4F71A

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, wild-type protein, complex with magnesium and inorganic phosphate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
198
Chain Sequence
GIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron vpi-5482
molecule tags Hydrolase
molecule keywords Putative haloacid dehalogenase-like hydrolase
total genus 69
structure length 198
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4f71A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4f71A01
4PNHA 4XPZA 1AQ6A 3VAYA 3E81A 3ZX4A 5ALZA 2WF9A 2HCFA 1QQ6A 2OM6A 3SLRA 2QYHA 4XQ0A 3W5DA 4NFLA 5AVSA 5AI6A 3NAMA 1J97A 3QU7A 4QJBA 3QUTA 3QU5A 2OBBA 4UU0A 5ALUA 3ZX5A 4Y2PA 5ALQA 3IRUA 3PGLA 1QYIA 2G06A 2ODAA 3I6BA 4DFDA 4NAVA 1SWWA 4QQFA 3U7FB 5AICA 1Z4QA 5ALOA 3L1UA 4BYGA 2P11A 4I9FA 3W5CA 1N8NA 3QLEA 3KBBA 4NABA 4DWOA 2WF5A 3W5AA 4L6CA 2BDUA 4YGYA 1MH9A 4L57A 1ZJJA 2HO4A 4YCNA 1F5SA 4YH1A 2AGVA 5ALKA 4YIHA 3CNHA 3ZVMA 5AK5A 4IG4A 5AKLA 5AW4A 4EELA 1RKQA 1Q92A 2RARA 3BA6A 3GYGA 4EX7A 1LVHA 5AW9A 4XOUA 1RMQA 1WR8A 3FZQA 5AK4A 1NRWA 2PKEA 1Z5GA 3OCXA 3EF1A 1TJ5A 1ZRNA 2FUCA 1SU4A 3U7HB 5AKXA 1TA0A 4ZEWA 3I76A 3AR4A 1T5TA 1RDFA 3A1EA 1VFPA 3WKAA 3AR5A 4UU1A 1ZD3A 3E8MA 3L0YA 2HF2A 2AMYA 3E84A 2X4DA 3FGOA 4FE3A 3ZI4A 2B8JA 5IT4A 3U7EB 1RQNA 1Z4LA 1YJ5A 3DAOA 4BEWA 3RFUA 4BX3A 3SKXA 5AKJA 3EWIA 3L8FA 3P96A 4IFTA 2YJ4A 3NALA 3ESQA 3N5KA 5AKIA 5ALDA 1QH9A 1YNSA 3AR2A 4UM5A 4UARA 1U7OA 3ZTYA 2FDRA 5AKEA 1L7NA 2FPRA 3QYPA 5ALEA 3QNMA 1EK1A 4UMFA 3QUBA 3WGVA 5FP0A 3A1CA 1CQZA 3FPSA 2R8EA 1IWOA 3M1YA 4UM7A 4UATA 3KZXA 2C8LA 4C4SA 3QUCA 4C4RA 3ZWDA 2B82A 3L0CA 5A3RA 1YDFA 3K1ZA 1K1EA 2ZBFA 1ZRMA 3L7YA 3NANA 3ZVLA 4UMVA 5E0OA 3OCWA 5AKYA 3R09A 3WK9A 2FPWA 3PDWA 3WK8A 5ALHA 3OPXA 4NV0A 2G09A 5AI4A 4BBJA 5ALNA 4CF4A 5AI0A 3UM9A 1ZD5A 4G63A 4UMDA 5AVUA 4BX0A 3FM9A 3WK6A 4OHFA 5AVTA 4Y2UA 4EX6A 3BWVA 2NO5A 5ALGA 1XVIA 1TJ4A 1QQ5A 3WK5A 5AVQA 3SKYA 1TJ3A 5AW7A 4XE5A 4UASA 3QX7A 3WKEA 1Z88A 2W4MA 4J03A 3KOOA 1WZCA 1RMTA 1YMQA 5AW2A 4AS2A 1S8OA 4YCMA 4Y2XA 5AKHA 2GMWA 3L1VA 2OYCA 3I28A 3AR6A 5AM1A 3UMCA 2RAVA 3RF6A 1O03A 2G08A 2YMPA 1Z4JA 3WKCA 2O9JA 1RLTA 4KX5A 3UMGA 4C4TA 2FEAA 2IOFA 5AM2A 4KX3A 5ALYA 4ZEXA 1NNLA 2R8XA 2I55A 4Y2QA 3I1YA 4UW9A 3ET4A 3SMVA 2HSZA 2CN1A 5AIBA 2CFRA 4BNDB 2YJ3A 5AIAA 1LTQA 3UMBA 5AHXA 3ZW7A 4I9GA 2WF7A 2W43A 1WPGA 3MMZA 2AH5A 2YY6A 4Y2SA 1T9ZA 1RRCA 2YBDA 2JARA 3AR9A 5AKKA 2GHQA 1L8LA 1WVIA 3L8HA 5IS2A 4MWOA 3J7TA 4HAIA 3QU4A 4L6AA 4OCZA 3DV9A 3B8EA 2JAOA 1RPZA 3OCZA 5AVYA 3NUQA 5AVRA 2Q4RA 2MU2A 1ZD4A 2YMLA 1L6RA 2HEGA 2C9MA 4CF5A 1EK2A 2Q4TA 3AR7A 2I6XA 2ZBEA 2IOHA 5T41A 1U2SA 2R8YA 1Q91A 2YJ6A 2WM8A 4BEVA 4Y2JA 3NIWA 2NO4A 2ZBGA 4B6JA 3OCVA 1KYTA 3WK4A 5AESA 4FFDA 3U19A 2NYVA 2I34A 3B9RA 2I7DA 3HYCA 5AM0A 2B1RA 3WGUA 3ZWKA 3OCUA 1QQ7A 2PR7A 2HI0A 3HLTA 2C88A 4DW8A 4O8CA 3L5KA 4OD0A 3ZUPA 3U13A 4DCCA 3NRJA 4YIKA 2CFSA 5AK6A 1U2TA 3AR3A 1FEZA 2D2VA 3QU9A 2B30A 3M9LA 1RKVA 2MU1A 2PQ0A 1Y8AA 5ALLA 4Y2RA 3FPBA 5ALIA 2JAWA 3ZTWA 2WF8A 3IJ5A 3WK7A 5ALJA 2JAUA 3L8GA 5AW1A 1VJ5A 4GXTA 5IT0A 5AM5A 2YN4A 3PGVA 1XPJA 4AP9A 4Y2TA 3B9BA 1TE2A 2B8EA 5AVZA 5AW0A 2BY4A 3IB6A 1VJRA 1JUDA 3SHQA 2ZOSA 4AS3A 1YS9A 2AUTA 3PCTA 3ET5A 1YV9A 4E88A 4RESA 2O2XA 1S2OA 3MN1A 3MC1A 1SWVA 4F72A 3A3YA 3EPRA 4OFZA 4HGNA 2MSNA 2B1QA 2HX1A 4UAVA 5ALTA 3S6JA 3ZU6A 2I33A 5AM3A 1N9KA 4BKMA 3W5BA 2HOQA 1L7OA 3E58A 3N8GA 2YMMA 4CE6A 2RB5A 5ALPA 3D6JA 1ZS9A 2FPSA 1RLMA 4HYTA 5ALFA 5ALWA 2EAUA 2GFHA 2I54A 3QGMA 1RLOA 5AI8A 2EARA 5AI5A 2FI1A 4Y2VA 4KNWA 2IYEA 3QUQA 2FPUA 3A1DA 2W11A 3AR8A 1L7MA 1RMYA 4Y2YA 3ZVNA 1XP5A 2WF6A 2P27A 3CZ4A 5AK3A 4Y3UA 2EATA 4HGOA 4MUMA 1RKUA 3L0BA 2HHLA 4HGQA 4BX2A 1Z4KA 2HF7A 4F71A 3ONNA 1Z5UA 1L8OA 1CR6A 1T5SA 2FUEA 4NWIA 5JJBA 5AW6A 2FPXA 2P69A 3QU2A 5AI9A 3ESRA 3R4CA 4BNDA 3KD3A 5ALSA 3SD7A 4KNVA 3KDPA 4J2TA 2C8KA 4CF3A 5AM4A 5ALMA 5A3SA 2DQSA 1X42A 3KC2A 4JB3A 2WHEA 2CFTA 4KYTA 3NASA 2G80A 2ZBDA 4FYPA 5ALRA 5AVVA 4HGPA 2JGAA 2IOFK 4EENA 2OA0A 3F9RA 1PW5A 4HGRA 1Z4IA 2G07A 3N28A 4G9BA 1Z4PX 5AVXA 2HDOA 3WKBA 2Q5EA 3MPOA 4YCLA 2ZG6A 1U02A 1RQLA 4H1WA 5ALXA 1NF2A 4RETA 5AVWA 5AW8A 3N07A 2G0AA 2B0CA 5AW5A 3ED5A 2YFYA 4EZEA 3FVVA 3DNPA 2RBKA 2YMQA 4UAUA 3OTQA 3OCYA 2YJ5A 3WKDA 3EF0A 2GHTA 4ZEVA 4KN8A 3U7GA 1ZOLA 1U7PA 2BDEA 1Z4MA 2P9JA 5AW3A 1O08A 1J8DA 2C4NA 4GIBA 3TLMA 2QLTA 1L7PA 1RC8A 1Z4OA 5ALVA 4UMEA 3L8EA 2GO7A 3N1UA 2WFAA 3DDHA 3QXGA 5A3QA 2G1AA 2VKQA 4EEKA 2ZXEA 1ZD2P 5AKGA 3R9KA 5AKZA 2R8ZA 4CNQA 2IA5A 3SF0A 1Z4NA 3U26A 4JDPA
chains in the Genus database with same CATH superfamily
