4F71A

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, wild-type protein, complex with magnesium and inorganic phosphate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
198
Chain Sequence
GIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
total genus 69
structure length 198
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4f71A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4f71A01
4F71A 2JARA 4DCCA 2ZG6A 4FE3A 5ALEA 2JGAA 4KNWA 4AS2A 2HSZA 1Z4PX 1X42A 2I55A 2RBKA 1WR8A 2EARA 3N8GA 1XP5A 1Z4IA 3N07A 2CFSA 5ALJA 3A3YA 4DWOA 3QLEA 3SLRA 5AW7A 4BYGA 2CN1A 5AW5A 5AIBA 2RAVA 3AR7A 5JJBA 3QU5A 3MC1A 1Z5UA 5ALMA 4FFDA 2ZBEA 5AVRA 4UAVA 5AW1A 5AI6A 3L0CA 5AW9A 2PQ0A 3QXGA 1F5SA 3FM9A 4YIHA 2WF5A 3B8EA 4AP9A 1Q91A 1RKVA 2HI0A 3SKYA 1TJ5A 2HCFA 4H1WA 5AM1A 3S6JA 4BX3A 4HGNA 3QUQA 1RLMA 3FPSA 3W5BA 2YMPA 1RDFA 3B9BA 2BDUA 5ALVA 5AW4A 3J7TA 3NUQA 3DV9A 5AK4A 3FGOA 1Z4QA 3B9RA 3U7FB 2YJ4A 1L7OA 3NRJA 4G63A 3UMBA 1NNLA 1K1EA 1TA0A 3ZUPA 5AM4A 3ED5A 3ZTWA 3EPRA 3OCZA 2RB5A 5AKLA 4XE5A 1L8LA 3L8EA 4E88A 3P96A 2GHTA 2HF2A 5AVSA 5AVQA 3UMCA 2YBDA 5ALWA 2ODAA 1VJRA 3E84A 3WKBA 4EENA 2B1RA 4YIKA 1SWVA 2IYEA 2WF8A 1KYTA 3ZW7A 1RMYA 4XOUA 1Z5GA 3RF6A 2I34A 4YGYA 3NALA 4CF3A 2JAOA 2HEGA 2MU1A 3ESQA 3KDPA 4XPZA 3NASA 2P9JA 5ALKA 5FP0A 3WK8A 5IT4A 3BWVA 1ZRMA 4BNDA 3PGLA 5IS2A 1YNSA 4F72A 2FUCA 1MH9A 3QYPA 2AUTA 3U19A 1AQ6A 2YY6A 1U2SA 3FVVA 2IOFK 3SF0A 2YMQA 3R9KA 3FPBA 1O03A 1CR6A 2YJ6A 4UMVA 5AKGA 1L8OA 3WK6A 2P11A 1YDFA 1ZRNA 5AKEA 3EWIA 5AKXA 2O9JA 4BEVA 4J2TA 2R8EA 3U7EB 2ZXEA 3ZVMA 3KD3A 3ZTYA 1ZD5A 5AKKA 3ONNA 2OA0A 3KC2A 3QU4A 3L8GA 4KX5A 2FPXA 2PR7A 5AW6A 2ZBDA 4UASA 2OBBA 4L6CA 4G9BA 4EELA 3ZVLA 4HGOA 1QH9A 4CNQA 1QQ5A 4BNDB 2R8ZA 1Z4JA 4NAVA 5AKIA 5AM0A 1J8DA 3OCVA 4Y2UA 5ALTA 1ZD4A 2HDOA 5ALFA 2QYHA 5IT0A 2FPSA 5ALUA 3CNHA 3L1VA 4UMEA 3ESRA 4EZEA 2OYCA 2G06A 1T5SA 3ZWKA 2WF7A 4UM5A 3ZX4A 4UARA 4HYTA 3AR8A 1L6RA 3DDHA 3WGVA 2Q4TA 4CE6A 2CFTA 5T41A 2D2VA 4ZEWA 2ZBGA 2G0AA 2WF9A 1CQZA 2GHQA 2YMLA 3IB6A 4B6JA 5AM3A 4C4SA 2B0CA 1QQ6A 2FDRA 4YH1A 3L1UA 4Y2RA 2HHLA 4IFTA 3WKCA 5AKHA 2BDEA 3L0BA 3U13A 2NYVA 3WK4A 3DNPA 1YV9A 2Q5EA 4O8CA 5AI8A 4KN8A 1S2OA 4Y2SA 5A3RA 1Z4MA 4KX3A 2I6XA 2JAUA 2B82A 3E8MA 2YFYA 5AI0A 5ALSA 4GXTA 1FEZA 4UAUA 1RMQA 3K1ZA 3I1YA 2G09A 1S8OA 5AVXA 2C8LA 1ZD3A 4YCMA 2B1QA 2WM8A 3MMZA 3L0YA 3ET4A 3SKXA 5ALQA 4EX6A 4UATA 4RETA 2ZOSA 4BBJA 1Z4OA 2I7DA 2IOHA 3AR6A 5ALHA 3HLTA 1ZS9A 3NIWA 2W4MA 2WFAA 5ALZA 1Z4LA 1WVIA 3A1CA 2WHEA 4BX0A 1O08A 1U2TA 3W5AA 4UW9A 3KZXA 5ALYA 3UM9A 1L7NA 1LTQA 1RLOA 4OFZA 4HGRA 3PGVA 4NABA 3WK7A 2YJ5A 5AKYA 2G1AA 3WK5A 3ZVNA 3QU9A 5AVZA 5ALOA 5ALDA 2Q4RA 2PKEA 2I54A 2OM6A 1NRWA 4BX2A 3AR4A 4CF4A 2B8JA 1EK1A 2AMYA 3N5KA 2O2XA 1Y8AA 3ZX5A 4MUMA 5AI5A 3A1EA 1NF2A 5AM2A 1T5TA 3WGUA 3AR9A 5AIAA 2HO4A 1RMTA 4EX7A 5AM5A 3ZU6A 2HF7A 3U26A 1RLTA 3SMVA 1RRCA 1SWWA 1N8NA 3EF0A 1RKQA 4Y2XA 1WPGA 1YS9A 2G07A 3VAYA 1QQ7A 3IRUA 2YN4A 1EK2A 1ZOLA 3R09A 2W11A 2AGVA 3W5DA 3QNMA 3SD7A 1YMQA 3L7YA 5AW0A 5AK3A 2HX1A 3WK9A 1XVIA 2X4DA 3D6JA 1Z4KA 2C9MA 4IG4A 5AESA 3OCWA 3MPOA 4KYTA 1Z88A 4OHFA 3E58A 4Y2TA 2VKQA 4GIBA 4DFDA 5AK6A 2P27A 3MN1A 4CF5A 3A1DA 4HGPA 5AW8A 2C8KA 2DQSA 3TLMA 1VFPA 2MU2A 3AR3A 4ZEXA 2QLTA 4OD0A 4KNVA 5AW3A 2CFRA 2EAUA 3HYCA 4UMDA 3KBBA 4BEWA 2W43A 1YJ5A 4Y2YA 3ZWDA 1PW5A 2G80A 5AVUA 4Y2VA 3PDWA 4L57A 3QUBA 5AKJA 2GFHA 2RARA 2BY4A 3OCYA 3PCTA 4JDPA 4QJBA 4XQ0A 3QU7A 3I6BA 3NAMA 1XPJA 1Z4NA 5AICA 3I76A 5ALIA 1U02A 3QUCA 1Q92A 4OCZA 5AI9A 2C4NA 1L7PA 2HOQA 2AH5A 5AK5A 4UM7A 1VJ5A 2FEAA 2R8XA 3QGMA 2NO5A 2FUEA 3QUTA 4Y2JA 3L5KA 1ZD2P 3L8FA 3E81A 5A3SA 2FPRA 4ZEVA 3WKAA 3QU2A 1U7PA 3BA6A 1QYIA 2IOFA 1ZJJA 3FZQA 3F9RA 1SU4A 3CZ4A 3I28A 4BKMA 5AW2A 1N9KA 1TJ3A 1RKUA 4I9GA 5AVVA 3QX7A 4HGQA 2YMMA 4I9FA 4YCLA 3M1YA 1RQLA 1J97A 5AVTA 2FPUA 2NO4A 3WKDA 3ZI4A 2EATA 2IA5A 3OCXA 2GO7A 4UMFA 3N1UA 1L7MA 5AI4A 1IWOA 3AR5A 1RPZA 2WF6A 5A3QA 4UU1A 3W5CA 4UU0A 1RC8A 2B8EA 5ALLA 2C88A 2GMWA 3KOOA 4Y2PA 3OCUA 2I33A 3RFUA 3U7GA 3OPXA 5ALXA 4Y3UA 5AHXA 4Y2QA 3L8HA 4NV0A 3N28A 5ALPA 2ZBFA 5ALGA 2YJ3A 4C4TA 3SHQA 3GYGA 5AKZA 4NFLA 2R8YA 1WZCA 5AVYA 4MWOA 4HAIA 5E0OA 5ALNA 1JUDA 3M9LA 4NWIA 4RESA 2FPWA 3R4CA 4EEKA 3ET5A 3WKEA 2FI1A 3U7HB 1TE2A 4DW8A 3DAOA 3NANA 3OTQA 4C4RA 5ALRA 4QQFA 4AS3A 1RQNA 2G08A 4JB3A 3EF1A 2B30A 4J03A 4YCNA 1U7OA 4PNHA 3UMGA 4FYPA 2MSNA 5AVWA 1TJ4A 2P69A 3AR2A 4L6AA 3IJ5A 1T9ZA 2JAWA 1LVHA
chains in the Genus database with same CATH superfamily
