4F6WB

Crystal structure of human cdk8/cycc in complex with compound 1 (n-[3-tert-butyl-1-(4-methylphenyl)-1h-pyrazol-5-yl]-4-[2-({[3-tert-butyl-1-(4-methylphenyl)-1h-pyrazol-5-yl]carbamoyl}amino)ethyl]piperazine-1-carboxamide)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
267
structure length
267
Chain Sequence
b'DKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Structure-kinetic relationship study of CDK8/CycC specific compounds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transcription/inhibitor
total genus 100
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f6wB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f6wB01
1OGUB 1QMZB 3MI9B 3LQ5B 1VINA 1OL2B 2C6TB 4F7SB 3QHWB 4YOSA 4II5B 3G33B 1GUXB 1TFBA 5ICPB 3POMA 1O9KA 1OIUB 4EOPB 3H4CA 4OGRB 4Y72B 5FGKB 4BCND 5I5ZB 4BCJB 2W9ZA 4KRCB 1PKDB 2G9XB 5BNJB 1H26B 4EOMB 2WEVB 3MY5B 4UN0A 1JSUB 2WIHB 2JGZB 4F7LB 1VYWB 3BHTB 4EOKB 4G6LB 3RGFB 1H1QB 1AD6A 2BPMB 1D3UB 2WHBB 2WIPB 3QHRB 1ZP2A 1C9BA 5ACBA 2B9RA 3TNIB 1H1PB 4CFNB 1H27B 1GUXA 2UZDB 4F70B 4EC9B 3DOGB 2UZLB 5HBHB 4BCFB 4BCPB 2CJMB 5L2WB 5LMKB 4CFVB 4CFUB 1OKWB 2I53A 4F6SB 4YC3B 5CYIB 1UNLD 2PK9B 4F7JB 4EOOB 5HBEB 4EOJB 4CXAB 1H24B 1UNGD 2WXVB 3M03A 1UNHD 3MIAB 4I3ZB 4KRDB 5HQ0B 3TNHB 4F6WB 1OKVB 1OIYB 4ROEA 2F2CA 4CFUD 4CFMB 5HVYB 2W99A 3BHUB 1VOLA 1XO2A 4ELLA 3DDPB 2C4GB 1H1RB 2PHGA 3EOCB 4EORB 2C5OB 4EOLB 4EOSB 2QDJA 2I40B 1H4LD 2IW9B 3K7AM 2C5XB 2WMAB 2UZEB 2C5VB 4BCQD 4F6UB 5HBJB 5IDPB 4NSTB 2IW6B 5HNBB 1KXUA 1AISB 1O9KB 4BCMB 1GH6B 1G3NC 2WPAB 2R7GA 4BCGB 3F5XB 4FX3B 4EOIB 5IDNB 2WFYB 4BCKB 4ELJA 3BLRB 3O0GD 3BLHB 4BCQB 2W2HA 4BCMD 4TTHA 2BKZB 5LQFB 1FVVB 1OL1B 2V22B 2C5NB 2W9FA 1E9HB 2IW8B 1H25B 5EFQB 3TNWB 1JKWA 5CEIB 3EJ1B 4BCOB 4BCHB 2WMBB 2UUEB 3EIDB 4EC8B 2W96A 2CCIB 2EUFA 3TN8B 1OI9B 4BCIB 5IF1B 4CRLB 4ROCA 3BHVB 3BLQB 2PMIB 4RODA 4CFWB 1JSTB 4OR5B 1N4MA 2IVXA 1H28B 2PK2A 1JOWA 2X1NB 3DDQB 4F7NB 1F5QB 1GY3B 1H1SB 1W98B 1FINB 4EONB 3MY1B 1URCB 4YOZA 2UZBB 2CCHB 1P5EB 4YOOA 4EOQB 1BU2A 4IMYB 4BCNB 4CFXB
chains in the Genus database with same CATH superfamily
