4F71A

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, wild-type protein, complex with magnesium and inorganic phosphate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
198
Chain Sequence
GIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
total genus 69
structure length 198
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4f71A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4f71A01
2PQ0A 1RLOA 3AR9A 4J03A 1RPZA 2ZBDA 4HAIA 4XOUA 1RLMA 4CE6A 3NAMA 5AW0A 4KNVA 1ZD2P 3QU5A 3ZTYA 3EPRA 4HGRA 2G0AA 4RETA 2WF6A 3WK9A 5ALRA 1RRCA 3OCZA 2G80A 3SMVA 3R9KA 5ALEA 4ZEVA 3NIWA 2RARA 2WHEA 2ZOSA 4HGNA 2FPUA 1L8LA 5AW9A 4BNDB 1JUDA 5ALIA 4DCCA 4UAUA 2CFRA 2O9JA 2FPWA 2AUTA 1Z4JA 4UMDA 2OM6A 4BX0A 4UASA 2YY6A 3NASA 3OTQA 1O03A 3UM9A 2HEGA 1WPGA 3PDWA 2YFYA 2P9JA 3SHQA 4FFDA 2FI1A 5AK5A 3FVVA 1YJ5A 5IT0A 5AIBA 1U7OA 4QQFA 2B8EA 1XP5A 4Y3UA 4IFTA 5AW3A 3QU7A 1QQ7A 4AS2A 1L8OA 3ZX5A 2HCFA 3ONNA 5AM5A 2O2XA 4I9GA 4C4RA 2G06A 3ESRA 1L7PA 5ALKA 5ALXA 3ED5A 1QQ5A 2VKQA 1QYIA 1YV9A 3F9RA 2G08A 1RQNA 2R8YA 2G1AA 4YIHA 2R8XA 4KN8A 2ODAA 3CNHA 2IYEA 4UMVA 2HO4A 3GYGA 3KBBA 5ALQA 3B9BA 3SD7A 3OCUA 4YGYA 3ZVMA 2I54A 5AVSA 3AR5A 2CFSA 2JGAA 1ZJJA 5AVRA 3A1EA 3OCVA 4F72A 1WR8A 4Y2SA 2WF7A 2FDRA 3N1UA 4Y2XA 1Q92A 2IA5A 1YNSA 2GFHA 2Q4RA 2ZG6A 1Z88A 4Y2VA 2ZBEA 3L5KA 4QJBA 1S8OA 4KX5A 4HGOA 2FUCA 4HGPA 1KYTA 3OCWA 3I6BA 3SLRA 3AR8A 3R4CA 5AKJA 4Y2PA 1T5SA 1U2SA 3ET5A 5AW4A 3WKDA 2YMPA 4Y2JA 3RF6A 2B1RA 3A1CA 2R8ZA 1EK1A 2C4NA 1CQZA 4NFLA 4GIBA 4UMFA 5JJBA 2I6XA 5ALFA 5ALMA 3WK8A 3UMCA 2OYCA 3ZVLA 3ZW7A 1S2OA 3UMBA 3FGOA 2OA0A 4C4SA 4OCZA 3ZVNA 3WKEA 3A1DA 5AKGA 3U13A 5ALZA 1ZD5A 4G63A 1F5SA 2W11A 5AKKA 1QH9A 2YJ4A 3WK4A 2ZXEA 1L7NA 5AVTA 2B30A 3WGVA 5AVYA 1Z4OA 2C8KA 5AVXA 1J97A 5ALNA 2HHLA 1SWWA 3EF1A 2BDEA 4CF4A 4AS3A 1YS9A 3QUQA 2B0CA 2AMYA 3QU4A 2IOHA 2HDOA 4DFDA 5ALOA 5AW1A 2WFAA 3L1VA 3CZ4A 3ZWDA 4UW9A 3MN1A 1Z4IA 2GHTA 2P69A 3QYPA 5AI4A 5ALWA 1NNLA 3E58A 4KNWA 4BEWA 5AI5A 2I33A 1RMQA 5ALVA 1TJ3A 4EX6A 3L8FA 3E8MA 4MUMA 1NF2A 4L6AA 2JAWA 1RDFA 2W43A 2HF7A 2GO7A 2YMQA 5IS2A 4KYTA 3DAOA 1WVIA 3FM9A 4Y2YA 3WK6A 1AQ6A 1X42A 5ALTA 5A3QA 4AP9A 3E84A 4DWOA 3BA6A 4ZEWA 1L6RA 1VFPA 3FPSA 1N9KA 3KDPA 5AK3A 3HYCA 4C4TA 2BDUA 1WZCA 5AK4A 3AR4A 4NAVA 3AR2A 4YH1A 1RKQA 3WKBA 2EARA 3KD3A 4HGQA 2WF8A 2WM8A 3K1ZA 3IB6A 4RESA 5AVWA 2C8LA 5T41A 5AKIA 1TJ4A 3AR7A 3ZUPA 2QYHA 2X4DA 5ALUA 3DNPA 3NUQA 4HYTA 4GXTA 2WF9A 2B1QA 3QU2A 2HSZA 4MWOA 3SKYA 1XVIA 2I55A 3OCXA 3WKCA 2CFTA 4EX7A 2GMWA 1RKUA 1EK2A 2R8EA 5AICA 4BBJA 3DV9A 3B8EA 4B6JA 3HLTA 1LVHA 2IOFK 3W5CA 2YBDA 3U7GA 1T5TA 1LTQA 2NO4A 5ALGA 4J2TA 4UM7A 5ALHA 2JARA 5AW2A 3AR3A 3QGMA 1J8DA 2ZBGA 4I9FA 3W5BA 1Z4PX 3ZTWA 2FPXA 1QQ6A 2JAOA 3U7EB 3A3YA 2HF2A 4G9BA 4OHFA 3B9RA 4NWIA 1VJ5A 5AVUA 4OFZA 4UMEA 1Z5GA 3KZXA 5AW7A 3U26A 2RBKA 2HOQA 5AI0A 1YDFA 5ALJA 2YJ6A 3L8GA 2MSNA 4UATA 4CF3A 1Z4MA 1PW5A 3J7TA 3KOOA 3N07A 3W5AA 4Y2RA 5AKHA 1VJRA 3ET4A 5AIAA 5AESA 5AM3A 4L6CA 3NANA 2YJ5A 5ALYA 2C9MA 2G07A 4CF5A 3P96A 5AKYA 1Z5UA 3QXGA 4EZEA 3N28A 3I28A 1Z4NA 4H1WA 4CNQA 1RMYA 2YJ3A 1Z4QA 2B82A 4YIKA 4IG4A 3MC1A 1CR6A 5ALPA 2PR7A 5AVVA 1XPJA 2YN4A 1ZOLA 2RAVA 3L8HA 1Q91A 1TJ5A 5AKXA 3QLEA 5E0OA 5AKLA 1IWOA 2ZBFA 3FZQA 2GHQA 4YCMA 3TLMA 3ZWKA 4BEVA 1RLTA 2P27A 3MMZA 4XQ0A 2QLTA 5A3SA 3NRJA 1U2TA 5AK6A 1RKVA 5AVZA 2D2VA 3EWIA 3ZI4A 1MH9A 3QUTA 2EAUA 3QUCA 3KC2A 4Y2UA 3U19A 3ZU6A 1ZD3A 1RC8A 5AHXA 3FPBA 2HX1A 3L7YA 3SKXA 3E81A 1Z4KA 1TA0A 3PCTA 4BX3A 3L0BA 5AM4A 1NRWA 2I7DA 5AW6A 2YMMA 3MPOA 1O08A 2FUEA 4F71A 2MU2A 3U7HB 3WGUA 3R09A 4BYGA 3WKAA 1K1EA 5IT4A 4NV0A 1ZRMA 2CN1A 2I34A 5A3RA 2IOFA 3ESQA 1T9ZA 1YMQA 1Z4LA 2NO5A 1L7MA 1Y8AA 3L1UA 5AKEA 5AI9A 1FEZA 3QNMA 4EENA 3N8GA 2FPRA 4XE5A 3OPXA 4JB3A 5ALDA 2RB5A 2G09A 1SU4A 3BWVA 5AI6A 4E88A 3D6JA 3I1YA 2WF5A 5AM0A 3ZX4A 2EATA 2Q4TA 2HI0A 4UM5A 1SWVA 3WK7A 1ZS9A 4Y2QA 2AGVA 2B8JA 3M9LA 4EELA 3EF0A 2NYVA 4BKMA 4KX3A 1N8NA 3PGLA 2Q5EA 1TE2A 2DQSA 4UARA 4NABA 3NALA 4JDPA 4O8CA 4EEKA 3L8EA 5ALLA 2OBBA 5ALSA 2FPSA 2JAUA 4BNDA 3M1YA 2C88A 2FEAA 5AVQA 4XPZA 1RQLA 4PNHA 3U7FB 3QUBA 2BY4A 3I76A 5AM2A 5AW5A 1RMTA 2P11A 3OCYA 4UU0A 4Y2TA 3L0YA 4UAVA 1L7OA 3PGVA 4ZEXA 4DW8A 3W5DA 3IRUA 3DDHA 2YMLA 3N5KA 3WK5A 4FE3A 3AR6A 4OD0A 3UMGA 3VAYA 3S6JA 3IJ5A 2PKEA 3RFUA 4UU1A 5AKZA 2MU1A 5AM1A 1ZRNA 3QU9A 1U02A 4L57A 1ZD4A 4BX2A 1U7PA 3QX7A 2AH5A 5AI8A 5AW8A 4YCLA 4FYPA 5FP0A 3SF0A 2W4MA 3L0CA 4YCNA
chains in the Genus database with same CATH superfamily