2AQ0A 5TF0A 3OCJA 3NYRA 3IUJA 3OEEA 2WJPA 1Q3HA 4HYQA 2Y1GA 1NVEA 2OAEA 1MRZA 4U7FA 4POOA 5JAHA 1F0PA 4FMBB 2FN9A 2FPGA 4HRXA 3HTXA 2G5TA 4FYHA 4B71A 4BNHA 3R7LA 3SZGA 5ADUS 3S70A 3ADPA 2FEKA 4J16A 2ZJAA 2HK9A 1FC0A 2FPPA 4DARA 2C4VA 5ECYA 4MF8A 2HHCA 2FPOA 1M7HA 1RDFA 3CW2A 1T9BA 4LRXA 4F5EA 4YGXB 4N0MA 1ZQVA 4IXWA 3Q9LA 3B8HA 3DMTC 1YB7A 4L4XA 1E4EB 1U45A 2EZ8A 1MRNA 2BMDA 1IMJA 3SFZA 4KOEC 2R86A 3JPWA 1JJ7A 1MT0A 3WKBA 2PXAA 2ADFA 4IGIA 1V9LA 4BB9A 2J85A 4FW8A 1Z7WA 5B2ZA 1E69A 1TQ6A 2DUYA 1E1LA 1QF9A 3H2ZA 4OI0A 4QO8A 1WMBA 1M2WA 4HPWA 5AJXA 2YS6A 3IE0A 1AQ6A 3MWJA 5DNEA 1K3FA 3T7SA 3DLCA 4IHJA 3SYLA 1RJEA 2HL6A 4Q4HB 4N1AA 3DOEA 3RUHA 4FB5A 4EVRA 4ZV4A 4BZZA 1P1HA 1Z4JA 4HYKA 3EH1A 1Z9BA 1OC4A 3FOFC 4TYMA 5CMLA 1CNFA 1N34B 3A7DA 3ANNA 3UEOA 5DOZA 5JTIA 3H40A 3JZIA 1P61B 1UANA 3WHLA 2QUBA 5HJ5A 2ZR0A 5HZKA 3FHJA 3HRDD 1KJJA 4LQDA 4F5PA 3UJDA 3AW9A 1AF7A 1X74A 1U1DA 1TCVA 5BMOA 2CZGA 1KJ8A 3EGDB 1J8YF 4HWOA 3E8MA 2XODA 4YDSA 4JX9A 1KK2A 3KQTA 3UPTA 5AVXA 1JEYA 2B1QA 3O90A 1EP9A 4KQEA 4YCSA 4CU2A 2C83A 5CX4A 4DV6B 5CIQA 3GEEA 4A91A 4X9XA 1L7NA 1ZAYA 5B4VA 3AU6A 3DW1X 4JJ8A 1E2EA 2ZS7A 3MR2A 2ODBA 5TMPA 5KFFA 2C2ZA 1X0VA 1Z68A 3FVTA 1ZQXA 5FPKA 3IMGA 1Q0LA 1J2MA 5C7IO 3NT4A 5D6NA 1V37A 1Q1GA 4DMRA 3CLUC 2EKZA 3MXTA 3T12A 5GINE 3TOZA 2Q0SA 2LHTA 3KWLA 4KTTE 4EIWA 1YIOA 1T0BA 4EGCB 3AZOA 3VH2A 3OIFA 1FLDA 1TQHA 2PFSA 3MWFA 4CM7A 2D6FA 2FWRA 2QL9A 3LE8A 1ULZA 2BP7A 4D9IA 2HN9A 2BFEA 2OO3A 5DGDA 2D1QA 3LX8A 5EJ4A 2AT1A 4Q48A 1U5BB 5C7YA 1XZNA 4BLPA 3DTNA 3BVPA 5DBOA 4ZGGA 4S05A 1I2BA 3E23A 2DQZA 2GYYA 2IS1A 4N5DA 2IS4A 4ITRC 5TJHA 3GBPA 4AY3A 4F1WA 3M9MB 3DLIA 1KI2A 4DQUA 2GBLA 5KNLA 2QUJA 1Q17A 1PEKE 3HVUA 4V0RA 4OQXA 1K7SN 2PLFA 2RJNA 4C5AA 5IU6A 2HU5A 1IWPB 4P82A 2AN3A 2O5VA 3AB3A 5IAGA 3LKVA 4LECA 4WXYB 4MQUA 2ZJ4A 4B3IA 3D9QX 3U3MA 4YRIA 3FPCA 3VU8A 2DXIA 5KG3A 4RW0A 2GUWA 3JQ9C 3VYWA 3I2YX 1IUPA 4NTZA 4QEKA 4NIMA 2G5CA 3MGHA 3NHFA 4DEXA 4EZ9A 1A4RA 4XVRA 1HZZA 3IR5A 4HEQA 4BJ1A 2IW1A 3TOXA 2KX7A 4AJOA 1F2UA 1LVGA 2LMRA 4PYRA 2QTNA 1L7VC 1B1AA 3PYXA 5J0RA 2OG1A 4X3CA 2IS2A 3MGGA 2OV3A 1X92A 3K8QA 3SDZA 4REQB 5H3HA 2BFBB 2WSLA 1JJBA 4CLRB 1MBZA 3QUQA 4ETMA 3O1LA 2JCXA 3UH0A 4GLXA 3C5HA 1V48A 4K9NA 1F12A 1MT3A 3OCZA 3FX2A 2XT9A 4B3JA 1JI7A 5BR7A 2UZ3A 3FNIA 2IGTA 2I7TA 1ZUIA 3H1BA 3AWDA 2I2WA 2IOYA 1E79D 3ZDXB 1E6KA 1Q7BA 4KO3S 2NU8B 1NTOA 4J49A 3TRFA 1E2GA 3CEHA 2CC2A 3IIMA 4EA6A 1GTRA 2YY6A 3FVVA 2D3WA 4DCVA 3WRYC 3OECA 4C29A 1PYOA 4DJFC 1SUSA 2YJ6A 2P11A 2R96A 3K09A 4Y6PA 1QU2A 3NVMB 1O6BA 5BOSA 4TV8B 4ISCA 3PNMA 3F49S 2XW6A 3KQYA 3F2VA 1D1SA 1P4GA 5T3YA 1CE8B 4KR3A 5CM8B 1UBCA 4OQMA 4M9HA 4OHRA 1W52X 3EOAI 4KYVA 1NDHA 1QYDA 5KSPA 1Y7PA 1NU6A 1NTRA 1IHXA 1IDN1 1XEXA 4AIRA 4HOYA 3TMKA 5C31A 2Z56A 2JLYA 1FP2A 3ND6A 1MB9A 1OJ7A 1Z7EA 4IKEA 1KL9A 1J7JA 3MCTA 4EHBA 1MQ8B 3TW0A 3N2EA 2NYUA 4JLKA 5DB7A 4RZQA 4GX0A 1XE3A 3GRAA 2QBYB 3FAZA 3PJRA 5LSAA 2WT8A 1N8TA 3WO0A 2BFWA 2AC2A 5ERYA 2KN7A 1BE1A 5C7OO 1GDHA 4PY2A 3ODGA 4NAUA 4TSKA 4FIDA 2OHIA 2ZJ1A 3NVAA 4UHCA 3L46A 1WXWA 4NF2A 3GJXC 3OG9A 4PWYA 5KTPA 3RFTA 4RT2A 4H0CA 1PJ2A 1G21B 4O6VA 5F9NA 3NDIA 4ZCRA 2IHYA 4DT1A 3K20A 5I7UA 1Z7BA 5JYDA 1CT9A 5TT0A 2GHIA 4ZGBA 4I5DA 1RXVA 3AY7A 5JARA 3AEKA 2G5PA 4TM7A 2GPYA 1LRLA 1DPFA 3ILYA 4EZ6A 4RHTA 5LNK1 4BNLA 1UK7A 2PX8A 1U7UA 1SG9A 2FWMX 4M0EA 4QGHA 3TLGB 5EJFA 4Y2TA 1E18A 2OXRA 5CT5A 2PZFA 5KU1A 4KIJA 7ICTA 4QODA 3HGQA 3ELUA 4EUNA 4RUKA 1IJEA 1KS2A 1E0AA 5LZ4A 1EA7A 5BR1A 4G0OA 2K4HA 3QLVA 3SQDA 1XPUA 2KIWA 1SZPA 2R6FA 3UXEA 2RBGA 1BD3A 2C4NA 4E2ZA 2W7TA 4K8OA 4EKGA 1CZOA 3DE3X 2FEAA 1T8WA 4NCBA 3GQVA 1C7QA 4QD3A 1UBLS 9ICJA 1RZ3A 2Q1TA 1QTNA 4J7AA 1ZQTA 5EZYB 4R9RA 5KWEA 3LM8A 4HAWA 4QRIA 1W9MA 1ZGJA 4GPAA 3IQHX 2I3ZA 4UHFA 3WZLA 4W9MC 4GR9A 2XT0A 5TQVA 4IDFA 1WUTA 4E31A 2J0VA 1PR1A 3CUYA 5JNWA 2WHPB 2IUFA 1CWUA 3KOOA 2I4TA 3S1LA 4ABYA 1N1MA 2IEIA 1I4DD 1Y3FE 5ISMA 1KJNA 5CDFA 4UAWA 2WSSD 5BNFA 3BIWA 5G02A 1U94A 3L18A 3AVOA 4DR3B 3Q12A 3R7WB 4HPJB 3QV2A 4KPGA 3LO5A 2NXEA 4EB0A 1N3YA 2J3QA 5E6RB 3TIVA 3QVSA 4WOKA 1NN5A 3ZCTA 4ZK6A 2NT4A 3OEHA 2H5EA 1XMQB 3M5CA 1TCCA 2RGBA 4PE5B 5J2TF 3LY5A 5DN6D 3IXMA 1HDIA 2NNWB 3NH9A 2XAAA 5ALJA 1P9LA 5KFJA 4DL6A 3JZDA 2OAQ1 3TADA 4ZRMA 3PGXA 2EKPA 1XTUA 4ITUA 2OGSA 4MUYA 4TVBA 5K2MA 5CURA 1XSLA 3A6PC 2YMPA 4S04A 1XJQA 3Q7TA 3M81A 1H4SA 2HWXA 4ZC1A 2CE7A 2PT6A 4C7VA 3U60B 3KT8A 3KVRA 4ER6A 1L5UA 4F8JA 4NU5A 2WICA 3SC3A 3FR7A 2A0XA 4A36A 4R4JA 1M0TA 5DV9A 1C4XA 1TJNA 3COVA 1DU4A 3WWEA 2GAIA 5C37A 4ALMA 4RIHA 2WWGA 3ZY6A 3W79A 3Q11A 2H11A 3NKVA 1XEWX 1H2YA 2FZLA 4GT1A 1IZZA 3RSZA 4UB6U 2QN2A 3KIPA 5IAOA 3WDLA 3BA1A 1O03A 4MWGA 4I1VA 1V1MA 5AKEA 1M2VA 3OJUA 3P0FA 2PX6A 4Q8FA 1XRNA 3LL4A 5I9MA 3KFLA 4AS1A 3B1WA 3V8QA 2IYYA 1I33A 5CAEA 1PN3A 3AY3A 4IF6A 3KXKA 3FTFA 1VI5A 5JD3A 4EVSA 2VF2A 5TMEA 1TVCA 3GJ4A 4NMXB 3SHWA 4WGFA 4LJ7A 2Z8YA 1ZNZA 2XVMA 2CLDX 4EQZA 3K0HA 1M9NA 5H9VA 5CJPA 3AXSA 2VAVA 4HX2A 4EECA 2M32A 4I4IA 1Z4MA 1UBRS 4LUCA 3KSAC 4ODIA 2XF2A 1IH8A 4MI1A 1T0IA 2X41A 1Y6RA 2CF5A 2H1SA 4JVOA 2C8LA 1VI2A 2GB4A 2ZU0C 4FT4A 5KU7A 3HJNA 1T94A 2QL7A 3PA8A 3ZWXA 1C41A 4R7GA 2VVTA 2DPGA 4IO1A 5A9SA 2YJ5A 1HTBA 1A97A 3EXEB 4FX5A 1VP3A 3F3KA 2OM6A 3DCNA 3AI1A 1UFQA 1T1EA 3HR4A 3WNVA 2AMVA 4DBLE 4PRLA 2DCMA 1RE1A 3U26A 3OT5A 1KMHA 4LWQA 1C8BA 3IRUA 4N9WA 4KPUB 2PT7A 1SXJB 2R85A 3PQ2A 2BHRA 2ST1A 1WY5A 3BFJA 4G0QA 3AMZA 2PFQA 1PZXA 1NK9A 2PX2A 3WYEA 1VB3A 2VYVD 4J9RA 3ZCXA 5M7EA 3K32A 3DKRA 1EE1A 4W5WA 3GOHA 1B14A 3DGEC 4HDAA 2DPIA 1Q5PA 4CM8B 2D59A 2ZBPA 2B36A 3L0ZA 5LQNA 1Z2OX 5DNVA 3OPNA 3SZUA 4PX2A 