4F71A

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, wild-type protein, complex with magnesium and inorganic phosphate
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
198
Chain Sequence
b'GIKNLLIDLGGVLINLDRERCIENFKKIGFQNIEEKFQLDGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron vpi-5482
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
total genus 69
structure length 198
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4f71A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4f71A01
4Y2QA 5AW9A 2YMLA 5AK4A 3VAYA 3L1UA 2B0CA 4C4SA 2HEGA 5ALXA 2RB5A 4OHFA 5ALJA 5AI8A 4UMFA 1Z4JA 1LTQA 2DQSA 4DW8A 5AVVA 1Z88A 2G09A 4CE6A 5ALGA 2HCFA 1YJ5A 3ZVMA 3L8EA 5ALUA 1RKVA 3WGVA 4YIKA 5ALQA 4KYTA 5AKZA 1ZRNA 2R8EA 2WF5A 3AR6A 3UM9A 2W11A 3L0CA 2CFSA 1SWVA 4Y2XA 2WM8A 4CNQA 3A1DA 3N8GA 3PGLA 2EAUA 3ED5A 5ALPA 1ZJJA 2I55A 1RQNA 1F5SA 4EELA 3QU5A 3EPRA 4HGRA 5AW7A 5ALFA 1L7OA 4XE5A 4I9GA 4FYPA 4RETA 4DWOA 1ZOLA 3WK5A 4KX3A 1MH9A 4UAVA 3ET4A 5IT4A 2FUCA 1VJRA 3A3YA 3DDHA 2MSNA 2FI1A 2YJ5A 3L0YA 3QUQA 5ALMA 5ALKA 5IS2A 1RPZA 5AI5A 1ZRMA 3W5BA 2GHTA 2WFAA 3A1CA 3U19A 2B1RA 2HF2A 5AM4A 2YMPA 1NNLA 4KNWA 4YIHA 1TJ3A 2B30A 4UM5A 3MN1A 3QU7A 5AK3A 2YY6A 3S6JA 2R8XA 3A1EA 4Y2YA 1Z4NA 2EARA 4UM7A 3N07A 1O08A 1S8OA 4KX5A 1L7MA 1AQ6A 2X4DA 3QLEA 3OPXA 2I34A 2HX1A 2WF8A 3HLTA 3E58A 4F72A 3P96A 3AR4A 3ZX4A 2I7DA 3WK4A 4DCCA 1NF2A 4XPZA 1Z4IA 3QGMA 3L1VA 2MU2A 3L8HA 1RDFA 3MMZA 5AIBA 3DNPA 3SKXA 4UW9A 4UMDA 3RFUA 3SF0A 3L7YA 1WVIA 4UU0A 3FPSA 4KNVA 3ZUPA 5AIAA 2R8ZA 2B1QA 4UU1A 3ESQA 2BDEA 2YJ6A 2OYCA 3N1UA 5ALHA 2G08A 3NRJA 2C4NA 3U7GA 2G1AA 3UMCA 1CR6A 1U7PA 3AR8A 4EZEA 2GO7A 3ZX5A 3RF6A 5AKKA 5T41A 4L57A 2YJ3A 2G06A 3QUCA 3U7FB 1VFPA 4J03A 1L8LA 1TE2A 4AS2A 2W4MA 4G63A 3EWIA 5IT0A 1L6RA 5AVSA 1T9ZA 2GMWA 2HHLA 5AW5A 3F9RA 3WGUA 2IYEA 2MU1A 1QQ5A 3FGOA 3NAMA 2C8LA 3CNHA 3WKEA 4GIBA 1U02A 4G9BA 1RC8A 1YMQA 2O2XA 3WKBA 2ZBFA 5AKXA 1RLOA 2O9JA 2NO5A 3SHQA 3PDWA 5AI4A 2ZOSA 2G0AA 4UAUA 1SWWA 2ZBDA 3SD7A 4BEWA 2AGVA 1RKQA 4KN8A 4MWOA 5ALVA 3EF1A 3KC2A 4EX6A 3L5KA 1Z5UA 4HYTA 2G07A 4XQ0A 5ALDA 5AI6A 2CFTA 3QU4A 3HYCA 1KYTA 3U26A 3U13A 1S2OA 4OFZA 4FFDA 3ZU6A 1ZS9A 3L8GA 2IOFA 3W5AA 1YNSA 3OCWA 5AKYA 3I76A 2HO4A 1QQ6A 3N5KA 1L7PA 2NO4A 2HDOA 2Q4TA 1RKUA 2FPRA 2Q4RA 4J2TA 4H1WA 4UASA 3IB6A 1XPJA 1NRWA 3OCZA 4YCMA 1YS9A 1XVIA 1K1EA 4O8CA 4HGOA 4HGPA 3ZTYA 3QNMA 4BX3A 3MC1A 4BYGA 2RAVA 2HF7A 4UATA 5AVYA 3B8EA 5AVQA 3AR5A 5ALNA 2JAWA 4OCZA 1N8NA 4HAIA 2ODAA 3M9LA 1Z4OA 2GHQA 3AR7A 3ZW7A 5AM3A 2AH5A 2WF9A 3W5CA 2NYVA 5AVWA 3DV9A 1ZD2P 5E0OA 1RMTA 1Z4MA 2AMYA 2OM6A 5ALZA 2G80A 4Y3UA 4ZEXA 1Z4QA 2PKEA 4C4RA 2C8KA 4UMVA 5AESA 5AKEA 2FDRA 3R4CA 3AR3A 2ZBGA 3KD3A 5AK6A 1TJ4A 2P27A 3ZWKA 1RQLA 1Y8AA 4NABA 2FPUA 2W43A 3U7HB 2IA5A 1LVHA 5AM2A 1FEZA 1YV9A 4CF5A 2YJ4A 2B8EA 5AM0A 5AW2A 4BX2A 3WKCA 3NANA 5AW6A 5AVRA 1QH9A 3I1YA 2IOHA 3SKYA 4MUMA 5ALEA 5AK5A 3WK7A 5ALIA 1Z4LA 2D2VA 4CF4A 4HGQA 2RARA 3WKAA 4Y2PA 2FPXA 3IRUA 5ALOA 1JUDA 3PGVA 2CN1A 3N28A 5AICA 4Y2TA 2YMMA 4BNDB 1VJ5A 1XP5A 5ALTA 2HI0A 1J97A 1Z4PX 5AHXA 3OCVA 4NAVA 3SLRA 4NV0A 1U7OA 3WK8A 4BEVA 5ALRA 1ZD3A 3ESRA 3QX7A 4NWIA 4NFLA 1Z4KA 2C9MA 3KOOA 5ALSA 4I9FA 4QJBA 5AKGA 1L7NA 2IOFK 1Q92A 3AR2A 2HSZA 4F71A 2B82A 1SU4A 3E81A 4UMEA 4Y2UA 3ZI4A 3QXGA 3ZVNA 5AI0A 2CFRA 2HOQA 2ZG6A 5AVUA 2FEAA 3BA6A 5ALWA 2YMQA 1ZD5A 3FPBA 4ZEVA 2RBKA 3KDPA 3UMGA 5AI9A 3UMBA 1RLMA 4YCLA 4RESA 1N9KA 4BBJA 3TLMA 2Q5EA 3SMVA 5A3QA 2WF7A 3EF0A 3PCTA 2R8YA 1RMQA 1EK2A 4Y2SA 3FM9A 2FUEA 2JARA 4EEKA 2YFYA 3QYPA 3IJ5A 2AUTA 3J7TA 2ZXEA 3E84A 3L0BA 1RLTA 3U7EB 4BX0A 2P9JA 2ZBEA 1Q91A 5AM1A 4CF3A 4FE3A 3AR9A 3ONNA 5AW8A 3R09A 2OA0A 3QU2A 3R9KA 4Y2RA 5AVXA 3QUBA 2YN4A 1U2TA 3B9BA 5AW1A 1CQZA 2YBDA 3WK6A 3QUTA 2QLTA 2I54A 5AW0A 3ET5A 1PW5A 2GFHA 3NIWA 3DAOA 4JDPA 3I28A 4BKMA 2QYHA 1Z5GA 5AVTA 3OCYA 2B8JA 5AKIA 1YDFA 3ZTWA 1QYIA 4L6CA 5FP0A 1TA0A 3WK9A 3NASA 4ZEWA 3WKDA 3I6BA 4Y2VA 4EX7A 4GXTA 5AVZA 5AM5A 3MPOA 3E8MA 1WR8A 4AP9A 4YCNA 4XOUA 1WPGA 5AW4A 2P69A 1J8DA 2FPWA 4AS3A 3FZQA 2WHEA 1RMYA 4BNDA 2JAOA 4EENA 3B9RA 1O03A 3ZVLA 1ZD4A 1QQ7A 2VKQA 4DFDA 3NUQA 4Y2JA 1T5SA 5AW3A 2EATA 4JB3A 5AKJA 4L6AA 2I6XA 1T5TA 2BDUA 3D6JA 5ALLA 1IWOA 4YGYA 1TJ5A 4QQFA 2BY4A 1RRCA 4OD0A 3FVVA 1L8OA 2WF6A 1EK1A 3NALA 5AKLA 4YH1A 2OBBA 3OCUA 3ZWDA 2PQ0A 2C88A 5ALYA 3CZ4A 5A3SA 2JAUA 4E88A 5A3RA 2FPSA 4IFTA 4C4TA 4B6JA 3OCXA 5JJBA 2PR7A 2JGAA 3L8FA 2P11A 4HGNA 3OTQA 3BWVA 3K1ZA 3QU9A 1WZCA 3GYGA 4IG4A 4PNHA 3W5DA 1U2SA 2I33A 3KZXA 5AKHA 3M1YA 1X42A 4UARA 3KBBA
chains in the Genus database with same CATH superfamily