2Q5LA 2I1WA 2Z2ZA 2H9YA 1GG8A 4R68A 1PFQA 3BRQA 5BV8A 3F2VA 3RAPR 1GYRA 5G4KA 2H18A 3HJRA 1UXHA 4GOMD 1TNDA 5CFOA 3O2NA 2EX0A 1H6BA 1OR8A 2AG6A 1PYGA 2WM9B 8ICKA 1C7YA 3B8HA 3DUFA 1J25A 4KPUB 1OWNA 3BD7A 3HG7A 4X97A 2KW5A 3R1IA 3K30A 5DOZA 5F3RA 2IH5A 3ZDCA 4LHSA 6GPBA 1TYEB 1ID1A 1ITZA 4K9QA 5JTUA 2AFRA 4DCOA 1YR9A 4DS3A 2XGJA 3IP6A 1TLFA 3A06A 2YFQA 1ZOOA 4PRYA 2BRUC 4IRCA 1M2VA 2JB9A 1Y3IA 1BYUA 2JVJA 1SXJB 2QX7A 3I4CA 2YV4A 3FDFA 3KTOA 3RVMA 1Z7BA 3ND6A 1PEAA 1PGNA 5TVKA 1E2FA 2QKYA 1SVIA 3OFKA 3DBHA 1WHSA 1BJKA 1SVNA 4EHLA 3EIHA 3VNQA 3AV3A 1PQWA 2PUEA 4YD1A 1HKUA 2ZT8A 5DE3A 3A9UA 4D8VA 1JFSA 2P11A 4BO0A 4I9FA 2OQVA 4NZNA 1SM4A 1CDEA 5E4YA 5E9JA 3WGJA 4XARA 3TTYA 3CVXA 4WZBA 4WY2A 3VJMA 1PUXA 2DLCX 4FC7A 3ROKA 2PHZA 1P2FA 3U37A 4I50F 4FW9A 3OEHD 9ICSA 1RQPA 3BICA 3ND8A 2J87A 1Y88A 3EGDA 3GFQA 2P78A 1QH1B 3H2JA 3KHSA 3ND9A 4JLAA 3PXUA 4DC0A 3ZV5A 3AMZA 2W9AA 1NMZA 2EF1A 4ND4A 4YI3A 5HKOA 1ZICA 1D2EA 5ALKA 2HBRA 2ZQZA 2CB0A 1KIFA 2XT6A 4QO8A 2A1JB 5AK5A 2C5HA 2CL6X 4KO1S 1QK4A 3KTAA 4NK5A 4XEHA 1PS9A 1R64A 3KKKA 5I3CA 2D3DA 1W35A 4M9NA 4OHXA 3OEWA 1NJXA 3M70A 4BMZA 5FPKA 2JFBA 1CQWA 5BSMA 2NW6A 1K1QA 3R5KA 4C0LA 2CLMB 3CH4B 4A5SA 5AK4A 1NRWA 5EOZA 3O92A 4IXTA 1HC7A 3C3EA 2GASA 2PKEA 3BHIA 4W5JA 5F2OA 3VCBA 1URPA 1SY7A 1TEXA 1Z5GA 2PRSA 2AHOB 2HGSA 4N39A 1HURA 5B58C 5HR7A 2CXTA 2I78A 5IZCC 1VL1A 4AMZA 4UBCA 3RC2A 2ZT5A 3AOEA 4WL0A 5EXPA 2FDXA 5LXTB 5HYVA 1AF7A 2VPYA 1B6RA 2AD1A 4IGAA 2DULA 3E0XA 4TT3D 1U90A 2QUJA 1EBFA 4AUEA 3UJDA 2MYUA 5CM9C 4XJTA 1IRIA 2V54A 3ID6C 5HBRA 3RIXA 4OLAA 4ZU1X 3WLJA 1J21A 2VF2A 2UUBB 1V25A 2XLCA 3BKWA 1G1MA 4LBYA 3RSSA 4F97A 5T6BA 1RYHA 4J7XA 4CMEC 3JPOA 2EHJA 1IM2A 5A4KA 3WSTA 1CP3A 2P9FA 4N03A 3THWA 9ICXA 3DOFA 4WMLA 2IY9A 4LRTB 1IWPB 4UHFA 3K1RB 3FBTA 2WU8A 1CUHA 3GGJA 3NBXX 5A3VA 3ROQA 3UMYA 1QVVA 4DCGA 2PO7A 1KDVA 3DUWA 4ZQHA 4ND5A 3OH8A 1T24A 3T4PA 5DHQA 4A2PA 4Q4HA 4KKVA 1P75A 2IXTA 1W36C 4R9SA 4UB4A 3VISA 7ICRA 3VHRA 4BVEA 5F7XA 2A1TR 3OZDA 3ZDDA 5DCLA 4NZPA 2ZDHA 1X7WB 1JEDA 1VBFA 4OO3A 4DQPA 1PBNA 3DHVA 3QPVA 3IIEA 4MW2A 4GP6A 4WINA 1GQSA 3B1WA 3HXPA 1RQRA 2MYTA 1NTRA 4JB0A 3R5SA 1L7NA 1BQ4A 4IJ5A 2W00A 4EPXA 2PAAA 3PGA1 4AG6A 4ENRA 2C4MA 1B8OA 2P9QA 1EM8B 3M83A 1TYDE 3MG9A 5CDSA 2W9BB 3LHSA 2R00A 3SHTA 2B1JA 1EEXB 2IPNA 2PSFA 1BCSA 2IYAA 2ZYTX 4ZVPA 5T7BA 1I2ZA 3VH4A 4KN4A 3RBDA 1PUJA 1CUAA 4C89A 4TRJA 2QD5A 1U04A 3EXHB 4EI9A 3GP8A 2YCBA 1JZTA 4J4TA 4F8JA 2O1XA 4Q3EA 4EFDA 1NJ8A 4DOCA 4FDUA 3QPAA 4U7DA 4TS3A 1G5IA 1E32A 1XKXA 5JMWA 2H1HA 4XIFA 4GBMA 1YASA 1ZCFA 3QUCA 4FYWA 3QXSA 1HEIA 3TRDA 3LUGA 4KLNA 3LV8A 1U1FA 4R3UC 5IIJA 1MJGM 2VTEA 4YQWA 3M34A 1KRXA 5L1IA 2WUWE 1VPLA 3F2BA 3D4BA 4C0ZA 1J49A 1W0JD 2XKJE 5DM70 4I27A 3PDCA 1DZIA 2HUPA 4MVJI 5FOVA 3TBHA 4FWTA 3QLUC 2V7TA 1AURA 4AZWA 1JHYA 5CCDA 4DSFA 4TRRA 1SZHA 1NF9A 4HWKA 2YR0A 5JRTA 4DUGA 1ADBA 1KI6A 2AWNA 4LZPA 2EFEB 3ZCUA 1CI4A 3UM9A 2Z0MA 5LBTA 4FGSA 3TIGA 3CWCA 1T9DA 4BO4A 2X77A 1JLMA 1H0RA 3SI7A 2R8IA 3FG9A 4BKUA 4UJ5A 3PRYA 1DOAA 1MP0A 1TZMA 1VI6A 2QIOA 3H84A 1N2XA 3HP4A 4DYDA 3QXJA 4CTMA 3IV9A 1SOMA 2GESA 2Q4DA 4MB0A 5AVTA 3AU6A 4ZK2A 3RHTA 4MWGA 3NHZA 1E9RA 2RHCA 1ZCZA 2PX0A 1BPXA 2NUTB 3RS8A 2FN9A 1IB6A 3GEMA 5HQ3B 4D6PA 2HVIA 1IQPA 1NI3A 1E1RD 3PQ4A 2ASEA 4UU7A 1P5ZB 2BTQA 4S1PA 4XE5A 5A62A 5JZOA 4GRAA 4UASA 3AU9A 4DCSA 2FFRA 2VTBB 1TUGA 5BSVA 3KOOA 7MDHA 4WCFB 5BSEA 3AP2A 5ICEA 2ETXA 2HMWA 3A14A 3GYBA 4FHCA 4WH0A 1CNFA 4JIGA 3KJHA 2ARKA 4RVHA 2NYUA 2A5LA 3VPAA 1G42A 2JIQA 3CUVA 2C28A 2GD1O 2D1TA 1O77A 4NVRA 4UAJA 1JJIA 3O4JA 3TAQA 5EKDA 2R5NA 5IIMA 1HYQA 5AQEA 1SVMA 2MOKA 3G9XA 3UK2A 2PEZA 3DDOA 2CV1A 2Z4SA 2VHCA 3E8XA 4CEIB 2IF0A 5EWMB 3WL5A 2H63A 1DTSA 1JI7A 1Z16A 1EQUA 2ZK7A 2DKXA 1UPUA 4XFKA 1E1CA 1NLYA 1ZK2A 4CQMB 4RQ4A 4EG5A 4GYYA 1TM4E 3A8TA 3MBOA 4OFBA 1FY2A 2Z1NA 1RAEA 5BR1A 4Z8YA 3STWA 3ISCA 3DOUA 4J9UE 1LFAA 1X2IA 1KPIA 1HL3A 5LDHA 1BA2A 1JAHA 1P9NA 1K5PA 3ES9A 3Q7QA 4CT0A 4E70A 1J2YA 2AI2A 2R1ZA 3ET4A 4NS1A 5BVGA 3VZDA 5FWXB 3SMVA 3DCYA 3SEFA 1MB9A 3N7RC 5C5EA 1PLJA 3AVUA 4CKBB 5AIBA 4ENPA 4O25A 1G5QA 4KXWA 5KIAA 4OXKA 3R74A 1HEKA 3TIVA 3ASUA 2C59A 3C48A 1XQWA 3ZY2A 1ACJA 4DDVA 5K3FA 2O8FA 4XDGA 2P91A 2H2DA 2WW8A 3JD0A 1M8GA 1IU9A 4NDZA 4YASA 1E9DA 4OB8A 4Y9DA 1Y3FE 3UQZA 2OMEA 1EMDA 3OJOA 4J1SA 2QM8A 3CZRA 2H92A 1C1XB 1NWHA 1QYVA 1Y8QA 2PPVA 4D0LB 3LQKA 3AB7A 3EG9A 2XTJA 1WVIA 3L8HA 2B35A 1NP6A 1IZ9A 4C80A 3IQFA 4HPJB 4BV9A 4X85A 4MRMB 1E3MA 4CQLA 1TD9A 1GUBA 3I05A 4ZAZA 5JAMA 1QVZA 3H7AA 1VSTA 4NYJQ 3D2CA 1E2HA 4YMMA 2IPLA 3NU1A 1BMTA 2K7FA 4XWAA 1KARA 2XA1A 1YS1X 1QE0A 1NNI1 2XD4A 3DFUA 1G2PA 1YDGA 4Q1AA 3W2GA 4A3SA 2CFIA 4JI8B 2I6XA 4AT1A 5INTA 1U2SA 5FHQA 3TNYA 1IOVA 2NUBA 2G4CA 3BD6A 4S24A 4R40A 4F1WA 8ICLA 4YMSA 3BJMA 1JFRA 1SUWA 3FVQA 2AF4C 1LK7A 1O6ZA 1YO6A 3DXXA 1E2GA 1QHHA 2R44A 3RK0A 5E95A 3IBFA 2R7LA 4TUQA 5KNDA 1X9HA 3BQNB 3T7RA 4AMGA 3FAKA 4HFNA 2JFGA 2VH1A 1SPXA 1Y5IA 2I34A 4LRSB 5BVGB 1RXEA 1YVDA 3JQGB 3OWXA 2WD9A 5D5QA 1M54A 4PVCA 4ALLA 3Q85A 3K1YA 5BN3A 5CA1A 1LW7A 3T61A 4M1WA 3BFPA 3NWOA 4DCVA 4AMUA 2OWOA 1S3GA 1WZIA 4KLUA 2CZGA 2WAOA 1XD2A 4R71A 4GC6A 3L5KA 1L6IA 4PAGA 5FOUA 1F9AA 1D0IA 2BISA 2ICAA 3M4NA 4LTMA 4RQ2A 1G3RA 2AZ4A 2BFDB 2JI4A 3AERA 3KQSA 3VU9B 5L3VA 4B3MB 1KJYA 3NRJA 3K09C 4FIZA 1ZINA 4N41A 1SZPA 1G2QA 3QVTA 4MOWA 3RU9A 1PR6A 1L7DA 3IR5A 1WSDA 1RIIA 3GPIA 1TO2E 3Q15C 4F5DA 4BWGA 4RVGA 2FSSA 3W04A 5J4VA 3HVRA 3CVYA 1DT5A 2D13A 2WEKA 2R1VB 3KDSE 3WNBA 3W8NA 4ZYLA 4CWAA 3GDOA 4TTIA 4AWBA 2H2WA 4XLTA 