10 A;  2ZW7 A;  3F8K A;  2QML A;  4MJ8 A;  3QB8 A;  2I00 A;  3R9E A;  5J8C A;  1BOB A;  5F48 A;  2GE3 A;  3PZJ A;  2BUE A;  1M4G A;  4PSW A;  3GKR A;  1R57 A;  2Q0Y A;  2KCW A;  3FRM A;  4FD5 A;  1YLE A;  4U9Z A;  4JD6 A;  4F6A A;  2NMT A;  1NSL A;  1Y7R A;  3S6G A;  2BEI A;  4AVB A;  5ISV A;  2J8N A;  1GHE A;  4PK2 A;  2CNT A;  3K9U A;  4KOV A;  4ORF A;  2REE A;  4YFJ A;  2G3T A;  3B8G A;  3LOD A;  1YR0 A;  5JPH A;  3TT2 A;  4KVO E;  2B5G B;  3TCV A;  4U9Y A;  2P6E A;  3F0A A;  4UBR A;  5HMN A;  4HNW B;  4QB9 A;  1B6B A;  1LRZ A;  4KLW A;  2GIV A;  3TO6 A;  5C82 A;  1KUV A;  2BSW A;  4XNH C;  4XPD B;  4YRH A;  2ARH A;  1P4N A;  4B5P A;  2Q44 A;  2PQ8 A;  2PR1 A;  3TO7 A;  2QIR A;  4OLL A;  2B3U A;  4KOR A;  1S7N A;  1XF8 A;  3BJ8 A;  4X5K A;  4R3L A;  4PSX A;  4XPK A;  3FXT A;  1M4D A;  1RO5 A;  2FIA A;  2Q7B A;  3TE4 A;  4I49 A;  4CAX A;  1XEB A;  5IV0 A;  3F5B A;  3FB3 A;  1YX0 A;  4XPD C;  1B87 A;  4E2A A;  1QSO A;  3P2F A;  1IIC A;  3TOB A;  2AJ6 A;  2PC1 A;  4MBU A;  1BO4 A;  2A4N A;  4E8O A;  3FBU A;  4IF5 A;  5FVJ A;  4CRZ B;  4PV6 A;  2AE6 A;  3I3G A;  5J8F A;  3D2M A;  2WPW A;  3VWE A;  3W6S A;  2Z11 A;  4UA3 A;  3PP9 A;  2Q04 A;  2REF A;  3ZJ0 A;  4AB7 A;  1M1D A;  2ZW4 A;  4KVX A;  2ZXV A;  3CXQ A;  2HV2 A;  2BL1 A;  2X7B A;  1K4J A;  4HNY B;  3DR8 A;  4HKF A;  4H6Z A;  3GYA A;  1QSM A;  1ON0 A;  5EC4 A;  1S7F A;  2VQY A;  3R1K A;  3S6K A;  4UWI A;  3C26 A;  2EVN A;  1CM0 A;  2FS5 A;  3NE7 A;  4L89 A;  2J8R A;  1XIX A;  3R96 A;  3QAH A;  3S6H A;  2K5T A;  1IB1 E;  3DR6 A;  3G8W A;  2Q4Y A;  3TOA A;  4CS0 B;  2JLM A;  2B4D B;  3EO4 A;  2OB0 A;  3E0K A;  3KKW A;  4YGO A;  1S7K A;  4XPL A;  4E0A A;  2FCK A;  1J4J A;  4R87 A;  2CNM A;  2R7H A;  2Y0M A;  4CRY B;  2H5M A;  3CXS A;  1Q2Y A;  2I79 A;  5E96 A;  3I9S A;  3DNS A;  3G3S A;  2R1I A;  3MGD A;  3H4Q A;  4FD4 A;  3FNC A;  2JDD A;  3D3S A;  1XMT A;  2FIW A;  4HNX B;  3JUW A;  2HUZ A;  4FD7 A;  3TTH A;  3RYO A;  3SHP A;  1I1D A;  4BMH A;  1WK4 A;  2OZH A;  1KUY A;  3UY5 A;  3DSB A;  5JQ4 A;  4QBJ A;  2Q4V A;  2FE7 A;  2D4P A;  3BJ7 A;  2R8V A;  2ZW5 A;  1Y9K A;  4KUA A;  2DXQ A;  4CAW A;  4MY0 A;  4AG9 A;  3EFA A;  2ZW6 A;  1M4I A;  4EVY