4M9UA 4B81A 4XOUA 4I2AA 4I5IA 4P0QA 1ZD2P 2J30A 5J2FA 2OK7A 3WGGA 4MHTA 2EG9A 3AINA 4HOYA 1HY3A 2A9VA 2H08A 1NJSA 3BMQA 3CONA 3H2JA 1VYHA 3MZ0A 1I7PA 1PJZA 4XJTA 3TTSA 3K9GA 2HXSA 4G9GA 4ZAGA 3MGIA 5EP4A 5TQVA 5KNBD 2HEGA 2YFYA 4M9SA 1XMIA 1I4LD 2JH1A 2GXQA 8ICPA 4P7JA 1FPQA 2IEZA 4AS2A 1PJRA 3VYRB 5JSKA 2MR5A 2VKQA 3U3RA 5JY1A 4ZOAA 2WILA 1NC3A 3G6KA 4D99A 3BUSA 4EQZA 3UCXA 3SJCA 1HPLA 3EJ6A 5HE8A 3BRQA 1B7GO 4OHWA 3VNRA 3IVRA 2VLIA 1KMCA 3N8IA 3NYIA 2I6XA 1T0HB 4DQDA 3UT6A 3C70A 2ZWMA 3FUUA 1D7AA 2YV5A 2X1HA 4A6XA 1QXSA 1WUKS 4IV8A 1GLNA 3RC3A 1CY2A 3PUZA 4WFQA 4HRVA 4OMDA 2WTNA 1BHJA 4CMIB 3WFJA 4DWVA 4YUXA 3WGIA 2J0SA 2O0HA 3ID6C 4W7HA 2FPLA 2XY7A 1BXGA 4I5DA 4GOND 4WE3A 3FMFA 3QVMA 1UP7A 2J48A 2JCXA 4DKXA 3MRVA 3Q3VA 3HYCA 2RK3A 4HDRB 5DTRA 4DVGA 2YVQA 1E6KA 1P8AA 2QZJA 2R97A 2XMCA 1SOUA 5L3SB 3JPOA 5D3QA 2W03A 3HNOA 4P0QB 1LPPA 3EHEA 1II8B 3FOZA 3WMEA 3EAQA 3INTA 2WJHA 3R7DA 5DBBA 1XZKA 1NUTA 3BMQB 3L3FX 2Q5QA 3IKVA 4H3HB 5KAIU 4J2TA 2GTHA 1PBNA 1M34B 2ZUTA 4I9FA 2IOYA 4JLVA 1W4CA 1HQDA 4MV1A 3SPXA 3B1ZA 2QMYA 4GXIA 4KDCA 4KMOA 2C9YA 3L8CA 4ZHQA 4B85A 3T0GA 1Z38A 1CK4A 3K05A 1CZUA 1FMJA 5F5LA 1VL5A 5ALYA 1MH1A 3ZUGA 4DLZA 1EB8A 5AVOA 3LRPA 1I4DD 1IYZA 2YJ3A 1AO3A 4KWCA 3W8RA 1WF6A 1COKA 5IN4A 3L8HA 3Q8LA 6AT1A 1FRFS 5E79U 1E94E 3L04A 1KQOA 4B9MA 2RAFA 3V3KA 1UIMA 4RHCA 2BEUB 2XBMA 1L3IA 1RHKA 3ZKAA 4ELUA 2FUNB 1G20A 4DL3A 1XKLA 3EFOB 4JBIA 2FOXA 2MSDB 3E9DA 2PUWA 1QSYA 1E89A 2VJAA 5F9LA 2C2RA 3MQ2A 4AMYA 4EGSA 3I5XA 1Q46A 2P9TA 4MQEA 4DWIA 4LSWA 3R5KA 1XALA 2O05A 2VDMB 4ISCA 3A58B 1LK0A 1PS8A 4EB6B 3IIKA 2W9AA 5C46F 3RU7A 4M0EA 1MABA 4P3KA 3H3JA 1VRVA 2YHSA 1JJIA 2BM8A 2WJWA 4HDSA 3PW5A 4BB6A 3PNVA 2ZI3A 2YHBA 5IIIA 2BFOA 3BBPA 1KR5A 2FQQA 2Q3DA 1RXEA 3DOEA 5K6AC 4GXQA 2XA2A 2EW2A 4IILA 1K1SA 1UQTA 3I45A 3SMVA 2O20A 3ICWA 1KY5A 5J0QA 4ZEVA 1SOWA 1T8EA 2BIFA 1A50B 4R3WA 1EP3B 2WYUA 1JMYA 2EP8A 2VF2A 2AI2A 4FYYA 2EH9A 1TU4A 4JA2A 3WGTA 4YUZA 4UAUA 3O4IA 4UVDA 1KYVA 1Z6QA 9MHTA 2EJCA 4YXMA 2QZZA 5AK5A 3ROMA 3TZQA 2P90A 4FCCA 5LLDA 2VJMB 3PQ2A 1XC9A 5H02A 5LL6P 2P8SA 1I2ZA 5FB3A 1A0PA 3TSAA 2G5GX 1XPRA 3ED5A 1X0VA 1E5TA 2YS7A 2RE8A 3AT1A 4Q37A 2O5EA 3UB4A 5CFPA 1W88B 2GESA 1ADFA 1ZA2A 1IN4A 4NQRA 4Y6PA 3F2DA 4QA9A 2AN1A 2RJNA 1OR8A 5EZYA 3BJIC 4P0PA 4K1LA 1EK0A 4F5DA 3PIDA 2X40A 1T5SA 2HO5A 4FGKA 2WLSA 1G20B 3RF6A 4NLZA 2C4WA 4BZPA 1X1SA 1T2CA 1JVBA 2C0QA 2BKUA 4Z6KA 4TMWA 2AJBA 4GBMA 3MWGA 4YFVA 3JV7A 1JXQA 2EFHB 5E9AA 1NLFA 3I2IA 5BSHA 4L95C 2H2WA 3VU1A 4NESA 5E1OA 4MQEB 3JVUA 2XNJA 2O5VA 4U2BA 5CCDA 4LV5B 2YYSA 1A96A 3VVLA 1YJBA 3T7CA 1R6AA 1YASA 5FYQA 4JC0A 3W6NA 3WQRA 1PZFA 3M83A 1T13A 3IKMB 1QV9A 2O2JA 5JS7A 1Y82A 2DBQA 2JS7A 1ULSA 1X7WA 1TK0A 3MR3A 3SEIA 3BXFA 3NHRA 1YC2A 5C2JB 1GTJ1 1VRWA 1EP1B 1JQLB 1OU4A 4JJEA 1AXEA 4JV2A 3VTAA 1TA4A 3ANXA 2P2SA 2ERXA 1FYDA 1OAAA 5IVHA 3ZWNA 3O8CA 4I8IA 1TCUA 1RYZA 3R24A 3K4PA 1B4DA 1V9CA 5LCXA 1RYSA 4INZA 1UWCA 4FN4A 4NIMA 3PD0A 1UZNA 5I5EA 3K30A 2AKEA 3G9UA 4ZQCB 1FRVA 4U2KA 1NV8A 4YJ3A 2ZIUA 3L4BA 3WGMA 2CNNA 4E1VA 3BORA 4YO7A 1KTQA 3S2ZA 3S2SA 4REOA 1JQ5A 5H2FU 2ENUA 2N42A 1N5KA 7REQB 2JHCA 2FW7A 1E69A 4ED1A 5DQIA 4TMFA 3K3PA 2F3NA 2ZIXA 4PAWA 2BRUA 5AKHA 5BW8A 5KYUA 3RRXA 4RA9A 3UAXA 1UWKA 4QT0A 3O0TA 4JC4A 4POOA 3IAFA 1UBEA 5F9FA 4FR2A 4K8RB 1P0CA 2BKLA 1MQ9A 5A9RA 1E3QA 1FFEA 4G4IA 3P7MA 4ZCIA 1JAXA 1QWSA 1OZFA 5EZYB 1HQYE 3PY8A 2ERYA 2AN5A 2PFKA 4B71A 4KVFA 4JVOA 3VVCA 1LDNA 2Q7DA 2ZJFA 4DG9A 2HCBA 5DM2A 1VZ3A 1P6XA 3L2OB 4X7MA 3FPCA 4X1YA 3DE0X 2H3IA 4MF2A 4MJXA 4TL8A 4BDTA 5KQLA 1KEKA 2Q41A 2X5NA 5FTLA 3VYTB 1Q17A 1W73A 1CD5A 2Q0HA 2XUDA 4ND7A 2IUFA 3CG4A 2WIAA 2WE7A 5JRZA 1BVHA 3IV6A 1PFVA 2QGFA 3DVLA 1MA3A 2GKSA 1SOMA 3L4JA 4Z4HA 2RB5A 1COWD 3QMWA 4E88A 2QTVB 1NMSA 3H9UA 1OXVA 1I2DA 2PFOA 5BQFA 3KUCA 2YX1A 1PEKE 4E4RA 3G9TA 4IF4A 1CRLA 5IJXA 5DLEA 4FFBB 4X54A 2VJPA 3NP9A 1U90A 1VDZA 1MC8A 1X7WB 2R0QC 1C1DA 2FRDC 4YDHB 1NQVA 3HY6A 2VYND 3IQGX 1NHGA 1I2AA 4W5RA 2RH4A 1PSDA 1UBCA 3IAEA 4NQZA 4RLFA 4WFIA 3ZQJA 3VDMA 3EMDA 1Q7TA 3AU9A 1Q5PA 4HNQA 3AGQA 3FFBA 2H3VA 5AI8A 3EY4A 1AKNA 1NYTA 5DNCA 3LECA 4YJ3B 2O23A 2ZIUB 4J03A 2ORED 2QJTA 1ZONA 4MV5A 5CX4A 2B9VA 1II9A 4ZV7A 1IUKA 4WSOA 9ICXA 3PHHA 1O95C 3EXG1 3PS9A 4PZUA 3GYBA 4P22A 3VC3A 5KAPA 1JPJA 2I22A 2OEPA 1Y42X 1XJWA 3PNQA 3ZE9A 4KQ2A 2YUIA 1F60A 1A8UA 1GZ4A 3ESZA 3IO5A 3PZPA 3QBVA 4I14A 3A4NA 5KYUB 2PRIA 1O03A 3PDWA 2R1VA 2GUWA 4S12A 1N2OA 5JYDA 3ZWMA 2PX3A 1OGIA 4R2HA 5L1JA 3AETB 3D6VA 4UEKA 1PKEA 4M1WA 5CB4A 3VHLB 1D3AA 1C9MA 3IL2A 4OJOA 3DLPX 5DM60 1XWIA 4QD3A 2D8CA 1Q3KA 1F8YA 4QEKA 4JFAA 3AESA 1X9IA 3OJUA 2B7BA 1ORRA 4PY2A 2F9LA 1JGTA 3EWSA 3HN7A 4YJFA 2V65A 2I8LA 1Y1QA 1RC1A 3I42A 3DC2A 3K32A 2CNKA 3I9LA 4PAQA 5GV7A 1K4YA 5SY6A 1RTTA 2O2HA 2VTBA 5F78A 3T9DA 4DBVO 2A35A 1E7RA 4X7PA 3VC1A 3A1DA 4Q7MB 3ZWYA 1PV1A 4H7DA 4NATA 3JRXA 3ZOZA 3WSTA 3GXOA 1BD3A 13PKA 4BNZA 3H1TA 2ILVA 4EMUA 2EKBA 4AZ3A 2W6NA 2ZYWX 3IAS6 4ZD6A 4R54A 1U49A 4QEZA 4U2EA 1RRKA 2H1FA 4LISA 1C1DB 4IHJB 4MPRA 5JYEA 4TLBA 3VU3A 2W6ID 1FRQA 4JL8A 4K3UA 5H3CA 1Q1ZA 1AQ6A 1FU7A 3JR7A 3DVAB 1UZUA 1D2HA 2I4OA 3KDPA 2W3SA 3HDHA 4DOBA 3M2TA 1QIKA 2AN4A 3M0EA 5DRTA 2DR2A 4QSMA 3IB6A 4NLCA 3AR7A 3GRUA 5K4GA 2XADA 1PQYA 9ICKA 5K4HA 2R5NA 4UFNA 3GDGA 1EUZA 1E9FA 4WFJA 3ZV7A 3OC0A 4HF7A 5FPHA 3PNPA 5BVHB 4DIMA 1E0SA 1NX6A 5KTKA 1J8DA 2OCPA 1ND5A 2IYUA 4FONA 3BEOA 2Q21A 1I7DA 1GZ3A 5H68A 3O8RA 3CVJA 2H3EA 1IDN1 3O3CA 1NJWA 1D8AA 2F9MA 5HKBA 1F2VA 5BY2A 3OHSX 4DJ5X 2UYGA 5CB4B 4Q3KA 4PF1A 1RACA 1KJWA 1CB0A 1IN6A 4CM8A 2DLDA 1W0CA 2DRIA 1QUEA 4HX9A 3AJ8A 1G63A 