3ZWMA 2PNJA 1S0NA 1QGDA 2B20A 4TQGA 5IAOA 5JH7A 1D4ZA 1M7BA 1AIPA 3KAJA 4FN4A 4CM5A 2MTBA 1GILA 2ZRLA 2GPAA 1NQAO 3FMFA 2OHXA 3M4XA 3P2IA 5GY7A 5GONF 3VU3A 3W7AA 3HZHA 5MFPA 2CJWA 1BDMA 2XXAB 2ODNA 1HK7A 4OJ5A 4AP9A 2VP5A 3FKSA 4XW2A 3TVTA 5CFLA 3F3SA 2B8EA 3MYRA 3E5MA 2NRVA 1E2PA 3IB6A 4N5NA 4J2OA 5B58T 1KBZA 3LDGA 1L5GB 2ALZA 1SIJA 1VMKA 4PR0A 2WYHA 2WWYA 4FFBB 1W0KA 3RWOA 3HXLA 5H7XA 8ATCA 3QELB 4W99A 3WGMA 5DBFA 1OXJA 1L4BA 1WSBA 2FFAA 4HDSA 2OCPA 3NBQA 2F2AB 2O2XA 2P7IA 2YXPX 3VPGA 1Q1EA 1VG1A 5DKFA 5L7YA 3BRWD 2XD9A 5A7FA 4QDKA 2QTFA 4DSEA 3EFBA 2MCFA 5TQ2A 1F0MA 1JXMA 4GVXA 3SY8A 2P1DA 5L3RA 2PV7A 2IDMA 3L46A 4FSHA 4WOKA 4EYSA 1MN8A 2VSOA 4NONA 3DOCA 1INLA 1Z28A 3A2LA 2I33A 2C2GA 3CX8A 2XNDD 1ZSYA 3T0FA 2AW3A 2IYPA 3HCRA 3VKWA 2V7QD 1VJ1A 3D59A 1E2JA 3BE5A 1XAGA 2CK3A 3VC1A 5LZ4A 1U65A 3IHWA 1GV1A 5EA2A 5LJLA 1S7GA 1UJMA 4M6WB 1CF2O 3D3WB 3UJ7A 3Q3HA 4TMYA 1V6AA 2XICA 4U5QA 5H3CA 4CFYA 1DQPA 3NC0C 3F7OA 3KJQA 5KVCA 2NSYA 4PXAA 4F3YA 2DWQA 3TOXA 1T6XA 3P0HA 4E11A 2VHZA 1KRPA 2PYZA 4TTRA 2FI1A 1E8DA 8LDHA 2OFXA 3GQBA 2VJAA 3W3ZB 1CNEA 6LDHA 3MABA 3MAJA 3RFTA 4RDIA 3K4GA 2CB9A 2N3ZA 5A5GA 1L7MA 1U5CA 2PFPA 1ZJYA 4XFDA 1FBTA 5CUQA 3DFIA 5H3HA 2QE6A 5C81A 3IKJA 3NAQA 3IOYA 4MPPA 2HIGA 4EPYA 4RF4A 4PYJA 1ISFA 4OHVA 1RJ9B 4X1IA 1CZNA 1KS9A 5GWXA 4M37A 4OJKA 2H29A 3TARA 4FZ5A 2RGXA 4BX2A 4E5DA 2FMXA 5KCZA 2WILA 5EMHA 2AYXA 5K7SA 4A91A 2ZRJA 2MT9A 4X71A 2PSJA 2XC9A 4ALMA 5BW8A 1DRVA 1VC2A 2OHJA 3A05A 4XB1A 2PKQO 4EG3A 3PSHA 1YBMA 4NXNB 2ACEA 3G7UA 1A9ZA 5K99A 1USKA 4HQOA 4MS1B 2QF7A 4P0QA 3STVA 4GRIA 1XZFA 3AETA 5DYWA 1KRHA 2WJ3A 4KMOA 3QNUA 4XDZA 2WHRA 5CT5A 4F8YA 5JXGA 3GLGB 2C8KA 5F4BA 4CF3A 3ONDA 2A7QA 1LQTA 3ZDAA 2EJCA 3OHMA 5AW4A 2Z08A 5LR6A 1IJEA 2AN1A 1A8HA 5EE0A 2PXCA 4MI9A 3CCCA 3VPSA 4ND8B 1E58A 3WADA 1MQSA 2W98A 3S81A 2XGQA 5KPDA 1Y0BA 3I45A 3OLCX 4LQLA 4LJAA 1IYZA 5CA7A 2GK6A 3BD8A 1Q3VA 1ZH0A 2G5PA 4AP5A 2H11A 1MIOB 1VSBA 3UAVA 2X8JA 4DM4A 2IDKA 3S7TA 5JCOC 2IZZA 1DU4A 1E66A 2VK8A 3GJXC 3LOUA 3TAHA 3VVBA 4AX4A 3JSAA 1RWOA 4FR2A 1QG2A 2QZ4A 4IH9A 5JVDA 1QP4A 2WKWA 3LW8A 3OZXA 4F06A 5GINE 4BY9E 3VSDA 3D54D 4HXEB 1UFQA 3EDOA 1ZIDA 2IYYA 2QDXA 3WAKA 3O95A 3JQBC 3CTMA 1Z6YA 3RUFA 1U1IA 1T8YA 4B4DA 1IMJA 3WLMA 3TACB 1CTQA 1FRVA 2H16A 3DFMA 4UAUA 1C80A 3H0EA 1X7XA 3U7RA 2YJ5A 3ZJYA 4GL4A 5T4EA 3SIXA 1C50A 1FMCA 1VCOA 2QI9C 4LBVA 2WWVD 2ODEA 4JC5A 5J1TB 3RODA 4CLRA 1GA1A 1VHTA 2IEAA 2TECE 3KB2A 5AW3A 1LDMA 4M86A 3U7GA 4ARCA 1BFKA 3OHAA 2CXXA 1UIRA 2YXEA 1WDKA 2NV6A 4IHJA 3URKA 4DKXA 2C3MA 3FZEA 2VIXA 5BV7A 3AM9A 1PDWA 2GLXA 1E1QA 4R8RA 1ZBDA 4M0CA 2Y0CA 3NYQA 1Y1LA 3HDTA 4INPA 3BGWA 5CW2A 2FW6A 1MRSA 4CM7A 2X8LA 3OSZA 4BMYA 4L8YA 4ETIA 1WB9A 1N0VC 4TLBA 1SD2A 4M1OA 3KEFA 1R9MA 1K68A 3S2UA 4LJ8A 1RWQA 4MW7A 4KK4A 2NO6A 3SNHA 1DKNA 3VHXB 5BVHA 2BP7A 4NECA 4HLUA 3ICQB 3AZOA 4DA8A 1YHYA 3WTCA 4OGKA 2VSQA 2SICE 4P82A 3A6HA 4B9LA 3VAYA 1OTHA 4BGVA 1ZR2A 4UHEA 1S2LA 1PJ2A 1XZ8A 3ESZA 1OLOA 2HHUA 2OM6A 3KELA 4LXQA 1YI1A 3AEQB 4B6OA 1NBIA 4KBFA 2C83A 3C7CB 3LBIA 3RUCA 4JKYA 4C06A 5AVSA 2NRTA 6ADHA 3AQIA 4M0KA 2ZSJA 4YT2A 4A0SA 4IC9A 1NQOA 1V8BA 2RI0A 2GRUA 1YRBA 4MLZA 4ACBA 4DSNA 1FJXA 1EIWA 4FKMA 1TX4B 1VPEA 2C04A 3PNSA 3LT5A 3CC8A 4LYYA 4QHYA 3U3KA 1V9CA 4KO4S 2CJFA 4HWGA 4XA8A 1L4YA 3CX6A 5CVVA 1NVMB 3KSDO 4QWMA 1GGEA 5IPFA 1L5LA 3EVBA 1P1FA 2QTGA 3CTPA 1A0OA 2O7QA 2KJ5A 5ALOA 5IM5A 3I92A 1XRJA 2E4AA 3E2EA 2G9UA 4PIMA 3R8FA 4UUNA 1SC3A 4NABA 4RJIA 2KNJA 1U0RA 3BREA 3PF9A 1PF7E 1BHJA 3A2MA 3DFFA 3PUYA 1HWYA 1HZZC 1G8SA 4NAHA 4G0OA 1SKAA 1MO6A 4MVJH 4OM7A 5I8ZA 4G8JA 2HY7A 1I10A 4V0RA 3T5DA 1ZVKA 3MWDA 4Q4HB 2RHWA 1U0LA 3D7KA 3PWSA 1CG6A 2AGVA 1L7BA 2REXB 3QRWA 4EVIA 4BWJA 3CONA 1NVUQ 1XZLA 3R76A 3NHKA 4H15A 4D8TA 3HACA 4E2ZA 4YAEA 3FMVA 3FZYA 3GD5A 3T12A 5CFPA 4EBEA 2P4HX 2GFIA 2AG0A 4U0JA 5T67A 1S2DA 1RMQA 3GRCA 3C7AA 1S01A 3HMKA 3JQRA 4L72A 3M6XA 1G9TA 4M8NE 3OJUA 1CVRA 5HE8A 2NZXA 1Z38A 5J8YC 2YBEA 3R40A 1KMNA 2GYVA 3MTAA 4NLZA 1QSGA 3FPCA 3P0JA 4Q6WA 2W6OA 3WMRA 3PHGA 1Y8ZA 5JPDA 4RA6A 4CODB 1QTQA 2AVDA 4OOEA 3ORQA 4P31A 4TURA 3GJ7A 4DXAA 4P7GA 2YWJA 3UATA 2XUPA 5KJ1A 1EFVA 2QTVA 2YB4A 4EB0A 4RX1A 1O0CA 1GD1O 1GT6A 1I7PA 3V55A 2E89A 3CEAA 1M1NB 1WB6A 3E84A 3DDWA 4H0CA 3K75D 2X4DA 3ACCA 4G09A 2YICA 1Z3EB 3AHIA 5AR1A 3SYRA 4WEOA 3VU1A 2NP6A 1AKWA 2QRQA 2XUDA 3VR0A 4BP1A 1NE2A 4HNAA 1FNSA 4C8NA 4RY9A 1LF5A 2KHVA 4PQYA 4F8RA 4OY3A 2QVYX 4S0ZA 3REOA 3STUA 4ZMSA 2YVUA 2OZLA 1X7YA 4PCUA 1WRBA 1QCZA 2QV0A 4M4SA 1A9TA 3ELBA 3JZDA 4IVQA 4NHEA 4DR4B 2RDJA 3GNTA 3I1JA 2JA2A 2VO1A 2Z8YM 2IHYA 4IFTA 3IM1A 1IQ0A 2NTJA 1LD3A 4PGQA 2Q28A 4QBGB 4XLLA 2HJ9A 1TQ4A 3O8BA 5CVDA 2P41A 4EL0A 5CXUA 2C0CA 3BXPA 4NY1A 1SU7A 3KVYA 5FFFA 2PU7A 2XMSA 4GM4A 1C0PA 3NX4A 4FNGA 3GRUA 4RHEA 5FWDA 5GJVC 2UYHA 2PT9A 1TEVA 1IQRA 4M22A 5J5CA 3Q8WA 4ZO4A 3VKVA 5KSYA 3DPIA 3PITA 1PCXA 3IOMA 2ZYRA 3W5VA 4GLJA 2J3IA 1MNAA 4S1TA 4X91A 1ZU4A 2ZJYA 2J0VA 4JC0A 1P9OA 3FNRA 1XK7A 5ANRB 4B3FX 4BCBA 2O05A 4LDNA 3PJFA 1NUPA 1CW2B 3JQCA 4ZK6A 1OC2A 3D4PA 4DV2B 1DJMA 2NMVA 