3LQ5B 4HNTA 3QHWB 3HZJA 2QDYB 3H4CA 2ZPBB 4Y72B 4BCND 3KHIA 2G9XB 1H26B 4EOMB 2WEVB 3MY5B 4UN0A 1JSUB 2WIHB 2G77A 1ZP2A 3TNIB 1H1PB 4HNVA 1H27B 1GUXA 3HBLA 4EC9B 4AKIA 2CJMB 5L2WB 3QYEA 1OKWB 2KMGA 2AHJB 1IREB 3WVDB 4EOJB 4CXAB 3MIAB 4I3ZB 1OKVB 4ROEA 2F2CA 4CFUD 3X20B 1VOLA 2C4GB 2C5OB 2BS2A 2QDJA 2I40B 1H4LD 2IW9B 2QQ8A 2DPPB 4QSHA 4NSTB 5HNBB 3QWLA 4BCMB 2R7GA 4BCGB 4BCKB 3BLHB 4MFDA 2BKZB 2V22B 2C5NB 2W9FA 1E9HB 1H25B 2WJ9A 1JKWA 2ZPIB 2ZZDB 4M6VA 2UUEB 4EC8B 2W96A 2EUFA 5DQVA 4BCIB 5IF1B 3B57A 3BHVB 4CFWB 1JSTB 2DXCB 1N4MA 2PK2A 3MY1B 4JX4A 4YOZA 2UZBB 2CCHB 4CFNB 4BCNB 4OB3B 4JX5A 3MI9B 3QZ5B 1VINA 1OL2B 3A8LB 3POMA 4BY1X 4EOPB 2ZPGB 4BCJB 3BG9A 4MIMA 4Z6YA 1VYWB 3BHTB 3GTMS 1H1QB 1D3UB 2WHBB 1UGRB 5ACBA 2UZDB 4F70B 3HHTB 4BCPB 4CFUB 4AI6A 4YC3B 2CZ1B 2DMEA 4NC6A 3BG5A 3QYBA 1H24B 4F7JB 1UNHD 1OIYB 5HVYB 2W99A 3BHUB 4AKHA 1AHJB 2PHGA 4BBRM 1UGQB 4MFEA 5HBJB 5IDPB 5IHYA 3QYHB 1KXUA 1AISB 3A8OB 1GH6B 2WPAB 2CZ6B 3QZ9B 1QLBA 4FX3B 5IDNB 4BBSM 3O0GD 4BCQB 2W2HA 1OL1B 4OB0B 2CYZB 2DD5B 5EFQB 5CEIB 3HB9A 3QYGB 2IN3A 2DXBB 4ROCA 1OI9B 4HLQA 3X26B 2IVXA 4F7NB 1F5QB 1ENWA 4EONB 1URCB 3VYHB 1P5EB 4YOOA 3X24B 4IMYB 1OGUB 1QMZB 4HNUA 2C6TB 3BG3A 1GUXB 1TFBA 1O9KA 1UGSB 3VKGA 5FGKB 5I5ZB 2W9ZA 4KRCB 1PKDB 5BNJB 2ZCFB 3DJBA 2JGZB 3RGFB 1AD6A 2BS4A 3X28B 1C9BA 2B9RA 3QXEB 5HBHB 3A8MB 1UGPB 1FKMA 2I53A 5CYIB 1UNLD 2PK9B 2WXVB 5HQ0B 3NDQA 3X25B 4CFMB 1XO2A 4ELLA 4LOCA 3DDPB 3EOCB 4EOLB 4EOSB 2C5XB 2WMAB 4F6UB 2KR6A 2IW6B 4ZGDB 4ZGEB 1O9KB 2QF7A 2D0QB 3TW6A 2ZPEB 4BXXX 4TTHA 5LQFB 2DD4B 2IW8B 4ZGJB 4BCOB 4BCHB 2WMBB 3EIDB 3TN8B 4CRLB 2ZPFB 3A8HB 4OR5B 3PO3S 1H28B 2X1NB 1JOWA 3HO8A 4OB2B 1W98B 1FINB 4JX6A 3DL1A 3DTOA 4EOQB 1BU2A 2ZPHB 4F7SB 4YOSA 4II5B 3G33B 4BY7X 5ICPB 1OIUB 3VKHA 4OGRB 4F7LB 4EOKB 4G6LB 2BPMB 2WIPB 3QHRB 2QGSA 3DOGB 2UZLB 3VYGB 4BCFB 5LMKB 4CFVB 4F6SB 2PJQA 4EOOB 5HBEB 4HL4A 2BS3A 1UNGD 4F6WB 2CZ7B 3M03A 3TNHB 4KRDB 4AKGA 3A8GB 5DQWA 1H1RB 4EORB 1V29B 3TW7A 2LW4A 3K7AM 2UZEB 2C5VB 4BCQD 5EJCA 1G3NC 3F5XB 4EOIB 2QFZA 2WFYB 4ELJA 3BLRB 4BCMD 1FVVB 2CZ0B 1TD6A 4FM4B 3TNWB 3WVEB 3EJ1B 2CCIB 3BLQB 1E7PA 2PMIB 4RODA 4OB1B 3DDQB 1GY3B 1H1SB 4CFXB
chains in the Genus database with same CATH topology
