4F6SB

Crystal structure of human cdk8/cycc in complex with compound 7 (1-[3-tert-butyl-1-(4-methylphenyl)-1h-pyrazol-5-yl]urea)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
266
structure length
266
Chain Sequence
b'KAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Structure-kinetic relationship study of CDK8/CycC specific compounds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transcription/inhibitor
total genus 100
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f6sB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f6sB01
1OKWB 2PK9B 4F7JB 2C5XB 1AD6A 4OR5B 4KRDB 4YOZA 4BCNB 4EC8B 5CEIB 2UZLB 1GUXB 4EONB 1C9BA 2PK2A 1VOLA 3DDPB 4ELJA 4F7NB 2IW8B 2PHGA 1QMZB 2WMBB 4BCMD 2WEVB 4CFUD 3QHWB 4F70B 1URCB 5HVYB 1VINA 2C5VB 2WHBB 3DOGB 4BCKB 3H4CA 4EORB 1ZP2A 2I40B 3EIDB 1OKVB 5LMKB 4BCHB 5FGKB 3TN8B 4EOKB 4EOPB 3LQ5B 3TNWB 1F5QB 3O0GD 5HNBB 1P5EB 4CFMB 2PMIB 3DDQB 4G6LB 5EFQB 4ROEA 2C5NB 4OGRB 1JKWA 1OGUB 2W96A 4EOMB 4EOOB 2WFYB 1E9HB 3BLHB 1GY3B 2BPMB 5HBJB 1W98B 2IW9B 3K7AM 4EOQB 2UZEB 2WPAB 1UNLD 2IW6B 4F7LB 3MY5B 2WXVB 1O9KA 5ACBA 1H26B 2UZBB 4CFVB 5IDNB 4F7SB 1FINB 1OL1B 5HBHB 4CFNB 1FVVB 1O9KB 3BHVB 2CCIB 4CXAB 5BNJB 4YC3B 4EOIB 4ELLA 1OIUB 5HBEB 2CJMB 1AISB 4BCPB 4EOJB 3EJ1B 1JSUB 1H1PB 3M03A 1UNGD 4IMYB 4BCIB 2C4GB 4EC9B 5I5ZB 2W2HA 1BU2A 2QDJA 2JGZB 4KRCB 1H4LD 4BCOB 5CYIB 1N4MA 4FX3B 5ICPB 3BHTB 1OI9B 2W9ZA 4F6SB 1TFBA 3MIAB 4BCQB 3F5XB 2BKZB 4I3ZB 2I53A 4F6UB 4BCFB 2V22B 2WIPB 4NSTB 4F6WB 1UNHD 2G9XB 3MI9B 5L2WB 1H1RB 2X1NB 4EOLB 2WIHB 3EOCB 5HQ0B 4CFXB 4BCQD 2WMAB 2C5OB 4BCJB 4CRLB 1KXUA 4II5B 2F2CA 1OL2B 1H1SB 1VYWB 4TTHA 2B9RA 3BHUB 4EOSB 1PKDB 4Y72B 5LQFB 4BCGB 1D3UB 1H25B 2CCHB 1JOWA 3G33B 3RGFB 3TNIB 2W9FA 1GH6B 2EUFA 4UN0A 1H28B 1H27B 3BLQB 4YOOA 3TNHB 1XO2A 3POMA 4BCND 4ROCA 2R7GA 2UZDB 1H24B 4CFWB 5IDPB 2C6TB 2IVXA 1G3NC 2UUEB 4BCMB 2W99A 3QHRB 4CFUB 1JSTB 3MY1B 4YOSA 1H1QB 5IF1B 1GUXA 3BLRB 4RODA 1OIYB
chains in the Genus database with same CATH superfamily