1E92A 2Q6VA 1NMXA 2XDWA 4KI0A 4WFKA 3T5JA 3GGJA 3PRYA 4BY9E 1VKNA 4UAYA 3ZY3A 4KTVE 3SSOA 1KQGA 1AKWA 1IU9A 1KFCB 2ZE8A 4PHCA 1I3CA 3I5XA 3AL0B 3BS4A 3OPYI 4YO7A 4P33A 3PGKA 1R6XA 2EJUA 3OQVA 1RYMA 1KPGA 1RTTA 3KLBA 4WLOA 1OB2A 3TI9A 4LSMA 3DTTA 1Z1VA 2CYCA 3EGOA 3DCIA 4DY6A 2VPZA 4L5JA 1U8YA 3KWJA 3Q0EA 3ISBA 2ZM5A 1VHTA 1PGJA 3TX2A 3H86A 4O33A 4YQEA 3QWIA 3O8CA 5LOVB 5EPOA 4BNTA 1KA9H 3TQOA 5I7SA 4NZZA 4QJFB 3SXJA 1CHNA 4DRZA 2KMDA 2H4ZA 3KXDA 4EMTA 1CDDA 1KHHA 4DBVO 1X40A 3R4CA 1LQUA 1ZMRA 2H31A 2P9BA 3G6WA 4Q3NA 4L9AA 3OOJA 4W4TA 5F9LA 4PLCA 3MWEB 2ZE6A 2A5LA 4ZO4A 5CA0A 4C7JA 1Q46A 1Q0PA 1UJ4A 4KPYA 2GWRA 3HDTA 4KNWA 4F12A 3I34X 3SEAA 5JTUA 1G8SA 1HZJA 3F5SA 3N2KA 2YN0A 3VZSA 1NMSA 1PHPA 1ZM7A 1HO3A 1LZLA 1CY6A 2OWOA 4DSZA 2X7XA 2E7ZA 5E3JA 3FE2A 3AIIA 2JCBA 4KLEA 3TZCA 4MUIA 2H5XA 2PKQP 4B17A 2QXYA 2G5GX 3TTXA 1OTYA 4KSCA 4N6NA 4IKPA 3UK6A 3E5HA 3COWA 2IYSA 3HO6A 3UCEA 2NVBA 4G36A 2ASDA 4H08A 4M53A 2J3JA 3RJIA 4ACOA 5JAPA 1N9GA 4I1PA 4WXRA 4C14A 1P73A 4LC1A 2Q8PA 3R20A 5ALKA 2TRSB 3UC9A 3AB7A 1IB0A 4QNMA 3AHCA 1JKMA 1GTVA 5CYFA 2D2FA 3L4BC 1DDOA 2QK4A 2XQKA 4MV6A 2WTXA 3TOSA 1OX5A 4DO9A 2D13A 3GLUA 3RWBA 5ESRA 1AGYA 3FMIA 5AKXA 4OG2A 3JQBA 3A0RB 3DWEX 2ZBRA 2FX2A 5DI3A 2XUKA 3RS4A 4JQCA 5FEMA 3LBYA 4KRFA 2D74A 3LCMA 5IYZA 3HUDA 3QF7A 1YB4A 3C45A 3SC2B 2I5HA 1XU7A 2X3UA 1DTEA 4KMOA 3V00A 1H69A 1Z1BA 4OO3A 1T0UA 1Y8RB 5KYKA 3QEBZ 2R7KA 1XC7A 2OHVA 2A35A 1NDUA 1HE8B 5CG2A 1WIWA 2FR1A 4REMA 1D6SA 4Q4DA 4NENB 1DZ3A 2C22A 1W29A 4G5SA 2PH7A 3BMNB 1MKYA 1CW2B 3ICCA 3IVGA 5ALSA 3HRKA 5LYJA 5HM6A 3IT0A 5FFFA 4MUBA 4O2AA 1YS1X 3GAZA 1EJ2A 3K4GA 1EXMA 5IEBA 5J8YC 2Y9MB 1Q7GA 3ZIUA 1GJRA 4GBED 2ODEA 4HSGA 1LDMA 1XMVA 2WJ6A 1ABFA 1J0AA 1JHRA 1WB4A 1SB8A 3QNWA 5MFPA 1OFUA 3S2IA 1Y4AE 4EA8A 1NATA 1T6BY 3LBFA 3T4PA 1WKVA 4B0OA 3W8FA 4C06A 1CUYA 4O1IA 4UTZA 2ZI7A 3ISDA 3HVKA 2H4JA 3R5FA 5CCEA 1NJ1A 3OX1A 1DBPA 4R9SA 2AC4A 4F6CA 1K7CA 4KO8A 4LVOA 5KFHA 3FGNA 3MR6A 1Z62A 1QH1B 1OHHD 5C8VA 1E2FA 5JSZB 1LA2A 1L5LA 4AZ3B 1YGYA 1LC0A 1QO9A 3VBEA 3MOIA 4LZGA 5DNDA 4LJKA 1QFZA 4NNOA 3IBYA 1K6XA 3ZDAA 3AESB 5ALIA 2FLPA 5KCZA 1NJSA 2IUUA 3WX0A 1VJ5A 4EGFA 3M8RA 5CTJA 2W8ZA 3BFPA 4HQ6A 3U44B 4HWPA 1DKPA 1C20A 3ASVA 1EG2A 1DX9A 5FR2A 3BMOA 4OJPA 1U7DA 3QTTA 4XCXA 2JI8A 5KUTA 1ZK0A 3BAFA 3HW8A 2F8MA 3PR4A 1XZPA 4DFJA 2KV2A 2PGLA 2YY7A 4J4HA 7ICMA 1XEFA 4BFUA 3KO8A 3QWAA 3U6BA 3U16A 2Y2VA 4KEAA 1RKBA 1KEPA 1JG1A 3OZCA 3VR0A 4Z2YA 1V5EA 2ZSKA 2BGWA 2XOEA 2WTEA 4D8XA 2DR0A 3BPSA 4C9BA 3DFIA 4URHA 4XRRA 2PUFA 3R5TA 3OOHA 1IN5A 4OIMA 4RESA 4MI3A 4EEKA 5TS2A 4HFRA 5CCBA 1JLHA 3A1TA 2EKLA 4OO1J 2RGXA 1THGA 5BWMA 1HIWA 1KN5A 4B82A 1KH2A 2PH5A 4AQYB 3KU4A 4EY6A 1YVEI 2AFHB 2CF6A 3RUFA 3N7UA 3SMQA 3UJ6A 2DFTA 4B6SA 1XD2B 1MOSA 3O8OA 2BE9A 3C5GA 1ACMA 1XLUA 2V7QD 4CM3A 4KQ6A 5CVDA 1MUUA 2XMDA 1U2ZA 5M04A 1YHNA 2HU8A 1UKVY 3AI7A 4MFFA 4C0BA 1GCIA 4L28A 5EQDA 3OF2A 4US0R 3IFSA 4ARAA 3Q0TA 3TQSA 1T1IA 1RLMA 2IZOA 3MILA 3PX7A 3G2MA 2NNLD 3ER6A 3D3NA 3HYLA 1Z37A 4TTQA 1EUZA 8ICCA 5DHRA 1VSVA 5EE3A 3FPGA 2HPVA 3W5JA 4P0PB 1W0KA 4D0SA 3IEIA 1PT8A 4GI1A 2J31A 2KSQA 1EK6A 3TNLA 2NU6A 2HHAA 1XXLA 1BQEA 3WGLA 2ONKA 3NWOA 4TS4A 2D62A 3E3MA 3JQ7A 4HWKA 1MENA 1I6WA 2XKBA 1DBQA 3NTRA 3V6HA 3WMEA 5CGZA 1JJIA 1LPNA 4GOJA 3WK6A 3EVAA 3ND5A 1AN0A 1TKDA 1G20B 5K0LA 5JMPA 3JR3A 4P5PA 3K73O 1NIPA 4LZPA 3V8MA 5DBFA 2XA1A 3R7AA 2AZXA 5G4LA 1Y7LA 4QT4A 3WJ1A 4OLAA 2VUTA 4MWSA 1FJHA 3FVQA 3PE3A 1J2TA 4LMBA 3DZBA 1BNOA 2C7VA 4PYJA 1I1OA 4WXHA 2GZSA 2WD7B 4NZYA 4M36A 4K03A 3LC0A 3D4LA 1QK3A 1Q3VA 3LSTA 2FZEA 4IGEA 3I12A 1NT4A 1I24A 4D97A 3CRVA 3L0OA 3PK0A 2WFLB 3JATA 4E11A 4MW5A 2R5FA 1U48A 4V0NA 1E1MA 1QG6A 1RPLA 1RM6C 3TM5A 5HF5A 4D43A 5HQTA 2ZYGA 3D43A 3FBGA 2I2FA 2XGOA 4ZT3A 2ISSD 3TJMA 4AX8A 3VOAA 3W5AA 3FPLA 4TN1A 1MDBA 1N5RA 3WWDA 5ALDA 1I3MA 3FOZA 2QZPA 2ZB7A 5HS4A 3B70A 3FCOA 3WLIA 3JWEA 1N2JA 2B9EA 5KOJB 4XFKA 3V4OA 3R7NA 1FS6A 3C4JA 4R2MA 3TUZC 2YICA 3KKOA 1N8NA 3V2HA 3O1JC 4QU0A 2O2ZA 4EVIA 2VYND 5L4LA 3UTDA 2V7TA 1UPBA 1M0WA 3W8EA 5LN1A 3TLYA 5IIKA 3UFXA 2IGBA 4HS9A 4KYTA 1QQAA 3CR7A 2IKQA 5A7FA 1XQWA 1VLBA 1D04A 2P27A 4KBGA 3MUNA 3TLMA 3BE5A 3T7RA 1WCIA 3OT4A 4J0HA 3E3NA 3UJAA 2XGQA 1U2RA 2PFGA 4ARZB 4Z4CA 2IYRA 2V8BA 3WGYA 4YXFA 2WUDA 5GIOE 4YA6A 4ER3A 1UM9A 5JSFA 1H2WA 4CG1A 3WKAA 2HB6A 3R5JA 3UJHA 2AN5A 4UQOA 4X1IA 1OQAA 3M4JA 2SKCA 1LLUA 2OP0A 4O5EA 3GROA 1PFUA 1MVOA 3IIIA 3LY7A 3NEJA 1T29A 1M0EA 4JQOA 3HZHA 2B4KA 1ZNWA 4PLYA 4X71A 1LLQA 3ZY4A 4DUPA 3TSAA 3DL2A 1TKRA 4IIUA 1G66A 4J0IA 1NYLA 2MSKA 4HFJA 3KSBC 1E2LA 4V0OA 1T0PA 1T43A 2RHMA 4QLBA 3PI7A 1KO4A 1Y8ZA 4F4IA 4LHZA 5ELLA 1NC3A 1J90A 1USIA 1Q7CA 4YRZA 2I9KA 3A3YA 3S3TA 2LVBA 1KMCA 2CNKA 1YZVA 3Q8RB 4RV5A 4QUDA 1E2HA 2LYBA 1TECE 4QM6A 3GI1A 3O31A 1P8AA 1TD1A 2E4WA 3VU1A 3FKQA 2I2DA 3S6JA 4H4EA 2WJVA 3DBLA 3DCYA 2R8JA 1IBCA 1ADYA 3ZWNA 4K46A 2AE1A 2H3EA 1K1EA 2JF0A 5HILA 4YRGA 4DCTA 1MQ9A 1YIDA 1GDTA 3CMMA 2Q8NA 3H4DA 4B9LA 3HS3A 5KZMB 1YBMA 3RR2A 2J5RA 3AT1A 1MX9A 3T9BA 4C2AA 3AKCA 4KC0A 1A5BB 2UUAB 