1OGUB 1QMZB 3MI9B 3LQ5B 1VINA 1OL2B 2C6TB 4F7SB 3QHWB 4YOSA 4II5B 3G33B 1GUXB 1TFBA 5ICPB 3POMA 1O9KA 1OIUB 4EOPB 3H4CA 4OGRB 4Y72B 5FGKB 4BCND 5I5ZB 4BCJB 2W9ZA 4KRCB 1PKDB 2G9XB 5BNJB 1H26B 4EOMB 2WEVB 3MY5B 4UN0A 1JSUB 2WIHB 2JGZB 4F7LB 1VYWB 3BHTB 4EOKB 4G6LB 3RGFB 1H1QB 1AD6A 2BPMB 1D3UB 2WHBB 2WIPB 3QHRB 1ZP2A 1C9BA 5ACBA 2B9RA 3TNIB 1H1PB 4CFNB 1H27B 1GUXA 2UZDB 4F70B 4EC9B 3DOGB 2UZLB 5HBHB 4BCFB 4BCPB 2CJMB 5L2WB 5LMKB 4CFVB 4CFUB 1OKWB 2I53A 4F6SB 4YC3B 5CYIB 1UNLD 2PK9B 4F7JB 4EOOB 5HBEB 4EOJB 4CXAB 1H24B 1UNGD 2WXVB 3M03A 1UNHD 3MIAB 4I3ZB 4KRDB 5HQ0B 3TNHB 4F6WB 1OKVB 1OIYB 4ROEA 2F2CA 4CFUD 4CFMB 5HVYB 2W99A 3BHUB 1VOLA 1XO2A 4ELLA 3DDPB 2C4GB 1H1RB 2PHGA 3EOCB 4EORB 2C5OB 4EOLB 4EOSB 2QDJA 2I40B 1H4LD 2IW9B 3K7AM 2C5XB 2WMAB 2UZEB 2C5VB 4BCQD 4F6UB 5HBJB 5IDPB 4NSTB 2IW6B 5HNBB 1KXUA 1AISB 1O9KB 4BCMB 1GH6B 1G3NC 2WPAB 2R7GA 4BCGB 3F5XB 4FX3B 4EOIB 5IDNB 2WFYB 4BCKB 4ELJA 3BLRB 3O0GD 3BLHB 4BCQB 2W2HA 4BCMD 4TTHA 2BKZB 5LQFB 1FVVB 1OL1B 2V22B 2C5NB 2W9FA 1E9HB 2IW8B 1H25B 5EFQB 3TNWB 1JKWA 5CEIB 3EJ1B 4BCOB 4BCHB 2WMBB 2UUEB 3EIDB 4EC8B 2W96A 2CCIB 2EUFA 3TN8B 1OI9B 4BCIB 5IF1B 4CRLB 4ROCA 3BHVB 3BLQB 2PMIB 4RODA 4CFWB 1JSTB 4OR5B 1N4MA 2IVXA 1H28B 2PK2A 1JOWA 2X1NB 3DDQB 4F7NB 1F5QB 1GY3B 1H1SB 1W98B 1FINB 4EONB 3MY1B 1URCB 4YOZA 2UZBB 2CCHB 1P5EB 4YOOA 4EOQB 1BU2A 4IMYB 4BCNB 4CFXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OGU B;  1QMZ B;  3MI9 B;  3LQ5 B;  1VIN A;  1OL2 B;  2C6T B;  4F7S B;  3QHW B;  4YOS A;  4II5 B;  3G33 B;  1GUX B;  1TFB A;  5ICP B;  3POM A;  1O9K A;  1OIU B;  4EOP B;  3H4C A;  4OGR B;  4Y72 B;  5FGK B;  4BCN D;  5I5Z B;  4BCJ B;  2W9Z A;  4KRC B;  1PKD B;  2G9X B;  5BNJ B;  1H26 B;  4EOM B;  2WEV B;  3MY5 B;  4UN0 A;  1JSU B;  2WIH B;  2JGZ B;  4F7L B;  1VYW B;  3BHT B;  4EOK B;  4G6L B;  3RGF B;  1H1Q B;  1AD6 A;  2BPM B;  1D3U B;  2WHB B;  2WIP B;  3QHR B;  1ZP2 A;  1C9B A;  5ACB A;  2B9R A;  3TNI B;  1H1P B;  4CFN B;  1H27 B;  1GUX A;  2UZD B;  4F70 B;  4EC9 B;  3DOG B;  2UZL B;  5HBH B;  4BCF B;  4BCP B;  2CJM B;  5L2W B;  5LMK B;  4CFV B;  4CFU B;  1OKW B;  2I53 A;  4F6S B;  4YC3 B;  5CYI B;  1UNL D;  2PK9 B;  4F7J B;  4EOO B;  5HBE B;  4EOJ B;  4CXA B;  1H24 B;  1UNG D;  2WXV B;  3M03 A;  1UNH D;  3MIA B;  4I3Z B;  4KRD B;  5HQ0 B;  