2VYFA 2W9BA 1Z4QA 4B6QA 4E46A 3DAFA 3GCGA 4O2BA 1EWTA 2FP4A 3V2GA 2DBZA 3GIDA 3QJGA 3H0LB 5KTSA 5L3VA 2RAVA 5HOQA 2O6LA 4YCDA 3T41A 1JS1X 2VP0A 3MMZA 2HA0A 1PZXA 2RG1A 1FSSA 2GZ2A 3I01M 2VTBB 1NKEA 4MSUA 1EX6A 1UC8A 1DKQA 2DX7A 3BIFA 2OVBA 3QVOA 4RIGA 4H1UA 3V4VB 2MDTA 5BOLA 1X14A 3QEBZ 2VK2A 5A9SA 2CFIA 4R9UC 1YBAA 3L93A 1A4IA 1KAGA 3WWDA 3MJCA 4BRWA 2B4QA 1NK7A 1ZBQA 4Q18A 4DZZA 1T2EA 3JATA 1BMDA 4OSEA 4CIWA 2XQJA 1HTTA 4FEYA 2PYIA 1LXCA 3F6CA 1CUIA 2NSLA 4NSNA 1VP3A 1OCEA 1BFUA 3E23A 3SK0A 2J41A 4UBMA 4IQ0A 2I9PA 1P31A 2ESRA 4DPMA 4MRPA 1W36D 3PPWA 4QBFA 4OXIA 2NP7A 6REQB 3E7WA 3MMXA 4UU0A 1USWA 4X95A 5FOVA 2ZUFA 8ICGA 3PPXA 4MUNA 5J2BA 1GRCA 3T7EA 2GCEA 3UQ0A 1YQWA 5EXSA 3QX7A 1U65A 3SZ2A 2X4IA 4BVHA 3LMKA 3OD1A 2FWIA 4OEHA 2AK2A 1H8EA 3QELA 5JTIA 1C7RA 2FWJA 4QU5A 2VPTA 3SV4A 2W0MA 4UQPA 3V7LA 3L4PA 4HUQA 1Y5LA 5C3MA 2B98A 1G5IA 4IIBA 1M66A 1N2ZA 3DE3X 1UKAA 4OO1J 4IV0A 1JAHA 4CM8B 1TYDE 3X1DA 1PJQA 4BEBA 2BKVA 4G8DA 2QK4A 2R68A 2QU7A 3KQTA 2ISQA 4PRYA 5J0WA 5B2FA 1DV2A 2IY9A 1VPEA 4WGGA 3RWMB 4D8UA 3SD7A 4JR2A 1CDOA 4PNEA 3RDPA 4XD2A 4Y2XA 5E4YA 4NNPA 5B1YA 5DGDA 1T2UA 1GFZA 2DXIA 3BE5A 4OI0A 4Y6GB 2F59A 4DT1B 1FP6A 3JQRA 3LA8A 3G3EA 2VHEA 3L1JA 1MENA 3OH8A 4U7DA 4J9QA 3LD9A 3DE4X 3O9MA 4XSVA 1M72A 1E8NA 4BVBA 9ICBA 5BUSA 4QXQA 3MWEB 4LCEA 4C4SA 5K01A 5A9SB 2VDJA 1G41A 1XEWX 1D2NA 1EINA 5DI9A 4WNAB 4LNUA 2IKQA 1FFSA 4Y6LA 4X97A 1QGZA 1V8FA 1WCYA 3F6BX 4P4TA 4KMUA 4TLEA 3OQ1A 4DV6B 5DYGA 2OGZA 4JR0A 1DEAA 2C5HA 1GPH1 2CLKB 4ALJA 5F1OA 7ICNA 1NM5A 4D57A 2DECA 4W5WA 1F8FA 1ZL2A 4HDCA 1MPTA 4N8SA 4M1QA 4C6TB 3V7WA 4RTJA 4NE9A 2NO9A 5JR3A 4KGVA 4L51A 4OG2A 4LJ4A 4Z6FA 4ONEA 1RHMA 4LRWA 5I9BA 1XCLA 3BN3A 3QRWA 3VUEA 4IIVA 3R5SA 3QKIA 2XUAA 1A2OA 4IINA 2XSZD 1YUNA 1TJPB 2IX9A 3QENA 4NFYA 1IPHA 4LHYA 1A5ZA 5LIPA 2V97A 4LJKA 4QJ5A 3FFXA 1WXDA 4L5CA 2AFIE 3UC9A 4HUQB 1KOJA 3HJAA 3GPLA 4UUPA 2ESEA 3PXXA 3UKJA 3ACCA 1SXJE 2J4DA 3KZCA 2QD5A 2P2LA 5CIWA 2ZJ0A 4F4ZA 3KEMA 3AI1A 4CT5A 1DAIA 1W19A 3HADA 5CM2Z 2MR6A 5G4KA 2XZDA 4IIYA 4UTOA 1Z5UA 4HWSA 5EL0A 5JZSA 4YUYA 1J0DA 8ADHA 1A1SA 3T3PB 4CQJA 1LLCA 3KHUA 4XIYA 3H11A 2LDXA 2OBXA 2WD7B 1RM4A 2H5LA 3RAQA 3CWCA 4O4LF 3UXHA 4U3JB 1BIFA 4NARA 5SY4A 2WA2A 1JHAA 3C3MA 3VXKA 5ESWA 1Z9BA 2QROA 1S1MA 4QAJA 2AOTB 4LNUB 4F71A 2P2CA 3EYZA 3MXOA 3OZSA 1N6IA 1ZOOA 4KFUA 2XTZA 2A86A 3PKIA 5DCWA 4UULA 2ZIWA 2CBZA 1AQYA 4WRRA 3FKJA 3AG6A 4BTVA 2Y9MB 1OB5A 4H7HA 4AF8A 4IKPA 4F4YA 1TVEA 1Z17A 2YNMD 2IYTA 2O8FA 2B7LA 4Q02A 3EQ7A 1G5TA 4KSBA 2P4QA 2AWOA 4QG7A 1J23A 1RHRA 3I5AA 4H6PA 3QVXA 2ZE7A 1KRHA 2DTDA 4R98A 4XDZA 3IM1A 1P6QA 1EVKA 1EWKA 3VOAA 4QUHA 3MCVA 3CPHA 1NVWQ 1H2FA 4F3CA 2NTJA 2BELA 2P6PA 3ZDFA 4IAOA 3GIKA 1YIAA 4U8HA 1ZGCA 1QG4A 1SRQA 4Z9XA 4M9CA 4E5MA 4EHKA 1UK6A 1BHQ1 4BVFA 3KAJA 1PR2A 4QWDA 1AZTA 1Z29A 4GLFA 4Y2HA 2A0UA 4HAIA 3K9NA 2AEJA 3R8CA 1KY4A 3GJTA 1XQYA 5A0FA 3FI9A 4G9EA 3M7IA 5G0WA 4PGYA 2ZI6A 1YSCA 3RTGA 4AS1A 1RWQA 2QU8A 5J43A 5CLHA 1YVEI 3LYHA 5JAUA 2D74A 4MS4B 3HGMA 2K8BB 3E05A 2OKGA 1E7WA 3LCRA 3ZU4A 4FR0A 4DL4A 3FOAA 3KVOA 2QQFA 4JELA 2PU5A 1YDMA 4LDRA 1ZZGA 1QTIA 2B83A 4Z6EA 1K2WA 2IEDA 1BMFD 5JH7F 3MRXA 4OV6B 4BFSA 1PGPA 2GARA 3HKDA 3JQGA 4B79A 4KP7A 1FB5A 1XTVA 5B1SA 4MI1A 4DZTA 3H11B 5ALQA 1XOIA 1LF5A 5BXYA 2ZVQX 2E4AA 1ORWA 1XZMA 1L7EA 4F86A 4BMZA 2NZXA 4CKZA 4WXRA 3OEEA 5EJEA 4B3TB 2KK0A 3L05A 4ZU6X 4LYFA 1KA9H 1EK1A 2O7SA 5FEUA 3DMNA 3C6QA 1F1BA 1QO7A 2LVBA 3S2YA 2DSTA 2IXAA 1SV0C 2XVXA 5KBYA 1ESNA 1F20A 3T3NA 2ZIWB 3L8MA 3PQ6A 1DFIA 3IUYA 5FF9A 2YXLA 3AW8A 3HQ4O 3HUEA 2AVDA 4EL0A 5F3XB 2O57A 1L7AA 4FCWA 3A6FA 2O8FB 5E1DA 2PMWB 3R9IA 4ALLA 1N5LA 1U5BB 4DLXA 3T4EA 5K0GA 4PGXA 3PGJA 4MVJA 2HWWA 5K8UA 1BQ4A 3SS9X 5J0YA 4NDZA 3G02A 1HNWB 1ZH0A 4UCWA 3TMAA 4YXWA 1JYEA 3PEWA 1SHZA 1SL2A 3WGYA 1PFKA 4XUEA 5EKSA 4YJGA 3WA6A 3AEUA 3KJQA 1HGXA 1TEZA 2POCA 4FZ5A 4HYTA 2HW8A 5THQA 1VYTA 2O8CB 4HFRA 1BWPA 4NJEB 2WMOB 3U3OA 4DPLA 4FOPA 3PUHA 1CUHA 3AFMA 1YI1A 1QHNA 1XF1A 3JYHA 4AY5A 5EGSA 4MIYA 1E0AA 3EGIA 2LIVA 2WUFA 4LRYA 2W2LD 4PQFA 3X0DA 4XIIA 2BGUA 1WNTA 3FPGA 2Y2UA 1X74A 1NYLA 1OXSC 2RGNC 4ZYLA 3KJHA 1DKUA 1NQ5A 1XTSA 4ZAXA 3DKRA 4AJ9A 3UWDA 3HKDB 1PJ2A 4CLRB 2AK3A 3R0JA 1DHRA 4E21A 1CY8A 4EAQA 4C5AA 1Z12A 1U8UA 2YVLA 4G01B 1O8BA 1TPYA 4HR7A 2NPFA 2JCVA 4U8GA 2CFOA 4GOKA 2FRVA 3IT1A 3ZK8A 1ZN8A 3DBLB 2QG6A 1ZDMA 5F9HA 4C05A 4K5QA 4M21A 1US8A 4NLBA 4F1WA 4ZO8A 3BBLA 1JI7A 2I76A 3SIRA 2IKSA 1PUZA 1SG6A 3LSYA 3BXXA 4ED2A 1ICEA 3RD5A 2DHEA 2YZMA 5D3MA 2K4EA 3FZYA 3L1UA 4RVDA 4JB3A 2IHNA 3TUJC 2EATA 5CW1A 4OREX 2J87A 2Q0QA 3IN5A 2I6GA 2IFTA 4ZQGA 2J85A 4IUYA 2OM2A 3KP1A 1Z7YA 2DQNB 1RRMA 1XQVA 5KFGA 1U2GC 3PX4A 4L0MA 3E22A 3U4IA 1XRSB 2H59A 4NOKA 2P0AA 2IYQA 1EP2B 1D2RA 1B6SA 4FTWA 4G0NA 1ZI9A 3DTVD 3AEUB 1Z5VA 1GGHA 3CF4G 9ATCA 2BI8A 1RIFA 4OQ4A 4BP9A 4TZ6A 5DP1A 4D4LA 5B3JA 1JSRA 3JWPA 2Z1MA 2Z8YA 2VAVA 1NUHA 4RCVA 5C4GB 4KR6A 4YUVA 3COWA 4AYBF 2F77X 3R7SA 2ZJBA 4OQPA 2R6AA 2XUPA 1FDTA 1E60A 3QNWA 4ZRNA 1ZN2A 5HTKA 3UIEA 3KHTA 3A10A 4NICA 1J2YA 3H5OA 1ELOA 2XYGA 