2FR8A 9ICQA 3KPUA 3LAWA 2AD1A 5A04A 2YW2A 2OXCA 3DFMA 3QA9A 5AXDA 5CDTA 1BWSA 2W2LD 5IKOA 2BHTA 1JBKA 5SY4A 1QVAA 4QELA 4BVBA 2W04A 3PCRB 1RHUA 4NG4A 3FY4A 1AKTA 2YQ4A 2KPOA 3IR7A 2KE7A 2FSIA 2PN1A 3EWIA 3KV3O 5ANRB 5K8TA 3C3KA 4A23A 4AUMA 3NRZA 1UMCB 4EPXA 2HUNA 2RC5A 1OASA 1HE3A 2PE5A 3IDZA 4TKUA 2VJOA 2JATA 5HKAA 4F6RA 1KVSA 4HWSA 1J8DA 5ILGA 1T4CB 2EFJA 1S3SA 1SO8A 5FV4A 4KJXA 4RPYA 3CV3A 3KETA 2OLKA 1ELOA 1QQ6A 2FDRA 4RU9A 3BM5A 1K6IA 3EPLA 3S2EA 3DAGA 4N4AA 5C5CA 1RJ9B 4G5XA 1BGXT 3IPYA 3G85A 3RK0A 3QVUA 3B2EA 3INNA 4BB0A 3EQZA 4GXTA 5H1YA 1PAUA 5AUPB 2FXVA 1YZ7A 3NRBA 3U5TA 3LUCA 2I76A 2VCYA 2B1JA 3PKZA 4BKQA 3O3MB 2RJ3A 2PL3A 3K53A 1LBSA 3K9NA 3PP8A 3KM0A 4M38A 2A33A 2OXOA 1FDSA 4EJSB 3TXYA 4DNFA 4ZANA 4V24A 1NP6A 5F2OA 3A10A 3AR4A 3TE6A 5HNKA 3R3HA 1RMTA 1W25A 3W5VA 1DG1G 4O59O 3KXLA 3GLGE 1BVSA 4QDTA 3Q98A 1CJUC 4M89A 4P4TA 1L5MA 4GVPA 1R0KA 3IJRA 4Q7EA 1C3XA 1RBYA 2ZANA 3D0QA 5DYNA 1FJGB 3G59A 4MFCA 1OUQA 1RRGA 3IDAA 5I3CA 2Q6KA 4INAA 1GRNA 2B7LA 2UXCB 2W43A 2OORC 1KI4A 3DZHA 2IP4A 4RU1A 1E5TA 3P4YA 4F7DA 2ECQA 5EUMA 2CKDA 1Y9JA 3PSAA 5EP1A 2FQYA 1SVLA 1F6DA 4QOSA 3TLJA 2PA0A 1IXZA 2O8NA 3E8XA 1ESCA 3NDBB 4UEKA 5DYTA 1LX6A 2RHFA 3MCUA 4DGQA 3UV3A 5FIUA 1MIOB 1FUEA 1HT1E 4ZXFA 3USES 2IDKA 2IMWP 1UQTA 2NGRA 2J9FA 9ICAA 1HE2A 3WLTA 4NV0A 2HA7A 3WIEA 3T3DA 5FWXB 4YJHB 1S76D 4PFJA 3V42A 1JHAA 1UZUA 1OVMA 4ZYTA 1WHTA 1MFZA 1SR8A 3KS9A 5EKSA 4DEZA 3DHEA 4HRAA 3HJBA 3RANA 4B87A 5TY0A 5HR5A 4GP9A 2XVXA 5EP3A 3DO6A 2JARA 1ZBDA 1DUVG 3UHAA 4X97A 4R31A 3DZKA 4AU1A 1MX5A 2XXAA 4DWOA 3HYNA 1NJWA 5BNIA 1G6HA 3E27A 3KR1A 4ZT5A 4Q3AA 4PZAA 3WO1A 1A9YA 1R8XA 4QULA 3ZH9B 3GK3A 4FTWA 1SL2A 3UTCA 1Z63A 3W3AA 2IP1A 2UKDA 3ND9A 4XYLA 5CB6A 1TIKA 3L05A 3CTPA 2PUDA 3O5AA 4RQ2A 2FPLA 3C43A 3FWHA 3ZTTA 5AP9A 4GMGA 2XH8A 1NY5A 3IV6A 1OB5A 1DCFA 1JSCA 3O8LA 2JXJA 2BONA 3L79A 4R9NA 2W2KB 4E2FA 3ZHSA 1KZHA 5G3ZA 3RVRA 4CIXA 4C4YA 4U5XA 3UMCA 1GSAA 3HSSA 3VBCA 3MT9A 3PD1A 4QDJA 2E1FA 5C35A 4CKYA 4YCXA 4XWOA 5H7XA 3LBNA 1RMYA 4HEJA 1KBZA 2G25A 1RYUA 2XCLA 8ICFA 3U2QA 3UANA 2C77A 2AOXA 5LDDC 3DBRA 1AKVA 5EE1A 3AH8A 2FMPA 5KYUB 3H2HA 4ZCIA 3C4QA 1GPJA 4HNTA 4GXRA 3C23A 2HJSA 4S1WA 5CPFA 2QB0B 4U02A 1H8ED 3TNJA 4E2XA 4DM7A 1JXEA 3VPXA 5K0TA 2JFWA 1FRZA 5IPFA 3ZD6A 1T13A 1OTXA 4BQNA 3F7NA 4AF8A 5K6AA 4R3NA 4AT1A 3FNRA 4ZQGA 3WR5A 4N9QA 4NL4H 5I7RA 3OBBA 1U81A 2RHOA 3RHTA 1L5FA 1DV1A 2EFCB 1I5OA 4BTVA 1XFDA 1N33B 1SVIA 2BKLA 1RI4A 2WWVD 5EYPA 3RRFA 3WBJA 2R79A 3TDNA 2FMUA 2C42A 1Y48E 4QFCA 1KEVA 5IC5A 4FNOA 3CEMA 4UEJA 1E9SA 2WV7A 2V3VA 3NIWA 1Z33A 3PO5A 2BGMA 2ZRKA 2NRZA 4JUZA 3AF5A 2A1UA 2OILA 1QTRA 2H4YA 2R4TA 3TEMA 3TAXA 5EHXA 2PEZA 3IEXA 4GZ6A 4BKOA 3UK0A 2HQOA 3EARA 3VDQA 5EWJB 2XY7A 3JPRA 3RQSA 5AW0A 1P5JA 5HQ3A 4XW2A 1A69A 1IPHA 2DUJA 3SIXA 2JLSA 4LE0A 4I4CA 4PZYA 2KFNA 3RVJA 7ICSA 3BTOA 2GVNA 3E18A 1SV4A 3RUAA 4TV9A 4ZO7A 1NMEA 4LX0A 3EEYA 5CH5A 5KHAA 3PX6A 1A96A 5EIBD 4YJFB 4OYLA 2X13A 1ISGA 1K3UB 4MSUA 5KG5A 2PAAA 4CMJA 4RTOA 2H3VA 1MAHA 2QX9A 1N6KA 3ZWDA 4ARCA 4FD2A 1U2GA 3CG0A 2H3HA 2PUTA 1QCZA 3LK6A 4W8GA 5LMUB 3H9EO 2XITA 1IXYA 2ATVA 1SZDA 4AWAA 1T25A 1ZIXA 1N2GA 3H2KA 4GLFA 3OA0A 3U61B 3EGCA 3TUIC 1F44A 5C53B 4OJTA 4Q45A 4OGLA 3OQMA 2QYOA 2O8BB 1QOQB 4OHWA 2BISA 4GLOA 4E03A 1EDDA 3FIJA 1SCNE 1CCWA 3RHZA 5HCIA 4F8YA 1Z6GA 5F7OA 4PQGA 2GKOA 4KW7A 3HJCA 2LCQA 1KXZA 5C2JB 1CUCA 1E5DA 2RBEA 2RH4A 1JG7A 2Y1JA 1WUIS 4ZVRA 1LNSA 4X62B 4QTZA 2F1JA 2C7RA 1S2NA 3GZTB 5J0SA 4IFIA 1U4SA 4DOCA 4JB3A 2NUPA 4FC7A 1NVXQ 2DPLA 1X70A 3L1JA 8AT1A 1FMJA 4Q1CA 4XUGB 4WLEA 2Q1XA 2P90A 3K4HA 2FHSA 3HNPA 3SLRA 1LQTA 1BXGB 1W85B 4Z4QA 1E89A 1EP3B 3NRCA 3KLNA 8ICLA 3WFJA 1ID1A 4UE3S 4RPZA 3WNCA 3ROMA 4G4GA 2BCGY 1VIAA 4ZQBA 5BN3A 1CKEA 1K75A 2R87A 3K70C 3F3YA 3HUUA 1SEVA 3S2GA 2DPMA 5D49A 4C4ZA 4V2IA 1C3EA 4H1VA 1KEWA 1ZQHA 3DE6X 4YJDA 3OPMA 2L69A 4ZGWA 4EMUA 2FY8A 4Y0VA 3EZ7A 1QHIA 4GYYA 2I1QA 3CYFA 4TKMA 4P98A 1IQRA 2VJMB 4ALNA 3VU9A 2ZUTA 3RYFA 3ZDBA 3GFSA 2H1FA 4Q3KA 3O6VA 1G9XA 4NCXA 3QBJA 2Z3WA 2E8OA 3TZKA 4UBIA 1HG1A 3JD0A 4NCHA 4XIJA 1SRQA 3STWA 4AZTA 4DLXA 1K86A 5E38A 1RXSA 1GAEO 1X8JA 3EDQA 2Q99A 1D1PA 3LI2A 2HZBA 1CUGA 5CD9A 1FW8A 1SCUA 2NP6A 3K94A 4G9BA 4BLWA 3R9XB 4ZDKA 5J2CA 2D00A 1Y7IA 5IF9A 1U4OA 2HBYA 5KTQA 4MARA 1TT5A 1UKYA 5IK2A 3ZZMA 3RUCA 3U3RA 3MMNA 4GE3A 5FYQA 3X1YA 4RXTA 1BA2A 1FDRA 5AKHA 2OBLA 1UJ5A 1H9BA 1RYEA 3WMXA 3HA3A 5IKPA 2M0NA 4AKIA 2QLNA 5FBLB 2C95A 1LV8A 3NC4A 4IX1A 4B6FA 2GNPA 2AUMA 5BV1A 5CDUA 5GV7A 3F1KA 1T2VA 2BFFB 4N3BA 2A9QA 5JE8A 3NTVA 3RT1A 3VR6A 2PLNA 1DQRA 5SY9A 2WKPA 1OXMA 5FPTA 3SXUA 3WRVA 4M49A 4FEAA 4MHTA 2SHKA 1OREA 1I10A 2OXIA 3I8OA 2XI9A 4MUXA 3CPSA 3T3MB 2L0XA 2IEZA 5AKYA 2X15A 1BNCA 2VC2B 3BRQA 4LDPA 3VSEA 1WBDA 4J3NA 1IOVA 3X0DA 3P45A 5EP2A 5HF8A 3F97A 4ZA2A 3CX3A 1O1YA 1NJZA 2YVAA 1NUQA 3Q3IA 3EEQA 4BMPB 4KLTA 3ULKA 4QUGA 3IAUA 2P78A 5C1IA 4YR2A 4JI5B 4AJLA 4ZEOA 2W11A 2RKBA 1XZLA 2P1DA 1QPGA 5I9BA 3KKKA 3E9QA 4BUJA 3T5MA 3AF1A 3CJQA 1ZYUA 2ZW9A 1O77A 2CMHA 2MYTA 2ZUWA 2AYZA 1YCHA 5K4AA 2HRZA 