4F72A

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, asp12ala mutant, complex with magnesium and inorganic phosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
195
Chain Sequence
GIKNLLIALGGVLINLDRERCIENFKKIGFQNIEEKFGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 67
structure length 195
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4f72A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4f72A01
2G08A 3SKYA 4KN8A 4C4RA 2CFTA 5AW8A 1K1EA 3AR2A 3WK7A 4CF5A 3NANA 4AS3A 1YS9A 4BEWA 4I9GA 5AESA 3PGVA 1WZCA 4UATA 3UM9A 2YJ5A 3QYPA 3WKAA 2VKQA 4ZEWA 2D2VA 5AW0A 2PR7A 1ZD5A 3L8FA 2HCFA 3ZX5A 4UMEA 1RC8A 2B1QA 4BX2A 1EK2A 1ZD2P 5ALFA 4YH1A 3M1YA 1O03A 5ALLA 3ESRA 3QX7A 4CE6A 2ODAA 1QQ7A 3ZTWA 4Y2SA 3AR6A 3ZTYA 1RMTA 3QLEA 1QQ6A 1YDFA 4OCZA 2WFAA 4HGPA 1RDFA 1CR6A 1XPJA 5AICA 2HO4A 3L0CA 1L7MA 2FPRA 1YNSA 2C8KA 2Q5EA 3L8HA 4F71A 2YFYA 5AM1A 2HF7A 4KYTA 2GMWA 1T9ZA 1RMQA 3PCTA 3E8MA 4Y2YA 3WK6A 5ALYA 1FEZA 2AGVA 3NUQA 3FPSA 4KX3A 2HF2A 2WF6A 5FP0A 2RARA 2I6XA 2MU2A 2YY6A 5ALPA 1YV9A 3N8GA 1AQ6A 3NASA 4NAVA 4DCCA 2GHQA 2ZXEA 2WF5A 5AM2A 3HYCA 3SKXA 1XVIA 2P9JA 2YBDA 1EK1A 3OPXA 4CF4A 3E81A 2WF8A 4KX5A 4FYPA 4Y2VA 2I54A 3L8EA 2EAUA 3IJ5A 1U7OA 2B8JA 1U7PA 5AVVA 3U7HB 2IOHA 1U2TA 3ZI4A 3IB6A 1VFPA 3OTQA 2YMLA 5AVZA 2C88A 3SMVA 1CQZA 2HSZA 4EX7A 4Y2QA 3QU7A 4GIBA 5ALMA 5AI0A 4C4TA 1Z4NA 2IYEA 4GXTA 1LTQA 3QUQA 4UMDA 3R09A 3QU5A 2QLTA 2GFHA 1KYTA 2Q4RA 2P69A 1Z4QA 4XQ0A 2WF7A 3E58A 1L7PA 5AW3A 5ALTA 2B30A 2NO5A 5AKIA 5ALGA 3OCWA 3AR5A 3L1UA 1TJ3A 2YJ4A 5AK6A 4EELA 3KZXA 2G07A 4HYTA 5AIBA 4NWIA 1ZRMA 4F72A 2B1RA 5AW1A 3RF6A 4UAUA 4DFDA 1J8DA 4BKMA 4B6JA 4Y2PA 3B8EA 2GO7A 2RBKA 2BDUA 4QQFA 5ALRA 4PNHA 3WKCA 3E84A 4G63A 1RMYA 2NO4A 1RKVA 4ZEVA 3OCXA 2HOQA 4OFZA 2YJ3A 3EF0A 1VJRA 3KC2A 5AI4A 1LVHA 5AVTA 5ALXA 2R8YA 5ALSA 3OCZA 2ZBFA 3ZU6A 2JAWA 2FPWA 3ZVMA 3WK5A 2HI0A 2WM8A 3PDWA 3EF1A 1RPZA 3QUBA 5AW9A 3I76A 2PKEA 1Q91A 4Y2TA 3OCVA 4BNDA 1RKUA 3D6JA 1Z4MA 1JUDA 2FI1A 1N8NA 5AVWA 1L8OA 2CN1A 