1NKCA 2G1PA 2P7HA 1YJ5A 2BCRA 2EGGA 1OU0A 3RYCA 1NJZA 3TTXA 3IR5A 4K2AA 4LZAA 2PMCA 2W8BA 3HA5A 2G40A 4PW0A 2CNBA 1VLJA 4N5IX 1GUZA 2GZ3A 4BIMA 3SNKA 1V2HE 1SFRA 1WUIS 2FE9A 1QAMA 4DF3A 2F4NA 4GOLD 4ZAFA 4LK3A 3W2GA 2ZBEA 4WKCA 5FO0A 4ZDKA 2OGWA 4MVYA 4D9KA 3MJEA 1UPAA 5KFUA 4DQIA 2ZZKA 1LDGA 1Z6AA 4H3VA 5T4BA 3ZVLA 4ZO6A 4DFPA 1U47A 4EI9A 1IWBB 4PYMA 4DBZA 1OUQA 1S3SA 4P7FA 5JCJD 3KQKA 2F48A 3TCKA 2B30A 2I4IA 1R4MA 4TSFA 3FTNA 4V0RA 5GADl 3I4FA 2DWUA 4C3ZA 4M9ZA 3BZUA 2Q29A 2BF7A 1LRLA 3GBPA 2R7NA 3DVRX 1WV1A 3HL0A 4R6XA 2D7JA 3P2KA 3GARA 3OP1A 2AQ0A 2VHVA 3AKEA 5HS6A 3H0MB 2HJ9A 2JH3A 1L7XA 1E32A 5BQOA 2O2EA 4O1MA 1DKMA 2P0EA 5GONF 2JVJA 2WINI 5KJCA 4MLDA 5HM8A 1J99A 1DDOA 1UBRS 3TARA 1V6CA 4QZ9A 2OYRA 3H87A 3KD2A 1PFUA 4NAVA 5EGNA 1IY8A 4HGQA 1G4AE 3U1BA 1J39A 2XKKA 1NR1A 5KFFA 1MZVA 4JGIA 4ZANA 3GILA 2X5JO 4HCJA 3WA7A 4P84A 1D8LA 4O9MA 2EAOA 3FCYA 9ICWA 5CMLA 4QHSA 3UJCA 2G6BA 3LC1O 3IV9A 2IV7A 3DD1A 3RT1A 4TUQA 3UT5A 3V7FA 4HXGA 4II2A 2P1RA 1YQDA 2Y66A 1PWYE 3N7AA 4QULA 4ID3A 2AYYA 4UMEA 2XBLA 3AI7A 1Y8ZA 2QR2A 1MO4A 2BSQA 1UKEA 4MWTA 2FRXA 3IUQA 4ETMA 4RPZA 4Y8VA 5KNDD 3VZCA 2IZ1A 121PA 2WWWA 4U2GA 4TTAA 1FFCA 2X2EA 5JZ9A 4F5QA 2YN4A 3EPKA 1AY0A 4GFJA 2VYVA 3JQFC 2GK4A 1RU3A 4MLZA 1QX3A 1E58A 3N0WA 1KPHA 1Z7GA 2B94A 3A14A 3BAFA 5TY0A 4I9HA 3DEIA 1I0ZA 5BW5A 1RWXA 1KZ4A 4AWBA 3TSOA 1TA0A 4B7ZA 4KLIA 1AHHA 3L7DA 4UQLA 5TEWA 1R4MB 4MINA 3IDOA 1SVSA 1HE2A 2Y6VA 5HQJA 1PJ3A 1SCQA 4M36A 5IFLA 3RI3A 1H0KA 4HVCA 1TM3E 4G25A 3R75A 1X9SA 4HH3C 5ARCA 5ALDA 4Z4QA 1ZESA 1QZXA 4RLHA 1IRXA 1HQKA 1YJ8A 2XMBA 2YUTA 2IYVA 1DCFA 8ICAA 1XZJA 4JNKA 3MMSA 4RIFA 3M1LA 5HKLA 4B80A 5KTMA 2VT6A 3QWAA 4L3VA 1ZUIA 3OQMA 5H9WA 3I92A 4QDZA 4KXQA 1PJLA 4B7XA 4H7IA 1Z0KA 2AR9A 4I99A 4UAVA 4BQNA 3KFUF 4DLRA 3I3OA 1Z8DA 4ZVPA 3TANA 2O8BA 4G24A 1N4DA 4NH4A 3RFUA 4XR4A 1TNDA 2B5VA 1E2MA 2ZPUA 4RQ5A 1ZD4A 1PWXA 4AKTA 3AHJA 3D5TA 4MB0A 3OJWA 2CWDA 1UPTA 2R62A 1E1KA 4TS1A 4P32A 1CSEE 2WF6A 1NRIA 5CCEA 5ES4B 4ZQFA 3R9KA 4IDNA 4TRJA 2ZT6A 1ENYA 1OWNA 4H15A 5IANA 3H18A 5JRJA 2Z3ZA 4QXPA 2N46A 5FA8A 1RJGA 2DH5A 4EVQA 2QKQA 3MTJA 5JATA 1GNQA 2C61A 4XWGA 3K7EA 1T0UA 4E5KA 4QFCA 2SECE 3V8EA 4PNZA 3NTLA 1GGFA 3ND5A 3F5AA 4JQCA 4K6OA 2FMIA 1T1IA 1DDGA 4DC1A 2MINA 1L1QA 1SG9A 1G9XA 1VTKA 3ZDZB 3UPDA 1ADYA 1XZPA 4LZWA 4E94A 4OBBA 3GFRA 4R64A 2SNIE 3TLKA 4MYRA 3GJ3A 3LXXA 3C21A 3WZ2A 1HNNA 4L85A 1G3UA 4C0QC 1QFJA 1KJIA 4IJWA 2AHOA 2MYPA 4RF2A 4Z3DA 2VA3A 2R5WA 5TIIA 1NVKA 1O9BA 4R1UA 3O91A 1KS2A 2PFQA 2CY0A 1GT91 4OJPA 1AXGA 3IC5A 5BR4A 4GGOA 4ZIRA 2H5EA 2IPMA 1SJ9A 1CF9A 5CHGA 2X58A 1F0PA 4ODIA 2ZB3A 1QSLA 1V5IA 2WKQA 1GG8A 1CLUA 4RHFA 1S2DA 1T91A 1T1GA 3FNFA 2V59A 4KQFA 3T7DA 5KG1A 3RG2A 3TNLA 2OORC 3HI6A 5LR6A 3V4ZA 1J9GA 2JIRA 4TLDA 4O2AF 3M9OB 3M89A 4AWXA 2G82A 4OKNA 1YCGA 4E2WA 4IXMA 1DTSA 5CRIA 3B9PA 3LQ4A 4MGZR 1KFDA 1AQIA 3D3JA 5ECWA 2PXHA 1QOZA 4MHSA 2P2ZA 3TR6A 5GM2A 1E3WB 3Q3CA 3WLIA 4J4BA 5GZ1A 4XRRA 1DBSA 2NX2A 1MOPA 4C7VA 2FOLA 2WWTA 1HZZC 2ID4A 4P1ZA 2V98A 3EZ7A 3ZBTA 2CLMB 1T3NA 4WHMA 5CG1A 1LTQA 9ICGA 1ZC4A 1VMKA 1SU8A 2X8LA 3QOYA 4M0LA 8ICEA 4LMRA 5E6RB 5A3JA 2BPFA 3IBFA 2QV0A 4EUSA 2AUNA 3OPMA 3R20A 3GFFA 3FB4A 5FX2A 1AUPA 4OM7A 4HNTA 3FAZA 1N5XA 5DB7A 4GOOD 2FV8A 2NAFA 4YASA 1CUEA 3NEYA 1RBZA 1JQEA 2VXCA 4QWBA 1K5GA 1Y6GA 2BM0A 2PLFA 2EZ9A 1CUYA 2GEBA 5CU7A 2F4VB 3ZR4B 1KO4A 2C83A 3MEQA 2FFAA 1FIQA 2W0SA 4ZGGA 2X0IA 1BMQA 1TF5A 1LC0A 4LYJA 2VP6A 3HZOA 2B4KA 5KFDA 4FBLA 3RAJA 3EWIA 1RWNA 3HXOA 4Z9FA 1RR6A 3X1WA 3IP1A 3K09C 1ZVKA 2FJ6A 3AQIA 3MPOA 3DZKA 4WPGA 1DC6A 1SCDA 2PBRA 4CEJA 2Q5FA 3VU0A 1O94D 3H3FA 3OLVA 4TKMA 3NT5A 1EGHA 1XTKA 1DXQA 3A6ZA 1QM5A 1E5LA 2BHNA 2AMVA 3LQKA 1SU4A 3HCRA 2BE7A 1J0BA 2PJDA 3WIBA 1N2HA 1N92A 3I9KA 3W5HA 3UJPA 4EYQA 1OOEA 3V2IA 4P38A 5BT8A 4XDGA 4W5NA 4P2HA 3HUDA 3U7FB 4BFUA 4YHBA 2WPDA 1F0KA 3L0YA 2KVSA 1MGPA 1E4EB 1T9GR 4DB2A 1FBTA 1W5AA 2H9IA 3TAHA 1ESZA 2VNIA 4TV8F 3TLCA 2IOQA 3OESA 3VPBA 2Q5JA 1M1YA 3Q5GA 4XGIA 1WF3A 4GM1A 1Z39A 3B12A 3P2OA 3CX4A 4XM1A 3ZY4A 2J7PA 1RRFA 3ZTYA 1ZM9A 5DNDA 4C4PA 1VKJA 1Y4ZA 4F8EA 1KI8A 4YHHB 1WS6A 1RE0A 2FFJA 2WHEA 4PYOA 1K7FB 4G67A 3RSCA 3LHIA 4WCFA 4MKZA 5EJ5A 2YV4A 2ZSBA 4DL2A 1LBTA 4JUBA 1F4VA 3GNQA 4CGZA 4OUDA 4DJJA 2Z58A 1U8EA 3ZBUA 4ZT7A 1UKCA 1A04A 1AKMA 5GOZA 4BJ1A 1N2XA 4C7KA 3QMPA 4JOQA 2UXDB 3W8NA 1WCV1 4DCSA 5UKDA 1K4KA 1U3UA 5ALKA 4BJQA 3V8VA 4R51A 5IIJA 2PZKA 4Q3CA 1TZKA 1QTNA 2DHDA 1DAHA 3EPHA 4R9VA 2ZVJA 5FA6A 1WZIA 4Y2SA 3SIPA 1Q11A 4YMUA 1SOAA 4OGLA 1DQSA 2EG5A 4OA5A 1CVRA 1O0SA 1DARA 1Y48E 2E8OA 3IQZA 1A2KC 3CH5A 2WKRA 1CYDA 1I30A 4JVMA 4U9IS 1Z75A 3UJ3X 1YB6A 1OI4A 1K75A 3CB2A 1YKSA 3G8CA 3LOPA 3KL4A 4C29A 4FFWA 3VHRA 1KARA 2JH9A 2H0QA 3PRYA 2BEWA 1DE0A 2EKDA 4W63A 2A58A 4RQBA 5C8ZA 2G9ZA 1USUA 2H65A 2B4RO 2OILA 4E4YA 2W8ZA 4UD2A 5DDMA 1PCXA 3I58A 3QX8A 5ALOA 2WFLA 4NPAA 1OYWA 4QGHA 4WBNF 1ZJ6A 2KZMA 3RK4A 3HN6A 1KZ1A 1BFKA 1JR3A 1ZUWA 2HF7A 3NLLA 2NP6A 2PL3A 3AUKA 2FVXA 4K40A 3D4LA 5KNBH 1CEXA 5MDHA 2C4HA 1E61A 1M1YB 4H7FA 2HCTA 3ONDA 4QTUB 1F7VA 