4Y2QA 2CKMA 1G6KA 1ARZA 3NVMB 3QI7A 1R5NA 2JLWA 1G5QA 1ZOOA 3R5FA 4QVKA 1AMUA 1ZQTA 2GF9A 3AYXB 4DUGD 1VMAA 3P32A 4UJ3A 3GJSA 5EWLB 3IUEA 4YXJA 4NE9A 5I7WA 1BCRA 4LOIA 5HKBA 2P65A 4PY2A 1E9RA 3EZ6A 4G86A 1WDWB 1KBQA 5IASA 4O02B 1MJGM 2VK2A 4TTSA 4NL9A 3O7MA 3EGXB 5CFPA 1PV4A 4BKPA 1N8KA 3IESA 2PIDA 4H7JA 4O2AB 5ALGA 2HCFA 3MUFA 3L8EA 2EVWX 1M1NA 1RQPA 4IL5A 1NX6A 1RYBA 3SDBA 4WTOA 4RFSA 1KMCA 4D45A 3BUSA 1KERA 5CFOA 4IBOA 3WOVA 3HSKA 1O77A 4LHSA 2BCVA 1DU4A 4Q9AA 4TKVB 1JNXX 1L5HA 2BCJQ 2NUTB 4CCYA 1UDWA 1UH5A 1FUUA 2CJFA 1COWA 4NZ9A 4YT4A 1EBFA 2DT8A 4CRWB 3C29A 3O9ZA 5EZ5A 1NWCA 4ZV9A 5MDHA 1X9MA 3JQBA 4TRMA 1AVTA 1HGXA 3BRQA 4JGBA 4D8WA 1SXJE 4XWKA 3ZDYB 2EFEB 4FNOA 3A2NA 4XD2A 4AO6A 1FA9A 5B58C 2JKVA 4H6WA 5KQLA 1D0VA 2DQZA 4B3BA 3LT0A 3ED5A 2NRTA 5ALPA 3H2ZA 3K9LA 4BMXA 3L0SA 4N0MA 3UHJA 4EUHA 2BFFB 2WTNA 3EXHC 3QY9A 2Q1UA 3U40A 2VEDA 3EPRA 4NBKA 4UBLA 4EMBA 5ALFA 1S0OA 2VNKA 3PO4A 1L7OA 3AL3A 4QSMA 1C9DB 1T1EA 8ICUA 3VQTA 4BOYA 4IHAA 3EZXA 2I7XA 4BFWA 3TM5A 5EPEA 5KFLA 2EHJA 4X9XA 4MGHA 1E4OA 4TTTS 1TFRA 2W37A 4KO2S 3W6NA 1Z1VA 1BNPA 2JLRA 3Q1LA 1A9SA 1SHJA 2E21A 4WFJA 3FJ1A 3L93A 5EY5B 1CUZA 4BMVA 4F9TA 2AJ8A 4IIJF 3U1BA 2UUPA 2ZPTX 3C5WP 4R69A 5DHSA 1EX1A 5E8RA 2R6DA 3I61A 1LSUA 3UV7A 4HNTA 5FUQA 1P1KA 1X9SA 3H40A 4QDXA 3FXAA 2IL1A 1BDJA 2BFWA 3U19A 3PCXA 4FX5A 3ZEIA 3FAHA 1PNTA 2R44A 5D49A 1DS6A 1N3BA 2YOGA 4KWEA 5B55A 1OU0A 2W4IA 2PR2A 2YIDA 4MKZA 4R8LA 4YV1A 1Z4NA 3A9VA 2M1ZA 4DILA 1RCFA 2B0JA 4BGVA 4KX5A 2ZIZA 4JZYA 3O8QA 4Z3DA 2JEGA 3MERA 1ZCAA 3ITEA 3HN7A 4LNAA 2ACEA 2WF8A 2B98A 3HLTA 1ZXLA 4JVNA 1SJ9A 4NYIR 1DAOA 1OF1A 1K4YA 4OKNA 1J25A 1MHPA 3D3WA 2JFFA 1RLIA 3JWGA 4U2FA 2VP5A 1NF2A 2IXGA 2RHRA 3PTZA 4YP9A 5BQOA 3L1VA 3RAPR 4FONA 1TMYA 1BEEA 1PR6A 3DNPA 3NUGA 4MQ5A 2H07A 3Q9LA 3RHSA 5BYKA 3CUYA 3VAAA 2F8SA 1AK1A 1XO0A 1WVIA 5J0SA 1SBYA 3NHYA 4GX5A 4QOIA 5DGIA 2OBFA 4RDIA 3TLAA 2R8ZA 1XVAA 2EQ5A 4B3TB 2BDEA 4FFPA 2O6HA 3RJIA 5F2OA 2VDRB 1D9ZA 1XPRA 1S10A 5LBUA 4PO3X 1QR2A 2NW6A 3ISVA 4DQRA 1YA4A 3NYWA 5DN6A 3IX7A 1RYZA 1SKAA 3R8XA 3WBKA 1KJNA 2C99A 3QVUA 4BZZA 5G1OA 1G6HA 3ELUA 4RFSB 4F4JA 4LC9A 2QB1A 3CINA 3U62A 5CCXA 3GBSA 4AZ3B 4CKBA 4A8EA 3I5AA 4QZVA 2WYWA 1EP2B 2Q49A 5IJWA 4LE1A 1A95A 4MUEA 2V97A 1RWNA 1V3UA 2AEEA 4ZQFA 2R1VA 4PQGA 1PGNA 4I6EA 1MJNA 3HT3A 1CHNA 5IMSA 1VCHA 1VFPA 1N7IA 3G49A 3VOAA 3MWKA 2FXVA 1M2VB 2AOUB 1GWNA 3G1UA 1W1IA 1D8LA 1MX5A 1DAHA 1JQEA 4QC2A 2FV8A 5LM3A 3FB1A 5KG5A 4BGIA 1RHMA 2X6QA 3NHZA 4U5QA 2YWFA 1WV0A 1ZUNA 5A05A 2VSOA 2Z3WA 3LBIA 1HIWA 4YRJA 5FAKA 2EGUA 3GZ4A 2FEXA 1VI5A 2OK8A 1FX0A 1O6GA 2BHNA 1G0NA 1P2SA 3P9RA 4LF9B 4P2HA 3CW8X 3UPUA 3C87A 1AKEA 3CEAA 4RMJA 1IFXA 1G8HA 1HQCA 1L7QA 1RXSA 3CH6A 4UHDA 4P6VF 4BWYA 3C7AA 1JH9A 1CUBA 1L2TA 5D4BA 3H2YA 4NBVA 5CVEA 1P0PA 3ND9A 3R6TA 4JP2A 1KNQA 3WNCA 4DJFC 1YR6A 1E59A 2LBOA 1TK2A 2CNNA 2OKGA 3H97A 3JR3A 4Q39A 4BB5A 4F4UA 3QOFA 1HLDA 1SWWA 1XIVA 3OHSX 3V6MA 3FI9A 3N2YA 3UW1A 4MVJA 4Y6PA 4C88A 1YZ3A 2I76A 3LDGA 2O2IA 3N2KA 3R1IA 3H0KA 2HK7A 1XALA 3IOEA 2AOUA 2I03A 3GCWA 1SCQA 4E1VA 1K3FA 3BZUA 4QUHA 1FLAA 2G5HB 2G07A 4LYGA 2JS7A 1WCXA 5AI6A 3ROXA 3A9SA 1P45A 3OKCA 4OU4A 1MB4A 3W1EA 3K0EA 3KSZO 1Z73A 2ZSJA 1Z8DA 1HUZA 4KN7A 2RHBA 3EXEB 3DT9A 821PA 1AMOA 3DXFA 1TVEA 3KXDA 3IQGX 3L8GA 2EKDA 4F85A 4OLBA 3HP7A 3VR4A 5EOZA 3I76A 5JS6A 2QBYA 2OQVA 3ASZA 4KCGA 4ZZ3A 3MT9A 3OA2A 3OJUA 3D8SA 3TZEA 1GU0A 2EF1A 2HB6A 2YOHA 3B3JA 1P6QA 1OGJA 1T8EA 1VBMA 1WF6A 2HQ1A 3AY6A 3AZQA 2YZMA 2XB2A 3LTNC 2OXRA 4MR9B 4UBKA 5KG7A 3PW2A 1ZK2A 3AFMA 2ZULA 3G0CA 5FEUA 4W4TA 1BS1A 3B52X 1IK4A 3KUDA 2DF8A 3H18A 1ZQOA 2JAHA 2GVNA 3LYLA 2ZWAA 3F2CA 3VPBA 1CRLA 4XRHA 1SULA 4LSMA 3SJBA 5F7XA 3M6AA 5K03A 1N9GB 3HHPA 2VQ3A 3GGGA 4YRDA 2ZGVA 1Q7TA 3D3WB 1L5SA 3DBLB 4QRIA 1E98A 1SA0A 3BEDA 4N01A 4OQZA 4AN0A 5ALNA 1F2TB 3TI9A 4WBNA 3K0BA 3LL4A 2FQQA 1YVDA 3EULA 3OZXA 2DYKA 4P3PA 2DETA 2CXUA 3F7TA 4DR4B 4MMYB 4ZYUA 4TV8A 1B0AA 1NRIA 3ZW9A 2R8IA 2REQB 1L3CA 3BJEA 4Z6DA 2AZTA 3OJCA 2XQVA 2MCFA 4FT2A 3VGPA 1H38A 5HTOA 2O2HA 3QKWA 4AQ7A 1EFPA 1L1EA 5J2JA 5KFVA 1P2BA 5J2EA 4G5FA 4KLAA 2EIXA 4M7PA 5EP4A 3V4ZA 2EF0A 4G67A 3WTCA 3EXHA 2VPXA 3FUWA 2RHOA 4C4OA 4CL3A 5C5IA 3OI7A 4FYKA 3BDPA 5ALZA 7ICMA 1P7WA 2G80A 1SV0A 2HT6A 3BOSA 1VYHA 1DFGA 3CGWA 5F3RA 5G0WA 4DGQA 2X8LA 2D2EA 5K45A 5J2FA 1I4OA 1WSBA 1B22A 2NV6A 4E33A 5KYWB 4MTLA 2X0DA 4L3WA 5J8YC 1JDPA 3EWAA 3FLAA 4UVGA 1NRXA 3HKBA 2QARA 2YVLA 2HRBA 3ZE0B 4OU5A 1KEVA 4LPKA 4FDAA 4KXYA 3UUEA 2V4MA 3M1LA 3OEHA 3SAJA 1K5GA 1Y8AA 1XCPA 1ZMXA 3V4LA 3U7HB 1SCUB 1FBNA 1FVHA 3H2KA 2FE9A 2BEJA 1MQ9A 3E22B 1TA4A 1G2OA 3PNVA 3WLFA 2GK7A 2DHQA 1R8XA 3E03A 3GRZA 2HTEA 4P08A 5SV2A 1CC1S 2F6RA 4FSXA 1P7YA 1NOJA 1P0MA 2HOFA 1EUYA 1X9XA 2WW8A 2CVFA 1A3CA 1IM8A 1T8RA 3EHDA 3T9AA 3I01M 2Q45A 3OZIA 2A0UA 4J7CA 4LWZA 4ND5A 1KDVA 3VDRA 3ZJ5A 5A4DA 5LP1A 4XGNA 4O59O 1ADJA 1RXWA 1I4WA 3B5IA 2Q0SA 3HNPA 2RLTA 1RHUA 3LCMA 4GH5A 2DU8A 4KVFA 4EL5A 4BFXA 3HADA 1JDZA 5IW8A 3LWDA 3WJ7A 3ZNOA 4JXZA 3IQIX 4YN3A 3USES 2UYHA 5DWVA 5J4HA 3ETRA 2AGQA 3LSYA 6NULA 5KFZA 4IHQA 4XYMA 2FLLA 1COZA 4PHEA 3NEJA 5KYXA 3SBDA 2XX3A 5FDFA 1ZHFA 3LHKA 3PX3A 1BU8A 1RFGE 2OFXA 3B3QA 3QW2A 1NW8A 1OLXB 4LI0A 3TEMA 4FXOA 2AEFA 3UT0A 5K0GA 1V8DA 4P98A 5K6AA 4L8YA 3TOCA 1SQGA 1BPYA 4RL6A 4EZIA 4E6EA 1A5SB 1G8MA 5T8KA 3R3SA 4ECYA 1EG2A 3GHYA 4IXWA 4JQCA 4YB8A 1JMVA 3ENQA 5IJ0B 3MHTA 1Y1LA 3ZU4A 1D6JA 8ICXA 1N7HA 1Y37A 1OFGA 4YPFA 5ALSA 3LC2O 3MA0A 8ICVA 2Q5JA 4XGRA 2F1KA 3NORA 3DL7A 2HDNB 4GZMA 2CSXA 3VH4A 