A;  2G3A A;  4B5O A;  4Y49 B;  2F5I A;  3SXO A;  2PRB A;  4F0Y A;  5IB0 A;  4GS4 A;  3WR7 A;  1IID A;  1Z4R A;  1QSN A;  4DNC A;  4FD6 A;  4LUA A;  4NEX A;  5IX3 A;  2FXF A;  4IUS A;  1UFH A;  2RC4 A;  2B4D A;  1WWZ A;  2P6G A;  1KZF A;  1S60 A;  2J8M A;  1P0H A;  4OAE A;  4KOY A;  2JEV A;  4J3G A;  4JXR A;  2OZG A;  1RXT A;  4M85 A;  2CNS A;  4ZBG A;  3S6F A;  2C27 A;  3CXP A;  5KTD A;  5HH1 A;  2ATR A;  4PK3 A;  2OZU A;  1M44 A;  2VI7 A;  4KVM E;  2R98 A;  4KOU A;  1TIQ A;  1S3Z A;  3R9F A;  4NXY A;  4NSQ A;  2B5G A;  1Y9W A;  1Z9U A;  5DWM A;  1Z4E A;  2B3V A;  5H86 A;  1CJW A;  1VKC A;  4MI4 A;  3T90 A;  1YVK A;  5KTA A;  2JDC A;  1YVO A;  4JLY A;  5C88 A;  1Q2D A;  2P6F A;  3W91 A;  5F46 A;  1S5K A;  1QSR A;  3TFY A;  4U5Y A;  3IWG A;  4RS2 A;  1IYK A;  1MJB A;  2FT0 A;  4II9 A;  2OH1 A;  1FY7 A;  2B58 A;  1S7L A;  1V0C A;  4NCZ A;  4KZT A; 
#chains in the Genus database with same CATH topology
 2RB7 A;  3B3V A;  3FYN A;  4QC6 A;  2FSR A;  4NF1 A;  5AGE A;  5JM6 A;  1IYL A;  2B4B A;  5AG6 A;  1PCA A;  4RI1 A;  4B6Z A;  2AFZ A;  1ZG9 A;  2GFQ A;  2WYR A;  4WWV A;  4LQ6 A;  5CBM A;  1Z8L A;  4X2T A;  1ELM P;  5K8O A;  4UF4 A;  5F49 A;  3EY5 A;  4ONU A;  1NE9 A;  1F57 A;  1TKJ A;  4A32 A;  3FEE A;  3EC4 A;  4ZY2 A;  3EXN A;  5H84 A;  2PSW A;  2OU2 A;  3B35 A;  3V38 A;  1SQH A;  6CPA A;  2VXK A;  2ZEN A;  3KL9 A;  4AG7 A;  4K30 A;  4R8F A;  4XNH B;  2PR8 A;  1YGH A;  2F7V A;  3N5F A;  2Z0Z A;  4MMO A;  3IGR A;  1I21 A;  2JBK A;  3WT4 A;  3D7G A;  3PB7 X;  5GCN A;  4OAD A;  1QST A;  4M6G A;  2HC9 A;  1YW6 A;  1IY7 A;  1PU9 A;  3LWU A;  2IL4 A;  2EUI A;  4MXU A;  2VZZ A;  3PGP A;  2Q4Z A;  4FUU A;  3TC8 A;  3B3S A;  2O28 A;  1Q2C A;  3D7D A;  2XEG A;  4R6T A;  5KTC A;  4LX9 A;  2PDO A;  2QEC A;  2VZY A;  3B3C A;  1TKF A;  4JWP A;  1MJA A;  3PBB A;  4H89 A;  3ZZI A;  3CPA A;  4EFD A;  2F8H A;  4ZX8 A;  1Y0R A;  1VHS A;  4CYO A;  1VIX A;  4CAV A;  4OC1 A;  2J9A A;  1Y7E A;  4KOS A;  4CGM A;  1OBR A;  1RTQ A;  4MHD A;  3SXN A;  4QVT A;  3TO9 A;  3B7I A;  4OC5 A;  2YNC C;  5AG5 A;  1XE4 A;  4C7I A;  4CYP A;  5BWA B;  1Z8X A;  3B2Y A;  4MFL A;  5G20 A;  4KOW A;  2Z3L A;  5LYF A;  3PFE A;  4KOT A;  2D4O