4CT4B 1I3MA 4LHEA 3GIJA 4G1EB 4EI2A 5FP0A 1F8YA 3GAMA 1RRPA 3HSSA 2ZVDA 5FWYB 1JILA 3OFND 2LYAA 4RQMA 4WKOA 1ZMRA 3CT6A 1OY1A 2LVBA 1Z13A 2A19A 2DKFA 2GRAA 3U4GA 4CG1A 2CLSA 9MHTA 4UATA 1FS5A 3BMOB 4IYJA 1CXZA 3C43A 5T8KA 2Y1JA 3ZH2A 5IFLA 4KE7A 4NYMR 2O8BB 3IXMA 2W2TA 4OIMA 7ICQA 2PT6A 3AIOA 1LPMA 2FG5A 4DL6A 2NQ2C 3BXOA 1LPAB 3NV9A 1C9KA 4V03A 2OBFA 2I6UA 4G0UA 1GSHA 4ED7A 1E77A 2Q2WA 3GLRA 4RGYA 5CG2A 5THKA 1I7DA 2KMDA 4J9QA 1LNSA 2HSEA 1VHWA 2IK8A 3R2JA 1T9BA 4HN9A 1VL6A 1JMVA 4JJEA 4WLFA 1U1CA 5CVEA 3RVSA 4PHHA 2IHMA 3L0IB 4KBYA 3LTNC 3DOOA 4FZVA 1B42A 2Q7OE 4BFCA 3SICE 5I3ZA 4ZV9A 3LNCA 4DV4B 2VQEB 4WV3A 4ASUA 2JVKA 3UICA 1U5AA 3SIWA 3H5VA 2FUNB 3AIKA 3X44A 3TQOA 4DMUB 1A82A 4IS7A 4J9MA 1Z2DA 3R7SA 4C4ZA 4HYEA 1JHMA 5FBWB 4RK7A 3S55A 3KPUA 2H8GA 2QN8A 4GC9A 3ILYA 3IQDB 1C7QA 1DMSA 4UU8A 3IOCA 3I6IA 5TGDA 4D0NA 4DARA 5DG9A 4RQ3A 1LLUA 2PMKA 2ZR0A 3BXEA 3CF2A 1UHUA 2JBAB 2Z8ZA 5HKAA 4LWZA 5GM1A 1TO6A 2F1RA 2XNSA 5HGXA 3CH5A 2IEBA 3GVPA 2E8MA 4NNPA 2M6SA 3ZW8A 3VYSB 2ZSEA 1TTHA 1JEQB 3K5WA 3L0OA 3TZLA 2HA5A 4YRBA 3KUKA 5D85A 4QO7A 3J81k 2ONCA 1NAHA 3QX7A 1ZI9A 4PG6A 3UT5A 4S3MA 3DWIA 2R0QC 2HMTA 1JLLB 1MAVA 3Q88A 3UK7A 2PXHA 4TLDA 1PZGA 1T1SA 2QAGA 4JV5B 5FWAA 2QOEA 5K0NA 1S0MA 1UOPA 1ECWA 1PR9A 1YIOA 2H0AA 4ZC1A 2QSJA 3QM1A 1ATIA 2KS6A 3LT2A 4Y98A 3T6KA 3DFKA 2LDXA 3K7EA 4JT2A 4Z4GA 2P90A 3ZGZA 1HE4A 5TPWA 3TVDA 4RV9A 3K5IA 2C3UA 2AGPA 1I3OA 3KYIB 2KVSA 4F38A 1MENA 1XU7A 4KQJA 2OCLA 4RH1A 5JISA 1JKFA 3WKCA 1NK6A 1M75A 3H3XA 3ZDRA 4GOLD 1N6OA 1YCGA 1TF5A 1ZJ6A 3SEQA 3TAUA 2M9NA 5JU6A 4A6PA 1CDDA 5AM2A 2ZRGA 7REQB 2Z6QA 3I42A 3GV0A 4ZYUA 1AMNA 4JMPA 2D3WA 4UXJA 2QTNA 1OBCA 3HXTA 5HIIA 4ED8A 3WIDA 3ZJ4A 5FBVB 1WMSA 5FTWA 4E07A 1NNEA 3KT6A 3TDKA 1THTA 4NE2A 2VXYA 3AFGA 1U8TA 2QM0A 3UC5A 1SUDA 3MIZA 4G5GA 2RRDA 4MVJP 3E9DA 4A16A 1I80A 5I7HA 2ENUA 4D82A 3YASA 2QXUA 2ZANA 2JH1A 2BR5A 1DFGA 2JD2A 2NT4A 4B3TB 5EHIA 4OX9B 1JEYA 1GA6A 1E59A 4O63O 5EFOA 3H2GA 4C4XA 4X93A 3HMQA 1B74A 2BMVA 1KEUA 4I5DA 4MW5A 4DQDA 2H5EA 2H6EA 3D0RA 4PZAA 3IAM1 3S40A 8ICNA 4GGMX 2OO3A 4D92A 3Q7EA 2XY4A 5L3QA 4DBVO 2P4SA 4CM3A 3FTNA 3H40A 4M1SA 1PR3A 4Q45A 2P2CA 3KUCA 3KUUA 4EQZA 1RZRD 5IS2A 3L6UA 2HMUA 4MWOA 4JLPA 2F00A 2V9ZA 4HAIA 3MCZA 3IEUA 3OUZA 4DL7A 3UHPA 4C3OB 1LVGA 4U7WA 5EIFA 4MVJD 1QK5A 4M9HA 2ZTEA 4LUCA 2P68A 3UWDA 4BBPA 5JNRA 1FMFA 3AP1A 2VZEA 4X7BA 3ZEAA 3AO0B 4YJHA 4YO7A 1UDRA 5ENVA 4BIMA 5H81A 1RLIA 5L45A 2HDNB 1ZJZA 3SX4A 2WYUA 13PKA 2LGJA 5EEHA 3FW1A 1MQ2A 3QTBA 3G1TA 4M1MA 1KE1A 3THWB 3NIWA 3S28A 3UGJA 3FLAA 1C3OB 3GJZA 3QFFA 3DTVD 3HRDD 5KYTA 5CH8A 4KJZA 5DQGA 5I47A 2WMOB 4WKCA 2NYVA 1Y42X 2VCEA 3RHZA 2P9BA 4PN3A 1XK6A 4L9SA 5CT8A 4R8MA 3WIEA 2ILVA 1JKMA 4LG1A 4RK4A 3RHSA 1HTWA 2QAIA 2ECKA 4LKOA 3ZTTA 4R0NA 4DVJA 3VU9A 3OCUA 3WHPA 1N9GA 4RNOA 1QQ7A 3CF0A 3DHWC 4RZSA 4ZANA 2YCLA 3ZWNA 3TAPA 1OFVA 4B4KA 3JQAB 1ZQUA 5ILQA 4C14A 5DNYB 1UBCA 2WTXA 4HUQB 1L7QA 5J2TA 3K3PA 1GSAA 3QW2A 3OKFA 2PRKA 1FF9A 5A9SB 4FWIB 3SS7X 2ZIUB 4EFMA 2VUTA 3LUKA 5J59A 4CCSA 1C0IA 3OM0A 4WCFC 5KAPA 1VPTA 4BZQA 4DABA 3OE1A 1A71A 2NPOA 3R3JA 4P2GA 2HTEA 4GR5A 2QUBA 2OSBA 1DPGA 1JDZA 4BVJA 5JMOA 5KTRA 5DNUA 4PO3X 2Y2UA 4XSGA 1W93A 2BHTA 2NUTA 3PE4A 3A6EA 5D5HA 2RB4A 1MLDA 4MR9A 5KQRA 3N2NA 1E7RA 4MV1A 2V7GA 5LYJB 3WGGA 2E1RA 4YAJA 4BX9C 2CXHA 2IOYA 2W8ZA 1KHTA 1BEZA 1AY0A 2IF2A 2O52A 3NVDA 2YV5A 4GI3A 2A5YB 2OEPA 2VT2A 4NV1A 1RM6C 1DIGA 1QWSA 2NPFA 1FE8A 1QP0A 1J4AA 3EFHA 4G4GA 4W1QA 2WY2D 5AW0A 3PQFA 4QRIA 4KLSA 1SHUX 3A28A 3WRXA 2CEKA 4KE9A 4Q3DA 3KOYA 3ZY6A 3NBMA 1Z5NA 1YS9A 4QFMA 1Q0RA 4S0XA 1VB5A 3HGTA 4ZT7A 4Q9IA 3HB4X 1K6JA 3V4FA 4C4OA 3STHA 5JWRA 2W2LD 3JARA 5L95A 3VV2A 3RS2A 4RQNA 4O4LB 3CZMA 1XUOA 2AKEA 3C5FA 2RD2A 4KWEA 4I29A 2QRZA 1EVKA 1SUCA 2QA5A 5ERXA 2C7RA 4KGZA 3VGPA 4RD1A 1JHAA 4CZ2A 1G8MA 2PYDA 3L92A 4K6OA 2R68A 5B4UA 1IZYA 3H6KA 2J4FA 4DB4A 1E6MA 3K1AB 2GHRA 4FFNA 3VVMA 3I2HA 2H1VA 1IBLB 4LE1A 2PIAA 3KOMA 5EGNA 3AT1A 3M6ZA 4A8JC 3N2LA 1O95D 1XX6A 4MDEA 4IJQA 1LW6E 4JA0A 3UWMA 3RB6A 3N8GA 3JALB 1SIOA 4YPFA 5HF9A 1R0BA 3TQCA 4J9RA 3OESA 4CKBA 3IP9A 1ORIA 2K4MA 4HXYA 1IAVA 3DD5A 2HCJB 2C1ZA 4MP8A 5J0YA 1COWD 1SQGA 2IOQA 3MUOA 4FKBA 4Q7LA 1O97D 1SQSA 5C4IA 4LOJA 4DLAA 4ODIA 2AR7A 5T5QA 3Q6IA 3ZWAA 5KFZA 4KLMA 4O29A 2WMYA 1T4CB 3GFSA 4REQB 5IHXA 1DAHA 3W3AA 4DDKA 1DJOA 2XMDA 3IHTA 2IH4A 4LYEA 4RTLA 3JZIA 3LVBA 3NQ41 2QEQA 4ND3A 1MRZA 1Q3UA 2XUJA 4YJFB 4AMBA 3U09A 3C1YA 1W8IA 1FIQA 1RMYA 2F3UA 3A6FA 5DSZA 1XP5A 3RJKA 4D9HA 2NRXA 2CBZA 3T7TA 4AY5A 4IZIA 1QIFA 4AJHA 4WN9B 2P77A 2BUBA 3MZ0A 3PKIA 4B6FA 3I9OA 3DE4X 1KYWA 4QQ8A 1C3EA 5GZ6A 3AUSA 3JARB 3MRXA 1Z4KA 3ESCA 2J31A 3C2QA 4GO1A 4YP0A 3X1JA 2FMQA 1TUEA 3LSYA 2K60A 4Z2YA 1WQ3A 2F9LA 1X9SA 3HW8A 1UWVA 4YRLA 3EUEA 3NVKI 2WVAA 2ZRMA 3LW7A 3OUUA 3VOAA 1K1SA 5DLFA 3KJIA 3NS7A 3R4CA 4IW3B 1E3IA 4YXMA 1UMDB 4HQRA 2H5JA 4XQGA 4CF7A 3T7AA 4PZDA 1PZXA 4FMDF 1OFUX 2C57A 3E53A 2XT9A 4OYYA 3LLSA 1QOZA 2G88A 2AZXA 5IVHA 3KL4A 1H23A 4H7KA 3WGIA 3T1TA 2H4JA 3MWFA 4PGYA 2CFTA 3K4QA 4KYTA 4W7IA 4DZZA 4EEXA 3E7DA 