3TNH B;  4F6W B;  1OKV B;  1OIY B;  4ROE A;  2F2C A;  4CFU D;  4CFM B;  5HVY B;  2W99 A;  3BHU B;  1VOL A;  1XO2 A;  4ELL A;  3DDP B;  2C4G B;  1H1R B;  2PHG A;  3EOC B;  4EOR B;  2C5O B;  4EOL B;  4EOS B;  2QDJ A;  2I40 B;  1H4L D;  2IW9 B;  3K7A M;  2C5X B;  2WMA B;  2UZE B;  2C5V B;  4BCQ D;  4F6U B;  5HBJ B;  5IDP B;  4NST B;  2IW6 B;  5HNB B;  1KXU A;  1AIS B;  1O9K B;  4BCM B;  1GH6 B;  1G3N C;  2WPA B;  2R7G A;  4BCG B;  3F5X B;  4FX3 B;  4EOI B;  5IDN B;  2WFY B;  4BCK B;  4ELJ A;  3BLR B;  3O0G D;  3BLH B;  4BCQ B;  2W2H A;  4BCM D;  4TTH A;  2BKZ B;  5LQF B;  1FVV B;  1OL1 B;  2V22 B;  2C5N B;  2W9F A;  1E9H B;  2IW8 B;  1H25 B;  5EFQ B;  3TNW B;  1JKW A;  5CEI B;  3EJ1 B;  4BCO B;  4BCH B;  2WMB B;  2UUE B;  3EID B;  4EC8 B;  2W96 A;  2CCI B;  2EUF A;  3TN8 B;  1OI9 B;  4BCI B;  5IF1 B;  4CRL B;  4ROC A;  3BHV B;  3BLQ B;  2PMI B;  4ROD A;  4CFW B;  1JST B;  4OR5 B;  1N4M A;  2IVX A;  1H28 B;  2PK2 A;  1JOW A;  2X1N B;  3DDQ B;  4F7N B;  1F5Q B;  1GY3 B;  1H1S B;  1W98 B;  1FIN B;  4EON B;  3MY1 B;  1URC B;  4YOZ A;  2UZB B;  2CCH B;  1P5E B;  4YOO A;  4EOQ B;  1BU2 A;  4IMY B;  4BCN B;  4CFX B; 
#chains in the Genus database with same CATH topology
 3LQ5 B;  4HNT A;  3QHW B;  3HZJ A;  2QDY B;  3H4C A;  2ZPB B;  4Y72 B;  4BCN D;  3KHI A;  2G9X B;  1H26 B;  4EOM B;  2WEV B;  3MY5 B;  4UN0 A;  1JSU B;  2WIH B;  2G77 A;  1ZP2 A;  3TNI B;  1H1P B;  4HNV A;  1H27 B;  1GUX A;  3HBL A;  4EC9 B;  4AKI A;  2CJM B;  5L2W B;  3QYE A;  1OKW B;  2KMG A;  2AHJ B;  1IRE B;  3WVD B;  4EOJ B;  4CXA B;  3MIA B;  4I3Z B;  1OKV B;  4ROE A;  2F2C A;  4CFU D;  3X20 B;  1VOL A;  2C4G B;  2C5O B;  2BS2 A;  2QDJ A;  2I40 B;  1H4L D;  2IW9 B;  2QQ8 A;  2DPP B;  4QSH A;  4NST B;  5HNB B;  3QWL A;  4BCM B;  2R7G A;  4BCG B;  4BCK B;  3BLH B;  4MFD A;  2BKZ B;  2V22 B;  2C5N B;  2W9F A;  1E9H B;  1H25 B;  2WJ9 A;  1JKW A;  2ZPI B;  2ZZD B;  4M6V A;  2UUE B;  4EC8 B;  2W96 A;  2EUF A;  5DQV A;  4BCI B;  5IF1 B;  3B57 A;  3BHV B;  4CFW B;  1JST B;  2DXC B;  1N4M A;  2PK2 A;  3MY1 B;  4JX4 A;  4YOZ A;  2UZB B;  2CCH B;  4CFN B;  4BCN B;  4OB3 B;  4JX5 A;  3MI9 B;  3QZ5 B;  1VIN A;  1OL2 B;  3A8L B;  3POM A;  4BY1 X;  4EOP B;  2ZPG B;  4BCJ B;  3BG9 A;  4MIM A;  4Z6Y A;  1VYW B;  3BHT B;  3GTM S;  1H1Q B;  1D3U B;  2WHB B;  1UGR B;  5ACB A;  2UZD B;  4F70 B;  3HHT B;  4BCP B;  4CFU B;  4AI6 A;  4YC3 B;  2CZ1 B;  2DME A;  4NC6 A;  3BG5 A;  3QYB A;  1H24 B;  4F7J B;  1UNH D;  1OIY B;  5HVY B;  2W99 A;  3BHU B;  4AKH A;  1AHJ B;  2PHG A;  4BBR M;  1UGQ B;  4MFE A;  5HBJ B;  5IDP B;  5IHY A;  3QYH B;  1KXU A;  1AIS B;  3A8O B;  1GH6 B;  2WPA B;  2CZ6 B;  3QZ9 B;  1QLB A;  4FX3 B;  5IDN B;  4BBS M;  3O0G D;  4BCQ B;  2W2H A;  1OL1 B;  4OB0 B;  2CYZ B;  2DD5 B;  5EFQ B;  5CEI B;  3HB9 A;  3QYG B;  2IN3 A;  2DXB B;  4ROC A;  1OI9 B;  4HLQ A;  3X26 B;  2IVX A;  4F7N B;  1F5Q B;  1ENW A;  4EON B;  1URC B;  3VYH B;  1P5E B;  4YOO A;  3X24 B;  4IMY B;  1OGU B;  1QMZ B;  4HNU A;  2C6T B;  3BG3 A;  1GUX B;  1TFB A;  1O9K A;  1UGS B;  3VKG A;  5FGK B;  5I5Z B;  2W9Z A;  4KRC B;  1PKD B;  5BNJ B;  2ZCF B;  3DJB A;  2JGZ B;  3RGF B;  1AD6 A;  2BS4 A;  3X28 B;  1C9B A;  2B9R A;  3QXE B;  5HBH B;  3A8M B;  1UGP B;  1FKM A;  2I53 A;  5CYI B;  1UNL D;  2PK9 B;  2WXV B;  5HQ0 B;  3NDQ A;  3X25 B;  4CFM B;  1XO2 A;  4ELL A;  4LOC A;  3DDP B;  3EOC B;  4EOL B;  4EOS B;  2C5X B;  2WMA B;  4F6U B;  2KR6 A;  2IW6 B;  4ZGD B;  4ZGE B;  1O9K B;  2QF7 A;  2D0Q B;  3TW6 A;  2ZPE B;  4BXX X;  4TTH A;  5LQF B;  2DD4 B;  2IW8 B;  4ZGJ B;  4BCO B;  4BCH B;  2WMB B;  3EID B;  3TN8 B;  4CRL B;  2ZPF B;  3A8H B;  4OR5 B;  3PO3 S;  1H28 B;  2X1N B;  1JOW A;  3HO8 A;  4OB2 B;  1W98 B;  1FIN B;  4JX6 A;  3DL1 A;  3DTO A;  4EOQ B;  1BU2 A;  2ZPH B;  4F7S B;  4YOS A;  4II5 B;  3G33 B;  4BY7 X;  5ICP B;  1OIU B;  3VKH A;  4OGR B;  4F7L B;  4EOK B;  4G6L B;  2BPM B;  2WIP B;  3QHR B;  2QGS A;  3DOG B;  2UZL B;  3VYG B;  4BCF B;  5LMK B;  4CFV B;  4F6S B;  2PJQ A;  4EOO B;  5HBE B;  4HL4 A;  2BS3 A;  1UNG D;  4F6W B;  2CZ7 B;  3M03 A;  3TNH B;  4KRD B;  4AKG A;  3A8G B;  5DQW A;  1H1R B;  4EOR B;  1V29 B;  3TW7 A;  2LW4 A;  3K7A M;  2UZE B;  2C5V B;  4BCQ D;  5EJC A;  1G3N C;  3F5X B;  4EOI B;  2QFZ A;  2WFY B;  4ELJ A;  3BLR B;  4BCM D;  1FVV B;  2CZ0 B;  1TD6 A;  4FM4 B;  3TNW B;  3WVE B;  3EJ1 B;  2CCI B;  3BLQ B;  1E7P A;  2PMI B;  4ROD A;  4OB1 B;  3DDQ B;  1GY3 B;  1H1S B;  4CFX B; 