1Z83A 2CMHA 3NX4A 5DBOA 3LBAA 2HRBA 3UXEA 4FLEA 2WF9A 1E63A 2VIXA 1WP4A 3B8EA 4WCFB 4ABTA 1O1YA 4NMWA 1BXGB 2GN1A 3W05A 3W5BA 1CP3A 2FPXA 5DLFA 1V3VA 2FOIA 2LP4Y 3KPWA 1A27A 3LCMA 3HUFA 3T3MB 1T8WA 4EDFA 1UODA 4QIHA 1N36B 2BI4A 1MJGM 1FP2A 3TLYA 1MOQA 3L8YA 4H3KB 1A6SA 2OP1A 4Q9NA 5BW4A 3X1MA 4CM1A 4DR6B 2VWQA 1TXGA 2J6SA 2Y1KA 2PD4A 3MCUA 4FFRA 4BFXA 4YT8A 2BZ0A 4QZBA 5JPIA 2YQ5A 1YR1A 3OY2A 4O5KA 2MJLA 1PL0A 2W98A 1ZN9A 3P9SA 1U2DC 1JA9A 3CH7A 4F4FA 4C0WA 4GP7A 4KMOB 2OCEA 2H3ZA 4ZHQB 2WTBA 4R81A 1FE8A 1NI3A 4FEAA 4L22A 2X7HA 4C7MA 3OF3A 4JY7A 1TU3A 4FOLA 3L7KA 4W9RA 3PXBA 1P4JA 3T5BA 3QPUA 1JQDA 4D43A 3RH5A 3H9JA 3IQXA 3ZK7A 2BGTA 1J25A 3LQRA 4TTIA 1RYUA 2WFLB 4AW9A 1KI1A 1XQ6A 4DDWA 2AS0A 1WX1A 1TGVA 1CEQA 3WO0A 3C3YA 4IQ8A 1GPWB 2QVZX 5TARA 2JFVA 2XEDA 3KKAC 2VT2A 1D6NA 1Y0BA 5E1MA 4F3RA 1SCAA 1GGVA 1THGA 3NB0A 3WC4A 3PICA 2E1PA 1OLOA 5IEBA 3R1IA 2WRZA 5AM2A 3KHHA 5L1LA 1YHYA 3FD8A 1J2NA 3LUGA 4GQIA 1MX9A 5IG2A 5BQPA 4CMAA 5JPDA 4GNRA 2WUWE 4DEVA 4PN3A 1D7OA 4LVSA 2F44A 1ZQRA 4ARIA 2XQIA 4AZVA 1FY2A 4CM9A 1FFUA 1WW3A 4DUZB 2IHZA 1NXPA 3O26A 3AHEA 1MABB 3CW2A 1WD5A 5JS8A 2ZJYA 4HDSB 4INPA 4R63A 2ODTX 3DDCA 1CZHA 3ZW8A 3BCRA 2YICA 5C80A 5ESXA 1BU8A 1QJ4A 4FNOA 1RHUA 1GYQA 4HQFA 1SVMA 3GY0A 1L9XA 2OYSA 4HLNA 3ZVMA 1W5FA 2O1SA 1QKIA 4CI9A 4CKEA 2H1VA 2X7JA 3G5MA 2AGQA 5KWEA 1MQ8B 1ZH4A 4RMJA 1H69A 4E5VA 3WSVA 1IY2A 3R74A 5DB4A 2VDLB 2QZ9A 5FD8A 1K7EB 3ILSA 2CE2X 1NWCA 4IR7A 3UPTA 3RVOA 1O9GA 1U7XA 1EKXA 4WKOA 5KFEA 2I2CA 2HREA 1GPLA 2ZYAA 3JW8A 3I01A 5TV2A 3C7CB 2D59A 1PJ4A 1EZ1A 5A03A 7ICPA 2BGKA 1YS6A 2BDPA 1CFZA 3WGVA 4V0NA 1LQTA 4Y0VA 4J4HA 3PCRB 4Q82A 4AS3A 3I34X 5J58A 5CDFE 2FR1A 1T3SA 2IOHA 3TBKA 1EVIA 4ZVVA 4IGIA 3MFYA 3PGXA 3RARA 3L77A 4D4IA 3WLOA 3FCEA 3E58A 2NQTA 1J5PA 5B1EA 1SM4A 2CDCA 4P0PB 4YJ2A 4LE2A 1CUSA 4KPEC 1Z74A 3H5AA 5H4GA 1IBRA 1U1IA 2Z1DA 4CEIA 3CUUA 1WA5A 4DMKA 3LY8A 5GJBA 4M2LA 4W5JA 2DY1A 4D41A 4BQOA 3HC7A 2BLNA 5E6SA 3LC0A 1OT3A 4KBFA 3VOTA 1OGYA 5CAEA 2QRZA 5H83A 4CDRA 1P3DA 5FTJA 4EWLA 4R8RA 3R23A 2DQYA 2FLVA 3U60B 5DJ5A 3WLAA 1U31A 3B7GA 5E0KB 4JB2A 4DDUA 4ME6A 4MUIA 3STYA 3RC7A 1JHPA 4JEIA 3DO5A 1ACLA 1WHTA 3SQLA 4FZLA 3U7EB 2IUUA 3SDBA 1W2WB 3U7IA 4OM8A 2Q5OA 3AB8A 3NIGB 2JHPA 3H5VA 4NYJQ 1H93A 2I4TA 2HXGA 1LPAB 1BX1A 1R27A 2QP9X 2C1XA 4Q66C 2D5LA 4H4EA 1VECA 3KXIA 5JCZA 4I2GA 2W2NA 3D4OA 2DQKA 3SF8A 1QVWA 3SIWA 3WGHA 1ZSYA 1O96A 3I05A 2WNSA 1GPDG 3P20A 4E07A 3D7NA 2PVCA 4HYQA 5A7GA 1RC8A 4M99A 3A4IA 1BWQA 1X8JA 2ZIXB 5JMWA 2PI5A 4RA9B 2P3OA 3WO1A 1TDJA 2G0TA 1W5TA 5DO9A 1KZGB 1GU0A 1R5JA 2C4UA 1TMOA 1RI4A 2RHMA 1WUHS 2AT1A 1VG9B 4E5NA 4LF4B 2X3YA 2HWKA 1SXIA 4O4IA 1ZS9A 1ZQSA 1IQ0A 3ADPA 3C3DA 4CEIB 3CTPA 1KEJA 4X1YB 5E6SB 4QLBA 1G0NA 1DWUA 4TRNA 1SC3A 3NORA 3T9EA 3TFSA 3WL8A 3KS9A 4MW7A 2QW1A 2QZPA 5FI0B 2ET6A 1BKYA 3QI2A 1BD4A 2GBCA 5KAMA 1Z8NA 3UH0A 3ORHA 4NBNA 2FSFA 3DT6A 2JPDA 1HFEL 3WIEA 3ZDYB 1KAMA 2A9OA 5EOZA 2QTRA 3PO5A 5FBQB 2WTAA 3RSLA 5CTJA 4QASA 3O84A 3HT3A 2J3DA 4TROA 4ZXPA 5JD4A 3QXJA 2OXFA 4NK5A 4UTNA 2WABA 3H8SA 1ZMBA 3E53A 1CRXA 3LPMA 1RWVA 2YJZA 4R16A 3ZIAA 2NLOA 1T0PA 1FF9A 1GJRA 2QX9A 1KZYC 3SHVA 5F52A 4OA8A 1J9EA 1HE8B 4B75A 1MO5A 1U0EA 3AR5A 3OPYA 4A92A 1O96B 4F2WA 3CRW1 2ZU6A 3R8XA 1YL5A 2WWHA 3ANSA 1GVHA 4TZTA 4C0JA 1FX1A 3WWYA 1RFLA 1ZICA 1ACJA 4PZCA 4KPUA 5AKJA 4BLRA 2NQ2C 4B9TA 4XDYA 3GVCA 4W7SA 2CLLB 4G1EB 1CCWA 4E70A 4QO8A 5DTEA 1NMXA 2WQZA 8ICMA 2R1VB 2BFMA 4IG9A 1EWRA 3QBDA 3FA2A 3OHBA 2QN9A 5TGDA 2D3TA 3FNRA 2WB1F 4EHAA 1KK1A 5CNMA 3FTPA 1KXZA 3MBYA 3P2EA 3EEFA 1QF6A 3AESB 1M8JA 4C5BA 3HM9A 4YJFB 3COPA 1IU9A 1NULA 3HLYA 4I3FA 3AP3A 3ELBA 4NJOA 4MYSA 1F5NA 4PH5A 2JJ1A 3I5YA 2PUJA 2QI9C 1SH7A 1LBHA 1IAQA 5JVDF 1ZMTA 1H66A 2QM8A 2H29A 2R11A 2V7UA 2JFGA 1NVBA 2F43A 1DZIA 3JD0A 3AUJB 2JH8A 4CMCA 4AZ3B 1Y5IA 2H6EA 2EEPA 3J7AC 3IA7A 3A06A 3QVSA 1FFDA 2QL5A 3RU9A 5AQEA 4QZFA 1I2CA 1AF4A 1A88A 4CN8A 1AN9A 1FTQA 4KI7A 2D2XA 3KYDA 5AW2A 2VJNA 1ZM4A 2QOEA 4GWGA 1WB6A 4MUYA 1A9TA 2ISOA 1XLTA 4LSMA 5JXJA 1HSOA 4D3FA 1RZ3A 3ICCA 4R3NA 1JDVA 1EIZA 1N2CA 2PWYA 4LXGA 1VKOA 3HJRA 2XD9A 3EXG2 3WNBA 2WQ6A 1M6NA 3YASA 3ZI0A 3TFQA 3A2LA 3I8OA 1V8PA 2E5WA 2PR7A 1UP6A 4KPUB 2AG1A 3ZJVA 2ZBFA 1U6KA 4RPLA 1H1DA 1H05A 2P5UA 4FC6A 4MIEA 2XT9A 3EH2A 2YOHA 1KDOA 3VPCA 4Z7NB 4XGNA 2PMZF 3H5TA 5ESDA 4U7GA 3AOEA 4CTJA 1D8TA 1DWQA 4BX8A 4K4GA 1KTVA 4ZJZA 4YRZA 3B6ZA 2HA2A 4QICA 4XD7A 4YRBA 4CKYA 3ZGNA 1Q0ZA 4QZGA 3LVWA 4HGYA 2W9BB 4BECA 4FINA 1WPXA 1V0JA 2EQ5A 3DBOB 5C4IA 5BUQA 4O2BB 2FP4B 2I87A 3D6AA 1Q21A 1OC2A 3T3FA 2R66A 4JSYA 1JFFA 4C8NA 4F9TA 4M0AA 2TMKA 4DV4B 2X0NA 3Q7TA 1WUYA 1KORA 4O1HA 3FHLA 2P11A 3G2LA 4EFLA 3JR3A 2FWNA 2REXB 4W7IA 2F43B 2JDID 3NZEA 1TFUA 3UGQA 1H2AS 1YQUA 2WWIA 4KXXA 1VBNA 3ITNA 4DA6A 3Q3GE 1VCMA 1X80A 2YIJA 3JATB 4FIZA 1CUWA 3G1WA 4USAA 1JQBA 3MGHA 3KYDB 4JLNA 4NZ9A 1ULTA 1L7VC 1RYFA 3O3OB 4DIFA 4PHHA 3V72A 2HHUA 5CDSA 4Q3NA 2GTIA 3V1MA 2I29A 3AIOA 1JKMA 1JUDA 4B6SA 2KWIA 2ORVA 4PTYA 3AUYA 1C81A 5FLXA 4TPKA 1WMAA 1N2CB 1V8OA 1KR2A 5TS2A 1H3FA 4C06A 