1VC2A 2EF1A 4ZEXA 1ZD1A 3C15C 3OZWA 1RD4A 1H0KA 1KWKA 3U56A 4RZ3A 3FSJX 3AERB 2HJRA 3H11B 1IZ7A 1INLA 3O8QB 3MZ0A 4AM8A 2DHEA 5DLEA 4QFMA 1GEGA 3K0AB 3ZKWA 2B25A 3A7EA 4P9NA 4BRUA 1DIRA 4W5HA 3HB7A 4OB8A 3N0WA 2Z4RA 3ORHA 3OJSA 3E81A 1X8KA 1J39A 4UNNA 5FV7A 4E5PA 4D4IA 3I9LA 4XFJA 1IOZA 2DHRA 5DB6A 4PLFA 1H3FA 3LGAA 5EHZA 3BE4A 1MDFA 3WLNA 1AU9A 5GGXA 3BXXA 3LIIA 3GNLA 2A3NA 3CX7A 3EDRA 3OZTA 3ONFA 1B15A 4UU0A 1ISHA 2ZSUA 4UAJA 4B83A 1J24A 1P0CA 1Q7EA 4TUSA 3N28A 5TX7A 3SHQA 2A30A 2O6LA 2YWHA 5G1OA 2V4UA 1S8AA 3KK0A 4XLLA 2PQ2A 4PG6A 2G08A 3BXOA 1RP7A 2XMGA 5DK4A 4PNHA 1R4MA 1GGKA 2MTBA 3C70A 1XN1A 3LQQA 2BEWB 1FX0B 2XB6A 1QH8A 4CMEC 4XM1A 4Z51A 3WLFA 1JQKA 4ON9A 3P5SA 3A06A 3CY6A 5LQSA 3W9BA 4MINA 2X3FA 2IUYA 3LVRE 1I9CA 5JJBA 4QIWC 3NGMA 4KDCA 4POAA 3TFOA 3NQ41 4CF7A 4M46A 1OT3A 4K86A 3R6GA 1RAAA 5AOCA 3DTVA 2QM3A 3H7AA 2VTDA 4PYKA 5DHUA 3J7TA 2ZZNA 4IVQA 2F3RA 5JAIA 1JDBC 2ZU6A 4AL4A 1L7OA 1M2OB 5TE9A 4MVJM 1ZI6A 4DILA 2A9KA 4DSEA 2H1WA 2FEXA 4OP3A 2PSSA 3WLMA 3IP1A 2KQUA 1OIVA 1DS6A 2VKTA 2AQ4A 4JT9A 3SU8A 4JUFA 5EJ7A 5DIZA 4BNWA 1RCTE 3CPEA 4DLSA 1UDXA 1P2FA 4B3HA 3HY4A 4R98A 3P9YA 3ZWWA 1ZZEA 3THWB 1FO4A 9ICNA 3FCEA 3TBKA 2XKJE 2JIZA 1Q12A 4FT2A 3ZI7A 1JKJB 3QKRA 3K3PA 3KL2A 3RV4A 2AL7A 2FPXA 3O1HB 4PAWA 2BW0A 3GGCA 1MLDA 3KQOA 2QQEA 1QBGA 5KC9A 3GA7A 4EB6B 2R8RA 4L6IA 2AEJA 1YZTA 1FPQA 2VPYA 3K6SA 5K0NA 3K8ZA 4HDOB 4PC2A 1PKEA 3NFYA 5CXQA 2F90A 4MQMA 5DSTA 1N92A 1XDBA 1QMGA 2G06A 3QOYA 3WJ7A 3SI7A 1CEZA 2OM2A 5BQ3A 1O5TA 1G9TA 3PUWA 3WRWA 3GLHA 1E4VA 1WXXA 4FHZA 3G2KA 3KSUA 3KZOA 4AF7A 1JFFA 1DJLA 2G9NA 3O9MA 3TSWA 1OOEA 3GLFA 2I6GA 5KNCA 3Q7QA 3PSIA 2JZBB 2UYYA 3LYHA 1G98A 2N42A 1SKSA 4ZDJA 3T7CA 5KG2A 4MRSA 4EG0A 3WYCA 4LJSA 4WBXC 3ICQB 4CZ2A 3HA5A 4AY2A 1XPRA 1WRBA 3JSAA 1KI1A 4CIVA 1K2VN 4BLOA 3I2JA 5IARA 4NBKA 2Q3LA 2OD9A 4J1TA 1PD1A 4BQIA 1PDOA 3BXEA 1A8SA 1R3UA 4OL9A 3NWJA 1VDMA 1RIIA 4W9NA 4NX2A 1FY2A 1N5DA 3GMDA 3TB6A 4J0CA 4XEUA 4XYGA 4EARA 4H3KB 1RHMA 4UOEA 3AG6A 4P34A 4HO1X 3B2QA 4WEOA 2GPWA 4M8IA 1CTQA 2KK0A 4I8XA 3ZY5A 3I2FA 3MYYA 3NHJA 4Q47A 1JL3A 3G8AA 2V55B 3FTPA 3MJTA 4PO1A 4O08A 2ZJ5A 4I46A 3ASUA 5FUMA 1WU7A 4GECA 2X7HA 5AXAA 3NBKA 4CFZA 4Z8XA 2VFAA 2FVXA 2IPOA 3PIRA 2N75A 3QUBA 1EE9A 2NSLA 2CDAA 4OF4A 2EQAA 3PVXA 4YAGA 4MIOA 3WHPA 5CP2A 2R2AA 1HDZA 4MDFA 4AUKA 4WXMA 3H2GA 3O9VA 1FFBA 4CEHB 5HF6A 3RI3A 2KZ3A 1QTIA 3V4ZA 2DUUA 1R9NA 4IUDS 3M1YA 1HE1C 5D7BA 4BN5A 4P4LA 1MO4A 1OH5A 5BN5A 4OI1A 4QASA 4YJ3B 4OJOA 4TQAA 5IIIA 2ZPAA 1K1QA 1GAQA 1ZN8A 3KYIB 3OLVA 3LQFA 3DV2A 4WK6A 4GPTA 3KJNA 4GBJA 4CWAA 3GYGA 2V6IA 5FPHA 2CXQA 2BRUC 3C1OA 1WWUA 2PUBA 1OBFO 3NBZC 1N2OA 4AKSA 4EFLA 5EUBA 3IUEA 2ZXIA 1MW9X 4AS3A 2C58A 3K0BA 2WTUA 1O94D 4EJ6A 3QFHA 5EXEA 2G36A 1NR5A 4BO1A 2Q0ZX 1EFLA 1H0RA 1VLMA 3ZBQA 3S8MA 1N6OA 3IUMA 2QRVB 4PXYA 5FULA 5DGAA 2NAPA 2A57A 1Z39A 3A2KA 2V58A 3C39A 4V0SA 1E61A 3ILHA 2BEVA 1RVV1 4RAOA 1GA6A 1Q20A 2BFDA 4DSNA 3OTGA 1CR1A 1ETHA 1M2JA 2QVYX 4K2HA 3GEMA 3DR3A 3HP7A 3JAKA 4RVSA 4MRRA 3GLIB 2YVKA 1M5UA 3WADA 1W34A 5LD2B 3HNRA 2FE1A 2F48A 1XLWA 1IEXA 4MROA 3KX2A 5AKLA 3C3PA 3BZWA 1K9VF 1MJHA 1VZ3A 1RRKA 1DDGA 3A4LA 4JT4A 3P9PA 3OHPA 3GG2A 4HLDA 1N4AA 3IJPA 3SIWA 4L85A 2ZSDA 3H4VA 3BD6A 3IAM1 3VUEA 1VBKA 4JNCA 4EQ6B 2I34A 3NALA 3LWMA 4NARA 2PXIA 5DFAA 1I5RA 4JWMA 3EYWA 5IX8A 2IY8A 1N6IA 1I7LA 2ESEA 1QP0A 4XDYA 1I5EA 2D1YA 5SV2A 4IIJA 4DTCA 1FVXA 2KHQA 3X1JA 3BN3A 4GXIA 1NF9A 4C4OA 1XSEA 3HCEA 2CUKA 3LC2O 1U47A 1DBSA 1NR7A 2ZXUA 1Z3IX 2ILVA 1O97D 1MAAA 2XTJA 3KZKA 1AUOA 5JLJA 3L3BA 3JQDA 1MORA 2V9WA 2O8EB 1BO6A 1R0RE 2BDEA 5FLEX 2PSFA 2E8PA 1J99A 2J48A 4P4MA 2I6XA 3NWEA 3GPLA 1P77A 2II6A 5ELXA 4LAFA 1A5ZA 1XX6A 4RENA 1CQPA 4E14A 2P2ZA 2FWBA 4MW1A 3GDOA 4KXWA 3TD2A 1A1SA 3EFHA 2NXNA 3AR6A 3ZOKA 1OGYA 3LT0A 3SBOA 1RWQA 3JZFA 4WGGA 1PQPA 2O6HA 3R0ZA 1BXRB 1T3NA 4IWXA 4GEKA 1QSGA 4C88A 2GD2A 5FQOA 1E7SA 4KVGA 2CVFA 2B8JA 3QI7A 3CFYA 3KXPA 2M98A 3AHFA 3D2BA 4U8GA 5AOVA 4DBZA 2WAAA 3EXFB 4NJMA 1L5RA 5BYAA 3R09A 1ISMA 1O5OA 1ZQYA 1YVPA 3SX2A 3DKPA 5KT7A 1KI6B 1QG2A 4J75A 4ZH4A 1BPYA 4XUEA 2TS1A 4ND2A 4M9ZA 5HG0A 4M0PA 4NMHA 4JL8A 2H1CA 2ZRGA 3WRXC 1TMYA 5DM1A 3GHHA 3GIWA 1R0CA 2XE4A 1PW5A 3GEHA 4GVLA 2ECFA 1G4UR 2XCPA 1PLJA 5DH9A 3AVVA 3ZDQA 2G76A 1G8GA 3IT3A 1ZI9A 4LCBA 3L8FA 1VIMA 2I2AA 1MZPA 4E51A 2R4UA 3FZQA 5E1BA 3RC2A 1REQB 3C5CA 2Z9DA 5TGZA 5HDBB 5BPHA 1R6AA 1M1YB 1VMAA 2NZ2A 4MVWA 2NAFA 4J9KA 2IHJA 4IOLA 5LXTA 4YXJA 4FEEA 5EMJA 3ZGYA 2WTNA 3H1AA 4YVZA 2PS3A 1BHQ1 1M72A 2VBGA 3CO0S 3Q41A 1V4NA 1FP4A 1NNEA 2YVQA 2XCIA 3T5BA 2XZTA 3HA7A 4G56A 1C30B 2GAAA 4F4FA 2MSNA 4IRMA 2NZVG 1T8EA 4EFKA 4JI6B 4PHHA 4LZAA 4Y6LA 1ULTA 2E4AA 4MKFA 3CX4A 3RUIA 1DFIA 4D4GA 1A8HA 1F14A 1F8UA 3AEQB 3NHRA 5C8DA 3KLOA 5K45A 3K6JA 3WMFA 3TLZA 2O3UA 1E6EA 1SEPA 3JQ6A 3EG9B 1D09A 1MIHA 5KYWA 3DUFB 4GPEA 1VLQA 1L4GA 3MK31 4I2CA 5E79U 3MR5A 5DM0A 2WIGA 3S44A 4LYJA 1QBKC 2VI5A 3QE9Y 3OI7A 3V6MA 1HT2E 2W00A 2XA9A 3REFA 5J3JA 1T3SA 1A9ZA 4IKOA 3Q40A 2EBHX 1ZSVA 2RGUA 5IG2A 3GAAA 1SELA 4QBGB 3NASA 4BFWA 2W2MA 