2BS3A 2C5XB 4BCNB 4EC8B 3A8MB 1GUXB 4EONB 2PK2A 1VOLA 1URCB 1VINA 3QYBA 4BCKB 3PO3S 5LMKB 3NDQA 4BBSM 2DXCB 2PMIB 3X26B 1OGUB 2ZPFB 3X24B 1UGSB 4JX4A 2UZEB 1UNLD 4HLQA 4F7LB 3QXEB 3MY5B 1O9KA 1H26B 4F7SB 1OL1B 3HHTB 4CFNB 4EOIB 1OIUB 4AI6A 1AISB 4EOJB 1H1PB 3M03A 2CZ1B 4JX6A 4EC9B 5I5ZB 4FX3B 5ICPB 1OI9B 2W9ZA 3MIAB 4BCQB 3QYGB 3BG9A 2ZZDB 2DD5B 4F6UB 1IREB 4BCFB 1UNHD 2WJ9A 1H1RB 4OB3B 3X25B 2C5OB 2CZ6B 3GTMS 1KXUA 2ZPHB 1VYWB 4BBRM 4EOSB 5LQFB 3VKGA 4BY1X 4UN0A 1H28B 1TD6A 2DD4B 5IDPB 3VYGB 3BG3A 4CFUB 1H1QB 2ZCFB 1OIYB 3A8GB 5CEIB 4ELJA 2KMGA 1ENWA 1QMZB 2WEVB 3H4CA 1ZP2A 2I40B 3HO8A 4LOCA 2CYZB 3TN8B 3TNWB 1F5QB 5HNBB 5EFQB 1AHJB 4AKIA 1V29B 2ZPBB 4EOOB 5HBJB 3K7AM 3QZ9B 2WXVB 2QGSA 5DQWA 5IDNB 2G77A 2DMEA 1O9KB 3BHVB 5BNJB 4YC3B 5HBEB 2CJMB 2ZPIB 4BCPB 4FM4B 2W2HA 4KRCB 3QWLA 1TFBA 3TW6A 2QFZA 4NSTB 4F6WB 4JX5A 5L2WB 2KR6A 4BCQD 2BS4A 2WMAB 2F2CA 3DJBA 1OL2B 3KHIA 3A8LB 5DQVA 4BY7X 1GH6B 2EUFA 4MFEA 5IHYA 2DXBB 1UGPB 4OB0B 2UZDB 1H24B 4CFWB 1FKMA 2IVXA 3HBLA 4BCMB 2W99A 3MY1B 5IF1B 2AHJB 4RODA 3BG5A 1OKWB 4F7JB 1AD6A 4OR5B 3QYHB 2UZLB 1C9BA 5EJCA 3DDPB 2IW8B 4CFUD 3QHWB 3HB9A 4EORB 4MIMA 3EIDB 1OKVB 2LW4A 3LQ5B 4HNTA 4CFMB 4G6LB 2C5NB 1JKWA 4BXXX 2W96A 2WFYB 1E9HB 3BLHB 4AKGA 2BPMB 2IW9B 2ZPGB 4EOQB 2WPAB 2IW6B 2CZ7B 2UZBB 3B57A 1FINB 5HBHB 4HNUA 2D0QB 4OB1B 4M6VA 4IMYB 4BCIB 4ZGJB 2QDJA 5CYIB 2JGZB 1UGRB 3TW7A 4ZGDB 3BHTB 3VKHA 3F5XB 2I53A 2V22B 2WIPB 3MI9B 3VYHB 5HQ0B 4CFXB 2QQ8A 4BCJB 4HL4A 4ZGEB 4Y72B 2QDYB 3QZ5B 2CCHB 3TNIB 3G33B 1H27B 3BLQB 1XO2A 3POMA 2C6TB 2UUEB 3QHRB 1JSTB 4YOSA 1GUXA 3WVDB 2PK9B 4NC6A 4YOZA 4KRDB 4F7NB 2PHGA 2ZPEB 2WMBB 4BCMD 4F70B 5HVYB 2C5VB 2WHBB 3DOGB 3X28B 4Z6YA 4BCHB 5FGKB 4EOKB 4EOPB 3O0GD 4OB2B 1P5EB 3DDQB 4HNVA 4ROEA 4OGRB 4MFDA 4EOMB 1GY3B 1W98B 2DPPB 2BS2A 2PJQA 3A8OB 5ACBA 4CFVB 3A8HB 1FVVB 2CCIB 4CXAB 4ELLA 3EJ1B 1JSUB 2CZ0B 1UNGD 2C4GB 1UGQB 1BU2A 4BCOB 1H4LD 1N4MA 4AKHA 4QSHA 4F6SB 3QYEA 2BKZB 4I3ZB 3X20B 2G9XB 2IN3A 1QLBA 2QF7A 2X1NB 4EOLB 2WIHB 3EOCB 4CRLB 4II5B 1H1SB 4TTHA 2B9RA 3BHUB 1PKDB 1E7PA 4BCGB 1D3UB 1H25B 3WVEB 1JOWA 3RGFB 2W9FA 3TNHB 4BCND 3DTOA 4YOOA 4ROCA 3HZJA 2R7GA 1G3NC 3DL1A 3BLRB
chains in the Genus database with same CATH topology