A;  1L0C A;  4KLV A;  4UFW A;  4C68 A;  5DWN A;  4Z65 A;  4KS9 A;  1YW4 A;  4KUB A;  5I0C A;  5LRJ A;  1NMT A;  2CY2 A;  3SI1 A;  2AFX A;  2VBQ A;  3OWC A;  4UEF A;  2C1C A;  5J1Q A;  4PXE A;  4P4E A;  3PB8 X;  3T9Y A;  4H6U A;  3BI0 A;  4NGN A;  1FNO A;  1VGY A;  2XEJ A;  3GY9 A;  3R95 A;  4P6Y A;  2FL4 A;  3LD2 A;  3WAB A;  3GLJ A;  4AVA A;  5K8M A;  3V8I A;  4W9Y A;  4DYO A;  2VEZ A;  4IK2 A;  4MHN A;  3W6X A;  1ARL A;  4AVC A;  1XOV A;  3JRU A;  2HQY A;  2Z3N A;  3DDD A;  4M3S A;  3N7Z A;  4OP4 A;  4QUS A;  1YK3 A;  3P2H A;  1LOK A;  1U6M A;  3NH8 A;  4Y49 C;  4JJX A;  4R57 A;  5CNP A;  3BLN A;  2WPX A;  3JVN A;  4L8A A;  4MHY A;  4MFZ A;  3CT9 A;  4JXQ A;  2G0B A;  4MY3 A;  1I12 A;  4PQA A;  1VHE A;  1KUX A;  2ZEH A;  3D8P A;  5HVH A;  4R3K A;  2ZPA A;  4UWJ A;  5EMI A;  4NGS A;  3KI9 A;  4R9M A;  1MJ9 A;  2PJ2 A;  4B11 A;  1PUA A;  2Z3K A;  1BPM A;  4G1P A;  3D66 A;  2PJ4 A;  3R9G A;  4CAF A;  4B5P B;  4ZX9 A;  3FIX A;  5F47 A;  3RZA A;  2P0W A;  2EK8 A;  3PBE A;  5AG7 A;  3D2P A;  1CPX A;  1YRE A;  4NGT A;  5EBV A;  1N71 A;  1DE4 C;  1X12 A;  2GAN A;  2QJ8 A;  4X3R A;  1F2O A;  5A28 A;  2GLJ A;  4MFK A;  4MCQ A;  3VWD A;  4KOX A;  1MK4 A;  4DJL A;  4UEE A;  1OZP A;  4OC3 A;  1YSJ A;  1ARM A;  2Z10 A;  2ZEE A;  2ZW7 A;  3F8K A;  3GUX A;  3H5Z A;  2QML A;  4P4I A;  4MJ8 A;  3QB8 A;  4A94 A;  2FVG A;  4MHP A;  1TXR A;  2PJ0 A;  2I00 A;  2BO9 A;  4P4D A;  3IU2 A;  1ZG7 A;  4BD9 A;  3BHX A;  3R9E A;  1BOB A;  3V7Z A;  5J8C A;  5F48 A;  2GE3 A;  2XEI A;  1HDQ A;  3IC1 A;  3PZJ A;  1CBX A;  1XMB A;  2BUE A;  2GU2 A;  2PJ5 A;  1M4G A;  5JH9 A;  1NSA A;  3IEH A;  4PSW A;  2HB6 A;  1JQG A;  4RUH A;  3GKR A;  2PVW A;  8CPA A;  1R57 A;  4A37 A;  5LYL A;  2Q0Y A;  1XJO A;  1ZLH A;  2DEA A;  2KCW A;  3FRM A;  4C7H A;  2PVV A;  4FD5 A;  1YLE A;  2C6P A;  4U9Z A;  4JD6 A;  4F6A A;  4EME A;  1BPN A;  2NMT A;  3SJE A;  1NSL A;  1R3N A;  1Y7R A;  2PIY A;  3BXM A;  4R76 A;  3NE8 A;  3NH5 A;  2BEI A;  3S6G A;  4ZY1 A;  4AVB A;  4OID A;  2ZOF A;  4UCN A;  5ISV A;  4PXB A;  1PYT B;  2J8N A;  1F2P A;  2ZOG A;  1GHE A;  2AFO A;  3DGV A;  4IAV A;  4PK2 A;  4A30 A;  4ZYQ A;  4MFJ A;  3VAT A;  2CNT A;  3K9U A;  4KOV