4EZEA 3S6JA 2YMQA 5ALJA 1WPGA 2DQSA 5T41A 5ALHA 1QQ5A 1NRWA 5AW4A 3QUTA 2YN4A 3F9RA 1ZJJA 1Z4OA 3DNPA 5AKXA 2C4NA 4RETA 3P96A 2OBBA 1YJ5A 3U26A 3FZQA 2OA0A 3QXGA 3AR7A 5AK4A 4BX0A 5ALVA 2HEGA 3GYGA 3ZVLA 1ZS9A 4HGQA 3ZWKA 1L7NA 2R8XA 3ZWDA 4EEKA 1L6RA 3DDHA 3U13A 2I34A 3NAMA 1XP5A 4IFTA 3EWIA 1RLTA 3R4CA 4DW8A 4BX3A 5AW7A 1ZD4A 3UMBA 5ALQA 3U7EB 1F5SA 2W43A 4FFDA 3SLRA 5AW6A 4QJBA 2RB5A 4BYGA 4CNQA 2C8LA 3MC1A 2FPSA 4NABA 2P11A 2OYCA 3FM9A 3FGOA 1ZOLA 3MN1A 4HGOA 5ALZA 3TLMA 2GHTA 1RLMA 3I6BA 4CF3A 2W11A 3L0BA 3MMZA 4OD0A 4L6AA 4YGYA 5AIAA 5AVUA 3WKBA 4YCLA 1SWWA 2JAOA 3ZX4A 3J7TA 3DV9A 4YIHA 3OCYA 5E0OA 4BBJA 1Z5UA 4AS2A 5AKHA 1WVIA 4L6CA 2O9JA 2AH5A 3ZVNA 3U7FB 2HDOA 2EARA 2MU1A 2G06A 3AR4A 3WGVA 5AKLA 2CFRA 4JB3A 5ALDA 3FPBA 2CFSA 3ONNA 4YCNA 5A3QA 2FDRA 3W5BA 4YCMA 2R8EA 3BWVA 4EX6A 3L1VA 4NV0A 3FVVA 3WKEA 2ZBDA 5AM4A 2R8ZA 2I33A 1Z4PX 2O2XA 3CZ4A 5A3SA 5ALEA 4IG4A 3ET4A 3SD7A 4FE3A 5AI9A 4XPZA 1ZRNA 4JDPA 2G09A 4G9BA 5AK3A 3A1EA 1L7OA 2B0CA 3L5KA 2ZBGA 3L7YA 2JGAA 1T5TA 3A3YA 1YMQA 5AKGA 3ET5A 4UM5A 5AKKA 3ED5A 3MPOA 3I1YA 4UW9A 2G1AA 2JARA 5AM5A 1QH9A 4MWOA 3N5KA 5AKEA 4RESA 5AM0A 5ALWA 2IA5A 4AP9A 5AVQA 5JJBA 3K1ZA 3NALA 1O08A 1Z88A 1RLOA 1QYIA 2IOFK 1Z4IA 3NIWA 5AHXA 1L8LA 4Y2XA 5IS2A 3PGLA 4C4SA 3QU2A 2P27A 3QU9A 3N1UA 3W5AA 1X42A 5AKJA 2YMPA 3WGUA 4HGRA 1RRCA 4KNWA 2HX1A 3NRJA 2MSNA 1NF2A 5ALUA 4UARA 3N07A 5AM3A 2YJ6A 3A1CA 1N9KA 2ZBEA 1Z5GA 2RAVA 4L57A 5A3RA 1ZD3A 3R9KA 2G80A 1VJ5A 4UASA 2BY4A 4KNVA 3QU4A 5AVXA 5IT4A 3AR3A 3BA6A 2FPXA 2X4DA 2G0AA 2AUTA 4UU0A 1SWVA 3B9RA 1Q92A 4J03A 5AI6A 4I9FA 1TJ4A 4Y3UA 4UMVA 2ZOSA 3WK9A 5AKZA 3IRUA 1Z4LA 3WKDA 1IWOA 5IT0A 4HAIA 1J97A 3EPRA 1S8OA 5AI8A 1NNLA 3AR8A 3OCUA 4XOUA 1WR8A 5AI5A 1RKQA 3ESQA 2C9MA 2I55A 1TE2A 3DAOA 5AK5A 2FUEA 3AR9A 3SF0A 3W5CA 3L8GA 4Y2RA 3HLTA 2EATA 4E88A 3I28A 1PW5A 5AW5A 2WF9A 3A1DA 2QYHA 3KBBA 1T5SA 1TA0A 3KDPA 3KOOA 2IOFA 2Q4TA 3VAYA 1SU4A 2AMYA 3QGMA 2PQ0A 3QUCA 3UMGA 4OHFA 3WK8A 1U02A 2FPUA 2W4MA 3UMCA 3B9BA 3ZW7A 3KD3A 3CNHA 