4L4XA 1F6WA 2YWBA 2OXIA 1E64A 2ZE8A 3SJ7A 3TG8A 2C5GA 2QTZA 2DKZA 1ZK0A 3NKFA 5CLLA 3OJWA 4N1AA 1SXEA 1F0YA 5CURA 5K51A 4U7HA 1UM8A 4EENA 1KTVA 3JCZA 3CH6A 4I6GA 1J2UA 4JXKA 4QJ3A 1Z4IA 5B7GA 5KTOA 4WA8A 1F3OA 2OT3B 3T9AA 2H7CA 4ZI3A 3PF8A 4K3UA 2HDOA 2EBWA 3PFNA 4B0OA 3W1WA 3MPOA 2J0EA 3NC1C 1RS0A 1SH7A 1CP2A 1K98A 3EY9A 1R9NA 2GAIA 3DLIA 1L5KA 3VDNB 1SXQA 3D3QA 3IBYA 3WV4A 4B80A 2WHPB 1JJBA 3N8NA 4K26A 2VDKB 2WWXA 5HG0A 2VYNA 2HC9A 1VIYA 1P60A 2ZWMA 1YVEI 1XJWA 4OGGA 4RFLA 5AHRA 3OX4A 4WNYA 2WWRA 1NW7A 5AW5A 3PVCA 3AOGA 1NJSA 1KN5A 1WF6A 3VH2A 3ZVRA 4DCTA 3ILSA 2O0MA 3LU1A 4LXHA 2YMQA 4HZIA 3FPHA 4IHJB 3H11A 1LNZA 4DQKA 1AUQA 3MCAA 3AHHA 1JB9A 3H9UA 4DJDC 1FYFA 1UBHS 3BTOA 4M9SA 4E32A 2ZBUA 5IN5A 1R66A 1LFDB 3TOVA 5LU9A 3DBOB 1ETUA 2JIZD 2P2DA 2X40A 1NZDA 3QZ8A 1J8YF 2V96A 5FA6A 3EXHC 1J22A 2VQDA 3LK7A 3F2CA 1YE5A 3MA0A 2JGLA 4QTZA 3N2ZB 3EFOB 3H9JA 3TW4A 4C4PA 5F3DA 3QXGA 2JKZA 4RKFA 5EIXA 1O0BA 4MYDA 2HLHA 4TMWA 2AOTA 4E5SA 2D4HA 2HJHA 3GMDA 2RH8A 4JLKA 1UPHA 1GQQA 1JAIA 2D06A 3ODGA 1TU4A 3OAAD 3W34A 2I4OA 3F97A 3RHFA 3KZVA 2BCQA 1ZWLA 4PL2A 5JLAA 3WHLA 4ZQFA 5I7WA 1UKBA 3EGXA 1Y5NA 4NHOA 3U7JA 2Q1TA 3HXQA 2WAQF 2HLPA 3KHLA 2VPXA 2ZBRA 3RSFA 4C5CA 3S2YA 3LBFA 2RC6A 2FWNA 4AZ0A 4UOEA 1RBZA 2BFNA 1ZOIA 1LI7A 5IK2A 3DZGA 3LPNA 2NVUB 1KFEB 3ZVKA 2O07A 4DV0B 4UPVA 2XNKA 4Z2AA 3HCDA 4LDJA 4QJBA 3SM9A 3RSGA 1YU6A 2HBQA 5IJAA 1EJ2A 3WWCA 4BVGA 5KG6A 2A14A 4QELA 5KT3A 2Y76A 3FCYA 5HNKA 1WULS 2HF8A 1L3VA 4GXIA 2D8MA 2LRHA 4MR8A 4N0DA 4R81A 3IYLW 3WO1A 2ZYWX 1UBGA 1UWCA 1X70A 2O8EA 2N42A 4PVDA 3OU6A 4QT0A 3LBNA 5C3MA 3KKMA 3SV3A 1ZSNA 4QQFA 3RARA 2FX5A 1KI4A 4RJKA 3U7FB 1M34A 1Y7IA 5KYNA 3FSEA 3IDWA 3DL7A 3PPXA 2FZEA 2QB0B 4B9SA 4I4TF 4QZAA 1JTVA 4RF5A 3KBBA 3PGKA 5LFAA 2IFTA 4WT7A 4H3VA 1XZPA 2QD3A 2EX4A 3KQVA 3EIOA 4NH4A 4V24A 4B7CA 2BHSA 1L5OA 1VHLA 1ZMTA 3NNSA 2X3FA 2RGRA 4GDFA 3E05A 3HZRA 2YZKA 3GZTB 4C5BA 4B9AA 1BVSA 1L6NA 1VSQA 2B1IA 2C9CA 2P1RA 2P2ZA 2YXNA 3CKMA 1OVGA 3GFBA 3P2JA 1KWKA 3JVIA 4I1OA 4DJFC 2CV0A 1AK1A 3BEOA 2X1HA 3HH8A 1XIVA 3BL8A 1X92A 2J4DA 3ZBUA 1PTJA 3OTIA 1X2EA 2HKIA 2VT3A 1WCXA 1FXSA 1NN3A 3I01A 1YR2A 3B60A 4HXFB 1ZQDA 5LIRA 4F5PA 2IH2A 4MIYA 3KWJA 3CRNA 3FFWA 1ZJMA 1QE5A 3PNQA 5IH7A 5L4LA 2BFOA 3D8HA 2Q3JA 3MTIA 3E2MA 4QBHA 1JQAA 5FKJA 5J4YA 5JSZA 1YB6A 1E7YA 5A5EA 2F8SA 1Q21A 4X95A 1R37A 3VYTB 1U31A 2YOGA 2Z9BA 5DQHA 3LRXA 4D0RA 9ICUA 1AKNA 3OA0A 9LDTA 3HK2A 1PFYA 2J9FA 1QGUA 2G76A 3AEVA 2EKDA 2RDMA 3KFVA 3EVGA 4I8IA 2I2XB 2Z5FA 4QU8A 3SJUA 2WYOA 1IZZA 1I5RA 3JQ7A 3NWBA 5K3DA 4R0MA 4KUEA 3B13B 3HV2A 1ENZA 1D0VA 1P9WA 5JI2E 1U9ZA 2I4TA 1RYUA 4KFSA 2PGNA 2MWMA 5EXXA 5A0FA 1N5XA 3SVZA 1RP7A 8ICIA 3JXEA 2HPAA 3OO1A 3K70C 1GRVA 3WA6A 4TVSA 4O33A 1EUDA 5L7WA 2FPMA 1D7OA 3A1TA 3T7EA 3AI2A 4XCVA 4UBIA 4ESHA 2FEWB 4BX3A 1YHZA 2UZ1B 3LUFA 5CEFA 2DETA 3R7NA 3SAHA 1V4BA 2C5SA 2F9FA 1T2DA 2KFZA 2G1KA 4JLJA 4MS1A 1CNMA 3VNVA 2Z4RA 3UT6A 3K0AA 1T10A 2BGRA 3RS4A 3PGMA 5I7AA 2JD1A 3LKZA 1QV9A 3X1XA 3ROGA 3KFXA 4KODA 4H16A 4ND1A 1KC1A 4F3CA 3G2NA 2VA3A 4QZFA 2FPRA 1BRTA 1MX1A 2Q49A 3MDCA 1S8FA 1WXHA 3KPYA 2AGOA 4UUQA 5DGXA 5SZKB 4IKEA 1TCAA 1FTWA 2PH1A 2VP2A 1D04A 1VCIA 4GOJA 4QOEA 4BE4A 3EPPA 2WC1A 3VR4D 3RQIA 3VYUB 4X5VA 4FI3F 2Y71A 2GM4A 3I9NA 4N40A 3ZKWA 2QJTA 1N2IA 3C39A 4ROSA 2AN3A 5F7JA 1XDGA 4ARSA 1N6LA 3B1ZA 3MT9A 2IS6A 5DGAA 3KZXA 2C8LA 5ECGC 1T29A 4QXMA 4XASA 4QAQA 3NTOA 4AVYA 2CCKA 3AW9A 2B82A 3QY9A 4RU1A 4B8ZA 4M89A 1U5BA 1YDFA 2I22A 3CEMA 4B31A 3DR3A 4W7SA 4MGEA 4KVGA 3Q4GA 1T36B 5DK6A 3EA0A 2JAPA 3JQ8B 3QFRA 4O4JF 4AYWA 3SZUA 4YQZA 4QDUA 1VA5A 1P7WA 2FETA 1KFDA 3OHSX 1PP4A 3R5XA 5DBOA 2PVPA 3KKZA 2L18A 3OFVA 4UPDA 2Q21A 4L5CA 4WJKB 3OCJA 4MA4A 3X3HA 3OPXA 1TCUA 2ZDQA 1I2MA 4W9MC 4DQRA 4M0MA 5HEKA 5A6SA 2AA3A 3H8SA 1ODLA 4CF4A 1RI2A 5BYBA 4X7PA 3H8MA 2VJYA 4YA6A 4EM6A 3SR4A 2I4RA 4G63A 4PZZA 4JYMA 3WVNA 2I71A 4COKA 3W6NA 1TK9A 3RIGA 4A6XA 3WGYA 2EGHA 3H7IA 1FFDA 1IIPA 1LZLA 1X15A 4C7YA 1MX5A 3HWX1 5JSQA 2QLBA 4CTNA 1QSYA 2FLWA 2IC5A 3CB2A 2OYRA 5KWSA 3FE2A 1WXWA 4C20A 5LQCA 4WCVA 2V3CC 4GMGA 1QQ5A 1SU6A 4U3JA 9ABPA 4IIGA 1BXGA 3S7ZA 3DYVA 3KJEA 3RCBA 2EEZA 1XI2A 2CJXA 4FVTA 1N0UA 1Z34A 3RS7A 1J7JA 5HF5A 2WT8A 3WLLA 3RRHA 4CTOA 1W581 3CPJB 7GPBA 4JI6B 2PFOA 3BIJA 3OCCA 5K5EA 4L3VA 4RMIA 1UK6A 2YYSA 5DBBA 3AEYA 1ZQNA 3W7VA 3HVKA 1LQUA 3PA8A 3V6MA 3AQ4A 4R9RA 1VP9A 2YTZA 3KU4A 2X9LA 3GNQA 2PA0A 2Y05A 1BE8A 4G5OA 2BFCA 2D8AA 2I0FA 2F64A 4N0PA 4RNDB 3K72B 1GTL1 2H4YA 1KIMA 3BMQA 1OXMA 2AHRA 3JTEA 5CDGA 3P27A 4QRDA 3UG6A 4EBFA 2AZDA 1E3EA 1O4VA 4Q3LA 4GE3A 1ZIYA 3PVXA 2VKTA 3L8YA 3PQCA 1QGOA 4TWJA 4YRSA 2D5IA 2R8XA 2G5TA 3JQ9A 4KYIB 3QVKA 2CYBA 1GQFA 3GVHA 2I55A 4MJ7A 3AHCA 4BZXA 3G1WA 2ZZNA 3I30X 3TADC 1ZP6A 1X80A 3C8ZA 4MV9A 4N5DA 4PZPA 4JCOA 3RYIA 3C3XA 4PPYA 2ADOA 1N57A 3RABA 4CKEB 3K5PA 3KZCA 1HUOA 4OUKX 5F5NA 2FOXA 5IJ0A 4KR3A 4RY0A 2IS1A 3RUEA 3MTJA 2A88A 2Y27A 4AO6A 1XKQA 2RHTA 4FBLA 2NU6B 3A04A 4G36A 1D6MA 2G40A 1BGVA 3BZBA 1GZHB 1XRMA 1GRRA 1KZ6A 2J59A 3D02A 2AOUA 4UBNA 1KJIA 1B73A 4YAWA 4BFSA 2IXBA 