1OKWB 2PK9B 4F7JB 2C5XB 1AD6A 4OR5B 4KRDB 4YOZA 4BCNB 4EC8B 5CEIB 2UZLB 1GUXB 4EONB 1C9BA 2PK2A 1VOLA 3DDPB 4ELJA 4F7NB 2IW8B 2PHGA 1QMZB 2WMBB 4BCMD 2WEVB 4CFUD 3QHWB 4F70B 1URCB 5HVYB 1VINA 2C5VB 2WHBB 3DOGB 4BCKB 3H4CA 4EORB 1ZP2A 2I40B 3EIDB 1OKVB 5LMKB 4BCHB 5FGKB 3TN8B 4EOKB 4EOPB 3LQ5B 3TNWB 1F5QB 3O0GD 5HNBB 1P5EB 4CFMB 2PMIB 3DDQB 4G6LB 5EFQB 4ROEA 2C5NB 4OGRB 1JKWA 1OGUB 2W96A 4EOMB 4EOOB 2WFYB 1E9HB 3BLHB 1GY3B 2BPMB 5HBJB 1W98B 2IW9B 3K7AM 4EOQB 2UZEB 2WPAB 1UNLD 2IW6B 4F7LB 3MY5B 2WXVB 1O9KA 5ACBA 1H26B 2UZBB 4CFVB 5IDNB 4F7SB 1FINB 1OL1B 5HBHB 4CFNB 1FVVB 1O9KB 3BHVB 2CCIB 4CXAB 5BNJB 4YC3B 4EOIB 4ELLA 1OIUB 5HBEB 2CJMB 1AISB 4BCPB 4EOJB 3EJ1B 1JSUB 1H1PB 3M03A 1UNGD 4IMYB 4BCIB 2C4GB 4EC9B 5I5ZB 2W2HA 1BU2A 2QDJA 2JGZB 4KRCB 1H4LD 4BCOB 5CYIB 1N4MA 4FX3B 5ICPB 3BHTB 1OI9B 2W9ZA 4F6SB 1TFBA 3MIAB 4BCQB 3F5XB 2BKZB 4I3ZB 2I53A 4F6UB 4BCFB 2V22B 2WIPB 4NSTB 4F6WB 1UNHD 2G9XB 3MI9B 5L2WB 1H1RB 2X1NB 4EOLB 2WIHB 3EOCB 5HQ0B 4CFXB 4BCQD 2WMAB 2C5OB 4BCJB 4CRLB 1KXUA 4II5B 2F2CA 1OL2B 1H1SB 1VYWB 4TTHA 2B9RA 3BHUB 4EOSB 1PKDB 4Y72B 5LQFB 4BCGB 1D3UB 1H25B 2CCHB 1JOWA 3G33B 3RGFB 3TNIB 2W9FA 1GH6B 2EUFA 4UN0A 1H28B 1H27B 3BLQB 4YOOA 3TNHB 1XO2A 3POMA 4BCND 4ROCA 2R7GA 2UZDB 1H24B 4CFWB 5IDPB 2C6TB 2IVXA 1G3NC 2UUEB 4BCMB 2W99A 3QHRB 4CFUB 1JSTB 3MY1B 4YOSA 1H1QB 5IF1B 1GUXA 3BLRB 4RODA 1OIYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OKW B;  2PK9 B;  4F7J B;  2C5X B;  1AD6 A;  4OR5 B;  4KRD B;  4YOZ A;  4BCN B;  4EC8 B;  5CEI B;  2UZL B;  1GUX B;  4EON B;  1C9B A;  2PK2 A;  1VOL A;  3DDP B;  4ELJ A;  4F7N B;  2IW8 B;  2PHG A;  1QMZ B;  2WMB B;  4BCM D;  2WEV B;  4CFU D;  3QHW B;  4F70 B;  1URC B;  5HVY B;  1VIN A;  2C5V B;  2WHB B;  3DOG B;  4BCK B;  3H4C A;  4EOR B;  1ZP2 A;  2I40 B;  3EID B;  1OKV B;  5LMK B;  4BCH B;  5FGK B;  3TN8 B;  4EOK B;  4EOP B;  3LQ5 B;  3TNW B;  1F5Q B;  3O0G D;  5HNB B;  1P5E B;  4CFM B;  2PMI B;  3DDQ B;  4G6L B;  5EFQ B;  4ROE A;  2C5N B;  4OGR B;  1JKW A;  1OGU B;  2W96 A;  4EOM B;  4EOO B;  2WFY B;  1E9H B;  3BLH B;  1GY3 B;  2BPM B;  5HBJ B;  1W98 B;  2IW9 B;  3K7A M;  4EOQ B;  2UZE B;  2WPA B;  1UNL D;  2IW6 B;  4F7L B;  3MY5 B;  2WXV B;  1O9K A;  5ACB A;  1H26 B;  2UZB B;  4CFV B;  5IDN B;  4F7S B;  1FIN B;  1OL1 B;  5HBH B;  4CFN B;  1FVV B;  1O9K B;  3BHV B;  2CCI B;  4CXA B;  5BNJ B;  4YC3 B;  4EOI B;  4ELL A;  1OIU B;  5HBE B;  2CJM B;  1AIS B;  4BCP B;  4EOJ B;  3EJ1 B;  1JSU B;  1H1P B;  3M03 A;  1UNG D;  4IMY B;  4BCI B;  2C4G B;  4EC9 B;  5I5Z B;  2W2H A;  1BU2 A;  2QDJ A;  2JGZ B;  4KRC B;  1H4L D;  4BCO B;  5CYI B;  1N4M A;  4FX3 B;  5ICP B;  3BHT B;  1OI9 B;  2W9Z A;  4F6S B;  1TFB A;  3MIA B;  4BCQ B;  3F5X B;  2BKZ B;  4I3Z B;  2I53 A;  4F6U B;  4BCF B;  2V22 B;  2WIP B;  4NST B;  4F6W B;  1UNH D;  2G9X B;  3MI9 B;  5L2W B;  1H1R B;  2X1N B;  4EOL B;  2WIH B;  3EOC B;  5HQ0 B;  4CFX B;  4BCQ D;  2WMA B;  2C5O B;  4BCJ B;  4CRL B;  1KXU A;  4II5 B;  2F2C A;  1OL2 B;  1H1S B;  1VYW B;  4TTH A;  2B9R A;  3BHU B;  4EOS B;  1PKD B;  4Y72 B;  5LQF B;  4BCG B;  1D3U B;  1H25 B;  2CCH B;  1JOW A;  3G33 B;  3RGF B;  3TNI B;  2W9F A;  1GH6 B;  2EUF A;  4UN0 A;  1H28 B;  1H27 B;  3BLQ B;  4YOO A;  3TNH B;  1XO2 A;  3POM A;  4BCN D;  4ROC A;  2R7G A;  2UZD B;  1H24 B;  4CFW B;  5IDP B;  2C6T B;  2IVX A;  1G3N C;  2UUE B;  4BCM B;  2W99 A;  3QHR B;  4CFU B;  1JST B;  3MY1 B;  4YOS A;  1H1Q B;  5IF1 B;  1GUX A;  3BLR B;  4ROD A;  1OIY B; 
#chains in the Genus database with same CATH topology
 2BS3 A;  2C5X B;  4BCN B;  4EC8 B;  3A8M B;  1GUX B;  4EON B;  2PK2 A;  1VOL A;  1URC B;  1VIN A;  3QYB A;  4BCK B;  3PO3 S;  5LMK B;  3NDQ A;  4BBS M;  2DXC B;  2PMI B;  3X26 B;  1OGU B;  2ZPF B;  3X24 B;  1UGS B;  4JX4 A;  2UZE B;  1UNL D;  4HLQ A;  4F7L B;  3QXE B;  3MY5 B;  1O9K A;  1H26 B;  4F7S B;  1OL1 B;  3HHT B;  4CFN B;  4EOI B;  1OIU B;  4AI6 A;  1AIS B;  4EOJ B;  1H1P B;  3M03 A;  2CZ1 B;  4JX6 A;  4EC9 B;  5I5Z B;  4FX3 B;  5ICP B;  1OI9 B;  2W9Z A;  3MIA B;  4BCQ B;  3QYG B;  3BG9 A;  2ZZD B;  2DD5 B;  4F6U B;  1IRE B;  4BCF B;  1UNH D;  2WJ9 A;  1H1R B;  4OB3 B;  3X25 B;  2C5O B;  2CZ6 B;  3GTM S;  1KXU A;  2ZPH B;  1VYW B;  4BBR M;  4EOS B;  5LQF B;  3VKG A;  4BY1 X;  4UN0 A;  1H28 B;  1TD6 A;  2DD4 B;  5IDP B;  3VYG B;  3BG3 A;  4CFU B;  1H1Q B;  2ZCF B;  1OIY B;  3A8G B;  5CEI B;  4ELJ A;  2KMG A;  1ENW A;  1QMZ B;  2WEV B;  3H4C A;  1ZP2 A;  2I40 B;  3HO8 A;  4LOC A;  2CYZ B;  3TN8 B;  3TNW B;  1F5Q B;  5HNB B;  5EFQ B;  1AHJ B;  4AKI A;  1V29 B;  