4O8CA 4DWOA 4Y2UA 5ALOA 1Z4KA 5AKYA 1RQLA 3W5DA 4J2TA 4NFLA 2JAUA 2OM6A 3ZUPA 1Y8AA 5AVSA 4UAVA 3U19A 5ALKA 5ALNA 2BDEA 2I7DA 3L0YA 4BNDB 2YMMA 3M9LA 4ZEXA 2HHLA 1RQNA 2B8EA 5ALIA 4UM7A 3SHQA 1MH9A 5AVRA 2WHEA 1Z4JA 2ZG6A 4H1WA 3QNMA 2NYVA 2B82A 3N28A 3RFUA 4YIKA 4BEVA 1S2OA 4UMFA 5AVYA 2FUCA 4EENA 4Y2JA 3U7GA 4UU1A 4XE5A 2FEAA 1U2SA 4HGNA 4MUMA 1TJ5A 5AW2A 3WK4A
chains in the Genus database with same CATH superfamily
4NZNA 3MG9A 1ENPA 4CKYA 2OV3A 4MQ4A 5AW0A 3RGGA 1ZMBA 5B1SA 4C89A 2JRZA 5BMOA 3RVQA 3WMEA 2Q0ZX 4HUQB 1V5FA 4JBWA 1JDVA 2FPRA 2K4HA 4PZCA 3MWLA 3OWXA 1G6HA 2C7OA 1GFIA 4NZYA 4BS9A 2UUPA 3IODA 5K20A 3HGQA 2HLDD 4OHXA 3FFXA 3OTGA 2HSDA 3LD9A 5REQB 3BCSA 1YQDA 2P9FA 1U0BB 4H60A 3REQA 3VYUB 3NO4A 4FHFA 8ICPA 3VC3A 3EISA 3SMQA 4N0EA 1SOWA 3JYLA 2HU5A 1AU9A 5BMVF 4ECRA 2B98A 3FX2A 2OXTA 3B53X 2P77A 5K0SA 5AI0A 2RKWA 4DLPA 1U2EA 2EZTA 3TJZA 3COPA 1CQWA 3GEPA 3WX0A 3DKPA 2Q4RA 4Q9LA 4DDTA 4I5IA 4UTPA 9ICXA 3JQGB 4P54A 5B6PA 5IUNC 2R44A 3KT8A 2HHQA 1MXHA 1XWFA 4LF9B 2VAXA 3GR6A 5IJ0B 1DADA 4LFCB 3T38A 3IDFA 3KSZO 2Q1SA 1FFWA 4DLLA 1RAEA 1W4LA 4XTCS 3HDGA 3IOCA 3IT3A 3PNBA 1MKYA 3KKLA 3RSLA 2Z1DA 3OLQA 2XUKA 2WJYA 3AUTA 4HDSA 1XD9A 3PU6A 1YQQA 1JG2A 4CETA 4M9ZA 2P8SA 2H54A 4LDQA 4WINA 1BMTA 5IN4A 1DBPA 4Q3AA 2HBJA 3D02A 1EK5A 1MLDA 3A1TA 3OEYA 3ZU3A 1XLTC 2QM3A 2C4NA 1BG6A 1O6FA 4E4YA 4KIFA 1WMEA 4XJTA 4XWKA 4FLMA 3AEKA 4TTPA 3QWHA 4UU7A 2JPDA 3EDOA 3EXHB 4U0KA 2Y0SC 2RHOA 3FRHA 1ZG3A 5CNMA 5KNDH 2GKGA 2OHVA 2RGDA 4IPTA 2QX6A 3I0NA 4J1QA 3MJVA 3GVCA 5TPZA 1U47A 1TK8A 2P11A 1C7QA 4OHKA 4ZVVA 1B0AA 3BWCA 3P2KA 3K0SA 1JH8A 2MRLA 5I01A 1XZKA 1NHGA 2ZIVA 3LZDA 3KOMA 3PQEA 1BXRB 3EZ6A 4EG7A 1ZHOA 1JYSA 2FDRA 2MCFA 3OF3A 4OJ6A 1G5PA 1HDOA 4PZOA 4NBWA 4YQZA 4KXNA 3DJFA 4KTQA 5IT5A 4K3VA 4AN1A 1CJVC 2QAGC 3NIGB 3QFRA 2XYHA 4I0WB 2GI4A 2GVZC 5LP6A 3VZBA 1E2LA 1C8KA 2ZBGA 3L7YA 2ORWA 2CDBA 4CV1A 3TRFA 2PJZA 1VG9B 2PBRA 4QGFA 3S55A 4U5XA 5ESRA 2H18A 1Z7EA 4XGKA 1F6DA 3T5DA 2V5VA 3LY7A 4UPEA 3A1CA 1ACMA 3RJTA 