4DL2A 2I4LA 2W2MA 2HA0A 3AR2A 2HSZA 3BMNA 5C81A 4DN6A 2YN2A 4D9IA 1LK7A 3OU7A 5I9LA 5DW0A 5KFGA 2C0PA 3TZHA 1IAVA 2ZRNA 1GN9A 2NXWA 4NNOA 3TSWA 2DFVA 4HYKA 1GLVA 3RGGA 5JISA 4AKHA 1O94D 4ARIA 3TANA 1J0BA 2CXHA 4RD0A 2AR0A 4H6XA 2WAMA 1P1BA 1UBJS 1WY7A 3EJWA 2H11A 3PQEA 4GUDA 4BZPA 4OA8A 4AKTA 4W9MC 3WDMA 1QCYA 5FYDA 2FZKA 1OB5A 5K05A 2BBTA 2WF7A 2XADA 1OZFA 5MFZA 4ZWNA 1ESCA 2BJVA 2EGHA 4MWBA 3CRMA 3NHUA 3DTYA 4L6IA 2V6GA 4GXKA 1ECPA 1R5BA 4Q4HA 1QKIA 2VHUA 3U7RA 2AZMA 2IDJA 3CKLA 4PRYA 2J6HA 2E2WA 4FR2A 4G25A 2XB6A 3E84A 4M21A 1YKFA 1D8BA 4TV8F 2CMGA 1XTVA 3I2GA 4FWBA 4YLEA 3T3PB 4HS4A 4EH1A 4JYAB 4KLNA 1D8YA 3EEIA 4EPYA 4X1OA 5BSVA 3TAUA 3W2GA 4QTTB 4CI9A 5F23A 4YMOA 1E6WA 1H5UA 2W7TA 5FPQA 1LS1A 3LC0A 3GIDA 2W8KA 3G8DA 1TQDA 5KT5A 1Z26A 1FVFA 1P1IA 3FVTA 2PFPA 3GEHA 4FP9A 4MULA 4KEAA 4P4TA 1ES9A 1NMSA 4LISA 3VZRA 3C16C 4NLKA 1M6HA 2DQ4A 3TBHA 2WB1F 4DQIA 2RGEA 2L2QA 4BQQA 1R2QA 4US8A 2PPVA 1KJWA 4G8DA 3TQFA 4CW7A 4CIBA 5EJ6A 1KEUA 1YBHA 3D31A 5EHIA 3E82A 1HK7A 4XOIA 1U6JA 4TVBA 4KQCA 3FUVA 4KIWA 1KO1A 4TS9A 4M0MA 2DVMA 2GFHA 5DTRA 3WS7A 4DLGA 1ESZA 2NTEA 1PJBA 3BMQB 4AS1A 1IMOA 1PTJC 4QXQA 3AVVA 4U02A 1WJGA 3RB3A 3QW4B 2W0SA 4R40A 4WLNA 3V2GA 1HR0B 1JZTA 2H06A 2QYHA 4NOKA 1ZQSA 3ZV3A 4B1FA 4TLAA 2A8YA 3H65A 3RABA 4F1JA 3BGWA 2V4ZA 4JFAA 4MCIA 1Z82A 3ZNQA 4JI2B 3HU1A 4D9FA 3OKFA 3NC0C 3MUNA 1IY0A 1CUXA 2EP7A 4ZEWA 3ZV4A 4A5SA 3OHBA 4N47A 4COOA 2IHNA 1FOEB 1FP6A 3RS7A 5A6SA 5ESDA 1RXYA 1LKYA 4G1BA 3NCTA 4G65A 4R6WA 5JOQA 1NXOA 1U3FA 3AW9A 3QY0A 5IAEA 2ASJA 3IVXA 1THMA 3DMYA 5EAIA 1BWRA 3E27A 5DYNA 4U7WA 1XEWX 1JIVA 4KIUA 3QBTA 2BFOA 2HA6A 5FTNA 1B3BA 4CKXA 1B0ZA 1GSHA 2HCTA 2E4XA 1V8FA 3R2JA 4HEHA 4P2GA 3R9XA 4PLWA 5ESXA 2GZMA 1CSEE 4YMWA 1RWPA 5HR7A 4O2BB 4TSFA 4GO1A 4B85A 2PL3A 1FQKA 2HSJA 3R5TA 4JKOA 5IK2A 3R77A 4UE2A 3RODA 1O4VA 4LAFA 1HBJA 1R15A 4HUTA 5JBIA 4DFDA 5DLPA 9ICNA 1FLNA 2PWPA 3R0ZA 1NHGA 3TRJA 1UK8A 2WA2A 1TK9A 5AW3A 2EATA 1CUGA 2E6KA 1WB6A 2Y1DA 3Q98A 5HFJA 4TWAA 3WWEA 2C9BA 4N6GA 5PGMA 3CLTD 1X15A 2ZAIA 4ZA2A 3ZVRA 9GPBA 3AH8A 3BX1A 1NMZA 5IH7A 1G55A 1OPRA 2C77A 2ID4A 2VBIA 3O8OB 1TPZA 2C7GA 2PX6A 3IUQA 4ZQBA 5I8WA 3CEHA 4J0EA 5EJ5A 1BMFD 4Q1AA 2X8JB 2CWDA 1ZQYA 4Y7DA 5FTJA 2QARB 2ID9A 1XEFA 3BAFA 3AU2A 4M6WA 3DVAA 3BXGA 2C0CA 4KMRA 2OTCA 3VR2D 2C7PA 1T8TA 4G0NA 4RHTA 1SC9A 1HURA 2IU3A 4LHXA 3IP8A 5HF6A 3NVVA 2G4VA 4MVCA 5SICE 4FOTA 3ZY6A 3PQ2A 1N5XA 1EVIA 1SXJD 4IDQA 5A6SB 1L7AA 4PBSA 1NWHA 7ICGA 5ALYA 3W79A 5HZMA 4XM1A 1W5AA 4CL2A 1MRZA 2BYTA 1JFFA 4WNIA 4QT4A 4C4TA 3U17A 1DAFA 3N39C 3UK2A 1UODA 2O57A 1SXJB 4HEJA 1ACJA 3HFRA 3F3SA 3N58A 1KQNA 3N2IA 4NEQA 3HSYA 1U8ZA 4H15A 1AS0A 3CFYA 1PTKA 2FR0A 2P11A 1MRSA 3TL6A 3BWVA 5EQFA 2X0RA 3DMHA 4XB2A 4CR6A 5A9TA 1HDIA 1TC1A 4J0JA 4FILA 1R0KA 2JBAA 1QBGA 1UDCA 3L92A 1VRWA 2ZTHA 1ADBA 3ADOA 2PT9A 2E7ZA 4G1UC 1XU9A 3E1GA 3IP4B 2IK8A 2G1PA 1TD9A 1DOQA 1OX4A 3MCWA 2Q3EA 4EHJA 5CG2A 4AD8A 1HLGA 1RWXA 4CQMB 1H4SA 5DHFA 4QU0A 3FTEA 1WCIA 1OWNA 3GUZA 8ICIA 1OOEA 3EZYA 3SFTA 4F8JA 5JBNA 1G2IA 4PZNA 2RGCA 1AZTA 3KQTA 5COBA 3RRMA 4E13A 5BMVF 1QCZA 5HZGA 5IZ4A 1GZUA 1TW3A 3DTTA 3ISBA 1YUBA 2PNFA 4JP5A 4D43A 3MS2A 3DA8A 1W1WA 2IEBA 4ZOLF 3WNBA 3T5PA 1LCIA 1BA3A 3TVTA 1LSJA 4URUR 4GYJA 1ZFNA 3E4CA 4FFSA 3K9CA 4ZDJA 2WV9A 5BOLA 3ZHZA 5KFYA 2JVIA 5A04A 1U1CA 3P0HA 1MB2A 3IUYA 4C7ZA 3OT1B 2WIBA 3JWJA 3HLKA 5JSHA 1O9HA 3FR7A 4G8JA 4MVJE 2Z2JA 5HS6A 2VUHB 3CX8A 5KOJA 1AGYA 1HFEL 1UK7A 1MGPA 5B1SA 2V8OA 1EDBA 2A1TS 2E8MA 1N2EA 4QDJA 1LPBB 4W7IA 5A7HA 1KJ9A 3ZHOA 2B7LA 3JQGA 4K46A 1J5EB 1OFIA 1EK6A 4MUNA 4J2HA 5J4YA 1KQFA 5JNTA 4CLDA 1PEDA 2EYQA 2A9PA 5J0RA 2NPOA 3HL0A 4KSBA 2VI5A 3GCXA 1TCCA 1ETUA 2BHRA 4PSAA 1RZRA 4CM7A 3BQNB 5C0OE 1FU8A 1XU7A 1CDZA 1Y1PA 3KR0A 4TSFD 1XZGA 4UAJA 4XE5A 1XZKA 5EXTA 3SHWA 4FNMA 3TM4A 3TMKA 5BW8A 4EI9A 1DXYA 2H5JA 3LKZA 4AVYA 1W76A 2Q1WA 5BOMA 3KPWA 1V6AA 3N7TA 4JV0A 2YASA 3PQCA 4FGUA 4KBFA 4QFMA 1GGEA 2Q21A 3MTGA 4QU5A 5F2EA 3JD0A 1A0OA 3OE1A 3U7QB 4ZVQA 2H4JA 3D3JA 2GGSA 4ZXPA 3RBEA 2O3JA 2WWFA 2ZFUA 2PFQA 3PFWO 4GMGA 4LY9A 3ZH2A 2QJWA 2B4RO 4JY7A 3BD6A 1MOZA 2BC9A 2AVNA 3D5QA 1ZOIA 3KX2A 1I36A 3P97A 4I5FA 1BMFA 4EECA 3W5BA 3PU6A 3WLLA 2GHTA 4PFJA 1L4LA 2IY9A 3GPIA 3PGXA 4OEHA 4KYUA 1A9YA 3OY2A 4OK6A 1R6UA 3S2YA 1LF0A 2OCLA 2FOLA 1TJ3A 2I3ZA 4F3RA 5KJEA 2LNDA 5FUYA 4EKDA 1ZC3A 1AGXA 1JG7A 1OLUB 2OCPA 3BN3A 4OB6A 5IG2A 3KE8A 4AKGA 1J0AA 1TTTA 4TLLB 4E2XA 1O08A 1SXJA 1L7MA 1AQ6A 2IYLD 3BTUA 3NTUA 3G0DA 7MHTA 2O8EB 4O3SA 3KAJA 1P72A 4F72A 3IOMA 3IR6A 5KVVA 1E6CA 4J0FA 1E7MA 2Z1DA 4RJ2A 2I7DA 5K0LA 2WJGA 3C39A 4DV0B 2CJXA 1MAVA 1EP1B 2HK8A 2PMDA 1EVKA 1JEAA 2AX4A 4L9AA 3QGMA 4QJIA 4YRRA 1NOIA 4P7GA 2LDXA 2GPJA 4CKYA 1DSSG 4L74A 2O48X 2W2OA 3AGPA 4R83A 4LJ7A 2YYZA 3GIKA 1G2PA 1GAWA 1P19A 1PGPA 3G5LA 1PS8A 3ZUPA 4LRTB 2IYUA 1TFUA 2NPIA 1FTSA 3N6RA 1U2QA 1QVAA 2GLXA 2PLNA 4GI7A 4BO1A 2HFJA 2YYYA 4M76B 4RJJA 4X1IA 4XUEA 1T5BA 3LAWA 5ALHA 2FPMA 4P7KA 1VLJA 3SZRA 2HHSA 2PX2A 3UYKA 1Z34A 4FR0A 3PT5A 1SCAA 2GCEA 1IOLA 1QK5A 3MWLA 5FO1A 2R1VB 1NXTA 3F6YA 4YONB 