2ZPB B;  4EOO B;  5HBJ B;  3K7A M;  3QZ9 B;  2WXV B;  2QGS A;  5DQW A;  5IDN B;  2G77 A;  2DME A;  1O9K B;  3BHV B;  5BNJ B;  4YC3 B;  5HBE B;  2CJM B;  2ZPI B;  4BCP B;  4FM4 B;  2W2H A;  4KRC B;  3QWL A;  1TFB A;  3TW6 A;  2QFZ A;  4NST B;  4F6W B;  4JX5 A;  5L2W B;  2KR6 A;  4BCQ D;  2BS4 A;  2WMA B;  2F2C A;  3DJB A;  1OL2 B;  3KHI A;  3A8L B;  5DQV A;  4BY7 X;  1GH6 B;  2EUF A;  4MFE A;  5IHY A;  2DXB B;  1UGP B;  4OB0 B;  2UZD B;  1H24 B;  4CFW B;  1FKM A;  2IVX A;  3HBL A;  4BCM B;  2W99 A;  3MY1 B;  5IF1 B;  2AHJ B;  4ROD A;  3BG5 A;  1OKW B;  4F7J B;  1AD6 A;  4OR5 B;  3QYH B;  2UZL B;  1C9B A;  5EJC A;  3DDP B;  2IW8 B;  4CFU D;  3QHW B;  3HB9 A;  4EOR B;  4MIM A;  3EID B;  1OKV B;  2LW4 A;  3LQ5 B;  4HNT A;  4CFM B;  4G6L B;  2C5N B;  1JKW A;  4BXX X;  2W96 A;  2WFY B;  1E9H B;  3BLH B;  4AKG A;  2BPM B;  2IW9 B;  2ZPG B;  4EOQ B;  2WPA B;  2IW6 B;  2CZ7 B;  2UZB B;  3B57 A;  1FIN B;  5HBH B;  4HNU A;  2D0Q B;  4OB1 B;  4M6V A;  4IMY B;  4BCI B;  4ZGJ B;  2QDJ A;  5CYI B;  2JGZ B;  1UGR B;  3TW7 A;  4ZGD B;  3BHT B;  3VKH A;  3F5X B;  2I53 A;  2V22 B;  2WIP B;  3MI9 B;  3VYH B;  5HQ0 B;  4CFX B;  2QQ8 A;  4BCJ B;  4HL4 A;  4ZGE B;  4Y72 B;  2QDY B;  3QZ5 B;  2CCH B;  3TNI B;  3G33 B;  1H27 B;  3BLQ B;  1XO2 A;  3POM A;  2C6T B;  2UUE B;  3QHR B;  1JST B;  4YOS A;  1GUX A;  3WVD B;  2PK9 B;  4NC6 A;  4YOZ A;  4KRD B;  4F7N B;  2PHG A;  2ZPE B;  2WMB B;  4BCM D;  4F70 B;  5HVY B;  2C5V B;  2WHB B;  3DOG B;  3X28 B;  4Z6Y A;  4BCH B;  5FGK B;  4EOK B;  4EOP B;  3O0G D;  4OB2 B;  1P5E B;  3DDQ B;  4HNV A;  4ROE A;  4OGR B;  4MFD A;  4EOM B;  1GY3 B;  1W98 B;  2DPP B;  2BS2 A;  2PJQ A;  3A8O B;  5ACB A;  4CFV B;  3A8H B;  1FVV B;  2CCI B;  4CXA B;  4ELL A;  3EJ1 B;  1JSU B;  2CZ0 B;  1UNG D;  2C4G B;  1UGQ B;  1BU2 A;  4BCO B;  1H4L D;  1N4M A;  4AKH A;  4QSH A;  4F6S B;  3QYE A;  2BKZ B;  4I3Z B;  3X20 B;  2G9X B;  2IN3 A;  1QLB A;  2QF7 A;  2X1N B;  4EOL B;  2WIH B;  3EOC B;  4CRL B;  4II5 B;  1H1S B;  4TTH A;  2B9R A;  3BHU B;  1PKD B;  1E7P A;  4BCG B;  1D3U B;  1H25 B;  3WVE B;  1JOW A;  3RGF B;  2W9F A;  3TNH B;  4BCN D;  3DTO A;  4YOO A;  4ROC A;  3HZJ A;  2R7G A;  1G3N C;  3DL1 A;  3BLR B; 