3REFA 2WYHA 3K75D 4X3PA 2BM8A 3BA6A 3JWPA 9ICFA 1T4CA 3FDJA 4X9XA 2UYGA 1XWIA 5SZIA 2NV0A 3R5SA 4QFBA 5IU6A 2B4KA 1NNLA 5FWYA 1DV1A 2C0PA 3BCHA 1GSAA 1E6EA 1TD9A 4KBFA 3RQSA 4GPBA 2VDVE 1NK7A 3QY9A 2XXAA 4YBZA 5EKDA 4ECWA 4OH7A 2P3OA 3BMQA 4A23A 3AIMA 3W34A 1TV9A 5EEGA 4D9HA 2XDYA 5FTKA 3N7PD 2FMUA 4K1LA 3CEPB 3RSCA 3A36A 4YQWA 4AK9A 4EK9A 3MJEA 3SX4A 1W49A 2O0MA 4H1WA 5BV7A 1CCWA 1DAOA 4OJMX 5DCLA 1LVUA 2DEUA 1ZQOA 2KM1A 4KN8A 4UBLA 4ZIRB 2R84A 1YCDA 1E1YA 5KFNA 3LGXA 4IHQA 3NBFA 3L5OA 1JBKA 5FD8A 4AJKA 2NV3A 2F3UA 2OD9A 4CM9A 1YBAA 8ICUA 2W58A 1IY1A 4NATA 3KR1A 3KXDA 8ICFA 2P4UA 1SV0A 4GBED 1KZHA 4JB0A 1KBZA 4S2UA 5PGMA 4K9LA 1NLZA 1UBHS 5LP1A 4DT1A 2RHFA 2FJUA 4CMCA 4ENRA 3RS2A 4YAIA 1RG6A 3FBWA 1U3DA 3U4MA 2YYAA 3KS9A 4Q6WA 2ZS9A 3OHMA 2H1SA 3MJCA 3WGTA 4NMLA 2Q49A 1CULC 4BVEA 4CIYA 2PL3A 2XZPA 4FBMA 2G1KA 2N1RA 2P9ZA 4U1RA 2YHAA 3KV1A 2LYBA 2H00A 1UPFA 1N2ZA 3V6LA 3DE6X 2DLDA 1TXGA 5KX5A 3B12A 3I0ZA 4QPNA 1FP1D 3NIBA 1IPHA 4ELVA 5IAAA 1JX4A 4JVSB 5AK6A 4QHYA 5AIBA 3AJ9A 3CBGA 2QD2A 3KJNA 2B1RA 3RSHA 2NQ2C 2VQ6A 2VJ5A 2DSNA 4P0PB 4AXBA 4DJTA 5J43A 5BQPA 1MUUA 2HF8A 1WMAA 4KAAA 3MAGA 1JA9A 4RPYA 3GUHA 3A3OA 4MVYA 4KXYA 2GX6A 1A1VA 3QYFA 3K2BA 3OZAA 3VJRA 2X15A 4UHKA 4GF5A 3D6JA 1UP6A 1KJIA 1ISRA 1ONBA 1JTFA 1WWVA 1SZCA 4HBGA 5HF5A 8GPBA 2MHCA 4QT4A 1XG5A 2FDXA 2GCEA 4EATA 4HQ6A 3RTEA 4I2IA 3TR0A 1P2GA 3OECA 3MT8A 4PVDA 4B9TA 1R6BX 4F5OA 1UIRA 1M54A 4R2MA 2W37A 2M2IA 1ZWKA 2CNOA 1G2OA 4NCAA 1UMBB 2Z7JA 3W3AD 1UINA 3Q10A 2IS1A 4L8LA 4BZZA 2PZLA 2ZWOA 2WFLA 1EUZA 5CAEA 1ZBQA 4XARA 2YY5A 2OCGA 3EN0A 2F9FA 2QD4A 4L9WA 1NVUQ 4LZOA 4B4KA 1A8UA 4UEWA 3OIUA 4DL6A 3IE1A 2AOTB 1QSGA 1FMJA 3IAHA 5DNEA 2DECA 2IV7A 4M46A 3TTUA 3C5HA 3PA8A 3Q8XB 3R3SA 1JKJA 2FZVA 5DHSA 2PSJA 4DV1B 3FKQA 2NGRA 1A5AB 4YUWA 4O63O 2C82A 3VNBA 3GGPA 4Z6KA 3OTIA 5F4ZA 2R7MA 1JV2B 1VLBA 4CKWA 3HU2A 4C4XA 4UNRA 5DJ5A 4PG6A 3UUWA 1CUDA 1QVRA 3OOHA 2Q27A 5JJBA 5EJ4A 2FN8A 3HJBA 1E77A 3USCS 4ZGGA 1N9GB 1S5PA 4RZRA 4A0QA 3VKGA 1KI7A 5KL8B 