A;  4ORF A;  2REE A;  1FT7 A;  1QMU A;  5D29 A;  4YFJ A;  2G3T A;  5LYD A;  3B8G A;  3LOD A;  3NA6 A;  4UEZ A;  1EE3 P;  3T8W A;  1YR0 A;  4LQG A;  4CGL A;  2YNE A;  4UCP A;  5HVG A;  3TX8 A;  3JTK A;  5JPH A;  3TT2 A;  4KVO E;  2B5G B;  2ZEO A;  3IWW A;  3VAR A;  3TCV A;  2CXA A;  2DPT A;  2ODF A;  2IMO A;  2EK9 A;  4U9Y A;  4EWT A;  5LRK A;  2AFS A;  2P6E A;  2VL1 A;  4ZY0 A;  2PIZ A;  3F0A A;  2PJA A;  3WC7 A;  4Q36 A;  3L2N A;  4UBR A;  1KWM A;  4FAI A;  3FJU A;  4NGR A;  3SJG A;  5HMN A;  1Q7L A;  4HNW B;  4QB9 A;  1B6B A;  2CTC A;  3FF3 A;  1LRZ A;  4KLW A;  1TKH A;  2GIV A;  3TO6 A;  4NGQ A;  3KHZ A;  1KUV A;  1XRY A;  2BSW A;  5C82 A;  2WZN A;  4XNH C;  3SI2 A;  1IU8 A;  3D4U A;  4XPD B;  4YRH A;  2ARH A;  1P4N A;  4B5P A;  1DTD A;  5LYI A;  1HEE A;  2Q44 A;  2PQ8 A;  3KR4 A;  4A38 A;  4JZ0 A;  2PR1 A;  2Z3O A;  4YU9 A;  3TO7 A;  4WJB A;  2DF5 A;  2QIR A;  2Q51 A;  4PXD A;  4FBE A;  5F09 A;  4OLL A;  1LAP A;  2B3U A;  4P4J A;  4KOR A;  1Z8W A;  1S7N A;  1ELL P;  1TF9 A;  1XF8 A;  3BJ8 A;  3I1U A;  4X5K A;  4C2Y A;  3SI0 A;  4R3L A;  2AFU A;  4PSX A;  4AXV A;  4XPK A;  3FXT A;  1M4D A;  1RO5 A;  2FIA A;  2Q7B A;  3TE4 A;  1M4L A;  5DS0 A;  3S9M A;  3NH4 A;  4I49 A;  4CAX A;  4OC0 A;  1XFO A;  5G22 A;  1XEB A;  3RAM A;  1IGB A;  2C6C A;  1AUG A;  5IV0 A;  3F5B A;  3FB3 A;  1YX0 A;  1ZLI A;  4XPD C;  1B87 A;  4C2X A;  2WUU A;  2CF4 A;  2QVP A;  1QSO A;  3P2F A;  4E2A A;  4F9U A;  2O4H A;  1IIC A;  2POK A;  3TOB A;  1Z8T A;  2AJ6 A;  2PC1 A;  4MBU A;  1BO4 A;  2JBJ A;  4NFR A;  4CYQ A;  2A4N A;  3PB4 X;  3IIB A;  4E8O A;  3FBU A;  4IF5 A;  3KAS A;  3QAY A;  4KSF A;  4OIW A;  4PPZ A;  4UFV A;  5FVJ A;  4CRZ B;  4PV6 A;  2AE6 A;  3I3G A;  2YGW A;  5J8F A;  3D2M A;  3BI1 A;  2Z3M A;  4CGP A;  1IOI A;  2PJ3 A;  3PEI A;  3S9L A;  2WPW A;  3VWE A;  4MRI A;  2YNC A;  2Z11 A;  4UA3 A;  3PP9 A;  3W6S A;  2JEW A;  2Q04 A;  2REF A;  3ZJ0 A;  1M1D A;  4AB7 A;  5K8P A;  3PB9 X;  2ZW4 A;  5CPA A;  4HPS A;  3SJF A;  4KVX A;  2ZXV A;  4UCM A;  1TF8 A;  3CXQ A;  2HV2 A;  3H8G A;  2BL1 A;  5I4M A;  2X7B A;  1K4J A;  4M6H A;  4MCR A;  3WC6 A;  4HNY B;  3DR8 A;  4UIA A;  4HKF A;  4H6Z A;  3GYA A;  4FWU A;  2WSA A;  