#chains in the Genus database with same CATH homology
 1OKW B;  2PK9 B;  4F7J B;  2C5X B;  1AD6 A;  4OR5 B;  4KRD B;  4YOZ A;  4BCN B;  4EC8 B;  5CEI B;  2UZL B;  1GUX B;  4EON B;  1C9B A;  2PK2 A;  1VOL A;  3DDP B;  4ELJ A;  4F7N B;  2IW8 B;  2PHG A;  1QMZ B;  2WMB B;  4BCM D;  2WEV B;  4CFU D;  3QHW B;  4F70 B;  1URC B;  5HVY B;  1VIN A;  2C5V B;  2WHB B;  3DOG B;  4BCK B;  3H4C A;  4EOR B;  1ZP2 A;  2I40 B;  3EID B;  1OKV B;  5LMK B;  4BCH B;  5FGK B;  3TN8 B;  4EOK B;  4EOP B;  3LQ5 B;  3TNW B;  1F5Q B;  3O0G D;  5HNB B;  1P5E B;  4CFM B;  2PMI B;  3DDQ B;  4G6L B;  5EFQ B;  4ROE A;  2C5N B;  4OGR B;  1JKW A;  1OGU B;  2W96 A;  4EOM B;  4EOO B;  2WFY B;  1E9H B;  3BLH B;  1GY3 B;  2BPM B;  5HBJ B;  1W98 B;  2IW9 B;  3K7A M;  4EOQ B;  2UZE B;  2WPA B;  1UNL D;  2IW6 B;  4F7L B;  3MY5 B;  2WXV B;  1O9K A;  5ACB A;  1H26 B;  2UZB B;  4CFV B;  5IDN B;  4F7S B;  1FIN B;  1OL1 B;  5HBH B;  4CFN B;  1FVV B;  1O9K B;  3BHV B;  2CCI B;  4CXA B;  5BNJ B;  4YC3 B;  4EOI B;  4ELL A;  1OIU B;  5HBE B;  2CJM B;  1AIS B;  4BCP B;  4EOJ B;  3EJ1 B;  1JSU B;  1H1P B;  3M03 A;  1UNG D;  4IMY B;  4BCI B;  2C4G B;  4EC9 B;  5I5Z B;  2W2H A;  1BU2 A;  2QDJ A;  2JGZ B;  4KRC B;  1H4L D;  4BCO B;  5CYI B;  1N4M A;  4FX3 B;  5ICP B;  3BHT B;  1OI9 B;  2W9Z A;  4F6S B;  1TFB A;  3MIA B;  4BCQ B;  3F5X B;  2BKZ B;  4I3Z B;  2I53 A;  4F6U B;  4BCF B;  2V22 B;  2WIP B;  4NST B;  4F6W B;  1UNH D;  2G9X B;  3MI9 B;  5L2W B;  1H1R B;  2X1N B;  4EOL B;  2WIH B;  3EOC B;  5HQ0 B;  4CFX B;  4BCQ D;  2WMA B;  2C5O B;  4BCJ B;  4CRL B;  1KXU A;  4II5 B;  2F2C A;  1OL2 B;  1H1S B;  1VYW B;  4TTH A;  2B9R A;  3BHU B;  4EOS B;  1PKD B;  4Y72 B;  5LQF B;  4BCG B;  1D3U B;  1H25 B;  2CCH B;  1JOW A;  3G33 B;  3RGF B;  3TNI B;  2W9F A;  1GH6 B;  2EUF A;  4UN0 A;  1H28 B;  1H27 B;  3BLQ B;  4YOO A;  3TNH B;  1XO2 A;  3POM A;  4BCN D;  4ROC A;  2R7G A;  2UZD B;  1H24 B;  4CFW B;  5IDP B;  2C6T B;  2IVX A;  1G3N C;  2UUE B;  4BCM B;  2W99 A;  3QHR B;  4CFU B;  1JST B;  3MY1 B;  4YOS A;  1H1Q B;  5IF1 B;  1GUX A;  3BLR B;  4ROD A;  1OIY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...