2K60A 5BRAA 3OQOA 3FTQA 2WUGA 4BQFA 3M8SA 2VT6A 2E4ZA 2BH2A 3JASA 4B40A 3QXHA 4QPZA 4KL8S 3SF0A 1K7XB 3FWZA 5GOTA 1D9ZA 5EGSA 4M0UA 3RH4A 7ICFA 3M33A 1EYZA 1EVLA 3OGUA 1G8JA 3H83A 5IDVA 3D4IA 2PS9A 1XA0A 3DD5A 3GT4A 2BPFA 3KQNA 1TNDA 3NB0A 1U0RA 1K4KA 3V1LA 4TLBA 1YJAA 3ELBA 4URYR 2F2AB 2GEVA 3K92A 1QVVA 4GDFA 3N7SC 4MA0A 1Y1PA 1U8FO 3IVCA 5HM8A 4P80A 3OSPA 3RYIB 4II7A 4KQFA 4QBIA 1SKWA 2FMSA 1VPLA 2W54A 5FNVB 3OLZA 2WYWA 5AUOB 1XJ0A 1H38A 2P4HX 1L7BA 4ER0A 1IYZA 3RR8A 1Q0HA 1X1QA 3FSGD 1UZMA 4F3RA 4JSYA 1IQ0A 3PD7A 2QRNA 4OV6B 5JQGA 1Z36A 1RAFA 1Z6QA 5JSYA 1NMQA 3ZGXA 4P7FA 1B00A 5DYYA 4YCJA 4MQBA 2PWYA 3KOYA 5DB9A 2EYUA 1SVOA 3G89A 2Z58A 3R3UA 3ZD8A 4YJ2F 4M1KA 2G8LA 1I3NA 3AFHA 4D4MA 3DHWC 4RS3A 4FU0A 4EYQA 1FS5A 1ZMTA 4PC6A 1G1AA 5AUNB 2BTOA 3F1LA 1XEAA 2X22A 2UXDB 4JEUA 5KTSA 3QELB 5LP6C 2FMXA 2PL1A 2D8CA 1TM4E 3VU0A 5A62A 3LOPA 4RQBA 4DDHA 4D9GA 4PS0A 2I1LA 5F12A 1UODA 5LMZA 1BHSA 1VA4A 1EGQA 5B12A 3U4GA 1XTQA 3EGXB 1VPTA 5CFMA 3Q2KA 3U7RA 3USCS 3HKZF 3ZIAD 1B23P 2MCFA 1GKKA 4DQ0A 4A2QA 2OEHA 4BTEA 1GRRA 2IX9A 4DCSA 2RG1A 3KHKA 3GQBA 3NDRA 3GCZA 4ICIA 4KRXA 3OKPA 4F2PA 4E94A 1BXKA 1CNEA 2Q3DA 4YCDA 5DO9A 3MGVA 3QOWA 1VHDA 1TAGA 3JQQA 1TK0A 3IKTA 1NKEA 2VHVA 2ORVA 1PCXA 3S1AB 2FJ6A 2W9BB 3DS8A 3PXBA 1RC8A 3Q7SA 3BRWA 2J6CA 1P0IA 3TNFA 1KZ9A 4LJ9A 4DUGD 1EFRD 4R54A 2CL5A 1SAYA 4P54A 3QH4A 4DC0A 5AQEA 4DLRA 2BV3A 5IKEA 8ICXA 4IC9A 5GGYA 1XL1A 3QNUA 1SHUX 2H8KA 3U40A 1J09A 1O0SA 1Y5IA 1YKGA 3IC5A 1T8PA 1KL7A 1LLFA 4R41A 1JR2A 3ESBA 3B3FA 1L4EA 2ZYAA 5ITZB 5J2UB 4I27A 1U5AA 2EEPA 3EXHC 1KMQA 5FF9A 1Z34A 1YOVB 4U2KA 3SKYA 2KNJA 2OLEA 1BGWA 1XZBA 4HGNA 3EZ9A 2I4LA 2W2VA 1X7DA 3H2BA 3TW4A 4QA9A 4M0DA 1QG0A 1U7TA 2ZRPA 1CI4A 3CF4A 3MTJA 2PUAA 4FYMA 1JEJA 1ESNA 1W76A 1AZLA 2NXCA 5JVDB 3DXYA 1LZKA 5GWXA 1LEHA 4KLGA 5KPDA 4IQFA 1H0SA 3SVLA 3U1VA 5B64A 5ENDA 4BCCA 1VCMA 1NQVA 2KBEA 3PLNA 2A1JB 3I9FA 5BWNA 4CIYA 3SCZA 1ZZGA 1XQ6A 3HKCB 3DL7A 1Y6QA 3QVKA 1Z3CA 5E2IA 1U0BB 421PA 1UPAA 2F17A 3AI2A 2WKQA 3IO3A 4LQLA 1QH9A 4ENUA 2VQEB 2IXDA 4DJ5X 4LBYA 4HRYA 4FHDA 4WA7A 4ESOA 2WF7A 1Y1QA 1X0XA 1GTL1 2XUDA 3EUB2 3AETA 4H7JA 3LTNC 4PN7A 3E7XA 1ZINA 2AZDA 5HFNA 4CUKA 1X3LA 4BO5A 1T6ZA 1YQQA 2HHSA 3GFQA 1TUEA 5JYCA 4CKWB 3DMTA 4DIUA 1PKXA 2CW5A 1KAMA 3VNRA 5H9WA 5LUBA 3TTSA 1P6XA 4DIBA 2HK6A 3SLGA 5KFVA 5L6LB 4H6VA 4IR7A 2YIDA 3YASA 1UA1A 3U4IA 1PL6A 4UBKA 2ZVQX 3CF4G 1N5IA 2JLZA 3CLRD 5IFKA 1V8FA 3F9CA 3D3WB 3OHMA 1OTHA 4YRJA 4DVJA 3M49A 3A3OA 3QLUC 3EIQA 5CNJA 5KAPA 4TMXA 3DV0B 2QSZA 1J1ZA 3SEQA 1IHPA 3K1RB 3C8MA 3AM1A 2W9CA 4NP6A 3RC7A 1SQ6A 8ICOA 4H77A 4HRVA 4DDMA 3WWCA 3O2QB 2EX1A 1NKVA 1BE0A 4L72A 2JH8A 1KAHA 1E5LA 4JODA 1T0JB 1RKQA 3SJBA 4ZC8A 1FTYA 1ST2A 5FQNA 4XB6B 3FDXA 3GRUA 2OTCA 5J2BA 3ZWMA 3V7KA 4LTNA 3GEGA 2BWJA 1KK3A 1OXSC 1Y1KE 1G5RA 4GP7A 4E33A 3V7LA 1N48A 1RG6A 1NQUA 2R97A 1ZUD1 3FSRA 5LBIA 3EEOA 1PZMA 4JL5A 1UXOA 4RPIA 3IULA 4OUDA 3CVUA 1WV0A 4HNGA 4QWDA 4FGUA 1QKJA 1L1RA 3Q2OA 4JXKA 4DSLA 2VP2A 5BYBA 2DZDA 3A1SA 3DMPA 4QO7A 3RIGA 4KE6A 4ZOQI 1UT5A 3TQRA 3VR3D 2M6RA 2N3ZA 1M2EA 4JOQA 2VRCA 4BFZA 1GNPA 4TWAA 2NO6A 3L8ZA 2K8CB 2FZWA 4G24A 5B1SA 4EAQA 3NIDB 3ZHRA 2ACWA 1FTNA 4LJ5A 3TZEA 3DAFA 4AYTA 4JMLA 1MMFB 2I87A 3B78A 1NE2A 2IV2X 3PEFA 4RQ6A 4TVOA 1FP6A 4HAIA 3N7RC 2GK6A 2PSEA 3VKVA 2YWXA 3PEEA 1LBQA 4KWIA 4IQTA 4Z4IA 4G1UC 5G4KB 1NX9A 3AL3A 4HDNB 1CS0B 3H4BA 4NG5A 2O2JA 1KDPA 4IXTA 4O3FA 1SKBA 5DLYA 1OWNA 2HWYA 3W7VA 1HF3A 5HJ2A 2QAGB 4XGRA 2XIDA 2HTEA 3BZCA 2I9PA 3P9KA 4IIHA 3F5QA 2DTXA 2OQIA 1X6IA 2CLSA 1WLSA 1I2CA 1TJ5A 2LGJA 3U80A 2AKAB 3LLSA 4EF5A 2G1JA 3KWMA 3OY2A 1DX6A 2BR5A 3S2ZA 2BDUA 4YX9A 5KKNB 3EMBA 4KXVA 5FAKA 3AUAA 3AF3A 3BKWA 4KXLA 1COKA 3FI0A 1X80B 3OUTA 3ZUPA 3ML1A 4GICA 1RSZA 4KXMA 3THYB 1SHZA 3EZFA 5BQXA 1AKEA 2JKVA 1E5XA 4IS7A 5JNTA 3SQXA 4DMUB 3FTCA 5JD5A 3B53X 2J0UA 1WOYA 3FFWA 4HMPA 1NVFA 3NLLA 1J0EA 1UBOS 3JQ9A 4RK4A 3PGLA 3ACCA 3MELA 3UT5B 2VZ0A 3E22B 2PI5A 3TG8A 4RHCA 1IN4A 4QHYA 2Q07A 3AXTA 2A5YB 3LQKA 5DTRA 4MWDA 1RAHA 3C2MA 3AU9A 5EJ5A 1PGPA 5CIYA 1ZVJA 1FYVA 4H7PA 1MABB 3OCVA 4UTXA 5JHGB 4IILA 3VHQA 2CVOA 1E6LA 4YMHA 2ZIZA 3KQQA 1CJTC 4B9NA 1SNYA 1ZFNA 2G28A 5AM3A 6REQB 1XVAA 1UBJS 5EZQA 2JIQA 3B7GA 4X6UA 4QYIA 2BTEA 1RLJA 5CUQA 3SDSA 4LVNA 5HTKA 4G25A 4KYIB 4U6NA 4HQRA 2OCAA 1R74A 4FS1A 4DL4A 3I2IA 4E08A 4LYYA 3WAKA 3A6ZA 2CVQA 3STUA 2BFMA 2Y4OA 4HVLA 1V3TA 3WRYA 1FMFA 3PJEA 3AM4A 2J59A 4LF5B 1UXIA 2CDBA 2F77X 3DEKA 4CEIA 4X7MA 2ZAGA 1GGNA 3N5KA 2AJBA 3IILA 3SJAA 1W5BA 3A9WA 4B34A 2QTMA 3STYA 3WQQA 5A5VA 1H0HA 3B6IA 3UK7A 1BW9A 3CIFA 4XD7D 1ECGA 3EYAA 4I4LA 4JYAB 1X6VA 3IHLA 2QJOA 1JMYA 2NADA 1J2RA 1MOQA 1NBHA 2V45A 2CV2A 4E0BA 3TQ1A 1ZG3A 2YHBA 4PLTA 4CR7A 3A26A 1E2DA 3C5FA 4G5OA 3RYHA 1J20A 3HI6A 3BQMB 2CMGA 3V6KA 4U2FA 4TL8A 3CKYA 4B3RB 4KK4A 3GT0A 4I8IA 2P66A 2PTGA 1H23A 1GG2A 4Q12A 1BE6A 1RFGE 4P4NA 3PPWA 5KTKA 3UAXA 4HATA 4KYUA 2QTFA 4Q44A 3LRXA 5EUCA 4RA6A 1V8ZA 4K8RB 1QRRA 2YDXA 1MA3A 5DQIA 4EWLA 1U65A 4CW7A 4BBZA 3F6YA 3FYUC 3U0BA 1ZJNA 1CJMA 4LXHA 3WL3A 2WJJA 4RQ5A 