3P9ZA 2DR0A 3VTZA 2G1AA 4JLNA 1UPTA 2H1OA 4HRAA 2I2CA 3GLKA 4IF4A 3B2NA 5DGXA 3PR4A 4REOA 1QFXA 2RSLA 2NO9A 4BDTA 4BU0A 3FSRA 4PYLA 1ULAA 2EFHB 2EDCA 3A2LA 1N2CE 3H5LA 4M83A 5EPUA 3W5HA 4F5RA 4XD7D 3U7FB 1N36B 3EZNA 1SD2A 1NY5A 4CKBB 4DLUA 1DB3A 1QZTA 1RAAA 3E3OA 3JASA 4KQ9A 3U9TA 4JIMA 4CKEB 4Z0HO 1S0MA 1V5IA 2QR3A 1JS1X 3IXQA 2SNIE 5CPBA 2WYOA 5BN5B 5BXYA 2X86A 2IOQA 1WXWA 2QRLA 3FE2A 4OHBA 5JR3A 4M7WA 2B4TO 2XRMA 1PWXA 2FW6A 2HSGA 4MV7A 5C1IA 1UWVA 4KYVA 3AVYA 3L77A 3H4DA 3EXHB 4B87A 4ESOA 1T4CB 4BFCA 1SVSA 3LFTA 4LWPA 3IEMA 1NMEA 1LSSA 2EBUA 5EQDA 4A4DA 1P77A 2XYGA 3FPHA 1XTQA 1L4UA 1ADFA 2C2ZA 4HN4B 1RLOA 2O9JA 2R66A 2ODTX 4WNYA 5GVSA 2V0NA 4WXYB 2NSYA 3O2QB 4BB0A 2ZJ5A 1U0TA 2OPHA 1GZ6A 1YZGA 3L9XA 4BRWA 1DRJA 5LNK6 1C4WA 3WGJA 4IEIA 1HKHA 3Q3IA 3PJRA 3SYZA 1XC9A 4KFSA 1R4NA 4PPGA 4CU5A 5IT5A 1ZQ1A 1F7UA 3QX8A 2OB1A 2V6BA 1CE8B 3UXYA 1Z3EB 2C28A 5I7SA 4G09A 1X7ZB 1FJHA 4YCXA 3II6X 4IDFA 1Q3UA 4Z9FA 1T1IA 3RCBA 2NVBA 1XVVA 1IQUA 1SXHA 4J43A 3UXEA 1UMDB 2RGDA 2PMFA 1IBMB 4EGSA 4NXZA 1HC7A 1GL9B 3LUDA 4OFZA 3R74A 1FPQA 2CNKA 1GA6A 2VJMB 3E15A 5EJ7A 1BJTA 4B9LA 3OOEA 2NX2A 3IT1A 3RJZA 3TIVA 1YR8A 3G6WA 4KR9A 2IYFA 4B9EA 4CCYB 4TKVA 1EEXB 1U0JA 1R0ZA 2QBYB 4EA6A 5G2OA 4DJ5X 4DDMA 5KIAA 3PENA 3UQYS 3ZXUB 1KH1A 1A88A 2ZQ5A 4M46A 1PFGA 4G3XA 4OLJA 4X8MA 3CVVA 5HFAA 2ZTCA 3KHGA 1FUYB 5LNK1 3IUNA 1M2VA 3QEAZ 2IY7A 1JYSA 2BGKA 1ZAKA 3ZCVA 1Z15A 3MJEA 3QNMA 1O87A 1U9IA 1N2SA 5CP2A 4FMDB 1QYVA 2KN7A 2O7RA 3NS1A 3GJ3A 3PHCA 3KLNA 3VYUB 3BS5A 2JLBA 3R0JA 1MKYA 2WWTA 1EFHA 1J20A 3RJJA 2QUZA 3AB8A 3GBPA 4TL9A 1UZLA 2C57A 2C95A 2V7UA 4ZZ2A 4MP3A 4NHEA 4BFZA 4DR3B 1KSFX 3NDRA 1YUMA 1Z2NX 4NCIA 3S2SA 3QVKA 4GPTA 2X7HA 3M6UA 3AR7A 1MVOA 4D2IA 3UEOA 4RYLA 2Y9TA 5FLEX 5IZCA 4BNTA 1M75A 4IDDA 4EHFA 5HR5A 3ZIAD 2WMYA 5AT1A 1KARA 2D7CA 1J0XO 1AXGA 4JEIA 2M6SA 2ZRGA 1T9AA 3EVFA 3HMQA 4AUEA 1A82A 1B0PA 2XMCA 3DV9A 1Z28A 7ICLA 1OI7A 3AHGA 4HWKA 5JYDA 2PZMA 3DNMA 5DGBA 1XRRA 5CR9A 3BCRA 1UPCA 2MWMA 3RB0A 2WSSD 3B85A 4BQIA 2O54A 2JFXA 5KNCD 5EJFA 3PZBA 2KMDA 5K3BA 5E0KB 3N2GB 4G4GA 3ZWKA 4F4KA 4W5NA 4RBNA 1TI7A 4ZCIA 4U9HS 4KWHA 2O0LA 4K4HA 1C80A 2QX4A 3GDHA 3KZNA 4RQAA 4WXPA 4Z4QA 1GGVA 4QGGA 1SD1A 3MTBA 4RNCA 2A67A 5BR8B 5T64A 3EY4A 1FEZA 5LN1A 2R6GA 4M86A 4X1KA 1FYXA 4E2ZA 4JUFA 3T54A 3QEJA 4Z6EA 4PN3A 1LRKA 4TGLA 1ICEA 4Q7JB 1M8PA 2QL7A 1V8OA 3CX7A 3FFXA 1LKZA 4LV6A 5BR4A 1XB2A 2VDUE 3EC1A 3SKYA 4MUMA 5J47A 1M2HA 5TV2A 1HDGO 2W54A 3WL8A 4FEEA 2YZ2A 2C4TA 2PFKA 4P54A 3JPSA 1K7EB 3CGGA 3IEKA 4R2LA 4OLAA 1MJFA 4YRLA 1A2OA 3AWDA 4K5QA 1CS4C 1KVSA 2XZPA 3NVDA 3VO2A 2L19A 4F8EA 4MLCA 1U0OC 3L8ZA 1L5LA 5JG7A 1MR3F 4QLBA 1T0BA 1E9SA 3M6IA 1DRVA 4DXDA 1CUEA 5A62A 3E53A 4WJZA 5KYUA 1O95C 1DMSA 3SLRA 2XF8A 3QKIA 1O96A 4X6UA 4OP2A 5FUXA 2G36A 4NV0A 1U49A 1LBSA 4RCVA 1A8PA 2ZYTX 1XO1A 3QX7A 1HZZC 1SCKA 3DV0A 3FZQA 1URJA 3K6JA 3CZ9A 2OB2A 1P74A 3QG5A 3LBFA 4J7AA 4DKXA 4RTPA 3ZLUA 1K66A 2PLRA 1S9HA 1CUSA 3I42A 3CVJA 1P7DA 3KHUA 1AKUA 2C9MA 1UBMS 1IJEA 3BKWA 2H0RA 3KOOA 1E77A 1M2EA 4JLWA 4KTVE 4R5MA 5L3SA 3WGKA 5DI3B 2BQRA 3OQIA 3QUAA 1T4BA 5AKGA 1SKYE 2VXOA 5BR1A 1N2BA 3D8TA 2WV7A 3QIAA 4B6SA 4IVPA 5HHHA 3KVOA 4X20B 3X2FA 4UMEA 3CVXA 3EFBA 3QTTA 4PLPA 1H4VB 4FN4A 5FADA 3KYBA 5CLIA 2HOQA 1UOOA 2PMWB 3A2MA 4TLMB 3NT4A 3RARA 1P39A 2O8EA 1JEDA 4OK5A 2KK0A 4YROA 4HWOA 1L4BA 1Y9AA 3UMBA 3VR6D 1C30B 4QUIA 1ZJZA 4ZO9A 3WWYA 3LY5A 2D1FA 3PG5A 5JW6A 4IDGA 2Q5EA 3C3PA 1PS0A 5CURA 3ESYA 3KYDA 4F4YA 4LI3X 1KFCB 3HZRA 2DPLA 3VDMA 2AZ4A 1Z6TA 4I1PA 1VJDA 1RP1A 2IXTA 5HIMA 1Q17A 3VSCA 4DT1A 3GAFA 2GKGA 1DKOA 4EJ2A 5FV7A 2K4PA 2GILA 1AB5A 4FW8A 2A4MA 3CRVA 5J0QA 3JW8A 1PJ2A 1QTRA 4JJFA 1E5DA 3KAQA 1JG2A 2BKVA 4RAOA 3FCSB 4U7FA 4YLGA 5JDCA 2Y9UA 3R3HA 4Z8XA 1L5OA 2WINI 3W0LB 1E4EB 1GRRA 1CLEA 2PFGA 4NJEB 3WSWA 3CLVA 3W6PA 1QGED 4LMBA 2IZ7A 1UC8A 3IKTA 2FFRA 3NTVA 4FE3A 2B1IA 1KRPA 3FAZA 1EUCA 3CT4A 2BQ3A 1RBMA 3BIOA 3HJUA 4IYRA 4S24A 1FUIA 2WJJA 4FBGA 2WFLB 4UQPA 3TECE 9ICBA 4C2UA 1XD9A 2HA4A 3D7MA 3QE3A 4L4UA 4YQWA 3IH5A 3LX5A 4Z7QB 1VB3A 4A0GA 4K9MA 3SNHA 2HRRA 1R6AA 4HKTA 4QWWA 5AW1A 1PJLA 1UFKA 1GTMA 3HB5X 4EVQA 3KTOA 2EZYA 3HB9A 2I54A 1TAMA 4I5DA 2EW1A 2G7ZA 2QP3A 2AQ0A 3WFIA 1C29B 2K7ZA 3NIWA 3VA7A 3GUHA 5AXCA 2DLCX 2Z9CA 4CKZA 1POWA 2TECE 4D02A 3FWZA 4PZPA 1PT9A 1G42A 1OHHD 2DPHA 5AKIA 4JB8A 2PMEA 3MGAA 4WCFA 2QSJA 3TOZA 2M2IA 1IZ7A 4INZA 4OLHA 3LQKA 3ZTWA 2JEOA 5CX1B 3UGTA 4LSWA 3GJ5A 3O91A 1XXHB 1WZUA 2VQDA 3E5NA 1E64A 3ETEA 3ZJYA 3Q8WA 4EEXA 3SQDA 3T7CA 3HEBA 4NYMR 3B6MA 3BK7A 1M2GA 4Y2VA 1N2ZA 3GYBA 3QPCA 4EX7A 2K87A 4J1SA 4B6OA 4CT0A 1MOQA 5KINB 1ZQ1C 3ANLA 5FNVB 3A6DA 1F0MA 3PE6A 2DY0A 1JSXA 4OHRA 5EZ6B 8ICAA 2WJ3A 4XOUA 1EX9A 3K09C 3LIIA 1GKYA 3NLLA 2B37A 2WJVA 1QANA 2W9MA 1J49A 5IILA 2C2BA 4W9NA 3SXUB 5CB6A 5EE3A 1XJ5A 4TWBA 2GJAA 5AOBA 2XA2A 5TQVA 1NTRA 1QHGA 2C2WA 3P0RA 3UJDA 3BWYA 4BC1A 1USWA 1JXAA 1O57A 2ZUBA 5CDYA 2XNKA 3EVAA 2J7PD 4U2EA 5JC8A 1NBME 1L1QA 1PV1A 3G0GA 2H65A 3KYCB 1QSYA 3OJWA 3TTXA 4DMGA 3LCCA 2V0GA 4M53A 2IXFA 3DFUA 1GZDA 4MV9A 3L6OO 4D4JA 