3B1VA 3HHEA 4HUQA 4IH1A 5J2TB 3AUAA 3QTTA 3O1HB 3OBBA 3V00A 3IEIA 4K6FA 4UEOA 3GLQA 3AR9A 3KZ1E 3N0RA 1J70A 2I67A 4LCEA 2PT5A 1MSWD 1DUVG 3D81A 4K9PA 4ZMBA 5EERA 5JECA 1M2OA 1CKEA 2HA2A 2YDYA 4CFZA 4YAUA 3HO1A 4JEIA 4I28A 1L5HB 3NM4A 2ZRFA 3NYIA 3TCNA 1U3WA 2KP7A 1GLNA 1P9RA 3DV9A 4EPWA 2R1UA 4LXTA 2WJVA 1H1LA 1HEYA 4QARA 1MN6A 3CB4A 1YZYA 2FVXA 2I29A 8ICQA 3AOEC 4LJ7A 4X3CA 3FVWA 3CLVA 4PQEA 1MOPA 1FVOA 3RC3A 3GJ3A 3VZRA 4NYJR 1K2WA 4IMJB 1EK2A 2B2CA 3EPIA 1I1OA 3A0HU 1J07A 2PE5A 4Q66C 2EXXA 2RHJA 4E5VA 3TFRA 3K9BA 1AUPA 1QF7A 2TYSB 5SZHB 2XRZA 3PC4A 3DVQX 3P32A 3PNLA 5DLDA 4LJ9A 1EUYA 5LKRA 1E0DA 3RBVA 4QLOA 4Z0HO 2ASDA 2ZBGA 3ZY3A 1I32A 1K63A 3PC7A 4XWYA 4LV5B 1FS4A 4LX0A 3V7YA 4B34A 4C87A 4P08A 3NCHA 4L74A 3TX2A 4M47A 1YB7A 2X0JA 2H00A 3S8MA 1HX7A 2BBSA 5CFZA 3NBAA 1ENPA 1P5RA 2K2WA 2FWAA 2I7DA 2PRYA 4RIIA 4X6LA 1B8VA 3PX4A 1V48A 2B1RA 2MSEB 3A3OA 3OZIA 5D51S 2XO7A 2Q0QA 3P9CA 4BQPA 2RAUA 4MWEA 1KJZA 3D6UA 4R16A 1DQSA 2C9DA 2GLTA 2FNAA 4DUZB 3LPAA 1SG9A 2X15A 5JD3A 3Q98A 1EVJA 4JMLA 4M1ZA 3C3AA 1SBTA 3TKAA 5HM8A 4BFVA 4EG1A 4F9GA 3SR6A 3SXPA 3GARA 4MVWA 5LSAA 1R1DA 4UTXA 3EPLA 4PCAA 3CR7A 1MIOA 4C8MA 1BS1A 4PTZA 2F1KA 2C5EA 2W2MA 4ENSA 1GRQA 1PVPA 2QN1A 4HWPA 3RFVA 2BCVA 1AUXA 1EBUA 3AERB 4OFXA 3VNRA 1Q16A 4GSYA 2Y1DA 4HLNA 3OEED 2IYXA 4F60A 1NURA 1TMGE 1NSYA 1G3MA 4QQRA 4RJTA 4WESA 2HIMA 4NLLA 3K9LA 4RTQA 2I8LA 3L8GA 1BE0A 3HB0A 4HEA1 4ED0A 5CK4A 5CW1A 4N12A 5IVIA 9ICEA 2FLVA 3PT9A 2HHVA 4TXMA 3W3AD 2R6GA 4F6RA 3IV7A 4Y2TA 4PSAA 1UKCA 1P39A 2OCAA 1JU3A 4WNAB 3TPZA 4JCCA 2PMDA 5H9WA 1ZESA 1Y37A 5EUMA 1U2EA 2ANCA 5HHTA 3HFSA 2H9AA 4XPIA 5A4AA 2ZI9A 3ZWPA 4NJ8A 3HA5A 1SV0C 5TNXA 2Z5GA 1U4SA 3RW9A 5F23A 5F98A 2GZSA 3RVJA 5FBZA 2R25B 4BNXA 1A2OA 4E08A 5IXJA 1M34B 4HVAA 1BS2A 5GONA 1UKYA 1IHOA 4XFJA 4DIKA 5KUTA 3ALRA 1SBQA 1G5RA 4MUHA 1DARA 1P5FA 3LP6A 2IZOA 5A6VA 1U6IA 4ZXFA 3A3YA 1B22A 5HS4A 4TV9B 1I6MA 1T1IA 1P7YA 1EQAA 3MILA 4EPTA 5LB4A 1N9KA 1XMJA 3CUSA 4PO9A 1CR1A 3F6RA 2HOQA 4OJ6A 2YXBA 4W4TA 4ZVRA 1OFHA 1DQRA 2WNHA 5I7FA 5KG3A 1CLUA 4TUSA 1S3IA 3WU2U 2Q5HA 3A4TA 4TLMB 5KAMA 4JL8A 3TQRA 4N9QA 1MQ9A 2RG1A 4O5CA 1PX0A 3OIUA 5LP6C 1NR7A 3L7JA 4DA6A 2AE1A 2KB0A 2WAMA 2YX1A 1Z35A 2YDXA 3COZA 2YN2A 3EZYA 3KB6A 1S3FA 5ALFA 4GBGA 5IEJA 2OHIA 5IFKA 4ECYA 3NHBA 1LV5A 1M2FA 3V42A 5L3ZA 1H65A 4WADA 3CVVA 1AXGA 1G3QA 1K3UB 3PFKA 3QFTA 2PSSA 2A1IA 4RSRA 4XYBA 1CERA 1UJ2A 2IYEA 2FW8A 3QUQA 1N48A 2PQ6A 4GSLA 4ZPXA 2YWFA 3A1DA 4N7MA 3PENA 4B6GA 4F2SA 2J9FB 2Y1KA 1P8JA 3HNOA 3RUDA 3ZQUA 1XPRA 2PUBA 4FFLA 3V7UA 2P3QA 2QQ0A 1N1GA 4I5IA 3RM3A 1YCHA 3WGTA 3IB3A 1ZQXA 4LOAA 2HW3A 4A92A 4BZZA 4UZSA 3IQEA 4Q1BA 3H9CA 1AHHA 2ZQ5A 3CN7A 2ZTVA 4KRGA 1SVLA 4CR7A 4G86A 5JAHA 2SBTA 2R48A 1I30A 4AJ4A 4DUPA 2BF7A 4NWIA 4I50A 4KLJA 3GWGA 1DGSA 3Q3IA 2B25A 1PHPA 4TLLB 3PFGA 1B6GA 1NW3A 5H9VA 4WBNB 2Y68A 5CTJA 2JANA 2ZIGA 3E27A 3MAGA 3B7GA 1QVRA 1M0TA 3N7UA 4RA9B 5EJFA 2E4ZA 1FMLA 3GV7B 2EGGA 5L9AA 1RQ2A 3FYCA 1Z33A 3MJTA 4R7ZA 5KNDH 4B3RB 1GNPA 1K8QA 4PZEA 4ZO7A 2J9YB 5ERYA 5ELXA 4JB3A 4MJXA 2PGLA 4ZEOA 2QVCA 4OG2A 3A4LA 3C1AA 2G80A 4OHZA 1YZHA 1P7CA 3HGMA 1Z3CA 1WXQA 3DCNA 3PXAA 1ZQBA 1LCIA 3D7LA 4N54A 2X8WA 2JGAA 3R7WB 3EE6A 1OIXA 4N3GA 4NCNA 3RI3A 4US9A 2FKNA 2QVZX 3DMTC 3LUJA 4LHXA 5F64A 1BOOA 1JSLA 4HGRA 4TPKA 3WDMA 2JIBA 4UZFA 3N28A 4OP2A 3TB6A 5EJ8A 1N7HA 2N46A 1Z8FA 4PXSA 4G9BA 2W9CB 2EDAA 4TXHA 5KYXA 4GX2A 4RMHA 1G3UA 4D45A 4DZRA 2GUWA 4IIBA 5IRCD 1X6IA 1ESCA 2VJDA 4MQEA 2EZYA 2FKAA 1E1LA 2EFHB 2Z2IA 2CLCX 4RPCA 1AKEA 4OJLA 1FRQA 1VPDA 2XOKD 1SVWA 3IE0A 4EITA 5KVSA 3DZHA 5J0SA 3G8CA 4ZVQA 3ZHOA 2ONYA 4HB3A 1ANKA 1Z0UA 1R6AA 2EL7A 3A31A 5EN4A 3U9TA 2DUYA 4B4WA 2D1YA 3EZGA 4I3HA 3H0LB 4B43A 5KFMA 1TAGA 1EP3B 4XCQA 3WFZA 3DHYA 3S8EA 1Y7LA 1TW3A 4RTSA 4QWBA 4F6CA 5EIEA 3GF4A 3QQPA 1GN8A 5A5VA 1CWUA 2FRDA 4UBKA 2BDEA 2WUEA 5J2GA 1T2EA 3QE4A 1F60A 4EZ9A 2AWOA 2GD6A 3EEQA 3LQ1A 3FUVA 3JQAA 4B4OA 4RD2A 3LX8A 1FUYB 1RNLA 1TIKA 2UVUA 1JQJC 4MSUA 3UZUA 1GYQA 4DBZA 3T9CA 1PT6A 3B9PA 1ZHOA 1JDJA 5I7SA 3D2BA 1G38A 5ADWA 1DAKA 1O2DA 4Y6PA 5AKGA 1W59A 1YIAA 2EYUA 3ANYB 3H2BA 4ECXA 2BMDA 4QU5A 5BN5B 3RF7A 4P34A 4L51A 3V6JA 3HE3A 3Q10A 2YS6A 3NHAA 1LUAA 3SYTA 2IWRA 4AJ9A 4GGPA 1U49A 5EHXA 5FOWA 3C5WP 2B8TA 2DTXA 2HD4A 1MA3A 5JCZA 4XVRA 4JI1B 1NIJA 2HCFA 1PAUA 5CIQA 3I1FA 2BZSA 5J0TA 5TC4A 4XZ3A 1BROA 1I3CA 3I6MA 3DZBA 3KXPA 3NBFA 3AVWA 4KDRA 3DPSA 1TQ2A 5EIBD 5A0LA 4CKCA 1R10A 5AHWA 5KSZA 4OU4A 5EQTA 2ZAIA 3OU7A 1GTJ1 4PX9A 1WUDA 1ORWA 5K0FA 4S1NA 1QONA 2GOYA 3N7TA 7ICLA 1HY3A 3MJVA 4Y1FA 2ATLA 2JDIA 2C5BA 1PWXA 3AV0B 4H4DA 4FPXA 3W8EA 4K88A 3OD5A 4BJ3A 1F0NA 3NOXA 5EQFA 1RQXA 1NOMA 2BC9A 4LXIA 4YRNA 3F8TA 4OJPA 5COAA 5DM0A 1H3NA 1T0HB 3VDQA 3CZ9A 1P0CA 1P91A 3ZGNA 5C1PA 1XZMA 5MFZA 4X44A 1M8FA 4EHFA 3IR6A 2XKKA 2CCGA 1ULZA 2ZSAA 3K53A 3MS2A 2VJCA 4AQ7A 3D2NA 1GSIA 3KEOA 2ILTA 9ICIA 2X7HA 4FLEA 1I24A 1U99A 4S35A 3BH6A 5DGHA 3USCS 3CNBA 1XTRA 3WC4A 4HPWA 1H66A 4FMBB 3JYOA 1E4VA 1JKJA 5DGBA 2O57A 1RYBA 3H0KA 1RHJA 3AJRA 3ZXUB 2ZRBA 4QWCA 1I13A 3LY7A 2JASA 4Q48A 