3LMS A;  1LAM A;  1ON0 A;  1QSM A;  5EC4 A;  1ZO0 A;  1S7F A;  3CPX A;  2VQY A;  3D7H A;  3ISX A;  3R1K A;  5ELY A;  3S6K A;  1HDU A;  4UWI A;  4F9V A;  3C26 A;  2EVN A;  1CM0 A;  2FS5 A;  3NE7 A;  3ISZ A;  4P45 A;  1YME A;  2J8R A;  4L89 A;  1XIX A;  3R96 A;  3QAH A;  4GXH A;  3S6H A;  3HUV A;  2ZEL A;  2K5T A;  1IB1 E;  1YQE A;  3QNV A;  2ZEF A;  3SJX A;  2RFH A;  3DR6 A;  3G8W A;  3PFO A;  2Q4Y A;  2PJB A;  1Y0Y A;  3TOA A;  2BCO A;  3LAC A;  1JWQ A;  2JLM A;  4UFX A;  2B4D B;  4CS0 B;  2GRE A;  3EO4 A;  2OB0 A;  3E0K A;  3KKW A;  4YGO A;  1S7K A;  2PJ9 A;  4Q38 A;  4XPL A;  1BLL E;  4E0A A;  4MCS A;  2FCK A;  1J4J A;  4A31 A;  4R87 A;  2CNM A;  7CPA A;  2R7H A;  2Y0M A;  4O23 A;  2AFW A;  3K2K A;  1H8L A;  4CRY B;  2H5M A;  4ONW A;  4B12 A;  4OKO A;  3CXS A;  1Q2Y A;  2I79 A;  5E96 A;  3RNZ A;  3GB0 A;  3I9S A;  3DNS A;  3G3S A;  2R1I A;  4F0X A;  3MGD A;  5HXD A;  3H4Q A;  4FD4 A;  1Z2L A;  4ZGY B;  3FNC A;  2JDD A;  4CPA A;  2OR4 A;  3PRT A;  3D3S A;  1LAN A;  1XMT A;  2Q43 A;  3A9L A;  4A33 A;  5THW A;  2FIW A;  4HNX B;  4K3N A;  3JUW A;  4YWY A;  2V8G A;  4JYW A;  2CIJ A;  3FMC A;  5HVF A;  2ANP A;  1X10 A;  2HUZ A;  4FD7 A;  2Q7S A;  4KSI A;  3TTH A;  3RYO A;  3H8F A;  3SHP A;  4A2Z A;  1I1D A;  2YND A;  2Z3P A;  1WK4 A;  4BMH A;  5K8N A;  2OZH A;  3K9T A;  4MFP A;  2PJC A;  1KUY A;  3FH4 A;  4MHZ A;  3UY5 A;  4CYN A;  1VHO A;  3D68 A;  4R7M A;  1IOF A;  2IJZ A;  3DSB A;  5JQ4 A;  2V8D A;  4QBJ A;  4NJQ A;  2ZEP A;  2PJ1 A;  2Q4V A;  2FE7 A;  4ZI6 A;  2CTB A;  2D4P A;  3BJ7 A;  2R8V A;  2ZW5 A;  1Y9K A;  4RN7 A;  4KUA A;  3VH9 A;  1AYE A;  1A2Z A;  2PE3 A;  4F8Z A;  2DXQ A;  4CAW A;  4MY0 A;  2OOT A;  1LCP A;  4P4F A;  3H8E A;  4Q7A A;  4AG9 A;  4CAE A;  2C6G A;  2PRQ A;  3EFA A;  2ZW6 A;  1M4I A;  2G9D A;  3DLJ A;  3B3W A;  4NJR A;  4OME A;  2PJ7 A;  4X8I A;  2ZED A;  4OC2 A;  5G1Z A;  4H2K A;  4EVY A;  2G3A A;  2ZEG A;  4B5O A;  3FEC A;  4Y49 B;  2F5I A;  5G21 A;  3SXO A;  5IB9 A;  2EWB A;  2PRB A;  2O53 A;  4F0Y A;  1QQ9 A;  5IB0 A;  4GS4 A;  3WR7 A;  1XBU A;  1IID A;  1Z4R A;  3B3T A;  1CP7 A;  1QSN A;  4B10 A;  4CGN A;  1R43 A;  2ABZ A;  2V8H A;  4DNC A;  1ZG8 A;  3IFE A;  4FD6 A;  