5KC9A 3GLIA 3SY8A 1GNSA 4DQLA 2FKNA 4UAZA 4O3RA 3BF7A 3RK0A 3H9UA 1VXOA 4KAAA 5DX1A 1G38A 3AF5A 3OG9A 4CWAA 1ZQHA 2GRAA 2XDQA 2XCSB 2R6AA 2ZDHA 2H29A 4DLPA 2JH9A 4BNVA 5JT1A 5E8JA 5FKJA 1QG0A 3HO1A 3A3PA 1XKXA 1EFRA 1MEJA 2W9CB 4L5AA 4BE4A 2B9EA 1Q0TA 3TQRA 3AEQA 3UMYA 3TAPA 2EZ9A 1RHQA 3TQ1A 1ZNQO 2HMUA 5CJ2A 3AU8A 3B5EA 3DDNA 3I2FA 1ISGA 1QVRA 2BELA 4M8SA 1PX0A 1PJQA 1TT7A 5FLYA 4O5EA 5EWEA 2JAUA 4EYHB 5EJIA 1DJNA 3ELBA 2DP4E 2ET6A 3OCXA 5CB4F 4FZLA 1R8JA 2FAXA 2FW1A 4QWMA 3WLTA 4UDYX 1SCNE 1H4TA 1OYYA 2LR0A 3LT1A 1NKCA 4X3CA 3BFVA 3M5WA 3PK0A 3LW7A 4JX8A 2PWAA 3NC1C 2XCIA 3VZCA 3HA7A 4UARA 1L4GA 4DLVA 4E5YA 2Q0XA 1X8XA 4HLDA 2YMLA 3ZOZA 4BNFA 4QODA 3EUFA 4Q43A 3QP9A 3UBMA 5DN6D 5AK4A 3HCFA 1P4AA 4WACA 4D3DA 2ZTSA 3GARA 2IYPA 3BSFA 4NONA 2OFPA 4G1FA 3VI3B 1QP0A 1SC1A 4G89A 2EDUA 2AI3A 3ZHCA 3AUXA 3PF9A 1F6WA 4FDVA 3NPMA 2AG5A 2NRZA 5AI8A 1QOQB 3PA8A 3KZVA 4TN5A 4ZOLB 5KAPA 5J3JA 3NW9A 1QX3A 3F6CA 5DHQA 2QGNA 1Z88A 3Q3GE 1K8RA 4JYBA 4PGQA 1CY6A 5K8LA 2G09A 1HMYA 4LRSB 3F47A 1N6HA 2FLVA 3L9WA 4BGUA 4LYAA 2ZIGA 2VK1A 4XH9B 4DV2B 4YXMA 1GPBA 4GFDA 5GINE 2PJRA 4ZI7F 1A1SA 1U7TA 1W1UA 2DFDA 4KH0A 1XRJA 2PGIA 1Y6ZA 5AKZA 5EJGA 2XA1A 4B3MB 2WF5A 2IZ5A 5BWMA 2IE0A 3LVVA 1QLHA 4BNJA 4Q19A 2WB4A 3HKCA 3MB5A 4B6EA 3BT7A 4TUQA 1BNOA 2B2XA 2XRYA 3NETA 2VP6A 4H7IA 1XD8A 4H18A 4ARAA 4GVPA 3RR8A 4Y2XA 4I28A 3KFXA 1A1VA 2RC6A 3NBMA 1HPLA 4Y7CA 3F5FA 1X9HA 1XELA 3HR8A 4B2PA 1ZM4A 4QTXA 4EFMA 4PQFA 2BRUA 3UAWA 4D9NA 2QJFA 1SGGA 1QZXA 4DANA 4MMXB 3IFSA 2GK6A 5T8KC 4U0KA 4QEZA 2Q3FA 2VF7A 4MYCA 4ZPXA 5DGCA 1U0EA 4V39A 3MRVA 4PG5A 4RETA 5KYKA 1VLZA 2ABWA 2EC5A 2PXHA 2C5EA 3D3NA 4BTLA 1JN3A 3OURA 2F3UA 5T3YA 2WIFA 4UTXA 1ULUA 2W70A 1JEEA 5HKKA 5KQSA 3PXUA 2E5WA 3KKMA 4LOHA 1Z2AA 4PHTA 3TLGB 4RTLA 1K89A 3PC3A 3NXSA 1JDTA 1SU7A 2QX7A 2YJ5A 3ODGA 4JLVA 1PRYA 4JOCA 1RW4A 4EO9A 3QUQA 4GEGA 3L79A 4X66B 2WAQC 1BW9A 1RQGA 2ZS8A 1G8KA 1M0WA 1AN0A 2WUEA 3F1KA 4JITA 5GOTA 3R7FA 4MMZB 4EYKA 2D62A 3F5AA 1WXQA 5EQJB 5IX8A 1Y1SA 2V96A 2OLEA 3GRRA 1E2MA 4IDEA 5AM4A 5K0SA 5CAEA 2IU4A 3DE0X 3HU3A 1ZL2A 4D44A 1T1GA 5JASA 5T4FA 1ZH2A 3L7NA 3K6KA 4DA0A 3ISTA 4XJVA 1XEXB 3PF8A 5DZSA 5M7EA 3S2ZA 2R8XA 1KOGA 2EARA 2JH1A 4XLLA 2EW8A 4LHVA 4I50A 4QHYA 4E07A 4L7VA 1EE2A 3QYFA 1T3TA 3INGA 1YQ9A 2I34A 1QQBA 4YYEA 3E58A 1FFXB 3BD9A 3BDIA 4LZNA 4CCWA 3LMKA 3RVMA 1VSUA 4LQDA 4Q82A 1FQJA 1W6UA 3D8HA 3EYWA 4KC0A 5KOIA 1K2WA 3W3ZB 1TEVA 2FZEA 4O0MA 3E48A 1FC0A 1TVCA 4GE3A 3E3NA 4V0OA 4C07A 1TVAA 3O94A 3SEFA 3LDFA 1HDYA 1QJ4A 4UMDA 3T7IA 3L1IA 4NIMA 2GM5A 1Z83A 4GR4A 4IGFA 3RYFA 3TW8B 2NIPA 3FPSA 2WPNA 3CZCA 2YHIA 2BGIA 2GNAA 1IBRA 1BWQA 2P9CA 4PSDA 3RAQA 1FNBA 1UJCA 2COUA 4O4HA 3O31A 3I32A 4CEJB 1HEYA 1HO3A 3DPUA 4PTYA 2PH5A 3SI7A 1KDOA 5IBRA 2WDZA 1XZHA 5FYQA 3QPVA 5CM8B 2G7MC 2PXAA 1LX7A 3S8YA 5J0YA 1IB6A 2KFNA 3DFMA 3IAM1 3KQSA 4BWVA 3KJHA 2F55A 5DKWA 3L02A 2J9XB 1KDHA 1KC1A 4RTJA 2H1LA 2XUPA 4ZANA 3TUIC 3N2KB 1FSGA 3S0JA 4EZEA 1IDOA 2WWWA 1U90A 3RF6A 3REQB 1W4AA 3AHDA 5AMXA 4CXMA 5DK6A 2QAGA 1C0KA 4CIVA 4X8OA 1BDIA 3QUCA 3MJTA 2QRVB 2QZPA 4F4ZA 1VGRA 5CBPA 1A5TA 2ZT7A 2IYWA 1WCWA 2W2XA 4K9RA 4OHWA 5G1NA 1BS9A 2J3QA 3IR5A 1NVDA 1ZH8A 3FRHA 3FYUC 1XZDA 3KB6A 3NM6B 4KN5A 4R98A 3A4LA 2QZZA 2W4MA 3BL5A 3Q7PA 5H82A 2AC7A 4LMRA 1F4PA 3WLEA 4P8RA 5CFLA 4JLOA 1K5PA 4O1MA 3FNHA 1GT91 4TTRA 1QLNA 3V5NA 2ES6A 1Z5WA 3LNTA 1QQ5A 2XKAA 3FGOA 2NG1A 4OMCA 3GVHA 4XSHA 4A2CA 4BJ6A 5GTDA 4GIBA 4GG1A 1N2XA 3KL4A 3RBVA 4RY8A 4MHOA 1GLGA 4O1IA 4D5EA 3IVCA 3MVEA 1Y8ZA 1VE9A 1SH7A 2XVXA 4GLJA 2J0VA 4TMYA 5H70A 3PHGA 4FYIA 5DKFA 2HMSA 1EP9A 3WMXA 3AHCA 3EIHA 5HRAA 1G20B 1I7DA 5KX5A 5KAFU 2QTWB 4ARZB 1OH5A 2FFJA 2E82A 1ZK0A 5FI1B 1XMQB 1WLSA 3QPAA 4PZZA 3KZCA 4KLLA 1CB7A 2X1VA 1HDRA 4FLFA 1IBCA 1VZ3A 5FUMA 4AZ0A 1K7XB 5BRAA 1UJNA 1AHHA 1EXNA 2KSOA 3CR3C 4IVQA 3SIXA 3SZUA 2IEYA 3EF1A 3HGTA 3SC6A 4HYTA 3CEPB 4BKUA 2ZXIA 2GWSA 4MPPA 4B7ZA 3HVRA 4N0EA 1M1YE 4UUOA 5DBAA 4EWLA 2A5FA 1GILA 3DZCA 5BN3A 5J4LA 1U4BA 2FOIA 2JJ1A 4FN5A 2ID7A 2WU8A 1GG5A 1LBQA 3NYIA 1A8HA 3CE6A 4M2LA 4N7MA 3SU8A 4LVUA 3UQ2A 3VH2A 4EAAA 3A28A 1NR7A 1V4VA 4MSUA 5IAAA 2QNRA 2PD4A 3V1UA 3JPPA 4B9UA 2BW0A 3Q4GA 4E7OA 4HDSA 4DIOA 4F9FA 4UCFA 1XZCA 1ZQLA 4FDTA 5DNWA 3UWKA 3BTSA 2FSVA 4GQIA 2IU0A 4O8CA 3BMCA 4YI5A 2JD1A 2XE6A 1N2OA 3VKGA 1D2MA 3MK31 1F5NA 4XX0A 2VS1A 3O8QB 2QD5A 3LBNA 4K9KA 1ULSA 2V7VA 2YICA 5C37A 3GZTB 2FN9A 3MLEA 3PNOA 4G0PA 3KKLA 3U3OA 4I4TF 1T4DA 3L7IA 3OD1A 4E70A 1JXLA 2BF4A 1CEEA 1YR1A 2Y92A 1YT3A 2IUFA 4QARA 3A9UA 3SC2A 4GKBA 3DR3A 1MV8A 1JEQA 2O1XA 1WCNA 2Y1XA 1JMKC 3GGSA 3M9LA 1Z4OA 3AOEC 4Q03A 1Q3VA 3VR1A 3ZW7A 2V98A 4E22A 2MT9A 3FHTA 2ZJBA 2WF9A 4TZ6A 4XWTA 4DWWA 4YQFA 5JMTA 1RZRD 2B8NA 3ERCA 1EH5A 2UYGA 2ZRKA 2VYFA 1J6UA 2XVZA 1DOAA 4Q3CA 5DM2A 3EPJA 3L0IB 5BQFA 5F9NA 1BHQ1 3ISCA 3HA5A 3C5GA 3DFZA 3RVBA 3EC2A 1K7CA 3IPYA 4A7PA 2FWBA 2OHXA 3PJGA 1QWOA 4K05A 3VU1A 2Q9UA 4BAZA 1I3MA 3EAGA 4DCMA 1BMTA 1I7PA 2ONCA 3H1TA 1XZIA 2EV9A 3OE4A 3HWTA 1ENOA 3WNDA 5BQXA 3BBLA 1LX6A 5AQEA 4QL3A 5LQCA 4FGWA 2JKYA 2YINC 3PD1A 