1JG4A 1GKUB 1FU8A 1BRMA 1P9LA 1NOJA 2OL4A 4BNXA 2J08A 4JXKA 1PFGA 1NKVA 3FKSA 1QBKC 4CT0A 5BRJA 1IHOA 3ZV5A 1NXWA 4X85A 3ZG6A 3KVNA 3C24A 5AVSA 2FGKA 2HDNB 4ZGBA 1OX6A 3ADCA 3MGKA 4QSHA 1E1RA 3QELB 4P31A 3W7BA 2DGZA 1RQRA 2X9NA 2CV2A 2QTGA 2WKWA 1GTVA 5BYBA 4A10A 2CJXA 4ZDJA 2FZLA 2GAOA 3HYRA 4PAOA 3H1EA 4HWOA 2GK7A 4FMCF 2E6KA 2R6CA 3K0KA 5EKXA 5P21A 1Y3AA 4YN4A 1VXRA 2CJYA 1DIRA 1YOBA 5LYJF 1KKXA 3EDOA 3H9CA 3JXEA 2WSLA 2IHKA 4EHFA 3T5PA 5DISB 2GBFA 2HHLA 2HK8A 1QRRA 3ETEA 3O83A 3A9RA 4FGSA 4TMTA 5AJZA 3ZYZA 3KJGA 3PV0A 3U44A 3ISJA 3U9SA 5ALVA 5LB4A 4ZEOA 5BUCA 1GSHA 4CFSA 4DFKA 4YT2A 3HGTA 4RDXA 4QYXA 2C92A 4JIMA 4L0CA 3ZXYA 4NOJA 1UBTS 2W3RA 4HUTA 3R6DA 1KVSA 5JTTA 5DU2A 4N39A 5TGZA 3KD3A 2WHXA 3TLGA 1EJ6A 1H4QA 3VR3D 5I5GA 4KZKA 3EDRA 4FMPA 5BNWA 4IXTA 3LOUA 3B53X 3TZBA 3EZNA 3UMRA 1ODSA 3VSEA 1LVHA 2IOFK 2OP0A 4OHCA 4CR7A 1EVEA 2XR1A 3TPCA 5KQMA 4XYEA 3FB1A 1CQIA 2I03A 2MAXA 4N41A 3DYIA 3WHPA 2KJ9A 1J5XA 1H0RA 4FVTA 2EEZA 4QZIA 3BVPA 3MJSA 1WKCA 4AI6A 4IDOA 4AMGA 1LNZA 3S27A 3FTQA 3THWA 2CJFA 2PEZA 4CVNA 1AKUA 2ZJ2A 5JAOA 1NBMA 5T3YA 2JIDA 3PX6A 1XX6A 3CFYA 1G0OA 1DXHA 4JXZA 1MF7A 2V4RA 5JG7A 4EZ6A 2F3TA 4B7AA 2OCKA 4BU0A 3PX3A 1U3GA 4H7EA 1ZQ1A 4O3NA 2HF8A 2XDWA 3PDHA 2JASA 1YKFA 1T6NA 3TZKA 4R1SA 4UBLA 1Q91A 4LVUA 2PXAA 1IWOA 4K46A 1BQ3A 2AG6A 2XYPA 4G85A 4DLAA 1QE3A 1IM5A 4WXMA 3GUHA 4MQ4A 3PF9A 3DZGA 4KSCA 1H0HA 3IEIA 4HI0E 4J0CA 2WUEA 1HA3A 3AF5A 3K8OE 2QSJA 1AKQA 3KKZA 2WU3A 3UF0A 2PJUA 2HJHA 1XD9A 1P2FA 5DGCA 4ACAA 5G4KB 1C1YA 4U7WA 1ZITA 2PZ8A 1YCHA 2WVAA 3FBGA 3PP8A 3U44B 4B83A 2CL5A 2VDVE 5AM0A 5KDDA 1O0CA 1SEPA 4F5PA 4K9OA 5SYNA 3H4IA 2HPHA 1KFBB 1QLHA 1JIQA 4IDDA 4HV4A 3QV1A 4JUZA 3TB6A 3TLGB 2JRCA 2WU0A 5J2EA 4MUEA 1ZY2A 3EIWA 2J0EA 1QVVA 1N56A 5T5QA 3UUGA 3SC2A 3ONWA 2HFJA 4FI3C 1MQ3A 4OOEA 1IATA 1LSUA 4Z2YA 4HX2A 4MMXB 5HR5A 1FFAA 2SCUA 2I6SA 5A7FA 2VTEA 3DT9A 4HQNA 2AF3C 1KYQA 5CPFA 3EPRA 1CQIB 2QTAA 1KPIA 1QG0A 1ZD8A 2ZRKA 5A5GA 2YTZA 3SXPA 3QPBA 3AVOA 1Z68A 3CPSA 2RHJA 1T4MA 1V97A 2RAPA 1KWKA 1SZHA 5ALIA 3LX5A 3THWB 4UAWA 1N2GA 2C3PA 4KFSA 2R8JA 3OHMA 3ZNOA 1FLNA 2AA3A 4BV9A 2R18A 5EZQA 2M9NA 4A82A 3SHTA 3IT0A 3BGIA 4BGVA 1IZYA 1K3UB 3PJEA 2HK7A 4L8YA 1YR7A 2JJ2D 2LI6A 3ESBA 4R2WA 3QE4A 3IE0A 3L5OA 2G9RA 1QK3A 5IAEA 3AJAA 3OJ0A 1MG0A 2EX1A 2IPXA 1QAOA 3R5HA 3FLBA 5BSTA 5IEJA 4IOLA 3OWOA 4OH1A 1XA4A 3ABIA 3U37A 3N59A 2K4MA 4CIVA 2CHGA 4QUIA 1P44A 1BPEA 3FWNA 2H3HA 4JP1A 4CQNA 5KREA 4DQXA 1EVYA 3CA8A 2ZXEA 3JQGB 3BTUA 1F6DA 1RAAA 1W5SA 2ODEA 6PFKA 3QH4A 4RDCA 1AS0A 1KSPA 3K1RB 1A5TA 2FH5B 3AYZB 1VKRA 3MN1A 4EI7A 5EJ4A 5D85A 2OWEA 4EA6A 5DH9A 2KJ5A 2IF0A 1CNMA 4YMSA 5EHGA 4XWWA 4HTFA 1ZNQO 2JAWA 2BKEA 3ZU2A 4YB8A 1CJCA 3HRIA 4IRKA 3ZHUA 3FM9A 2O3TA 1R0CA 2YWCA 3OCCA 1V43A 1QGDA 3V1YA 2VUTA 3AILA 5C0YA 3WYGA 2QV7A 8LDHA 3THRA 2ZAYA 3MDAA 1XVVA 4ZI2A 4EA9A 4L72A 4DB4A 3KOXA 1UBKS 1IZZA 1NWHA 3DOHA 1G7CA 4MKIA 4MGYR 3W9UA 3D6MA 5HIMA 4EZ9A 5HG0A 3DMTA 2JI4A 3IHWA 3A0RB 4B6JA 1XZDA 1JFTA 4F97A 1UDXA 5J2CA 3DOJA 3PQDA 3D1LA 3ZH9B 4G5FA 1FUYB 3FTEA 2FW1A 2RHRA 5MN5A 2RGBA 1N7IA 4PC2A 4G9BA 4UHHA 3PPIA 3OTOB 2EW8A 4NV1A 1JNYA 2MMCA 1BNCA 4LDQA 4YJGB 4BQFA 4I2HA 1DDIA 4JWNA 2RH5A 3P0EA 1ARZA 4CKWA 1Y5RA 3FWYA 5FT9A 4EECA 1B74A 3GVHA 3STWA 1D8BA 3N6RA 4I7EA 3CYFA 2V7QA 2CLIB 4PO3X 1ZOLA 1TJ5A 3BL8A 5LZ5A 1I01A 1B93A 3H3XA 4ZCLA 4XQ0A 2X3UA 4OP3A 4DSZA 1UJNA 4L6IA 4TSKA 4HPWA 2R00A 4AJNA 9GPBA 1FUKA 4JODA 4EVRA 2AB0A 2UUPA 3PMNA 3KT3A 2FPPA 2QP4A 1PZGA 3CBGA 3ZQ6A 3CZAA 1G38A 4GLBA 2XYVA 3FJYA 4H59A 1XNRB 4DEYA 1S9DA 3H5IA 3D6JA 1MX5A 2ZYVX 4XEHA 2C9CA 1U6JA 3DAHA 3D7SA 4P4GA 1SHUX 5DGAA 4HTFB 3ZXUB 4LBYA 4KX3A 4B3GA 2AYZA 1L3TA 4NPCA 2HQ1A 1US8B 4WBXC 3CN9A 2PLAA 1NDQA 2JLWA 5JEEA 4HXYA 5GJWC 4GI3A 2KQUA 4WA8A 1V48A 5D3MB 3KQSA 2BDTA 2VSQA 1FXWA 4B4OA 4BNWA 4BVKA 4QEDA 4YR0A 1ZP6A 6GPBA 1AUOA 5HGJA 1UMKA 1XN1A 2QT0A 3CCCA 4YMTA 5FR2A 4K6GA 1QCDA 5HUQA 3K2EA 4JJ7A 4YREA 5JUWA 4DE5A 2HHSA 5KX5F 3DDNA 5CBKA 3CX7A 3E22B 1FJ2A 1E2UA 2AJQA 1GDDA 2ADFA 1SKSA 1HI9A 3QITA 2DE0X 4GP9A 4WN3A 2ZJ6A 8ICSA 1RBQA 4QM7A 3AG5A 3C41J 3EA4A 2HCFA 1J06A 3LBHA 5K8IA 4F92B 2FPOA 1G60A 2EWVA 2GNOA 4I5FA 3AL0B 5FTNA 4CL2A 1K5PA 2QVLA 1JROA 3A28A 2Q4RA 2VK4A 3V00A 1JECA 2PS0A 1XD8A 3BTSA 5JYBA 4KQMA 2DQZA 4LYDA 1SA0A 1FZQA 2HHVA 1RFGE 2A33A 3TQQA 2CC2A 5CH5A 2Q3HA 4AZSA 4MWEA 3FVRA 4OHXA 4QFMA 3FOBA 3HBAA 2CYCA 1ZD5A 1L4NA 1GTMA 2WIBA 3RYCB 3S44A 1CY0A 1XDZA 2W8BB 5BVGA 3GHHA 3N0VA 3G23A 4J7UA 1KO8A 3V32A 3IOCA 4I50A 3Q8MA 4ER6A 4UW9A 4DJFC 2IXDA 3VUFA 3C5GA 3EZ6A 4ARBA 3NHZA 2R4QA 4L6AA 1ZQVA 3SBOA 1W0JD 2QGNA 1W30A 1KRWA 1IJFA 1V6AA 3T5MA 5IBPA 1IH8A 3UJ8A 1PVPA 1R0WA 5AK3A 3DKPA 3FDIA 1XTBA 4US8A 4XB1A 4YLYA 1H3EA 3L92A 2VXBA 2W6JD 5C53B 4K9DA 1SKAA 4UAYA 2PKQP 2OECA 1RCUA 1SG0A 4MEYA 3TVTA 3J81A 2XPCA 1VLVA 3C4JA 5FUQA 1NP7A 3CR8A 1MVOA 3HABA 2LBPA 4OF4A 4FKBA 4LN1A 1XZHA 3ORRA 3STTA 3UAYA 1ZH6A 2Y71A 3TIGA 3ABQB 2P2GA 1EH5A 2PBLA 2H9AA 2YWRA 4AY2A 1AHPA 2RC6A 4O3FA 1FLAA 1QAQA 3CY6A 1IQUA 3G8DA 4JA0A 4E2ZA 4MGIR 4OQYA 