3WRYA 4DLNA 3SHFA 4KZPA 4CDNA 1YKFA 1R4ZA 1RKQA 1YQGA 1HA3A 2GVZC 1NOIA 2Z09A 2H3VA 3FY4A 4ZDWA 3IAAA 2ZT6A 3L7OA 1E6KA 4X62B 4C7VA 3EUFA 1OBOA 3RVKA 2ECPA 4U9IS 4OV6B 4EBDA 2FEKA 2DB3A 3RF9A 3IMGA 4IXDA 1PNRA 4MRPA 4ZQBA 2BLLA 1SUBA 3CNLA 2VHQA 1SXJE 4NCJA 2FGKA 2X1VA 2R84A 2DPGA 3KHTA 3TMAA 1B6TA 1TJ5A 2A3NA 4G9GA 4DMRA 3LNTA 4JITA 3MW8A 4AURA 2GAFA 2MSLA 4Q7EA 5EMJA 1E6EA 2HU7A 3AF3A 3PXBA 1RDFA 4FGUA 4DCUA 1A7AA 4QGHA 2W2XA 3QHQA 4QPPA 4AZVA 2JHGA 3OHBA 1J1ZA 3ZXYA 4IHJF 1ISRA 2GHIA 2CD7A 4BJQA 1D2RA 1L4MA 2EWMA 3L0YA 1V9PA 1JU4A 3GFRA 4MUYA 5SY4A 2BEJA 3NHRA 1AMOA 1MOSA 2GQ0A 5I7VA 3TIFA 2OO5C 4UQLA 4QFDA 1U0HC 3EXG2 2BW0A 1ZUNA 5IT4A 1Z6TA 3HY4A 1TVKB 1EBBA 3IR7A 3B3QA 1Q0TA 4YBRA 4PAMA 4M9LA 1AQUA 1E3TA 1HQCA 2YQZA 4N3NA 5K0LA 2PJRA 1KJJA 3K5HA 3L8FA 3FTPA 4XIIA 2WB2A 3U4QB 3NALA 9ICHA 4LHWA 1IY9A 3JQ6A 3D0OA 3PFHA 3N5KA 1FJHA 4CHGA 1D5CA 1EFRD 2Z2YA 4IMIB 4L0CA 5H4GA 3ZE1B 4PAQA 2G82A 1WCIA 4BN0A 4H9GA 5CJJA 3N76A 1YJAA 3FN4A 5KQGA 1DXQA 3AKCA 2DZDA 1Z1VA 5AKEA 1WOYA 2VDWB 3F0TA 4Q5IA 1O4WA 4DLZA 2PS9A 4YCCA 4XUGB 4FILA 1B2RA 1KP2A 4LXXA 4YRRA 1E92A 4ETNA 1UOEA 2NVWA 5E7MA 1B8PA 4YLGA 4RNNA 4ZYZA 1SBZA 4AY3A 2H08A 2OHHA 2Y1LA 5ETJA 4R1NA 1JIJA 1FNDA 4Y30A 3LHIA 1EUZA 3RBZA 4K05A 5DPMA 3MSXA 3KQLA 4GGOA 1NW4A 4AW9A 1Q7BA 4M8LA 4B7XA 4I4IA 2V7EA 3ONWA 4XB6B 4Q9AA 2D1SA 3DMYA 4TYYA 4I2AA 2GI4A 1NW8A 2ZR8A 3HLKA 3LQYA 1Z7EA 4ZO8A 1ONSA 4ZO9A 1AGRA 2BGKA 3AB3A 4C4RA 1AZWA 1X8JA 4EYQA 4U7CA 2AR0A 2VHUA 4X84A 2PJDA 1UQTA 1SUEA 1JMKC 1H9AA 4NFHA 1RACA 5EZQA 3RUPA 1OI2A 1V5FA 2NZ8A 3HKEA 4H1TA 1ULAA 4O3FA 4Q00A 4R98A 2JCBA 2X5XA 1Q5PA 3A1SA 5FORA 3S99A 4TUYB 5KQPA 3ADCA 3C4QA 2F8KA 3P2KA 2VA8A 2BQUA 2FGJA 3G2LA 1EVYA 2XW6A 1QRAA 4DOBA 4O1HA 2BOVA 3O9VA 5E2AA 4YUYA 2X8BA 4A0HA 5F7ZA 1KFSA 1KMQA 2V6FA 2G09A 5CIYA 3J80A 2AXEA 3MERA 3QLVC 1ZD5A 1VCHA 2IGBA 3LXXA 4TVOA 3UMVA 1S4QA 1GPMA 4ZJYA 2VK1A 2F9MA 3R8CA 2GBGA 2PAFA 2OE2A 5FEMA 4YMHA 1XEXA 3DO6A 1M5TA 4A26A 1RRGA 5D1NA 1YZ7A 4CNBA 4BNLA 1GZDA 3GFOA 5KDLA 2EKPA 1YF3A 1OKKA 2IYWA 1CCWA 2XDAA 4JYPA 4UB5A 5CVTA 4EYIB 4DL3A 4QXQA 2UZAA 3GJ5A 4N01A 5IM4F 3HA3A 4AQYB 4L3OA 4JBHA 4KMUA 3AEUA 3ZLTA 5KREA 2DJ5A 3N2YA 5L4NA 4YMOA 1TEHA 2W4MA 1TAMA 2J3MA 2EAOA 1Y8QB 5BYKA 5H70A 1WYGA 1XZCA 3GL9A 2UVQA 4R7GA 3CRQA 4JBGA 2JAXA 4GFJA 5HDQA 3HLYA 4CPDA 1CSEE 3U1TA 4BCCA 1XZIA 3ASZA 5EP3A 1R4AA 4QHTA 1BJRE 3EDRA 2RCNA 1RP1A 3E22B 4TKMA 2AK2A 5EIAA 3VO8A 4YCMA 1EFPB 4GMXA 3P0IA 1CUKA 1W5AA 4R65A 3V4VB 3BRWA 1W85B 1H38A 1CF9A 5KI6A 2FJ6A 1UZUA 2YMPA 3UGKA 3FTQA 4XX1A 3VOSA 5L6LB 4QUBA 3D4LA 4P32A 2R6DA 3UMGA 1EZ4A 3DH0A 1KJQA 2IZ1A 1KFBB 2ZROA 1X1EA 1XDWA 3OZEA 1KDYA 1Q7RA 3K8ZA 5ALYA 4PLZA 3QJYA 3GXBA 2WSBA 2WSMA 3KYCA 4MYSA 4NJEA 3U5ZB 2BEUA 2JIMA 4HMOA 5EJMA 5EPOA 4XQCA 3LH5A 5C3UA 4AKHA 3IILA 5ICFA 2ABWA 1FC0A 2CLLB 1JB1A 4ND7A 4DIDA 5B5SA 3CF4G 3G2MA 1KVTA 4AAYA 5KT6A 3G17A 2CNWA 3FPGA 3KZOA 4RUCA 2OKGA 4BXOB 5DM1A 4CMKA 1U0NA 2CN1A 2BPGA 2BRUA 3D2QA 2ZVJA 3WGNA 4EABA 2HMXA 1MEJA 1R6TA 2DFPA 2WZDA 2QMOA 3VKHA 3NOOA 2WF7A 2W43A 2QN6A 2ID7A 2QL9A 4QC2A 4QXOA 3UWKA 2IPAB 1ZQJA 1Z2AA 4KIWA 4TS1A 3BWDD 4YNBA 1PGQA 1IG3A 2Z30A 4TKVA 1IM8A 1R5OA 2CNDA 5FNVF 1NN5A 1PQUA 2W6CX 1XZAA 4WXEA 4BFXA 5SYAA 2RQ5A 4UNNA 1AH2A 5B3LA 4IOLA 1ZGCA 3OU2A 1HPLA 1AK9A 1ZM3A 1G6KA 1MMFB 2R79A 4ZOLF 5KCMA 4OCZA 2DWUA 4RWEA 4QL3A 1W0CA 1OB2A 2VXCA 1FFAA 3ISDA 1UJCA 4RVSA 3E9ZA 4O2RA 4WLUA 3SQWA 4L73A 1XMOB 1XC7A 5D2CA 4N7BA 1CX9B 3O6VA 4L16A 2C1EA 3RG2A 3V4SA 4YP9A 1P7PA 2ET6A 1P2GA 2OCKA 1RPAA 4QASA 1TD1A 2KG5A 5T41A 5JFGA 4N76A 1FFXA 4XTCS 3EW9A 4YDHB 4IJ6A 1MRNA 2DR0A 1M76A 3FNGA 4H6PA 1ZQ1A 1W1WA 2GD2A 2W58A 2AQHA 3A1FA 3HDHA 3HU5A 9ICPA 3GPBA 3CPEA 4DT1A 2BI8A 1EDOA 1E4OA 1Q77A 1QTIA 3E9RA 3M6VA 3NIDB 3R6GA 4FT2A 2PZLA 4QWAA 1GZ7A 2MINA 5IIOA 3M33A 3OE7D 4HYQA 4A9AA 3TLGA 5KWEA 4ABTA 3C6BA 2Q4BA 1M2KA 4B0PA 3UJNA 5BR7A 4GEKA 2ASJA 4BXOA 4QYSA 2ZUTA 1MXHA 2YASA 3S2EA 3ZNOA 2XYHA 3DDCA 4RD3A 4IY1A 2BQRA 2HREA 1RAHA 2JFNA 4ZTUB 2AQKA 2EVWX 3JVDA 2RHOA 1M2NA 5KNLA 1KGDA 2ZTSA 3UQYS 1ZVVA 1I2BA 1OFIA 4U2DA 3D1VA 4POOA 1QE3A 5A6SB 3HKZC 1ZJNA 1LBHA 3I34X 4FOTA 2QPLA 1WKBA 3V4LA 4BNFA 4D9FA 1EGVB 2AD5A 4JJAA 1NUHA 1W94A 3DBRB 3NV7A 4OMUA 2OBYA 1QSSA 4ECZA 2XGPA 5KFIA 3D8SA 2OP1A 1NJ2A 3ECAA 3KR0A 2JFZA 3DWGA 3C29A 4C0AC 2P66A 4EMBA 3I4FA 5K0GA 1VYHA 5H4HA 3T1VA 4L28A 1NWCA 3P26A 1G8PA 1GZ5A 3PC2A 4LHYA 1L4KA 3EULA 3GEIA 2H65A 2G9RA 3EISA 4GOOD 4DMLA 1GCAA 3F2IA 4EI8A 2PH3A 5G0VA 4JJFA 3CS3A 2ESEA 3Q8SB 1OC4A 3IIMA 2W6PA 1PG2A 2XE6A 3JVUA 3RTEA 3LL4A 1NY5A 1P72A 5CFMA 1S2IA 4F21A 3L4JA 3TZCA 2JH3A 4K9RA 1NVAA 1GGVA 4PLYA 4WKPA 3MJEA 5TLSA 3FUUA 1OI3A 1MC8A 3B1KA 1FYWA 1HM5A 3N53A 2Z9DA 4OBBA 2ATVA 1NY6A 2R8OA 3C6KA 4GPAA 4DSKA 4O2LA 4U5XA 5DEOA 4RENA 1E9FA 1X8XA 2J6IA 4Q1DA 4MQ4A 1AO3A 2GAOA 3DP7A 3GRAA 3HJGA 5JS7A 4FD2A 2CDRA 4MS3A 1UXOA 3E5RA 1U3FA 3CR8A 3X1MA 3H87A 3IA7A 3CO0S 2EW1A 5JNSA 4INAA 2COKA 2P4QA 1TTPB 4ZI7F 4R2LA 1TVAA 3EPRA 4HGNA 5CGZA 5IAJA 3V2HA 4WBNA 1ZXXA 1G2IA 5CJ2A 2QTCA 2GJAA 1SL0A 3AP3A 4UAVA 1ONNA 