3NP7A 2NRVA 2XOEA 3OZSA 4NLNA 2CVHA 4JUCA 1PBTA 3ICXA 2AXPA 4KO3S 3RG2A 4DCTA 3SGLA 3DKVA 3FHLA 3ZCPA 4E6PA 3PEYA 4MR8A 4PIVA 2F3RA 3ANNA 5ANRB 5LQDA 1VP9A 4ES6A 2GN8A 4I50B 1ADGA 4CV0A 1FFUA 2PGXA 3EMVA 3GBVA 5FBZA 5JZOA 1XWWA 1CY0A 4EI8A 3KCNA 4DQQA 1NYRA 2ST1A 2W3RA 3BZCA 5JDIA 5JAIA 2GCGA 3B0YA 3RVQA 1WMAA 3B3FA 1ML4A 5IMBA 3GF4A 5AM0A 2C4KA 3NANA 1PW7A 1P73A 1GFSA 1REQA 2BLLA 1MABB 3ASYA 1UJ2A 1E9EA 1W4LA 3GXBA 2VZEA 1RI1A 2PBLA 1Z4LA 1Z07A 2KYRA 3CSDA 1CV2A 1SPBS 3GVCA 3PS9A 2FTKE 1QNFA 1B41A 4M1QA 4X7RA 5D85A 4DB4A 2ZJZA 4DNXA 4ACOA 1YZQA 3MR2A 1YOVB 2FPXA 4LYYA 1AKVA 3BYZA 1GAJA 4M8IA 1LA2A 3DHEA 1GYRA 4B6GA 2ESEA 5CH8A 5GZ6A 2HIHA 5TQ0A 1VL5A 3GD5A 3IO5A 4G0UA 1NJZA 2ZRIA 4OUDA 1I3LA 1Y3AA 1CVRA 3JALB 4IFIA 2Y0PA 2ZZNA 1GQSA 2PKQP 3NO4A 3RVSA 3KHRA 3JSAA 2EXXA 3C23A 4LF8B 1YONA 3JQ8B 3HEMA 4MUYA 2ZJOA 1HQDA 1CUYA 3GEEA 2ZTEA 1VDVA 4YP3A 1Z0IA 4TLBA 3WQBA 4B2YA 3K70C 3ZJTA 3M70A 4R2XA 2DKZA 1YU9A 3LM8A 4PLVA 4Y8VA 4JI0B 3OLYA 4Q47A 3DOEA 4P0PA 4QLOA 5HWSA 4TXMA 4LC0A 4YMSA 2Q9CA 1JHZA 1AN9A 3GP5A 1Z5VA 2GCNA 3LDAA 1J00A 1RYSA 3H1FA 4G1MB 4UD6A 4QGSA 1EAYA 1QTNA 1IN5A 1SU4A 3E81A 1I0LA 4ISCA 4FD3A 3LVWA 3JPWA 3FZGA 2W6ID 4BRZA 1P2DA 3RW9A 3KTQA 2RHDA 2PZAA 3TZCA 2YMQA 1JR6A 1TT5A 9ICKA 3QUSA 1H5QA 3ZD8A 5KTNA 3VR2A 3BSYA 2ZYAA 3I5UA 4X44A 1ZKMA 3TLBA 4TVSA 4RTMA 3TLMA 3W06A 2I3BA 3H1GA 3KT3A 1GEEA 1TKDA 2IHYA 4W7HA 4RANA 2PMZF 3IM1A 4XEHA 3K4PA 4G0ZA 4P4SB 5JCJA 3ANXA 4BBPA 4DPMA 4IJKA 3RD5A 2QY9A 5EXEA 4K81B 3DYVA 1H94A 1JEQB 2B4AA 4MI6A 3SYRA 4OSPA 2BM1A 2WU1A 3ADDA 4TQAA 3AEZA 3H4MA 3FDZA 2PXCA 1CJSA 3N76A 4P38A 4N3GA 3M6XA 2V6IA 1RPLA 2ROQA 3CPSA 3GT3A 1QU2A 1YGYA 1TM2A 3HBAA 3K0CA 3L0BA 1VKOA 4J8PA 4UOZA 3TE7A 1TTHA 1XSLA 2FX2A 1N48A 1YGPA 4JK3A 4J16A 1B15A 1JA9A 2H9YA 2SKCA 3CZQA 3FMFA 3KOXA 4S1NA 5JO9A 4C03A 4RTNA 1YDGA 2P5YA 3MFYA 4HLUA 1DT3A 3RVKA 3WWPA 3DBRB 2QTNA 1E8NA 2B5VA 4GBMA 5DHPA 3ZBQA 4P4OA 4K4IA 1ZUWA 2CUKA 2H5LA 2AXQA 2J8ZA 3JVUA 3K5HA 4II3A 1SBQA 4RENA 3ROZA 2AT1A 3TIIA 5AVXA 5KL1B 5HIAA 4ID3A 5JD3A 3K4QA 2XTMA 3LSTA 5JLAA 4MF2A 1NKTA 2X7XA 3EY9A 3HL4A 3P9CA 4P3YA 1EWKA 2IBTA 2QYTA 2HQBA 2AYYA 3QE2A 1OW5A 4EZBA 1EFLA 3W6UA 3UUWA 4MA5A 1Q0RA 1CQIB 1ZI6A 2O8VA 4HGZA 4IQGA 1TM4E 1KO8A 1A69A 4EKYA 5F3WB 4JGGA 4LNUB 4O2RA 1R9NA 3D5EA 1XZFA 5LJLA 2H2WA 2C96A 1DVRA 2I2XB 2RB4A 2W2NA 2W9BA 2NVUA 2XAAA 4G37A 1LBTA 16PKA 2I1LA 4L0QA 5DEOA 3C28A 5LB4A 3V7NA 4D8TA 1UAYA 2HKIA 3VYVA 4EM6A 4WOJA 4ALKA 4AG5A 3H1PA 4ICIA 3M6FA 1YK0A 2PZ8A 1E1RA 1JSCA 2FP4A 3IAFA 1SKUA 5FNVF 4UB6U 1RWBA 3OE7D 1PSWA 5KCMA 2XUJA 2ECOA 1K1SA 3GPCA 3M4JA 1FMLA 1D8TA 1H1TA 1EFVB 2CXPA 3GN2A 3INNA 3MMSA 1HG0A 1E69A 2Q4BA 3P1JA 4Y18A 1W0KD 5A0TA 1W48A 2AHOA 2HUNA 3ADKA 4IOLA 4M9NA 4R1OA 1F8XA 5JXGA 1W59A 2ZT5A 3JQAB 1P7CA 2KKPA 1BWSA 3G79A 1NK4A 1ZQFA 4E3WA 5E7JA 4D8UA 3VNRA 3M6KA 4GC9A 1P61B 3GZNB 4LMAA 2BZGA 3VNBA 4RLHA 1N63A 1WDTA 2XWBF 3D59A 1O5TA 3GLTA 4AAYA 1M8JA 1QVWA 3UK7A 5AXBA 5KFHA 5CK5A 1C8BA 2H8KA 4BIIA 5C4GB 3C7KA 3V2IA 2AQ4A 2R2GA 3KJZA 4ND8A 1SMKA 3T5TA 3AVXA 4H1HA 3URMA 3OJ0A 3CCFA 7ICEA 3F74A 5F4BA 4A0HA 4X45A 3VKFA 4FYXA 1T34A 2ZDQA 2Z09A 2YV2A 1J5XA 1XF1A 3BILA 5J0XA 4URYR 5HSGA 1NE7A 4YGYA 1WPRA 3HQ4O 4A2PA 4AKIA 1KDZA 5JANA 4R63A 4B5KA 5E9WA 1TJ5A 3CX6A 1CJKC 2R3SA 2TSYB 2HZ7A 4GM1A 5J1TB 4OXQA 3I12A 2A0FA 1N56A 4R8UA 1KTVA 2VH5R 4EOGA 1EK1A 5DCWA 4HVLA 4Y9DA 1V9PA 1VL8A 4WK0B 5L51A 4CV2A 1L5YA 2OBBA 4S3MA 1S5PA 3N7SC 4TL7A 4HN9A 1KPGA 3FX2A 5A3SA 3TUJC 3X1KA 3Q3JB 4E88A 4ZGBA 2CD9A 3AERB 4DLZA 3UCEA 1H8EA 5JJBA 1IZ8A 2PDAA 3ZCTA 4W7SA 4ZCLA 3RHTA 4L28A 3CCCA 4RFVA 2H2IA 5BQPA 4XWWA 1CF4A 3WWZA 2QX6A 2VO1A 3D8UA 3OTQA 2HXGA 3ZHQA 2ZSHA 4EI2A 2XMGA 1C0PA 4G2TA 2I33A 3ON5A 4PFSA 3EXIA 2OD2A 4QGFA 4BKRA 4BVHA 1WCLA 1NJ1A 4NFHA 1H3FA 4ZHSA 2GLEA 5REQB 2AQ8A 2P66A 2PWZA 4KLIA 4IWXA 4S0XA 1LQTA 1L5ZA 3L1UA 5LKAA 3M33A 3GILA 2PKCA 4TKMA 1JTFA 1YVRA 1A5AB 3K1YA 3TSYA 5TXGA 2I2FA 4XUSA 2R62A 1C7IA 3PEUA 1NKVA 4G4SO 1XWIA 4CTOA 1KEEA 2ORIA 2HZBA 2Z98A 2BPCA 4IJWA 2B4YA 1NYLA 2QM0A 2WSBA 3QI2A 4TLCA 1EINA 2X4GA 4MHSA 1XZPA 2XJ4A 3IT2A 2VPWA 1FUKA 1V9LA 4CE6A 2XGGA 3D54D 1M0SA 3ZN2A 1RKVA 1WXIA 1XTKA 1N3LA 4JBXA 3FOAA 2BUCA 2O2ZA 2PKRA 3BORA 3GFOA 4RHXA 3MR6A 1D0IA 2Z5FA 3AHFA 4OJNA 3MLAA 4PG4A 3I04A 1Z35A 4EUNA 4EIWA 1IYZA 5KEIA 4GLLA 1LW7A 4EUFA 3H9BA 3ER6A 4YS6A 2QL6A 4DC0A 4WJLA 2CB9A 5K8CA 1M6EX 2QD1A 2O7QA 4G5OA 5KZMB 2HHCA 2HU8A 3GIIA 4KQ1A 5K2MA 1WULS 3LX6A 5JZBA 2O4CA 3OPNA 3NPAA 1JIUA 2QG6A 1ZA2A 2MSLA 4D56A 3SR0A 2OPBA 4GKJB 3A1WA 3PL5A 4OP3A 2RGUA 2QTZA 2Y1JA 1U4OA 2QTMA 2ZWOA 4UKDA 5IJAA 3SSOA 1I9CA 3CEJA 1XC7A 1CE8A 2OECA 5IC5A 4WZBA 4CN9A 3PHBE 4FYPA 4LFAB 4OIMA 1OI2A 3GELA 3U9SA 4DWOA 1JWLA 1G7SA 2FEWB 4UDNA 1MH9A 1SQ0A 1UBOS 1GCGA 4B09A 3TBKA 4D9EA 1WHTB 5EKSA 3OETA 3ZU3A 4AX8A 1TMOA 1LUAA 3ONFA 1KOLA 5BNTA 3QJYA 2JVKA 4I55A 2ZSKA 1CP3A 5DDYA 2ZIWA 1X2IA 3GRVA 1J39A 1GPYA 3AVOA 3BREA 3NWEA 4ICAA 1FNMA 2IDZA 2YCBA 3ASVA 3L7DA 2WNSA 3TE6A 4AUMA 2XD4A 5A2GA 5B7GA 2B8TA 3EA4A 2OESA 4F06A 1NI5A 2WILA 1GA1A 1RM5A 