1WBBA 3M7DA 3OIGA 4HEQA 2V3VA 2HZ7A 2O48X 3LUKA 3MC1A 3UT5B 4RSMA 3MJRA 4KBYA 3L4BC 4J2OA 2VQ3A 2D7DA 4Z53A 4J1SA 1ONSA 2AOWA 2CXNA 5JFOA 1ISHA 3IHKA 1HMYA 2H48A 2J4FA 4UUQA 3HJUA 2ODPA 3A36A 3CP8A 1PG5A 3OAAA 4KGZA 3RNOA 3S5JA 3D5EA 4JLPA 3WGUA 2HJSA 4BLTA 5BVGB 3VDXA 4V2IA 1DCKA 3UWPA 4B7CA 2QJFA 5KVSA 2NUAA 4OMUA 2AC2A 3G68A 4LTDA 4I1VA 2IODA 1NOMA 2OV1A 4B09A 5AI6A 4MF8A 2PUHA 3L7NA 3H4MA 2RGEA 2W6OA 4LJ6A 3I83A 2C7QA 5CIQA 3F8SA 2Y99A 1VHWA 4B2YA 1TE2A 1KOLA 3L41A 3DCYA 1N1DA 2X76A 1FCJA 1DIGA 2ZJ4A 1JG1A 1EGVB 3O8OA 4G0UA 4BNDA 1OXUA 5IC6A 3KE9A 5AVQA 2YV2A 4DF8A 3SM9A 1Z0FA 3RRNA 1SXEA 4ECUA 3GB9A 1GZ7A 3LS2A 5KYVA 1FUIA 3B6KA 2P6NA 5J63A 3ASZA 4ZCPA 4BX9C 1Q84A 5KNDH 1IM4A 3R3HA 4EY4A 2H18A 2VPXA 3CE9A 2OCIA 3QPAA 1VG1A 4NF2A 5INTA 4FNMA 3BG5A 1NPTO 4X66B 3NNDA 3ESYA 3I53A 1X1BA 4NLKA 2VCYA 2X4GA 3CKYA 3FUWA 4AY4A 3L40A 1LPBB 3FGNA 2EYUA 2ZRDA 1B76A 3OTIA 2JB9A 5EIXA 4QBKA 3LPCA 3GLIA 5J2DA 1KJYA 2EERA 3WXBA 2Z95A 2O8BB 4JUIA 3ZV4A 3CRMA 2P4SA 2CMFA 2FEXA 2GN4A 4JJ6A 1L7PA 3K4HA 4RGBA 5T4FA 4N49A 1ZCZA 1MJGA 3SJBA 1JQKA 2HO4A 1TYEB 1PIWA 3E1SA 2I1QA 4RZIA 1XUOA 4MFFA 3ABRB 2GRUA 3V9PA 1VE7A 2IUEA 2JA1A 4RCZA 2PYZA 2HU7A 1H2YA 4RNCA 3H1BA 1PQPA 1HYHA 1WVGA 4LIPD 5MFPA 1AMUA 3KK0A 2IZ6A 1SBYA 1L8AA 3PFFA 3ROXA 2QF7A 4J9PA 2JLZA 1WSBA 2PPVA 3GEIA 2GA9A 3H4DA 2NUAB 5KYWA 3SHOA 4XRHA 2Q3JA 4NX2A 5TEVA 4IZ6A 3IUMA 2MINB 4QW9A 4B4UA 2ZR7A 2A9QA 3VR6A 4QU8A 2A9JA 2ZRQA 4GLXA 3FIUA 4RQAA 4JJGA 1ZUD1 2A57A 1MOZA 3QYPA 2ZT7A 4GLLA 1U2PA 1Z25A 1UOEA 4ZAVA 4GPAA 4MUMA 2JZCA 2AHOB 1MA7A 8ICXA 1OPXA 4JV0A 4IIFA 5KFCA 3O1IC 4QIWC 4GU5A 1Z6PA 4KRXA 5D2CA 1UBGA 3RJZA 3BWBA 4QUKA 1F17A 3B5JA 1UXJA 2GFIA 2Y0SF 2FK7A 4ZIRB 3BIXA 3VC7A 4NKRA 4TWIA 4L15A 3SLGA 2XY6A 3HJFA 2I3DA 4US9A 4RD0A 2IS4A 3V4RA 2EL9A 1OGJA 4LWZA 3PIIA 3B89A 4PO8A 2ZUSA 1C4WA 2XMQA 4EUFA 3C74A 3GU3A 4M8SA 1PVQA 3B52X 2C2MA 3NVZA 4ND2A 1LZKA 4GZ6A 4OUKX 4FGZA 3NS1A 7MDHA 3N2EA 3HNPA 3WLNA 2EBFX 5D7BA 1YJXA 1CUKA 3FJOA 1U7ZA 2UZ0A 3K0FA 5B64A 5I47A 4GAEA 2XIQA 1TO2E 2JLXA 3N7UA 3O2QB 1RLIA 2XB4A 3MGGA 3H2HA 2AF4C 4JNCA 1TC1A 3SVZA 2MSNA 3FMOB 4BKOA 3KQVA 3IEKA 1IIBA 5CLJA 2W4IA 2FMKA 4XRGA 1ZN7A 3R7WA 9ICHA 1OWMA 1UJ6A 1ZETA 1SU7A 3WGQA 4DHEA 4B3JA 1P7CA 4FOOA 2AEMA 2QM0A 1OXTA 2G4CA 4RS4A 2FJ0A 1C7FA 3B3GA 3O31A 4S1WA 2H85A 2VHZA 2K89A 4EHBA 1MAAA 1YBVA 4HD8A 1T3ZA 4AJPA 2VF5X 5TX7A 4R0VA 2GEFA 3NOXA 3DZBA 1F6WA 2ES6A 3TLEA 3SKXA 3IOBA 2C20A 3X3HA 5KYWB 3OHPA 3HA2A 1O97C 2QN6A 1QDEA 2Q5IA 1A69A 1M2HA 2FFHA 2VSFA 3JQCA 1B41A 4RV5A 4KXLA 3HVJA 1ORDA 4KACA 3UPQA 4I6JA 4PYIA 5IAJA 2R6GA 2P3LA 3OHAA 3UAOA 5J5CA 4KO2S 5AD1A 3CF2A 2Y0PA 4XH9B 1NKTA 1AM4D 1GY8A 2XB6A 2HU2A 2FXVA 2ACWA 2G5TA 5A05A 3UW3A 2AE1A 4V0MA 2GB4A 1FJXA 4MB6A 1ML3A 1OYVA 4BNYA 3I76A 5AW5A 4BP8A 3LHFA 2GBLC 4Z4IA 3WNDA 3SAHA 1U7WA 3LUHA 4CEJB 4NOLA 4YRAA 1TM2A 2VPZA 3OICA 4JI6B 1UDRA 2J3KA 2QLLA 5KQSA 1XCOA 4YCLA 5CH8A 5DNVA 4GYWA 1IJKA 4FYJA 3P71T 2G80A 4K9RA 4XARA 5LQKA 2OZKA 1HOXA 4ZOCA 4YBZA 2FW8A 1W6UA 4QJ4A 3D81A 3FHJA 3PIRA 5A0TA 5JPCA 1M54A 3R7WB 4Z4FA 3CEJA 3WB0A 1I3NA 3CO0S 5AIBA 2W6ZA 4YROA 2ZVPX 3EQZA 4I9GA 4KWEA 1LQ2A 2E4WA 4KLQA 1VSBA 2IEAA 2VO1A 5AVRA 4L8LA 4DARA 1Q92A 1YU9A 1RTKA 2PRJA 2VJOA 4X5VA 1MB0A 4TYYA 2X41A 3FOWA 3FWKA 1H94A 3VTFA 1F0MA 4EGAA 1I1QB 2YMPA 4OUDB 4B9NA 2C7PA 2RIRA 2PUVA 1KQ3A 4FUQA 2FCAA 3TIIA 3RLIA 4QO7A 1FS6A 2E3TA 1DBPA 4AG3A 3QXCA 4OBXA 3EGCA 3JTEA 4J9UE 4K6FA 3QMMA 1NJFA 5DN6A 1LW6E 1TZBA 4WGFA 1HM5A 4OLFA 4IDFA 2ZXIA 3PUXA 5C81A 3BFKA 2D7CA 3C1ZA 3GLFE 2QN8A 2J5BA 1IXRA 2F8MA 3O0FA 3DCJA 3WTBA 1XDUA 2QRLA 3UJBA 1XV5A 3VZQA 4TX1A 1QFMA 1MJFA 3T9AA 5HS4A 1S9HA 4EHJA 1N25A 1UDAA 4OHOA 5KFNA 2HUNA 2BEWB 1KYXA 5BQ3A 2V45A 1MC4A 3D2NA 1FVHA 1ZQUA 4CV1A 4CIBA 3COYA 1D2AA 3X1KA 4CLOA 1V37A 4Q9AA 4PCUA 3QU2A 3GJYA 1E0JA 1DFGA 3ZWWA 1M2NA 4JWKA 1OD6A 2CVQA 1IUNA 3DW1X 5DIZA 4Z4EA 4R2LA 3G0IA 4OXYA 4M8LA 5ED4A 3MABA 1DO8A 2W90A 4QRDA 3FMGA 1X7XA 1GZ6A 4XZ3A 2WIJA 1T2NA 4Z5XA 2NVBA 2P5YA 4BNNA 2BQ3A 3JYLA 3EXIA 2IBSA 3C28A 2RBEA 1VJRA 1GCOA 4YP1A 4HDOB 2JGMA 2R7AA 4A6EA 3P96A 4PX5A 2V96A 2DWCA 2Q9AA 2ZIZA 3I61A 1Y6JA 1ZQ9A 4X65B 1EFRA 3EC1A 3W79A 4PHCA 3ONEA 3QP9A 1ZIXA 4ASUD 2OCYC 1DPFA 3SIXA 3HZHA 1HV8A 3TFRA 1BDBA 2AJDA 5BR7A 4L02A 4G37A 8ICNA 2JXJA 1XQXA 2DFKB 1TKCA 4X8HA 4JBLA 4Y2UA 5HZMA 2UYYA 3DPIA 4R1MA 3WXMA 4EUHA 1EFAA 5JQGA 3A2KA 4BRSA 4EYEA 3SX4A 1QS0A 3D4IA 3BFPA 3Q85A 4QL3A 4P93A 3DLTA 3AKDA 4BLVA 5K45A 1L1FA 4RPYA 4FJ2A 3MWKA 4TTSA 4XE5A 1AGNA 4OK5A 2XTMA 4X7RA 4CR6A 2WWFA 5CXXA 2OHGA 4M1OA 2BONA 1ZMRA 4WLEA 4GC6A 1Z2AA 2GX6A 3QX9A 2AGVA 3OQHA 2V55B 3TQTA 1XDSA 4PLGA 1HT3A 2PTGA 1DRKA 1XSPA 1EDOA 2ZUBA 1UOQA 3COSA 5ALSA 1JWAB 4I1OA 4C4XA 4QYMA 2G4LA 2RQ5A 1JPNA 4PGMA 1SIUA 1XCJA 1QYDA 3ZCVA 4M1TA 1NW4A 3C6MA 1Y6FA 2FWAA 1RP7A 5KL8B 5DG9A 1Z0IA 2PA0A 2VK1A 3QE0A 1H6DA 1SHLA 5CEEA 5KNCD 2ZTUA 3MWYW 1GADO 5ER9A 3KPJA 3RBEA 3QXXA 4X1KA 2IYRA 2JLAA 1JJBA 4J16C 2WYOA 3JSAA 4F5RA 1U0LA 1X7XB 4WEOA 4TURA 4LG1A 3EXIB 2II6A 1DP4A 4DNQA 1DBVO 3SE0A 4ESEA 