2VG8A 1QR6A 1QNLA 1TTQB 3FZEA 1C4XA 2AG5A 4PRYA 5BOVA 2DQYA 1RXIA 2BGWA 1Z5GA 4L57A 4EY4A 5KWIA 1U8TA 3H1TA 1RYNA 1DV2A 1XE3A 2WJZB 4HXFB 1R18A 1M1XB 3BIXA 2YKGA 3FHCB 5AI5A 3PUZA 2XNJA 4IDGA 3NT4A 2BCSA 4L4SA 4R1SA 3ERCA 5ELMA 4DRYA 1A96A 3TGWA 2WQ7A 4JL5A 2W8BB 2MYNA 3OESA 5TQ0B 1KDYA 2ASLA 2WJIA 1SCIA 3E3OA 5KCMA 3VGJA 3JQ7B 2Y76A 1M1UA 2O6KA 1P60A 1GNQA 1TEXA 2HPHA 2QTNA 4JP8A 2WDPA 3LJKA 2O0LA 3NU1A 2HHLA 1LJ8A 4X7RA 5CG2A 5CFMA 2ZU0C 3K0FA 3SY8A 3WP1B 2LWIA 2VJPA 5CA0F 3KEFA 2UUCB 5DFAA 4A6PA 3MGBA 1ZCJA 3GD5A 1TK5A 1A5TA 2QUZA 4C4RA 1GLNA 1GLVA 1D7OA 1NW5A 3PP8A 4A36A 2KVSA 4QUEA 4TWZA 2FWPA 1FSPA 4OLBA 5GJCA 1SKQA 4MFCA 4JKOA 3TQ1A 4F8EA 4KG7A 4Y0AA 4CKEA 2K87A 3L9XA 1W52X 3VZPA 3ZXYA 4LE2A 3R7SA 4BRUA 3W2TA 1ZVJA 2WAXA 4EYKA 4MGIR 4CODB 4ARIA 4R40A 2G9NA 4FS3A 5AJTA 4DTCA 1M10A 1GDTA 2R8KA 4RGVA 3II6X 4MWDA 3QBTA 3VPHA 5HDBB 3ONEA 5AM2A 4CQNA 1MA3A 3AY3A 3OEHD 2N75A 5JO9A 4WFKA 1BNCA 1U0RA 1LU9A 2YMLA 4XA8A 4JK1A 1QPZA 3EUAA 1H1DA 5KFAA 1D6SA 1XQ1A 2PGLA 3QU5A 1Z0AA 2JFFA 3IPXA 1G1MA 4P7BA 3TQFA 4HWOA 2ATXA 5BVGB 2PLNA 1P1RA 1UM8A 1PFUA 1XZQA 2PZFA 1JI7A 3OUZA 1ABEA 3FJOA 3D8NA 4N18A 5LA6B 5EUMA 4O2LA 1WP9A 3IFSA 3FYCA 1QQBA 2WJVA 2XMGA 1I10A 4WOBA 4IMJB 1RKVA 1SHLA 4OFZA 3ZNQA 1ZM3A 1KYVA 1HWYA 2EKZA 3CPJB 2E8NA 1TCAA 1GPYA 3RKRA 1HZJA 3R0ZA 4IWYA 3I37X 2GN8A 3NRCA 1U8CB 1ULSA 4X6UA 2PR2A 5HFJA 1N8NA 3VYRB 2ZRMA 2FSGA 3B8HA 4HLUC 1TVKA 5TARA 5HYVA 2K4PA 4XCXA 2AOUA 1NRWA 3QUAA 3PHCA 1Z1VA 2NUPB 2ILVA 3TDKA 1QTIA 4QXAA 5ERGB 4LW8A 3GFGA 3CNBA 1S7CA 1UM9A 3W1WA 1USKA 7ADHA 3NTRA 1NF3A 1U1GA 4MLDA 3UTDA 4FIZA 2RI0A 1S02A 1YT3A 1GTZA 3GG9A 4W7HA 1CIPA 4BKPA 1HL7A 3T7DA 1PL8A 1W0KA 5AVUA 3GFVA 3AYZB 4RDCA 1EBBA 2V5AA 3Q72A 4G65A 4DM7A 4KR6A 3QPWA 2XB9A 3VR0A 3UT5A 3VHRA 3LTEA 4EG6A 2V7VA 3FWPA 3SX2A 2WQ6A 4JCCA 2ZI7A 2GAFA 2J3DA 3SD7A 3G7SA 1CJUC 3PYMA 1QTNA 3AHJA 1YBMA 1AM4D 1SD5A 1ZQ9A 8LDHA 1OI7A 3GI1A 3AF2A 1STOA 4NESA 4ZAWA 4DY6A 1IUNA 4CCHA 4CG1A 2AFIE 1DRWA 3HPQA 1D03A 2DC1A 3EMDA 1F9EA 1P2DA 