4LUA A;  4NEX A;  5A27 A;  3IJ3 A;  5IX3 A;  4IHM A;  2IQ6 A;  2FXF A;  4GM5 A;  1UFH A;  4IUS A;  2RC4 A;  4P4B A;  4OC4 A;  2B4D A;  3PB6 X;  1GYT A;  2GLF A;  4TNU A;  2V77 A;  1WWZ A;  2P6G A;  2NSM A;  1KZF A;  1S60 A;  3D7F A;  3GIU A;  2J8M A;  4UIB A;  1P0H A;  4OAE A;  2JEV A;  1BAV A;  4J3G A;  4JXR A;  4KOY A;  2OZG A;  3S9N A;  1CG2 A;  1RXT A;  4M85 A;  2CNS A;  3CZX A;  4ZBG A;  2PJ6 A;  1YLO A;  2ZEM A;  3S6F A;  2XEF A;  3KHX A;  2C27 A;  4BIN A;  1CX8 A;  3CXP A;  4A95 A;  5KTD A;  3FVL A;  2ATR A;  1CP6 A;  3CDX A;  4PK3 A;  5HH1 A;  1LFW A;  2OZU A;  2NYQ A;  1M44 A;  3KZW A;  3WC5 A;  4CGO A;  2VI7 A;  3RBU A;  5LRG A;  3FX6 A;  4KVM E;  2R98 A;  3D67 A;  1TIQ A;  1S3Z A;  4KOU A;  3R9F A;  4NXY A;  4NSQ A;  3KQZ A;  4A39 A;  1AMP A;  2B5G A;  3FED A;  4PXC A;  1Y9W A;  4P10 A;  2I3C A;  5JGF A;  3KGQ A;  4TWE A;  2EO8 A;  3IU1 A;  3MRU A;  1Z9U A;  5DWM A;  1Z4E A;  2B3V A;  5H86 A;  3RO0 A;  5D8N A;  1CJW A;  1VKC A;  3IO1 A;  4MI4 A;  4NGP A;  1YVK A;  3T90 A;  5KTA A;  4MCP A;  2JDC A;  1YVO A;  4JLY A;  5C88 A;  4B13 A;  4NGM A;  1Q2D A;  3MN8 A;  2PCU A;  4KSA A;  4M6I A;  4P44 A;  4C2Z A;  2P6F A;  3W91 A;  5F46 A;  2PJ8 A;  1S5K A;  1QSR A;  2AFM A;  3TFY A;  4U5Y A;  4DUK A;  3IWG A;  4RS2 A;  3KR5 A;  3NFZ A;  1IYK A;  1MJB A;  2FT0 A;  1CPS A;  3KQX A;  4II9 A;  2OH1 A;  1UWY A;  3IWE A;  1FY7 A;  4B14 A;  2B58 A;  2BOA A;  1S7L A;  2EBJ A;  1Z5R A;  1V0C A;  2V8V A;  4MFQ A;  3HLP A;  2QYV A;  4NCZ A;  4BBH A;  5AG4 A;  2DPS A;  4KZT A; 
#chains in the Genus database with same CATH homology
 3FYN A;  4QC6 A;  2FSR A;  4NF1 A;  5AGE A;  1IYL A;  2B4B A;  5AG6 A;  4RI1 A;  5F49 A;  3EY5 A;  4ONU A;  1NE9 A;  4A32 A;  3EC4 A;  3EXN A;  5H84 A;  2PSW A;  2OU2 A;  1SQH A;  2VXK A;  4AG7 A;  4K30 A;  4XNH B;  2PR8 A;  1YGH A;  2Z0Z A;  3IGR A;  1I21 A;  5GCN A;  4OAD A;  1QST A;  1PU9 A;  2IL4 A;  2EUI A;  2VZZ A;  3PGP A;  2O28 A;  1Q2C A;  5KTC A;  4LX9 A;  2PDO A;  2QEC A;  2VZY A;  4JWP A;  1MJA A;  4H89 A;  3ZZI A;  1VHS A;  4CYO A;  4CAV A;  4KOS A;  4CGM A;  4MHD A;  3SXN A;  4QVT A;  3TO9 A;  2YNC C;  5AG5 A;  1XE4 A;  4C7I A;  4CYP A;  5BWA B;  4MFL A;  5G20 A;  