3NJ4A 2Z9BA 3UH1A 1TK8A 4RQTA 3THRA 5CDSA 1E3IA 1SUDA 4MPTA 4D3XA 2ZTLA 3Q8PB 4JASB 1I9GA 4Q1BA 2QNIA 1LV5A 1D2HA 1A4IA 4DV5B 1TQ2A 3VDNB 2LYAA 5DB4A 2UVPA 5C8YA 1D2AA 8ATCA 3A05A 5FTMA 2OUIA 3UJNA 3JD1A 2O5CA 4XB1A 4EO4A 4DTIA 4MGZR 3TBHA 1IUKA 1Z4PX 3QE4A 1JG3A 1E3JA 1FLAA 2EQYA 4WK0B 5AHRA 3K9WA 4W5NA 2C4UA 1I2ZA 1I6MA 5K3EA 3WZ2A 4MMXB 2W42A 4Q9KA 1YFZA 4YREA 5CIWA 2FMKA 4J3JA 2PZAA 3PC8C 4EHFA 3RU2A 5LLSA 1FQJA 3LA6A 2ZUBA 3PJGA 4L75A 1Q16A 1DTWB 3G17A 4PCAA 1UMDA 1YU9A 5ECGC 5FTLA 5KFGA 1HE4A 4QWCA 3P9IA 4MX8A 5SZKB 2C7QA 4WZAB 3HC7A 3K31A 3AEXA 1QRAA 5I5GA 1P6UA 2CNBA 3AF6A 5JC1A 1GGHA 2WF8A 2JVJA 4YRCA 3WGJA 4N0QA 1I51A 1A3CA 4X1YB 4YGYA 1ICIA 2DQ4A 4PTLA 1N77A 1XRJA 4TUQA 2GN9A 2FN8A 9ICEA 5A4MS 3MT7A 3A36A 4XQGA 4FSXA 5F2KA 4U7WA 2FOIA 1U04A 3GGDA 4S2EA 2GAOA 4R83A 3F5MA 3CKKA 1X87A 1GUFA 4QLAA 3JXEA 2XNHA 4CKCB 1NSYA 1QK4A 1CB7A 2FWJA 4A8JC 2XRMA 4LHEA 3F73A 1BMTA 3VR4A 1QAOA 1ZN2A 1GO2A 5LA6A 1ICEA 3JPSA 1YR6A 1ZESA 2CXSA 5AT1A 1L4BA 5ILQA 4FB4A 3PQDA 1JAHA 4UCQA 5T4EA 3EAQA 2FFHA 5HIAA 4RTSA 1L4HA 2QVBA 2XXBA 3KZ1E 3KKZA 5DE3A 2O2SA 1PS8A 4H7EA 3MERA 4N3NA 2B82A 3MGAA 1QO7A 3NTUA 4Z0HO 1FEZA 1M75A 2I7VA 2XOKD 4HUQB 5CLHA 4L0QA 5TEVA 3VYSB 5BY2A 4FYKA 1X1RA 3RD5A 1T2AA 4DQIA 4ND4A 3F5EA 1Z4OA 2AHOA 1DRGA 4HX9A 3V80A 4MV5A 4KPFC 2XHEA 3ZZ1A 4W63A 2C8VA 4L0MA 4HHEA 3CX6A 1KKMA 1Q50A 1D2RA 1OXUA 4MVJA 4DCMA 3RYCB 1LKYA 1B6GA 4EY5A 3FOWA 4CQNA 3FPEA 5DB8A 3BXGA 1OU0A 1H4TA 4Q3CA 5DVZA 2AEMA 3G3EA 4ZHQA 4BQOA 5HHTA 4PCLA 1JIUA 4Z6FA 3LWDA 1O57A 4F3TA 3WLRA 4S24A 4ZJYA 2CCGA 4M21A 1Z4KA 3B20A 4YT5A 3M6AA 4OQZA 2DECA 1RRVA 3TNDA 1CUAA 2CXTA 3WIDA 2WSMA 1X2BA 1Y4ZA 2PV7A 2P7IA 3K4PA 1KXJA 3JQ8B 4INZA 1H2XA 4RPKA 1F48A 1TLLA 2PLAA 2QN9A 5CX1A 3TWOA 4LJ6A 4ASUA 2RARA 4GWKA 4JDPA 1Q0SA 1NUTA 4RM3A 3CZQA 3QJYA 1QRTA 1F8GA 2HOQA 1LV7A 4PX9A 3X1XA 2X1LA 4ECWA 3DFKA 1WXGA 3OPYB 4FOSA 3H19A 3N0VA 2NSDA 5F2EA 2DYKA 5JZSA 3UMSA 1D6MA 4P86A 3OZGA 3BIJA 5DGTA 1CFZA 2PRSA 3RVDA 5EI5A 3QSGA 4EUFA 1P3JA 2ZJ6A 2D3DA 3HMKA 4HDMB 5K8VA 5AI4A 5DNCA 3DOFA 1IWOA 4EI9A 2POCA 2E55A 3K16A 4TUYA 3R4VA 3SZMA 4Y3UA 5IJWA 3ED1A 3MT0A 4YP9A 1Z5OA 4PYLA 1YBVA 4IRXA 4UHBA 4L73A 2CNDA 1XP8A 4N18A 4AJ2A 3RREA 1KEUA 1HEYA 3H1EA 4B4DA 3OTQA 4QQFA 2RLTA 4LHSA 1J49A 1I01A 4XD2A 3ROZA 1P74A 1HMPA 4N3CA 4ZWNA 1FRVA 1T9ZA 2YOGA 1C7RA 1V5GA 4TZ6A 2J09A 1R15A 5DK6A 3RJGA 3AM3A 3WFIA 1U3FA 4JJ7A 5AI6A 1RJFA 1ENZA 2O5EA 5KNDH 3B8EA 4D98A 3E9YA 2HF9A 3GFPA 4JROA 4EA7A 1NVKA 4BX3A 3HR7A 4KLRA 4X84A 2E1PA 4KQ1A 4PHFA 2CNLA 1LPPA 1EMDA 4J2HA 4W1RA 2ZRCA 1QCDA 1TYCA 5KB3A 3C7DB 3UMBA 5CB4F 3A1NA 2I6FA 2DLNA 3G49A 4H0FA 1U9CA 1CY1A 3MWLA 1VJCA 1U4BA 2R1ZA 3CSDA 5CT6A 4M7RA 3P97A 1UAYA 2ZIVA 3N7TA 3OLCX 1PJ4A 3NDJA 4PPXA 1EP2B 1MW8X 3ESQA 2C9YA 1GSOA 4JP3A 3R8FA 5HK8A 4A1OA 5A05A 2WE7A 4H16A 1SOWA 1YS7A 3EUEA 4H59A 4QOGA 1EUCA 3PQFA 1B0AA 1N61A 1L4YA 2KMLA 2W6JA 1DWOA 4UMVA 4IJVA 4DNXA 2F43B 5KT5A 5D3QA 4CEJA 4I9NA 1OLSB 1RQPA 4JP1A 3AIMA 3J7AC 3GDFA 2EJWA 4UNQA 2JGLA 1WKCA 5L9XA 3UJBA 2BL4A 4F4KA 1ODJA 2R8ZA 4G84A 2VR1A 3FA2A 3R0XA 4QWEA 2FG5A 5EQFA 1K7YA 2YMLA 1HLFA 3AVWA 1RW4A 2PMFA 3N76A 2VS1A 4YRPA 1DI0A 1LJ8A 3E9ZA 2HLDA 3DOCA 4WZBB 4A82A 3Q5GA 1X1BA 1MJFA 3L7AA 3KLMX 3IBTA 3OFND 3W5IA 4G23A 1EEXB 4FGJA 2OVBA 3DTYA 5A6SA 4MUEA 2QE7A 4JBWA 4YCMA 3WU2U 1CR4A 3F8SA 2QMOA 3O74A 2EXXA 1WJGA 7ADHA 3L4BA 2WAXA 3X2SA 2I4OA 1CS4C 1TK2A 1DQPA 3T4XA 1WTCA 3A3PA 1SKYB 1EJ0A 1J33A 2I4NA 3ESZA 3FZEA 4LIPD 3VPAA 4C43A 2X7JA 1RLOA 2XDAA 1DLJA 1ONNA 5A06A 4J9VA 2YNMD 1MJNA 2ZBVA 1S5LU 4JKIA 2H7XA 4X5OA 3PF8A 2IV3A 1JEYB 1TEVA 4K4HA 4EX7A 5CVVA 3OHAA 4XUCA 2GEDA 2NTYC 1EFPB 2R6ZA 4NATA 1QG4A 2IPNA 1E4YA 4E1BA 1SQFA 3ICWA 4X1OA 3R9IA 3E5RA 2EFDB 2K8AA 3U31A 2AOVA 4HY3A 2JDIA 1GZ5A 4G9GA 3NEPX 3CGWA 3FI9A 1BX3A 2YWRA 1EK0A 2H18A 4LCEA 1K2WA 3VMMA 4JMUA 4D0RA 3RFAA 5L51A 2KFZA 4TWIA 2W58A 2GGSA 3BL6A 2I8CA 2B98A 4U2EA 1A8QA 2VHUA 3NUGA 2H0RA 1MXHA 2WUWE 1FSGA 1SXQA 1SJ9A 2Y1FA 1HR0B 2PZLA 1FB5A 1JDTA 1FVOA 1AQLA 3LBAA 3UOGA 3QE3A 4MRNA 2SCUA 3U9TA 1NSFA 4CR6A 3T34A 3T1YB 3WSTA 5J8YA 3NC1C 3L5KA 2IUEA 3KDSE 2CXYA 1DXYA 2AOWA 4K9DA 3DPSA 3VZDA 2BP7B 1U0EA 4NH4A 2BFEB 4DSJA 4J7UA 3LPDA 2TSYB 4J2OA 1TYZA 1DKOA 3FUCA 3VSDA 3PXAA 4HMOA 5CEJA 2V5VA 4C4XA 2PWBA 3SAJA 1RU3A 4PJ0U 1N6NA 1ZGCA 2XBMA 1OW5A 2O8VA 3G0HA 3R0VA 1L7RA 2C1EA 4G0XA 4EBFA 2C4MA 1PWXA 3FCSB 4KMRA 3TM4A 4BNYA 2MRLA 9ICPA 2WNHA 2XWQA 2WJYA 3EPJA 2VUUA 3FC4A 5LZ7A 1U8XX 4KLCA 5DBHX 2JGAA 2HSZA 4Q6WA 4HDKB 5D1HA 3EZXA 4R63A 1UJNA 3BEDA 2VP4A 1UPXA 2A84A 4Q1DA 3M6UA 5ALMA 4MWTA 4CMCA 4PQFA 3SR6A 3RRHA 2IBTA 1P45A 2WFMA 2FFAA 4K5QA 2B6NA 1RYZA 4E30A 1BPEA 3B9PA 3RO7A 4KQ2A 4C6TB 2QQGA 4MV9A 1RI2A 5HTOA 1O54A 4EPWA 1K0UA 1HI9A 4B0PA 3A6JA 1F2UB 2G0NA 1IM8A 3IHWA 2JFHA 2OO5C 2YWCA 3O3CA 4WESA 1UOQA 4HDSA 2ZULA 5K5EA 3Q1KA 3CRZA 4M7WA 1ZCZA 2IWRA 4W5RA 1T9CA 1TKBA 4MVXA 2R751 2Q3FA 1XAHA 2H9YA 1D0SA 3ONEA 1EWQA 1ZJZA 2HBKA 2IYAA 4EYSA 1D1TA 3LW7A 3BIFA 4YP1A 5DX0A 4J2TA 3ZPXA 3LBHA 5ER9A 1OGJA 3H7IA 1EA5A 5LU8A 2ICAA 