2Q8PA 3NNSA 5A9SB 1EHYA 2EHDA 1R8YA 4LOAA 4J1NA 4C3UA 4LHZA 1SWVA 1GEGA 3PLAE 3OWOA 4NYJQ 1GZ4A 2LRHA 3VOTA 3RHSA 1BPDA 2IXTA 3S8YA 3LXXA 2I6SA 1I1QB 4KLNA 1S0VA 3HLTA 2IYTA 5DB6A 4JROA 3GZTB 3USZA 1FU4A 3L92A 2ZLBA 1QANA 1VHWA 3IXMA 1BJTA 1JIVA 3A8TA 2R48A 3HKZF 1U02A 4GMGA 1JJIA 4EAAA 3MBKA 3RSSA 3CW8X 4ZQCB 5LOVF 4R7ZA 1QRSA 3PNKA 3EPPA 1DE0A 3C2KA 2B5OA 4OXYA 1O7JA 1HOTA 1PDWA 4H7DA 1A8PA 5K1ZA 3ANSA 1J8MF 3RJEA 1P4JA 4C0HA 1URJA 2I5HA 4DILA 1WKBA 3FE2A 4HGNA 4N5IX 3VVCA 5JVDF 3LT0A 3DFMA 2PI4A 4G5FA 1ZU4A 4FLEA 4B3CA 2WUWE 3TFWA 1MXFA 4A8EA 5KFFA 4XVCA 2ISSD 4V2IA 4NZZA 3NG1A 1NBMA 3TIFA 3KHTA 3PUKA 2PAFA 1E3WA 2PRKA 3W6OA 1AUXA 3VV2A 3UBMA 1D8YA 3L41A 2AJLI 5J2EA 2AG0A 3CVJA 3SX0A 2H4JA 3ZU4A 3STYA 3L8HA 4YMLA 1DKQA 1KVSA 3U4GA 3NYQA 2JLAA 2GD2A 1QIGA 2EL9A 1E1KA 3V7WA 3AB8A 4FNAA 2GPSA 5BWCA 4D3YA 2XCAA 5EIEA 3I6MA 4OO1J 1Y1PA 3TAPA 2YVUA 1JQDA 2W70A 1MW9X 5F73A 5F2EA 4KX5A 1Z16A 2IIBA 3KTQA 2V7QA 4KPYA 3ZLJA 3HDVA 2FKNA 1E2GA 4IV0A 1ZQXA 4FK8A 4US0R 3HUUA 4XB1A 1R0LA 1W88A 1CJKC 3PSIA 1A0PA 1LC3A 3L1UA 2JAPA 2GESA 5KTNA 4LPSA 3KSRA 4LMRA 4GD3Q 4RJKA 3OJLA 4MKFA 5BQ3A 1LPNA 4BMXA 4G63A 4TMXA 2DSTA 3IVCA 1OY1A 4LRUA 4ZQFA 3TF5A 5J5VA 3RQIA 3U56A 4UUBA 1YVEI 3UXEA 1XQ9A 3NHJA 2EJUA 5DTEA 2P6MA 3U4CA 1VLHA 5E7JA 1X94A 1DRJA 2QP4A 3ODGA 2H4ZA 2VTEA 2DQSA 4MW9A 1C7EA 3IUSA 4NENA 4V0NA 4KN5A 1XZIA 4TRMA 1OH6A 2DTEA 1VSVA 4UZEA 5GMOA 2IHBA 5IHXA 1O0BA 1KI4A 2OHGA 2VPXA 3AXSA 4RU9A 1HG0A 1CZUA 2IX3A 1T91A 4C06A 3TCXB 2WG1A 1OYVA 1BFKA 3TVTA 1FNCA 2J5QA 3Q0IA 3DWIA 1SEVA 3EXFB 1S9DA 2DU8A 4ITRC 3QHAA 5L6LB 2H2AA 3WDMA 1ZVMA 3HHEA 1TD1A 4DQQA 1B6SA 2YN2A 3DZCA 1G4HA 3BWVA 1SHUX 3L1VA 3ID6C 3UYKA 1BX1A 3THYA 3CZ4A 1K6JA 4F1KA 3IE0A 3IAXA 3U0BA 5ALEA 3G2MA 4M53A 5J58A 2X6RA 4HN2A 5AK3A 1T3NA 2QK4A 4WKCA 3HJFA 2YOGA 4QU8A 3GGDA 3EZYA 1TW3A 5K0JA 2CD9A 4OSEA 4X1KA 1HM5A 3SDBA 1OXJA 1Z4IA 4Q37A 3DOIA 3A6HA 3I45A 2DF4B 1FPQA 4TT8A 4BUCA 5IVIA 4F5DA 4GPEA 2C83A 1TYAE 1U2GA 2ZBVA 1V5WA 1VYHA 2KIWA 1BD4A 5F12A 