2W4QA 5ALTA 1I5OA 2QJWA 3L4KA 4MKRA 3HY3A 3DZCA 3DE6X 4CG3A 1T3GA 3C5EA 4FHDA 4U7FA 3WRVA 1U1EA 1P61B 5JYDA 2BD0A 4RHXA 2RB5A 4P3PA 4M9CA 3GLFB 2HMAA 3HKCB 3VDXA 2O48X 2ZTLA 5H59A 3CEJA 1F2VA 4HRAA 1RLMA 4MVJG 2FG7C 9ICGA 1LJUA 1O94D 1UC8A 3AFHA 2LIVA 2V0CA 3KCNA 4MITA 1ZK4A 3E2PA 4O02B 4AP6A 2FYTA 2J7PD 5NULA 3ZE9A 4AKIA 4EG6A 1X1QA 4RDHA 2CF5A 3ADKA 5LA6F 4GHWA 1NQ5A 4HNRA 4Y2VA 2H3QA 1NVXQ 2VFAA 2VP9A 1NU8A 2LCFA 4KMSA 4LOIA 4P86A 4MVJF 5D7BA 1CLEA 4X3PA 4ENUA 5KYKA 3H1AA 5DXAA 5F9HA 4EHBA 5IWAB 1L7XA 5C0OE 2IUUA 4H7EA 1V3QE 4P35A 3GGGA 4Z9FA 3QXXA 4AJOA 2EU8A 2WPDD 4HGOA 1T3SA 1G8AA 4B6QA 1ZOSA 4FBGA 5EMMA 3DL2A 3M8SA 1MX3A 5ERGB 3U6KA 3BULA 4GNKA 5AJTA 1PYDA 3F7MA 5TMPA 1QIMA 3QKRA 4O4LA 2HHJA 4TTJA 3ONNA 3WMFA 4O1MA 4JV2A 1IHXA 3G0GA 3AETB 3JZMA 2X0IA 3DE3X 4L5BA 4JHXA 4L27A 4IQ8A 2UVRA 3MTQA 4RFVA 2FMFA 2X0EA 3BN3A 2HRZA 1Y82A 2P69A 3ADOA 1BKYA 4URUR 3CSDA 5K3BA 4RT2A 2CHUA 4CCWA 1CY7A 2FZGA 4Y7DA 3JPNA 3EEOA 3O8DA 4C9BA 3IPXA 2FQXA 2QW8A 1JSRA 2RMKA 1WTAA 2BKVA 3KLMX 5FA5A 3VYWA 1ODSA 4ZMRA 1UMDA 2XT0A 4MH0R 2XRFA 3O7WA 3KC2A 4DXHA 1O1YA 3EXAA 4TS9A 1RBYA 5JSHA 2XA9A 5MDHA 4NLNA 1Y98A 5TARA 1IMOA 2QGNA 2ZBDA 4JLSA 4V2IA 4JI7B 4ED1A 1T8UA 2DGZA 4WLOA 5CX4A 5ES4B 3HUFA 4MDYA 3CIFA 1PJ3A 3V8NA 2NU7B 1KI1A 2NWQA 3QG1A 2OA0A 2IBMA 1C0KA 3G68A 4IXWA 1MCZA 1SIUA 3SQNA 4DNPA 3NEAA 1VCNA 3MNFA 3PRJA 1HSZA 1R3UA 1X8LA 2H4FA 1MEEA 4ITRC 4C7XA 2B8NA 5LNK6 1ZMXA 3NW9A 2RGCA 4I81A 4YCLA 5I7UA 1FDWA 3L6DA 4DYVA 4KAJA 4LF6B 1UEJA 1D3AA 3A1NA 3BF8A 4FOPA 5LQMA 3QTLA 2X2EA 3BFVA 4JLDA 1XDUA 3TD6A 3LLMA 2X23A 1B6SA 4PTYA 2EFDB 1XZKA 3BB1A 3DBLB 4FX5A 3UO8B 4TKLA 5I9LA 2KQUA 5KS2A 1VLJA 1ZJ4A 1W87A 3AEKA 5IMSA 1VJ0A 5KMGB 2FLKA 4J9VA 4E6PA 4MUEA 1N5MA 1ZH8A 2P9TA 1U0GA 3W6UA 4BAGA 4CFSA 4DUGD 1M1UA 3WTBA 1R9GA 4DRZA 3FROA 3FFAA 4RZRA 4WERA 1ORTA 4OSOA 1PFUA 2GZ1A 1AV7A 1L4NA 5JARA 3H5AA 1ZOLA 4LWPA 4EYKA 3LPMA 2WLSA 3QKUA 4G07A 3U48A 5TT1A 4JB2A 1SC4A 4WNCA 5J63A 1N2CA 3COWA 1NP7A 1KEJA 2AX3A 2KOBA 1FXUA 3OD1A 4QG7A 4QVIA 1T0PA 3BMNA 3O1IC 8ICWA 1DC8A 1BG6A 2ZIXB 1AZLA 1Z6AA 4NBSA 5FJJA 2HPZA 4F5QA 2Q5JA 2VC2B 3CPHA 3EZ6A 4JR1A 5AVJA 4DJTA 1RJWA 2DH6A 4CNQA 1UPXA 4UVDA 5DLQC 3QPDA 2RK6A 4AQDA 2CLOB 1TAUA 4JDPA 1WX1A 4H3KB 3W79A 4YV7A 1ZISA 1T6YA 1TF2A 3RVOA 5CCBA 4FSXA 3OQVA 4LOHA 1YTUA 3GDFA 1WHTA 1QQTA 3C1TA 1A2QA 1KO1A 1S77D 1JDPA 1IHYA 3D43A 2QYHA 4LYFA 5IC4A 1C41A 3TLBA 3OVMA 4LNAA 3CR3C 4NFLA 4K6GA 5KHOC 1YB5A 2AG5A 4MJ3A 1NXQA 5EWGA 3HQ4O 1JJAA 4ITVA 3ETEA 3QU5A 1T26A 2NN3C 2OBBA 4N49A 4UU0A 5EJ7A 3L7LA 1JPVA 3MT0A 2W2VA 2KE5A 5GVRA 3FUCA 2H3FA 3D64A 4CTKA 4I2EA 2XVZA 4NYMQ 5HJ7A 1KAOA 4TXJA 1DTWA 4JGGA 1N56A 4OHWA 3J7AC 1X1BA 2AB0A 2ORVA 5AJXA 1N8SA 2FZKA 2CJPA 1DX9A 1M2VB 3DZIA 4RJJA 4DUYB 3PZPA 1WMAA 2HWXA 4WN3A 1U7HA 4MV3A 2I7CA 1RRVA 1QIIA 1JE1A 1Y8RB 2JZCA 1GGNA 2OO5A 4Z4EA 2BGGA 3QLEA 4B32A 4PW0A 4MFAA 6CHYA 1G8KA 2A57A 1XTPA 1HYEA 2XGGA 3NDJA 2IP1A 4HDOB 2HSDA 3H16A 4P4LA 2HO4A 1P80A 2A1JA 1OV4A 1F5SA 2Y93A 3T7DA 3E3AA 3RKUA 2X86A 1OZGA 2A9KA 4U02A 4E14A 3DZKA 5K03A 4IL6U 1KZ7B 5BOLA 1IULA 1DG3A 1A77A 1U9LA 4I14A 4KVZA 4KWHA 4DY6A 4N4AA 1F20A 3T5JA 4GH5A 2V3WA 5KYUB 4ELUA 3FSRA 3FX2A 3MGHA 4NMHA 4B9UA 4DEYA 1V8PA 1WKVA 1L8AA 1QMGA 4AJ1A 2RARA 4LOKA 4UC0A 1K7SN 2OV1A 1HG0A 2H1OA 3PLAE 1KDTA 4HQ0A 1TXGA 2NSLA 1H2RS 1P0FA 1X2BA 3HB7A 5DHAA 1PV4A 2B2XA 4E51A 2VXBA 4I2VA 1P3JA 1X7ZB 2FK8A 4AN4A 3RB4A 4TZ6A 1RWWA 2ECFA 1RXCA 3GRPA 2XDWA 5D00A 2X5KO 3V4ZA 2BR4A 1U8EA 4M8SA 3ZLUA 4PYQA 2PKRA 3QG5A 1CRWG 3Q7PA 2QMYA 4QYIA 1RI1A 1EP9A 3HJTA 4E15A 2QBYB 4MR8B 3IG5A 4HN4B 1SZCA 3GB9A 1YJ8A 1VFPA 2KKPA 2ISPA 2Q6TA 4X5OA 4QNLA 1W5SA 2JV3A 5SZIA 2PX2A 5J3JA 1ZD3A 1L5FA 2P3LA 4JLNA 3GRYA 5A9TA 3U1VA 4MA0A 4PFQA 5CB0A 2IX3A 1UQUA 3EQ8A 3THOA 1GL6A 1HT1E 3WLTA 1O8CA 3UG7A 1NG1A 4FBTA 3N74A 1V2GA 4C1NA 5F33A 3NAZA 5FULA 4PHEA 1Y48E 4NMMA 1N36B 5KU1A 4N3CA 5C4GB 2QTAA 4P4SB 1X1AA 2ZBPA 4ZVVA 5GZ3A 4AKGA 5AKJA 3KX2A 4NBLA 4H7HA 2FE4A 2QX9A 4JY7A 1GPUA 1SU8A 3BOSA 5CX1B 2FTKE 2P5YA 3P96A 4MRVA 4O2BF 3QBJA 1WW8A 3KOWA 4K2AA 4D44A 4KWTA 5CXQA 2WB1F 1H4VB 1GEEA 2I8CA 1ZQZA 4BQIA 3VX3A 3T3FA 1Z08A 5IULC 4MHVA 1KEPA 2NT3A 4KIFA 2NUAB 4LN1A 5JC8A 1IEWA 3AR2A 2QMEA 3FLMA 1Y4AE 3GDWA 1KTQA 1KSPA 1PR0A 1J0DA 2CE2X 1NG9A 1R8SA 2O3SA 4NZZA 3GIDA 4HP8A 3IDOA 4ON9A 2WR8A 4UD2A 1OT3A 4OX9Y 2L69A 1WXFA 3INRA 1NVFA 3ITEA 1WS6A 1UJ4A 4G2NA 1W5TA 1F8UA 2C5AA 1EK1A 2ZXHA 1KH1A 2XB6A 4R8LA 1T15A 2D54A 3N7SC 2Z8XA 4QXPA 3U7QB 1J9GA 3IVCA 5LQAA 2CKMA 3AFNA 4ER6A 4D9KA 3A3KA 4YFYA 2VRBA 3L7DA 2O7NA 5FTKA 5B3AA 5HS6A 2NAFA 4EJ6A 4DDUA 1C8LA 2HRDA 1YR7A 2C31A 1JVBA 2HBLA 2B4AA 2D62A 2PS3A 2WWIA 3DHNA 3FCSB 4MGIR 4YRDA 4D46A 4E1VA 2XOXA 1MR3F 2O4UX 1X8KA 2V55B 3O4GA 1JXAA 5J2IA 4WOBA 4JP3A 1BX3A 3IVMA 2CXUA 2QRGA 3D8NA 2OP0A 3CFYA 1VECA 5I45A 1K6MA 2EDUA 1FVFA 1Z0JA 3WGQA 3ZHYA 2JFYA 2ZRCA 2IUTA 4OI4A 1OAKA 1CT9A 2UUOA 1SXJA 4FDMA 3W78A 3N70A 4IBOA 1V8DA 2FWIA 3ZWBA 4EJSC 5BY2A 1Y9DA 5KJCA 3VJLA 4ZYVA 3Q8MA 1VKRA 1UIMA 5E0OA 4BPBA 1KOLA 5AKYA 1KDPA 2JHAA 3B2EA 3UIEA