1USKA 5A4KA 4DBLC 1T9AA 3D7MA 1PJTA 4IWYA 5JIBA 1NVDA 1JEQA 1YDHA 3QU7A 1NBEA 2V6GA 1PS9A 2VRCD 2V9ZA 4I29A 1W94A 2FEPA 2ODAA 2WT8A 1PEAA 2YRXA 2XRYA 3QV2A 1JILA 2RKWA 1C9DB 2I8AA 3KSBC 5GVRA 4LGVA 4OIMA 4AC9A 4YRDA 4J9VA 3FLEA 4IEFB 4MROA 1F12A 5JQGB 4JL5A 2R751 2UU9B 4I5GA 3FGOA 2Y1LA 2XUQA 5HPYB 1TM1E 1ECPA 5IX8A 4Z1MD 2P9FA 3L0ZA 5AKKA 5K8CA 1W96A 5EPOA 1L7NA 2X42A 2RCYA 3K70C 1F3LA 5AVXA 2FYTA 4A36A 1FFGA 4NG5A 1OVMA 3HDYA 4CKEB 1XZFA 1SULA 4DLUA 4AULA 2C94A 1RABA 2JAHA 2C5EA 1NNI1 4N0QA 2ACVA 1MD9A 4TQRA 3WQQA 1OWPA 1S4QA 2GEJA 3JPQA 1T8RA 3HEMA 5DDIP 4D9JA 3NONA 4KYTA 4P9NA 3QBJA 4ND3A 4LAFA 3OFND 3EVFA 3MUOA 4YCCA 5F2EA 4WOJA 3IP9A 5KKCA 3V2UA 3NVDA 3PLNA 1H1LA 2EARA 1YB7A 5EJAA 5SV2A 4DSTA 1WUJS 4RPJA 2ZT5A 1RAEA 5DV9A 2WUDA 3AEXA 4TLAA 1JH8A 3T5HA 4X1KB 3IMCA 3DFFA 4ON9A 2XXAA 3HX0A 3G0OA 3ZIDA 2EV9A 3JQ6A 4YJ2B 3CV3A 1F0NA 2H2DA 5DYIA 3TAPA 4K87A 4ZHSA 4EHIA 1H2EA 3RGWS 3CLVA 4H18A 3U26A 5G2OA 1ZNXA 3KZKA 4NCXA 1JEQB 2M32A 4AKHA 3ZDXB 5CAEB 3BQ1A 3OZVA 3ACBA 2CXXA 3BMXA 3ANYB 2DF8A 4G3IA 2X1VA 4EG5A 1IL0A 3U7QA 1PT7A 2HXYA 5F23A 5DNEA 1Y89A 4YFKA 2M1ZA 3LQQA 4YPOA 5C31A 1YWGO 3HKEA 3S1SA 3IXMA 5EY5B 1VCOA 3FWPA 2DPLA 3NWJA 2ZJOA 1N7HA 2HZBA 1U8XX 3P0HA 2ECFA 1E59A 1WHTB 3GX1A 3AV0B 1Y6QA 4R1QA 3QFSA 2YH2A 2YWDA 3BERA 3H42B 3EB9A 1PT6A 2DHCA 3ELUA 4XVQA 5JCPA 4RM2A 2H2GA 4LZGA 5I9TA 1UXOA 3QG1A 4KN7A 2FU5C 3B20A 3N3AC 1PX2A 1OZAA 1NW7A 3T1OA 1MJHA 1FEZA 4W6QA 1WQ4A 3LP6A 1OKKD 3SF8B 1JNXX 3T61A 8ICBA 4NCIA 5A4FS 4PONA 4GH5A 2FDCA 4KN6A 3B36A 2C2EA 1NQWA 4C7OA 4E6PA 3AY7A 4J49A 3UMMA 4KSYA 3H2SA 4CG0A 3FR7A 4LJAA 4CIAA 1H1LB 2COKA 4K86A 1K08A 4ZAZA 5CA1A 3VAAA 4QVIA 1XEXA 2PZGA 3IJEB 1HLDA 4YAIA 4U2CA 2MIIA 4DL9A 3HCBA 2JFZA 4H7KA 2XXAB 4O5CA 1E7SA 1IN8A 4GWKA 4O4IB 1JG7A 4OAOA 4TLLB 2EW1A 2C2KA 4G6ZA 3DR5A 4B6EA 3UA3A 2VP3A 1L3VA 4EIWA 4NHEA 3VKUA 2KP7A 2D62A 1M2JA 1TX4B 3ISVA 1VPDA 3ZHCA 3PL5A 3TTUA 1TKDA 3LWZA 2C9ZA 5FQNA 2JFQA 5KDOA 4EGJA 3A1FA 1GUYA 3IAAA 4B2IA 3B13B 3MINA 1HL7A 3U7QB 3B60A 1O95D 2Y1XA 4UKDA 1JH9A 1BEZA 2CNLA 3F4BA 4GXRA 3TN7A 1SCKA 4O6VA 3HKEB 1L5YA 2ZWIA 4DA7A 1UFKA 1IUOA 2GN0A 1TTPB 1TF7A 2R8YA 3C45A 1DAKA 3EUEA 4FHCA 3OMWA 2DZDA 4O5OA 2NVOA 5DTJA 3TVDA 4DL5A 4HGPA 4N54A 1P1KA 3W9BA 4J9KA 3WKDA 3TO5A 2P6MA 5TNXA 3RAPR 2DU8A 1JLLA 4MI6A 1C8LA 1TECE 3UMBA 4P82A 2ALZA 4Z7JA 1GNSA 3FYDA 4C3OB 3ZW9A 3EWNA 3PWTA 1WEHA 3EVBA 2DKNA 1ZEMA 3KUUA 5E8RA 3NETA 3MSCA 2GDZA 1I1NA 4I2IA 2CHQA 3OPYB 7ICGA 1Y98A 2R96A 3ZDQA 1KQQA 4DNOA 2BR4A 3WIVA 5EKTA 2IXFA 4EB8A 1L5KA 4HNRA 3DL0A 2Z09A 2VPQA 1KQGA 2D1QA 1X2BA 3QQ5A 1NBAA 1M83A 3CNOA 1E9CA 5EIWA 5CA1B 4GUDA 5A3QA 5G0TA 5FI3A 4CTOA 2AFHE 3GL9A 1ZLXA 3RIYA 3DXZA 1X94A 1KVRA 1ZQQA 4U6QA 1NBIA 2JFUA 2WM8A 2C4TA 2FUG1 3B9QA 3RHZA 2C8LA 3Q72A 4G4SP 1AROP 3NUQA 1W4AA 1WZ2A 2J8ZA 4EHHA 4K3VA 2OLKA 3T79A 3BWEA 4R8VA 3U7GA 3RRJA 1ISMA 1KAEA 4UNIA 3FX2A 4MW5A 2PSEA 4H9GA 3JQ8A 2L19A 3JQ9A 4KMMA 4O4JF 2PH1A 1E2FA 3KLMX 4NEQA 4C22A 1M2WA 3IB3A 5I7OA 4J2HA 1HDIA 2B37A 5F64A 3KOOA 1TCAA 3OZ7A 4PZLA 1FFYA 1V95A 4OFXA 2NG1A 2YJ5A 2FXIA 3MCTA 4TXMA 2ZRFA 3LIPA 4BRZA 2I6QA 2WW8A 2BLLA 4DMLA 4ED6A 5DM70 2HQSA 5DCUA 1M0WA 4IJUA 1UXGA 2CBXA 3Q8KA 3FDSA 4MPTA 5TC4A 1OI7A 3E8XA 4KR2A 3ESAA 3RW9A 2IZ5A 5A3SA 4EMTA 3EIXA 1P1HA 4NECA 2QHXA 3WYCA 1E1DA 3L7YA 2R4TA 4EO7A 4YRGA 1Z4KA 4RHXA 4RUAA 2ZE8A 4OOFA 1Q19A 2VUIB 1P1RA 1I9GA 1TT5A 1YMQA 3T7KA 1AQNA 3TBHA 3FDXA 3D6HA 5JXHA 2XMRA 4M3NA 2JZBA 1DMSA 3GI1A 2MCFA 1C1XA 3SJZA 3ZX4A 1AKEA 4NR0A 3WK7A 1FC0A 1U2ZA 1AOXA 4E1AA 2YASA 3E1GA 5E3JA 2Q1XA 4JU8A 1Q22A 2P9HA 3G2PA 2VH2A 1OREA 3H1PA 3O4VA 1FYXA 1JFVA 1Z18A 3OA0A 1NJYA 4EJFA 5M04A 4WY5A 1QCKA 4HS9A 4QDKA 4KQXA 4BYMA 2QUHA 4O8ZA 2PUFA 1VJDA 3DTNA 4EI8A 4AQDA 2HBRA 1BEUB 3E3LA 1DT5A 2YIDA 3W2IA 5KWIA 2WKPA 2YV1A 2BEJA 1T6ZA 3WQSB 2QMUA 1HSZA 1JFFB 3RIGA 4D1YA 4DQVA 2PKWA 3F97A 4G5RA 1UPXA 3OZBA 1COZA 3A1WA 4B2PA 4LDPA 1XJ0A 5A04A 2O7QA 3P2YA 4UBNA 4G5GA 1GAEO 1OZHA 4HN2A 4WZAA 4X63A 3ETGA 2F1HA 3G0HA 2FUKA 3GGSA 2WBLC 1KK3A 4C8KA 1JDSA 3NBKA 3EW7A 4X3CA 1GP2A 2XZOA 2ZDGA 4D7AA 3NEPX 5ALXA 4QUDA 3THVA 1X80B 3ILVA 3AVTA 2VOEA 4JLAA 1XEWY 5LXTA 1MXFA 3TD6A 3F7OA 1GIAA 1U3VA 4QFBA 1T15A 2HNKA 3ZLTA 4DUPA 4ZZ3A 1WDTA 4BQQA 1S01A 4UHKA 4L5JA 3S7ZA 3AF0A 1O9HA 3M9XA 4GL2A 4Y2JA 3ZGYA 1TL7C 3UHAA 3HSYA 4CDNA 2FW0A 4RH1A 1SVOA 1XGKA 1SKMA 2YY7A 3LL4A 3WL4A 2ON6A 3L6RA 4RBNA 2JZNA 5T6BA 4TWJA 2AX3A 2A3VA 2F8SA 4RTSA 3EODA 5LU9A 1IV8A 4AJHA 1C1XB 4LY0A 1SWWA 1CUXA 4ZARA 1V9SA 1KSJA 3T54A 2QUJA 5KVQA 1LD3A 2WSSA 3FETA 1UT8A 1NNLA 2OAGA 4ZDIA 1E1QA 1PVOA 3R4VA 3H05A 1CRPA 3IEUA 3CKMA 3T35A 5F1PA 3SS8A 1RBYA 4L28A 3OJFA 3LYSA 4B4WA 5JSUA 3IRVA 4JOBA 1YB2A 5KFYA 1VLZA 4V0QA 1MVNA 2ZRJA 2G5HB 3TLZA 4AXXA 4WXEA 2WF8A 3I0NA 4HNGA 2FN4A 2OG1A 4RK0A 2B2CA 3UJ6A 4US1R 4KODA 5A4DA 3N8DA 3AY3A 2PZEA 4FZMA 1EK2A 4L8VA 4PZ9A 3ZBPA 1LNQA 2DH6A 2BPCA 3I73A 4EB3A 1MNQA 2NXWA 4JQZA 1TZJA 3DHYA 2OO3A 1YT3A 4HAXA 3D8HA 3C3PA 3D2BA 1Z33A 3QPCA 2DUJA 4QJ3A 2ZREA 2XGGA 1KZHA 4BPRA 3MGBA 5DB9A 5K20A 5K6RA