4YI3A 4DSZA 5B3JA 2G4LA 2BT4A 4RQ6A 3AWDA 1E5XA 4ZU1X 2FFRA 1FZTA 5D5PA 2GWSA 1PR3A 2DKOA 2H1IA 1M2WA 1T5IA 2Q1TA 1QAQA 4FSXA 4ZT3A 3PEVA 4XEUA 4TLEA 2C4KA 4CIBA 3OZIA 1GPJA 4HDRB 3PR1A 4ZT6A 2PGOA 2PIAA 2L2QA 2IEYA 1ZQKA 4FR0A 4HB2A 2QMOA 3O2QB 3JQQA 2QRQA 2QYOA 2EKPA 4LXYA 3V8EA 4NFLA 1MEEA 5KG5A 4FMCF 4YJ3A 2CKMA 2EGGA 4RFVA 1TM2A 3SG0A 2MSEB 1DZIA 2HCRA 1KRPA 3FRIA 2Q4OA 1GU1A 1TK9A 1RQXA 3DCYA 1E79A 1IXSB 3T9BA 2VSQA 5DHRA 4Q02A 2CHUA 3A6JA 2C9OA 1PK1B 1ZQDA 4I99A 4MUIA 3DGFC 2F44A 2GLTA 1LQUA 3KYIB 1O6ZA 4UBCA 1RC8A 1W9HA 2Y9PB 1C8LA 4MDHA 5GADl 2PMCA 4TS3A 1L7AA 2WWVD 5FFMA 5DNCA 5KDOA 4B3FX 1XXHE 2XCIA 4IQ0A 1HT2E 3H9BA 3R0VA 4IQ4A 5LZ8A 4L8YA 3TGPA 2ZTSA 3V8NA 2ZYVX 5LYJA 3U4HA 3B36A 1JAZA 1E9RA 5J59A 1JA0A 2VN8A 2XDQB 4XYBA 3H84A 4Y9DA 4Q34A 1A4UA 3ISBA 4OBEA 2P75A 4DDUA 4HWSA 4N7BA 1E6UA 1XTIA 5TS2A 4JQOA 2HGZA 3BFVA 4I2NA 5AVZA 4OXKA 1P45A 3HXKA 3PWKA 4GIBA 3EPJA 4GNRA 4FN5A 1U04A 5CT6A 4GRIA 2ZJOA 2Q45A 4IS3A 4IJ6A 3OTWA 1XI2A 1KKMA 2A5GA 3WFJA 2IVFA 3KPVA 1R3DA 2VDWA 3JTEA 2JB9A 1FFHA 1GM5A 2OC9A 1R6TA 3LUDA 3PSTA 4FDAA 4DDWA 4I29A 3RTAA 1QOZA 1ZGBA 2DJ5A 2YNMA 2B6NA 1SOUA 3OQIB 3SC2B 1Z2AA 1Y1SA 3MCTA 3IYLW 4R1TA 2IK8A 1WB6A 3RVJA 1HDYA 4ACOA 4IG9A 2D5LA 2PUCA 3OQHA 1DCTA 1QX4A 4KQ6A 2PT6A 4DNXA 4OQPA 1IK6A 4BNDA 3VI3B 1L8OA 2PIDA 4DEZA 5U4XA 3MS2A 4AJOA 4V0LA 4TKZA 3ABOB 1B41A 1TRHA 5GONF 3UYLA 1LD3A 4YMVA 1VB3A 2G72A 3OT4A 5KNBA 3KM0A 5JH7B 2WKRA 1C3JA 3NVKI 1ZD9A 1YS7A 2W93A 2G5HB 3S2SA 3AP3A 3MTEA 5IJAA 3TG8A 2AW3A 4MHTA 1BYUA 5JFGA 3AJ8A 5EIFA 2V03A 2ODWA 1A2OA 5FQNA 2HIGA 3IH5A 3MGIA 1Y4SA 4PLHA 5DWQA 2WUGA 3PIIA 3FGZA 3BXEA 4OMUA 3L0BA 3FPCA 5DLEA 2HHHB 1DCKA 3WHLA 4PAWA 4OXXA 2NXEA 5CDSA 1X87A 4RJ2A 3M9NB 1Q0UA 2G06A 2JJ8A 3ZGYA 5D6OA 1RJDA 4V39A 4E1AA 4I27A 4BRSA 2DR2A 2WUEA 2HLPA 4HMOA 3W9SA 1UIMA 5SYMA 3WGZA 4NXZA 2HV9A 1C4WA 4LV6A 1F2TB 3TN7A 4KSBA 4PO3X 1KMIY 1DVRA 4UW9A 2M0NA 3OJFA 4IDNA 3PEWA 1POXA 2KHVA 2QE6A 5ALWA 4C22A 1VL8A 1XMSA 3E3NA 3IN5A 1XDZA 3KFXA 4LJSA 5AHXA 3ZWAA 