1RPTA 1MO3A 2A2ZA 2O23A 2P1RA 2X76A 4IMJB 4OREX 1BA2A 2YMPA 4DWJA 2I71A 3E7DA 4PHFA 4MPRA 1XPUA 2ZATA 2ADOA 3CB4A 1ZITA 3FUCA 1EHIA 4FU0A 3WIEA 2MR5A 4CUZA 1II0A 3AM1A 1BCSB 4BAGA 1CZKA 3THSA 2UYCA 2X8AA 4WXRA 2PNJA 4PYQA 4AROA 5B53A 5JFGA 1R0WA 2XZTA 3IN5A 3WB2A 1I3OA 1JHAA 1SK8A 1UQRA 2J3IA 5DYWA 3HCNA 1CQJB 2FPIA 1M2OB 1PZGA 3BG5A 4HXGA 4S1OA 1L5QA 4ZOCA 4TUYB 5J5AA 4TM8A 2XZLA 2V9PA 2AMLA 2FGKA 2R00A 2D0OB 1WM1A 1TYEB 2MU2A 5JVDB 2F59A 4M1YA 4HFNA 2I65A 4RE5A 4NYJQ 4DMFA 1A9XA 2IEIA 1XRPA 1CI4A 3DKKA 5BWBA 1ZCBA 2C5LA 5KCZA 3PSFA 4JJ4A 3UH1A 3NHMA 2EX4A 4FOOA 2E1RA 4D9KA 1KI7A 5IM5A 4K88A 2JHPA 3RUDA 4JMUA 3O1JC 1Z5PA 1R6XA 2XCAA 1DG1G 1W2HA 3AL0B 3U7GA 1N0WA 1J2UA 1QF7A 2IH4A 2FSHA 3L7MA 1E5VA 2XT9A 5KFTA 1L7BA 2IVFA 4HFJA 3Q9NA 4ED0A 1L8AA 1VPVA 2C03A 2HJSA 2BM0A 2E1EA 3F8TA 3O9MA 4OXXA 2G06A 1WG8A 4B4DA 2DECA 4XWAA 5DGAA 2CXRA 3QV2A 1X3SA 1U2DA 2B2CA 4OI2A 1L5WA 3M2PA 3KEQA 4DEXA 3DD1A 3AETB 1XUOA 4ZT4A 2I2AA 4BB6A 1JYFA 3TNYA 3CX4A 5F33A 5D7NA 3OU6A 5KFSA 2ASLA 2Q8QA 4WH0A 1JI0A 1NV8A 3SVZA 3RRBA 2R48A 1EX6A 2VRCA 3LY7A 1P2TA 5KSYA 1E1MA 1TIKA 2C8LA 1GNPA 2Q4DA 2ZJ7A 3WKEA 4RQ6A 4K2AA 5FTWA 1I4TD 1V8PA 4UB4A 4FYMA 4WA7A 5K3DA 4G9BA 1U11A 1PUIA 3AM3A 3SFZA 5GIPE 5BV7A 4RPYA 2WK1A 5LQSA 3HP4A 4CMCA 2G0AA 4NVRA 3C1YA 1J99A 1NF3A 1ZUHA 2C2OA 2FJ0A 2Q7XA 5TGDA 4KLEA 3M8SA 4L7QA 4V3BA 5EMMA 3OJFA 4CLEA 1U8AA 4CIDA 1HE8B 1NBAA 4GM0A 4L4YA 3LT4A 3M4XA 4D4GA 2HLDD 2K8CB 1PLJA 2B8WA 2ZB3A 4J75A 1EGVB 4KN8A 4M54A 3FKSD 3V8VA 4JV2A 4DL6A 3BMNB 3KYJB 5I5EA 1C8KA 4TT3A 3AT1A 2ALZA 3GVPA 3LRTA 4CL8A 9ICIA 4OA5A 1KYTA 2I4TA 3U9LA 1QDLB 2YC2C 5C5DA 4TL6A 3JWEA 4TZTA 2GAAA 4PYMA 4YDRA 4LZGA 1FTWA 2XIJA 1PL8A 2RK3A 1AM4D 4LZZA 4R0VA 1DAEA 4R1PA 5EWJA 3RRYA 4EJMA 5CB0A 4EBEA 3KP1A 2CXSA 3K4GA 1RYUA 1XTPA 4HBZA 2NPFA 4F4XA 1XLTC 3TGLA 1M7BA 4ND8B 3ZXIA 1IG6A 1ONBA 2Q4TA 3AV3A 1ZK1A 4ZVVA 4BNUA 3PYXA 2JGIA 1TNDA 2D2XA 3PV0A 4W1QA 4AZTA 2KBFA 5LYJB 2QL9A 4I6GA 4P7BA 3QVOA 1LY1A 1V8BA 2I5HA 1B93A 4BVKA 1PVDA 5TVGA 1KA9H 3CCBA 4MJXA 5TPZD 1W47A 1MA3A 2HPAA 3AGQA 3H87A 4OMUA 5FL3A 3ZU5A 4DEVA 3RAXA 2QMOA 4BNIA 4JC0A 5SY4A 3IA7A 1MC1A 1WE2A 4HPWA 1Y89A 3RM3A 1VYTA 5DW3A 3SJ7A 1CZUA 3WGHA 1VSVA 2E87A 2GBLA 2R7LA 5AHOA 2HF7A 3FHOA 1COWD 4J0DA 3VR5A 3OE7A 4ZTZB 1H2EA 3IIIA 4RE6A 4KLTA 5A4KA 5LSAA 5AJZA 3UAVA 4UHFA 4JBWA 4CKCA 1W0KA 2PKYX 1Q46A 4IIVA 5L1IA 4PGHA 3TJZA 1UZAA 1SKRA 3UFBA 1IY9A 5J9FA 3KQNA 4ZCSA 2CLSA 5FWDA 5B4TA 3JATA 5E2BA 5ARBA 4YUYA 1IZZA 2FDXA 4BBZA 4C6RA 2H1WA 2XOKD 5FNVA 4LG1A 3HDVA 3R9IA 4MRRA 4FGLA 5J0UA 3HKEB 4ALLA 5IYZF 3R3WA 5CA1B 1BX3A 1VPDA 2VL7A 3S29A 4Y3UA 4HK4A 4D81A 1N78A 5BW4A 2QXTA 3MJVA 3M9MB 2EJUA 3FBGA 3TJMA 4FZNA 3VH3A 4QOFA 1NP6A 4UEKA 4RTSA 3V4RA 1XEXA 4K6GA 3EPIA 3R4CA 1QX4A 5TGZA 4QYWA 3UW3A 1UPUA 2WUGA 4QUGA 2BVNA 1NBWB 1KTQA 4DCOA 2WTAA 1IJFA 3E9DA 4PGMA 1KY2A 2M9NA 1ZVVA 2NXJA 1XMPA 2WP0A 2WOJA 4E5KA 2QB5A 2AG1A 1NVXQ 3KFVA 3R6DA 1W36C 5B5EU 3NI2A 5K0NA 3G6XA 2EP5A 1W29A 3SAGA 1JJFA 3BB1A 3RVDA 4CUKA 4H77A 3ZS8A 4UNRA 1I7NA 1KO5A 4KLSA 1SKBA 2D59A 1J2TA 2JIZA 4AF7A 5E79U 4UUPA 4HVCA 1VKHA 1UQTA 3GUCA 1JFVA 4ZU1X 3JQ9C 4D26A 3GT0A 2G6TA 4IXNA 4Y30A 4BCDA 5BUCA 4LHWA 4DDWA 1OLSA 4ND4A 1J21A 1OHHA 5EUCA 4JHXA 3HPOA 2IOHA 3U4QB 1XAIA 5J2CA 3IXMA 5DNDA 3CUKA 9ICLA 3AG5A 4J6FA 2IS2A 3OIVA 4G0QA 4X3OA 3SZOA 5AJXA 3TGWA 2J07A 2BR3A 1I6WA 2V7BA 4FHCA 3D9QX 1RADA 3BICA 5HUJA 5ALOA 1OBFO 1PFVA 5AICA 1XJ0A 2EHDA 1HFKA 3HA3A 2YOFA 3FTQA 1S76D 3OSNA 3CLUC 3R8CA 3SICE 2NO0A 1UMDA 1KR2A 4J29A 4XQEA 5JSFA 4BMOB 3IULA 1SV0C 3L7CA 3JVVA 3TARA 1QP8A 2VA3A 1ZEMA 1K6XA 4BLWA 3IP7A 5HBGA 4Q1VA 3T5JA 5IM4A 2K4EA 5EWJB 3ZV5A 4K40A 2PVSA 1M1ZA 1Z4KA 2A3NA 3DQQA 4HDMB 2GTPA 2FX5A 1C30A 2F1HA 1USVA 4K9DA 4U5XA 4ZT3A 4CM4B 2G1KA 5M04A 2ADFA 3MCVA 4QM6A 1Q92A 3IP1A 2F8MA 5LXTF 3PV8A 4GPIB 5FNZA 1YZYA 4N6NA 3TIXB 4F71A 4BLRA 2O4UX 4ENUA 5F9LA 4QWCA 5BVHB 1ZLXA 3L7OA 4JVSB 3UK6A 1ZH4A 5FORA 1IUNA 2R7MA 4ZPJA 3WMRA 1T4CA 1TXGA 4URZR 1DARA 3IYLW 2L42A 5EMLA 4KR0A 5LDHA 4RVUA 1G3RA 4ZEVA 1AHPA 2AN4A 1Q22A 3OM9A 4DUZB 4TQGA 3AJ8A 2R96A 1B2LA 1XXHE 5TSDA 1G4AE 3C8DA 1ZM7A 3WYGA 1T9BA 2JGLA 3BWDD 3QKSB 4TYWA 2OEHA 2A0YA 2BZSA 2Q6VA 4CTJA 3AU9A 2O19A 5DB6A 2C4MA 2E37A 1F3OA 1UQUA 1S89A 1VSQA 2AN1A 1NW9B 4O08A 3FNRA 5I6DA 4XASA 1YFZA 4N76A 3VOBA 4BMNA 3SSAA 3AQ4A 3C14C 5EHNA 2GN6A 5DM60 1KC3A 3FVRA 4MRVA 8ICTA 2Z9BA 1C7EA 2JFBA 3NT5A 4U00A 4WZAA 5BPCA 5EOVA 1VIAA 2VNIA 3CY6A 1TF7A 2FKAA 2H0AA 3GLRA 3UV3A 4N1AA 2WZQA 5JYCA 4GLOA 1YT5A 3U7EB 2W6ZA 4Z4GA 3HILA 2JVJA 2ZBPA 4JNCA 2C2DA 1K5HA 4IWYA 4JYCA 1T4GA 4YP0A 2O0JA 1A9PA 3MTIA 4CHTA 3Q3VA 4AJ2A 1AUQA 1JIHA 3TSZA 4ZCMA 4YXWA 4HZIA 3P2JA 4B3RB 3CF6R 3LW8A 4W5JA 3DHVA 1IN8A 3QKSA 5DO9A 3SN6A 2QXYA 2YYAA 1N4DA 3G0OA 1RWMA 1RKXA 2GEDA 2VJMA 2ZRJA 3PFNA 4R2WA 5A0FA 4YHHB 5MFPA 1XNSA 3PEWA 4C0JA 1Q21A 3PQ7A 5G4LA 3IDQA 4FFRA 2YBDA 5JBQA 4M6WB 4W5QA 1WQ4A 2BZ1A 1FB5A 5CX1A 3IERA 2PS0A 3A9RA 3PNSA 8ICNA 1M34A 2A1UA 3LVQE 5LP6C 2I6QA 1XD2B 3PMNA 2OZEA 3SEQA 3NHSA 3OLWA 3DL0A 4RD1A 3BZBA 4TS1A 4B9MA 2QF7A 