#chains in the Genus database with same CATH homology
 1OGU B;  1QMZ B;  3MI9 B;  3LQ5 B;  1VIN A;  1OL2 B;  2C6T B;  4F7S B;  3QHW B;  4YOS A;  4II5 B;  3G33 B;  1GUX B;  1TFB A;  5ICP B;  3POM A;  1O9K A;  1OIU B;  4EOP B;  3H4C A;  4OGR B;  4Y72 B;  5FGK B;  4BCN D;  5I5Z B;  4BCJ B;  2W9Z A;  4KRC B;  1PKD B;  2G9X B;  5BNJ B;  1H26 B;  4EOM B;  2WEV B;  3MY5 B;  4UN0 A;  1JSU B;  2WIH B;  2JGZ B;  4F7L B;  1VYW B;  3BHT B;  4EOK B;  4G6L B;  3RGF B;  1H1Q B;  1AD6 A;  2BPM B;  1D3U B;  2WHB B;  2WIP B;  3QHR B;  1ZP2 A;  1C9B A;  5ACB A;  2B9R A;  3TNI B;  1H1P B;  4CFN B;  1H27 B;  1GUX A;  2UZD B;  4F70 B;  4EC9 B;  3DOG B;  2UZL B;  5HBH B;  4BCF B;  4BCP B;  2CJM B;  5L2W B;  5LMK B;  4CFV B;  4CFU B;  1OKW B;  2I53 A;  4F6S B;  4YC3 B;  5CYI B;  1UNL D;  2PK9 B;  4F7J B;  4EOO B;  5HBE B;  4EOJ B;  4CXA B;  1H24 B;  1UNG D;  2WXV B;  3M03 A;  1UNH D;  3MIA B;  4I3Z B;  4KRD B;  5HQ0 B;  3TNH B;  4F6W B;  1OKV B;  1OIY B;  4ROE A;  2F2C A;  4CFU D;  4CFM B;  5HVY B;  2W99 A;  3BHU B;  1VOL A;  1XO2 A;  4ELL A;  3DDP B;  2C4G B;  1H1R B;  2PHG A;  3EOC B;  4EOR B;  2C5O B;  4EOL B;  4EOS B;  2QDJ A;  2I40 B;  1H4L D;  2IW9 B;  3K7A M;  2C5X B;  2WMA B;  2UZE B;  2C5V B;  4BCQ D;  4F6U B;  5HBJ B;  5IDP B;  4NST B;  2IW6 B;  5HNB B;  1KXU A;  1AIS B;  1O9K B;  4BCM B;  1GH6 B;  1G3N C;  2WPA B;  2R7G A;  4BCG B;  3F5X B;  4FX3 B;  4EOI B;  5IDN B;  2WFY B;  4BCK B;  4ELJ A;  3BLR B;  3O0G D;  3BLH B;  4BCQ B;  2W2H A;  4BCM D;  4TTH A;  2BKZ B;  5LQF B;  1FVV B;  1OL1 B;  2V22 B;  2C5N B;  2W9F A;  1E9H B;  2IW8 B;  1H25 B;  5EFQ B;  3TNW B;  1JKW A;  5CEI B;  3EJ1 B;  4BCO B;  4BCH B;  2WMB B;  2UUE B;  3EID B;  4EC8 B;  2W96 A;  2CCI B;  2EUF A;  3TN8 B;  1OI9 B;  4BCI B;  5IF1 B;  4CRL B;  4ROC A;  3BHV B;  3BLQ B;  2PMI B;  4ROD A;  4CFW B;  1JST B;  4OR5 B;  1N4M A;  2IVX A;  1H28 B;  2PK2 A;  1JOW A;  2X1N B;  3DDQ B;  4F7N B;  1F5Q B;  1GY3 B;  1H1S B;  1W98 B;  1FIN B;  4EON B;  3MY1 B;  1URC B;  4YOZ A;  2UZB B;  2CCH B;  1P5E B;  4YOO A;  4EOQ B;  1BU2 A;  4IMY B;  4BCN B;  4CFX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...