4KOW A;  2Z3L A;  4KOT A;  2D4O A;  1L0C A;  4KLV A;  4UFW A;  4C68 A;  5DWN A;  4KS9 A;  4KUB A;  5I0C A;  1NMT A;  2CY2 A;  2VBQ A;  3OWC A;  3T9Y A;  4H6U A;  3GY9 A;  3R95 A;  2FL4 A;  3LD2 A;  4AVA A;  3V8I A;  2VEZ A;  3W6X A;  4AVC A;  2HQY A;  2Z3N A;  3DDD A;  4M3S A;  3N7Z A;  4QUS A;  1YK3 A;  3P2H A;  1U6M A;  4Y49 C;  4JJX A;  4R57 A;  5CNP A;  3BLN A;  2WPX A;  3JVN A;  4L8A A;  4MFZ A;  4JXQ A;  2G0B A;  4MY3 A;  1I12 A;  1KUX A;  3D8P A;  4R3K A;  2ZPA A;  4UWJ A;  4R9M A;  1MJ9 A;  4B11 A;  1PUA A;  2Z3K A;  3R9G A;  4CAF A;  4B5P B;  3FIX A;  5F47 A;  2P0W A;  5AG7 A;  3D2P A;  1YRE A;  5EBV A;  1N71 A;  2GAN A;  5A28 A;  4MFK A;  3VWD A;  4KOX A;  1MK4 A;  1OZP A;  2Z10 A;  2ZW7 A;  3F8K A;  3H5Z A;  2QML A;  4MJ8 A;  3QB8 A;  2I00 A;  3IU2 A;  3R9E A;  5J8C A;  1BOB A;  5F48 A;  2GE3 A;  3PZJ A;  2BUE A;  1M4G A;  4PSW A;  3GKR A;  1R57 A;  2Q0Y A;  4C7H A;  2KCW A;  3FRM A;  4FD5 A;  1YLE A;  4U9Z A;  4JD6 A;  4F6A A;  2NMT A;  1NSL A;  1Y7R A;  3S6G A;  2BEI A;  4AVB A;  4UCN A;  5ISV A;  2J8N A;  1GHE A;  4PK2 A;  4A30 A;  4MFJ A;  2CNT A;  3K9U A;  4KOV A;  4ORF A;  2REE A;  4YFJ A;  2G3T A;  3B8G A;  3LOD A;  1YR0 A;  4CGL A;  2YNE A;  4UCP A;  3JTK A;  5JPH A;  3TT2 A;  4KVO E;  2B5G B;  3TCV A;  2CXA A;  2DPT A;  4U9Y A;  2P6E A;  3F0A A;  4Q36 A;  4UBR A;  5HMN A;  4HNW B;  4QB9 A;  1B6B A;  1LRZ A;  4KLW A;  2GIV A;  3TO6 A;  5C82 A;  1KUV A;  2BSW A;  4XNH C;  4XPD B;  4YRH A;  2ARH A;  1P4N A;  4B5P A;  2Q44 A;  2PQ8 A;  2PR1 A;  2Z3O A;  3TO7 A;  2QIR A;  4OLL A;  2B3U A;  4KOR A;  1S7N A;  1XF8 A;  4C2Y A;  3BJ8 A;  4X5K A;  4R3L A;  4PSX A;  4XPK A;  3FXT A;  1M4D A;  1RO5 A;  2FIA A;  2Q7B A;  3TE4 A;  4I49 A;  4CAX A;  5G22 A;  1XEB A;  5IV0 A;  3F5B A;  3FB3 A;  1YX0 A;  4XPD C;  1B87 A;  4C2X A;  2WUU A;  4E2A A;  1QSO A;  3P2F A;  1IIC A;  3TOB A;  2AJ6 A;  2PC1 A;  4MBU A;  1BO4 A;  4CYQ A;  2A4N A;  4E8O A;  3FBU A;  4IF5 A;  4KSF A;  4UFV A;  5FVJ A;  4CRZ B;  4PV6 A;  2AE6 A;  3I3G A;  2YGW A;  5J8F A;  3D2M A;  2Z3M A;  4CGP A;  2WPW A;  3VWE A;  3W6S A;  2YNC A;  2Z11 A;  4UA3 A;  3PP9 A;  2Q04 A;  2REF A;  3ZJ0 A;  4AB7 A;  1M1D A;  2ZW4 A;  4KVX A;  2ZXV