4O4HF 3GJTA 4YMGA 5DDIP 3IHTA 4RCZA 2XVYA 3IBSA 4B8WA 4O3QA 2AGPA 4OXYA 1TZCA 2JGNA 3WB0A 4HYTA 2ORWA 3VJLA 1IE3A 4B6RA 1YZUA 3NNDA 1X8LA 2WB4A 3VNBA 5FPYA 3VR5A 1A5SB 3KQPA 2NPFA 1U0NA 2E3JA 3PR5B 2ZETA 3E15A 1T3QA 3QMWA 4YDQA 4F84A 5BVHA 4ZYLA 4UJ5A 4DIEA 3T7IA 2YQZA 1PQUA 4I3HA 3QBDA 1PUXA 3BAZA 3L06A 4UZSA 1XEXB 2XICA 1BPXA 3FYHA 2C5FA 1KE2A 2BJHA 4XGKA 5ALHA 1T6YA 1NJ5A 4DS5A 4WBNF 4ZODA 2HHTA 1IOLA 2WT4A 2VF7A 2FN4A 1CVIA 3FFBA 5HBRA 4U1RA 3C8ZA 5DASA 4J0EA 1CF4A 3NIBA 4DN6A 3QPWA 4O4LF 3E4CA 1OF1A 5LYYA 1JDJA 1DDIA 2O2XA 4MUMA 5K8UA 3DWFA 4R2JA 3H99A 4Y6QA 3OURA 1XVUA 4DLAA 1YF3A 4AO8A 2O3JA 4JYCA 3CRQA 1EGHA 2XX3A 1A9PA 1GV0A 3DYVA 3BS5B 3RFFA 2QP4A 4FNAA 4LK3A 5HQJA 4IEFB 3MDCA 1S0MA 2QX4A 3JPNA 1LU9A 1TVKA 1YTLA 4BE4A 4F5WA 1ANKA 5K0GA 3T79A 5HVNA 2O6KA 2YFKA 2V7GA 2KEYA 3HB4X 4LQ4A 1WCLA 4L57A 2JFVA 5J0XA 3UXMA 5K7SA 2XRZA 3OQNA 2E49A 1WXFA 2HAEA 4K9SA 4LDAA 5F77A 3DZJA 2P3QA 4YRDA 3BCUA 2TYSB 5HKBA 1B7GO 4R6XA 4K28A 2YZGA 2EHDA 4BKMA 4JP8A 1JXLA 2DY0A 4OMCA 1BDIA 1ADGA 2B8WA 2O0LA 3BBPA 1H94A 2IE8A 4E5DA 4RL4A 4ZVVA 4BXOA 4RA9B 3D8BA 3OE7A 4EGSA 3SVZA 3HN7A 3QFTA 5L7TA 4QZBA 1SUAA 1YAHA 3EYZA 1WEHA 3TLAA 4Y9TA 4O2BB 4L4ZA 2NZUG 4RVFA 2B21A 4H7HA 3B82A 4IOMA 1Y5RA 1YRWA 3EXAA 3I9KA 2WD8A 5BSUA 2HSWA 3G82C 5F7XA 2GLEA 2ORED 7ICJA 1R4NA 3HCRA 5BN4A 1W9HA 4N8DA 1G9SA 2HJGA 4IDPA 5MN4A 4RX1A 3FKSD 4D8TA 1E32A 2J33A 4E3ZA 4X5VA 3HPQA 3WYBA 1LFAA 4I4TF 4MUNA 5B6JA 1UXJA 3BDVA 3QMMA 1DMRA 3LF1A 2WJAA 2RI1A 1AGPA 4OU5A 1JIQA 9ICWA 1B0ZA 5I7WA 4L2IB 4AP9A 3PWSA 1F3OA 1G21E 4ZOEA 8ICQA 1N5LA 4PZDA 2WSIA 4MS3A 3DLHA 4R1LA 1LDGA 1N0HA 3OH8A 5KJ6A 3CYMA 2HCTA 1JQLB 3ONVA 3ED5A 2RB5A 2HJ9A 3T9AA 4DJTA 1MJGM 2VSQA 4MV0A 2PSDA 2MAXA 4KUHA 3X1KA 1S10A 1PEDA 4XLZA 3FJ1A 3KAJA 2DAPA 2UVQA 4GXNA 1EDZA 5BUQA 3GPBA 2ZB8A 1TLTA 2HTFA 2BHSA 1NQ5A 1J0DA 8LDHA 3IOCA 3CQ9A 3PEYA 3U19A 1NK0A 6GPBA 4ZYXA 3H1FA 2L2QA 2YC4C 1J0XO 4LYHA 4EFNA 1K7EB 1OGIA 3KPJA 1PZEA 4PHTA 2C2GA 3ENZA 4PIVA 1A88A 4YLEA 1ZH4A 1GLNA 4RJLA 5JASA 4O5OA 3LYUA 3UPUA 4I28A 2HXYA 3PVZA 4L5IA 3EFOA 2RAUA 3PF9A 4OAQA 5TB5A 2A9VA 1CD5A 2GN4A 4EHJA 1ZO8A 3ZWKA 2H2AA 1O2DA 4LJYA 3ITDA 5FO0A 1JV2B 4NU8X 1E2UA 3B1VA 1AS3A 1PS0A 4UFPA 1V1MB 1CQZA 1M2VB 2RDMA 3PFNA 3MWDA 1OILA 4DMGA 3NOVA 3A2NA 4IWNA 2PBZA 2VHJA 4DDWA 4KQCA 2D06A 5CVJA 1RYRA 3FIUA 5A6VA 5CAEB 3VHXB 2IYOA 4BGDA 1OE0A 1C50A 1AG9A 1UKAA 1HFJA 2JNWA 1OXKB 2WM2A 1UBUS 2ALZA 1O6CA 4BWYA 1Z0ZA 1DK2A 3ZK7A 2WAMA 4HC4A 2WG0A 1KNXA 4BX0A 4BX9A 1TCUA 3LQ1A 3HSYA 4ZICA 3ROPA 1BH2A 2Q49A 2BFNA 3IKJA 3DC7A 2G63A 1Z0SA 3MGBA 2QAJA 4KV7A 2HO4A 3NHYA 4YNBA 2X8AA 5EXTA 1ZCJA 1P7VA 4KFRA 1MF7A 2PFPA 1C7JA 4MV3A 2HSJA 3FF1A 1YVRA 1ZXLA 1M1NB 1KVUA 2RK3A 4L15A 4B2YA 2XUQA 5A9SB 2X4DA 1JFTA 3GVHA 3PV8A 4MVJI 1T2FA 2YHSA 3FMFA 4MKGA 2UV8A 2WAYA 2BKVA 1PUJA 4JLNA 4ZOLA 4OD0A 3M4XA 4BMCA 1KMHB 1L3TA 2HBLA 4LG1A 2G8NA 4BEWA 1YJ5A 5BV8A 4S2UA 3HCNA 5JIBA 1GSIA 4FZRA 1GTJ1 1JPNA 1SC4A 4M1MA 1Q92A 1XC9A 4FGKA 2HZ7A 3G0DA 1TAUA 2FPRA 5J0OA 3SF8A 2RKWA 4HCJA 4MCAA 4ATNA 4HYYA 4LWZA 3V8PA 4EP1A 5ITWA 2VT3A 1WUJS 2FPUA 3RKUA 1D2EA 2IX3A 4OHUA 1L3CA 2A3RA 2DHQA 3AR5A 1ZC3A 4ND3A 2O0KA 3JQEA 1ZISA 3DP7A 3MJCA 5KMGA 3LY8A 5ALPA 2NXWA 2Z5LA 3F6RA 1YE3A 3F2IA 1V8OA 4K6OA 5I7HA 2IY7A 1T24A 5F5LA 2GA9A 3QBEA 2GYVA 2PZEA 5B7GA 2G5IB 1QTMA 2OORA 1LVHA 3ZHYA 1FDVA 4JBHA 1ZQLA 2V0CA 3N07A 3L7KA 2XNDA 2JD2A 4R8SA 2HMTA 2QB1A 4JUBA 2WYHA 1TO2E 1R50A 3IEVA 1IONA 1GT91 1T3TA 4M0KA 1RAIA 4F4WA 2NSJA 1NLZA 3WGHA 1JR3E 3HA2A 5KT3A 2DWQA 2C2KA 2CWDA 4C7BA 2J45A 5JLAA 2QRZA 2O07A 4JH0A 2V74B 3B9RA 1OYYA 3N9IA 1QHFA 5EINA 4XPIA 4LOHA 5DEIA 3GNSA 1PV1A 4F4JA 3EMKA 3RS2A 1Y9ZA 1X9WA 2G6BA 1SXJE 1U3VA 1BHO1 3EQ2A 1P9WA 1Q0QA 4CI0B 1R00A 2YXEA 2YXBA 4DM4A 1FBNA 1X1AA 3D6HA 3UVEA 4E7PA 4KLZA 3VI3B 3UW3A 4LVSA 2EX0A 4EOGA 4TSFD 5IS2A 3AFNA 1O95D 1T5OA 2VZ8A 2VDPB 2Q3HA 1MAWA 3NORA 2VUIB 2LKYA 2ZT6A 1N9GB 2QM7A 2HGSA 3DOUA 5AKKA 3CZCA 3UGTA 4HEA6 2DC1A 1QFMA 2DPJA 1MOPA 4N82A 1VQ1A 3K1JA 2C4HA 2JAPA 4X92A 1I14A 1L5SA 3W6NA 2FLKA 1PR2A 4CV2A 3GWGA 2HPZA 2ZTCA 4KAAA 1T2NA 1U0TA 4ZJUA 5HKLA 1E0DA 2R1VA 2YYAA 3SBXA 4Z7QB 2NRWA 3IDQA 4YXMA 1S4MA 3HN2A 4PPYA 2YRFA 3VU3A 4WI1A 4E09A 5DI3B 4FONA 3N2GB 3KZMA 3LWZA 3J80A 5IYZB 1PI3A 2WVAA 3PQ3A 3ZDCA 3I39X 4KMOB 5KG1A 2BI8A 3W77A 8ICUA 4MAFA 5EG5A 3EPHA 5CP8A 5KOYA 1KBQA 1L5YA 3IA2A 5KNDD 5L3QA 2HIAA 3O03A 5DLFA 2OV4A 3Q7PA 1FQOA 1R6DA 4F4CA 5CLIA 3GO4A 4AQDA 4DS3A 3G5AA 1NRWA 4E15A 2J67A 4W5TA 3WGUA 3D3QA 2WG1A 1WOMA 3M3HA 2XADA 1A9XB 4RTMA 5BV0A 5K6TA 5JU5A 1CUJA 2ACVA 3OZSA 4O0LA 5DGCA 3UGQA 2E21A 3PE4A 4F7WA 3I52A 4NONA 2COUA 4AZWA 4U7TB 5K8CA 2C8KA 4B7AA 1DC5A 4G5QA 5JAZA 5BVGA 2VUHB 2H08A 1PJCA 2PUCA 3Q8SB 1NQXA 1ADBA 3MDAA 3CLHA 3AJ8A 1AHNA 4DSFA 1YL7A 2QG6A 5GJBA 4J0KA 1AUQA 3RVPA 3HACA 3PW0A 4GSYA 1OLXA 3IDSA 3SR0A 4A4DA 2DVMA 4RSRA 4IPTA 4PG5A 1RWOA 3NW9A 1P5RA 2YZ7A 2EFYA 1U49A 5BNWA 2DKZA 5AHKA 1MV5A 1GKIA 1E8NA 1VSBA 1QLWA 1NBEA 2GNOA 4ARVA 2IL1A 2GZ1A 2Y05A 3ZWOA 1O89A 1Q1EA 3N8KA 4ZZ3A 1GNRA 3QWFA 2FDXA