3HKCB 3LQ1A 4DBZA 2HLPA 1YS6A 3A4MA 3KQPA 2JIQA 5EEHA 4DA9A 1DC7A 2HBKA 2EFGA 3BXZA 2NQTA 1IRIA 1QC5A 4QYIB 3AVTA 4C7OB 2CF6A 5CD9A 1Z6ZA 1K5OA 1PZHA 5CB8A 2O2SA 4BO0A 1KQ3A 3KSUA 4M9UA 4RUAA 1E63A 1JILA 1N0UA 5DNCA 1A8SA 2HPZA 5B3LA 5KS2A 3UPTA 2WTBA 3C3KA 5DCUA 2GWHA 1JNYA 1PD1A 4F93B 1IVNA 2NLOA 1GQQA 4W8OA 2PD6A 2YV5A 5A9RA 3LLCA 2HQOA 3V8EA 1LDNA 4Q3DA 3RF7A 2UUOA 3LOPA 2VT7A 5EIFA 4Z0TA 5D86A 3K5IA 5GM2A 4DSUA 5FL7A 1OBCA 2HWWA 4LCJA 1RHJA 4RL4A 2UKDA 4F50A 3KZKA 4L1KA 1WV1A 1BIFA 3CW2C 5BYAA 4XYBA 1XCOA 5BSGA 5TT1A 1U5AA 3MPOA 1Y9ZA 1M34B 2ATVA 2IQIA 3IDOA 4DLNA 5HIIA 2AGOA 2I6UA 2V7XA 3KKPA 4V03A 1FRZA 5JCPA 1Y6RA 1AQYA 1CEYA 3AEUB 3KB2A 3ONEA 4KE7A 2P4QA 3WHPA 1BPDA 3OO1A 5JNSA 1CCWA 1C8LA 3NOVA 3OU2A 1U2EA 4RNOA 2W55A 2PYZA 1C2TA 3EQ6A 1OXXK 1NE2A 1UINA 2XRFA 2HLHA 2WBLC 4KGZA 4W63A 2C2MA 3B9RA 5INTA 1A5ZA 3PQDA 3ZVLA 1O7JA 4TQ9A 3IBGA 3ENZA 2HWUA 3IEUA 5CHGA 3K6SA 1WEKA 2XYRA 3QEMB 4KO4S 1KXJA 2QS9A 3BD8A 4HZUA 1HQYE 2A33A 2QTGA 4IQ4A 4MAFA 4HUQB 4J1NA 3R76A 3FOWA 3RIYA 5CDUA 4G1VA 2BMEA 3GNTA 3RS5A 2Y3IA 4RZIA 3RREA 2B92A 1UBFA 4M9ZA 4MQEB 2XYVA 1NN5A 3IDSA 3ZHSA 1CZRA 3W34A 4PRKA 3ZE1B 1TMGE 1NSYA 2W71A 4HMOA 4DBVO 4DPKA 4A15A 1BGWA 3K4HA 1G20E 3BL8A 1IOZA 3F7OA 3FFAA 3G9TA 3GAZA 2EAPA 3QVTA 4NJMA 3TNJA 3GLHA 1AO0A 2KTQA 2GD2A 4J7XA 3U3XA 3AUOA 1QZUA 3WWDA 1JW9B 4YH1A 1H66A 4I2GA 2ZI5A 1EI9A 2GCIA 2Y1KA 4MUAA 3KKAC 2E4VA 5CU7A 2W2QA 5AHKA 2I4NA 2Q5OA 1R0SA 1CS0A 3EEFA 4WCDA 4B7AA 1GZ3A 4LJ4A 3ZWNA 3P2OA 1TQ6A 2IEAA 2PMCA 1HT1E 4RKQA 4CL0A 1U7DA 1YVUA 3R40A 3QXSA 5J58A 1S97A 1JH8A 3AFHA 2YX8A 3RJKA 1W0CA 3RC3A 3TPCA 3JYLA 1AQJA 1OWOA 4BV3A 4WZ6A 3KZXA 2Z8YA 2HBYA 5DG8A 4DJDC 3PUVA 4IO0A 5KBYA 3KBBA 4OI0A 1EB9A 3QKTA 4FLMA 2H59A 5SY6A 4DLWA 3GNLA 1U94A 3A36A 3B6EA 1IRXA 4LOKA 1M5RA 4P35A 5KVSA 3WIDA 1BVHA 1TVKB 1NVEA 5C5EA 4DR2B 2E8NA 1C9KA 5AVKA 4IHKA 2KQUA 3P9SA 4FI3C 2CUNA 1IDN1 1L4NA 2PX3A 3F6BX 3KXIA 4J94A 4XCQA 5REQA 2X4IA 3WAKA 2PLWA 3VOSA 1VCNA 4EY8A 2DQSA 3B36A 8ICMA 4URHA 1U2GA 5A03A 3ZWQA 3RLIA 2X23A 2V58A 2D1YA 4PHAA 2HU5A 2QORA 3GN1A 3WHIA 2VH1A 4YR9A 1DEXA 1IBSA 2EL9A 5JATA 1E2LA 4YIKA 4C7KA 5I8PA 1K08A 2W6IA 4QDOA 5JH7A 4XUDA 4R1LA 4M60A 3Q0TA 2Q07A 1DDIA 2H2FA 1J2NA 4R54A 3M34A 4OIFA 2R8EA 1YB6A 4QUAA 2WU3A 9LDBA 5EWGA 4RJLA 2Z1MA 1EFAA 3AFNA 4KLCA 4WOKA 4C7VA 3TH5A 3DUFA 4MIOA 1AQLA 3EBOA 4JLBA 1I5RA 3KKKA 4NU0A 1V3VA 5DIZA 4EEYA 3D0OA 3LOQA 5EJAA 5TX7A 1GV0A 1UJ5A 1Z2EA 5SZKB 3I6IA 3UMVA 1UDAA 2W22A 4URFA 1E5XA 4F5OA 2VJKA 2VTDA 3M49A 3RT9A 1ZJJA 3DL2A 3FCOA 3IIKA 1T7PA 1B8OA 2X3UA 1ZJ6A 3OZ7A 2ZAMA 3GR6A 2QQFA 4EJSB 5BT9A 4HMQA 3FCAA 3SYMA 4DFPA 4RNDB 3F2DA 3UV6A 4JLJA 2RONA 2Y1IA 2G6BA 3BB4A 1KIMA 3LYUA 4G2NA 4HVTA 1DC5A 1QIGA 4GX1A 1R6VA 5CYFA 4UVHA 3R23A 4KMSA 1AURA 5DSZA 2CV1A 1FLDA 1XGKA 2NAPA 1D04A 2XEDA 3F1LA 1X70A 3HDTA 1A72A 2VCHA 5AJWA 1MU0A 2C5BA 3NGXA 5K8VA 5KQRA 3ET4A 3OF5A 4MZXA 4P36A 1ZJ5A 4RNNA 4KHZA 3ZC3A 9ABPA 1G2QA 2MSNA 3EVZA 2GUGA 1DK3A 2G82A 1ZQEA 1SUIA 3L0YA 4R31A 1U1GA 1P75A 1BHO1 3D6FA 1N5OX 2AD5A 2D7JA 4KVZA 1WIWA 3UG6A 2VHZA 4YASA 1OBVA 1JDBC 5A9SA 2JIZD 1ZRMA 1C9JA 3DV2A 1WMSA 2MA1A 1F44A 4EY5A 2A5YB 1LFDB 1JB9A 4RGQA 2QAGC 2FNAA 3OIUA 5CXQA 5AK3A 1OLUA 2ZCUA 1H69A 1Y82A 3I2JA 4K1LA 4LW8A 5ARCA 1HUQA 5TPWA 3GGDA 1PIWA 1I2MA 3N07A 1S8OA 1CW2B 1A27A 1EJBA 1QO7A 5TMDA 2QSYA 4G9GA 3TUZC 1DAPA 3HUEA 4OJYA 5E2AA 3H2BA 2FFQA 3TR5A 3VSBA 4ERNA 2A1UB 3RTEA 3IIJA 2KI5A 2VDVE 1NXWA 2YXLA 5LOVF 3MJSA 1SCBA 1L5HB 3GO4A 4IMPA 4PXSA 2Q6TA 1BXGB 1JA0A 1TAGA 3UJ3X 4QZFA 5HOEA 2H54A 2QW1A 4IHJF 4MR7A 4WBSA 4AMBA 1P2UA 5DI3A 1A7AA 3Q8KA 1VE5A 1Z6GA 4M9RA 3MELA 3D6UA 2C1XA 4ML3A 5BVGB 1NA5A 4HRYA 3FI0A 3WDSA 3GFVA 1EFPB 3T5CA 3C2LA 3BE5A 2XUAA 2ZR8A 3GB9A 3UJHA 2FPLA 1INLA 1QE5A 1E6KA 1L6NA 3DFIA 2YS7A 4FYVA 1VXRA 5KFKA 2DSNA 2X1HA 1M2FA 2BCSA 4YAIA 3PW0A 2CLIB 4B34A 2VPYA 4BMZA 2B4KA 3B82A 1JWBB 4MWZA 1KBOA 3PPIA 2HJHA 3QBDA 1U7PA 3K9NA 1ZU4A 2Z8ZA 3A1UA 2DGDA 3ZX5A 3QSGA 3T3GA 1BE1A 2AQKA 4EDFA 3QLVA 1QNLA 3TO5A 721PA 5BWNA 3CPEA 5K99A 1TAUA 1GTG1 3E9RA 1DXOA 3L7KA 3R0VA 4NDZA 3TLEA 3WICA 4B4WA 1E5LA 2V4QA 5JZSA 1LJUA 3LUHA 3PDCA 1JKJA 4HEQA 5LB2A 4DWIA 2OHVA 5DB4A 1T3GA 1EEHA 2CZGA 3BXEA 4BQSA 1I6MA 4PPXA 2P79A 5AVSA 5IHXA 1PEKE 2GMWA 1K6EA 3STYA 1PDOA 4RMGA 3TDMA 1RP7A 4IILA 1X19A 1NK5A 1HSZA 2J6SA 2CLCX 3EGIA 3HRIA 3PWKA 4C4YA 2Z4SA 4LVNA 1JAHA 2WD8A 2DUMA 3AKCA 1U2DC 2LBPA 1X39A 3EGWA 4L76A 1E1QD 4V0NA 2L82A 2H1FA 2ZB2A 3P52A 3CNEA 1DQSA 4NLLA 3CZRA 1S1CA 4LYHA 3UMRA 3WLJA 3ROKA 1U1IA 1Y63A 4IFBA 4Q9NA 3GROA 1N2IA 1XRNA 3BS7A 3H6HA 3C5FA 4QQ8A 3BCSA 4ESEA 5LR6A 4UBCA 2HBJA 2XB4A 1MDFA 3CJTA 4I36A 1YZKA 3K73O 5E6SB 4BO2A 4KR7A 2DT5A 2YB4A 1ZN9A 1OU4A 1RM3A 2XMQA 4C89A 4EW1A 1H2BA 2ZVDA 1AT1A 1DWPA 1B16A 4R1QA 2GDJA 2ZB4A 5BURA 1WZEA 4LK2A 3T9DA 1V7CA 2YQ5A 1MC8A 1TYZA 3FOBA 4LYEA 4NJOA 5F9MA 3TLGA 4F5EA 3MR3A 1GYQA 2HWKA 3I0MA 2QKYA 2GJSA 4WXHA 4RLSA 4WESA 4FQ7A 3VNAA 1P4GA 5ENVA 4X1IB 1ZETA 1RHKA 1YRAA 5BOSB 2XMRA 5FHRA 4E15A 1S2OA 2QUJA 4EG8A 1XU4A 4B44A 3M7IA 3MTJA 5TC4A 2JGKA