A;  4UCM A;  3CXQ A;  2HV2 A;  2BL1 A;  2X7B A;  1K4J A;  4HNY B;  3DR8 A;  4HKF A;  4H6Z A;  3GYA A;  2WSA A;  1QSM A;  1ON0 A;  5EC4 A;  1ZO0 A;  1S7F A;  2VQY A;  3R1K A;  3S6K A;  4UWI A;  3C26 A;  2EVN A;  1CM0 A;  2FS5 A;  3NE7 A;  4L89 A;  2J8R A;  1XIX A;  3R96 A;  3QAH A;  3S6H A;  2K5T A;  1IB1 E;  3DR6 A;  3G8W A;  2Q4Y A;  3TOA A;  4CS0 B;  4UFX A;  2JLM A;  2B4D B;  3EO4 A;  2OB0 A;  3E0K A;  3KKW A;  4YGO A;  1S7K A;  4Q38 A;  4XPL A;  4E0A A;  2FCK A;  1J4J A;  4A31 A;  4R87 A;  2CNM A;  2R7H A;  2Y0M A;  4CRY B;  2H5M A;  4B12 A;  3CXS A;  1Q2Y A;  2I79 A;  5E96 A;  3I9S A;  3DNS A;  3G3S A;  2R1I A;  4F0X A;  3MGD A;  3H4Q A;  4FD4 A;  4ZGY B;  3FNC A;  2JDD A;  3D3S A;  1XMT A;  4A33 A;  3A9L A;  2FIW A;  4HNX B;  3JUW A;  2HUZ A;  4FD7 A;  3TTH A;  3RYO A;  3SHP A;  4A2Z A;  1I1D A;  2YND A;  2Z3P A;  1WK4 A;  4BMH A;  2OZH A;  4MFP A;  1KUY A;  3UY5 A;  4CYN A;  3DSB A;  5JQ4 A;  4QBJ A;  2Q4V A;  2FE7 A;  2D4P A;  3BJ7 A;  2R8V A;  2ZW5 A;  1Y9K A;  4KUA A;  2DXQ A;  4CAW A;  4MY0 A;  4AG9 A;  4CAE A;  3EFA A;  2ZW6 A;  1M4I A;  5G1Z A;  4EVY A;  2G3A A;  4B5O A;  4Y49 B;  2F5I A;  5G21 A;  3SXO A;  2PRB A;  4F0Y A;  5IB0 A;  4GS4 A;  3WR7 A;  1IID A;  1Z4R A;  1QSN A;  4B10 A;  4CGN A;  4DNC A;  4FD6 A;  4LUA A;  4NEX A;  5A27 A;  5IX3 A;  2FXF A;  4IUS A;  1UFH A;  2RC4 A;  2B4D A;  1WWZ A;  2P6G A;  1KZF A;  1S60 A;  2J8M A;  1P0H A;  4OAE A;  2JEV A;  4J3G A;  4KOY A;  4JXR A;  2OZG A;  1RXT A;  4M85 A;  2CNS A;  4ZBG A;  3S6F A;  2C27 A;  3CXP A;  4A95 A;  5KTD A;  5HH1 A;  2ATR A;  4PK3 A;  2OZU A;  1M44 A;  4CGO A;  2VI7 A;  4KVM E;  2R98 A;  4KOU A;  1TIQ A;  1S3Z A;  3R9F A;  4NXY A;  4NSQ A;  2B5G A;  1Y9W A;  3IU1 A;  1Z9U A;  5DWM A;  1Z4E A;  2B3V A;  5H86 A;  1CJW A;  1VKC A;  4MI4 A;  3T90 A;  1YVK A;  5KTA A;  2JDC A;  1YVO A;  4JLY A;  5C88 A;  4B13 A;  1Q2D A;  4KSA A;  4C2Z A;  2P6F A;  3W91 A;  5F46 A;  1S5K A;  1QSR A;  3TFY A;  4U5Y A;  3IWG A;  4RS2 A;  1IYK A;  1MJB A;  2FT0 A;  4II9 A;  2OH1 A;  3IWE A;  4B14 A;  1FY7 A;  2B58 A;  1S7L A;  1V0C A;  4MFQ A;  4NCZ A;  4BBH A;  5AG4 A;  2DPS A;  4KZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...