1EM6A 4CM4A 1JKFA 2BSXA 2AUNA 4PN3A 5U1PA 1C1DA 4X5OA 3SFTA 2GK6A 2WMYA 3C8UA 3HXMA 1K6MA 1GZUA 2QDKA 2ILTA 3BOSA 5ETJA 2ZSEA 1UAGA 3RBEA 4JH0A 1P9WA 3UOAB 4D8XA 3ZI0A 2B36A 4B5KA 4J16A 5IT0A 1RAFA 2CZCA 2FF7A 5JECA 3G7UA 1LPBB 3LZ6A 1TE2A 2SKDA 4C6TB 2BKAA 2Y05A 2KMDA 3G5UA 5CVUA 5E8RA 2KS6A 1JLKA 3TI0A 4BE4A 1VL5A 1D8TA 1S3SA 5CD1A 2RHTA 3C28A 1XGKA 1ZESA 4GOLD 3DYVA 3SDSA 1GFZA 1P39A 1PHRA 1GKLA 3ZLTA 1ZH4A 1ESZA 2CT8A 1HNWB 4Q3EA 4TUYA 3LIIA 3OT1B 3A9CA 2V6GA 3WL4A 4M99A 2OECA 2HMAA 2PT9A 3CZ9A 1XRQA 4BECA 3OUUA 2C97A 1Z37A 3LCJA 2ACVA 1BMFA 4KK4A 3U6KA 4LY9A 3KQNA 5BVHB 4A2QA 1G6KA 3ZV3A 4DMHA 2M1ZA 4M89A 2CJWA 1T0JB 4JELA 4BP1A 5T5QA 3TE7A 1IBCA 3HCDA 4RPGA 3K9FC 2FQYA 3A4TA 3K1AA 4MUHA 4BKOA 4XRHA 3KB6A 4R7GA 3K70D 1EVQA 3AMVA 4HXGA 1MT0A 3T4XA 4BWJA 3GNQA 3LDGA 4YPOA 2Z2ZA 2BCQA 4OHBA 1D9ZA 1EDBA 2W7PA 2J6SA 1ZN2A 4BASA 2PGJA 1GLGA 4KE7A 4PNZA 1AKRA 3U44A 1QRDA 3N8GA 1YB5A 1M5RA 4F8YA 5A9RA 2UZ0A 2XTJA 1JN3A 2PJDA 5KWVA 1U9IA 2GZRA 3D8UA 1KNXA 1SCUA 3VU3A 4JLDA 1BCSB 5BR1A 2PMDA 2H4YA 2YIDA 3FIJA 5EFOA 2HDHA 2O05A 4EHJA 3O8BA 4ZCIA 2JGLA 3QRWA 3JYQA 1ZN7A 3TW4A 2PL5A 2JH9A 2QTLA 1T1IA 3E9DA 3P9YA 4NWIA 1E59A 1D2MA 1VBNA 2CBGA 4F72A 1J09A 4KPGA 4AJIA 4R8UB 3HEBA 1LF0A 2KBEA 2WB4A 3I9V1 4ZA2A 4S1WA 3GLSA 1K3TA 4D4LA 3FF1A 1MOQA 2GCOB 4KIUA 4MW2A 1N75A 1C3VA 4KQXA 4Y2TA 1KORA 3ABZA 2OCPA 2PJUA 2AQKA 1RPAA 2FI1A 3O95A 4ZOAA 1F6BA 3CT4A 6PFKA 4K8OA 1NQ5A 1UMDB 4JC5A 4GU5A 1Y9ZA 3UHJA 1NNUA 4PS0A 4Z3KA 4X24A 3BL8A 4LFBB 1AGXA 6CHYA 2VRNA 4QGBA 3GCXA 4FGUA 3SXUA 3Q3CA 4W5OA 1YR3A 4R8RA 4GXRA 4FFDA 1KOLA 5B12A 4M0CA 2C42A 3KWFA 3U49A 1B3RA 3NBUA 4AKSA 5J63A 3H2KA 3OA0A 1HOXA 1N2BA 2KMLA 2YS6A 1ZICA 3UWMA 2PO7A 3VV3A 1WG8A 2IXDA 3UPDA 3TSYA 3RTDA 1ZK0A 4MROA 1KQFA 1H05A 2ECOA 1YFLA 1YS6A 1PGQA 2D0PB 1D2EA 3FTFA 3ZVNA 2GCNA 5EEHA 4KLZA 1E5LA 1S76D 2RIRA 2VIIA 4DMUB 1OZHA 3W5BA 3RBXA 5TR9A 3UIEA 1JXAA 2N1BA 4R66A 1E7MA 2EBWA 1ETHA 5UKDA 3S8EA 1JG7A 4OM8A 1XTZA 4S3MA 4CI0B 2ZUEA 3MRTA 1XYVA 4D97A 1VSBA 1OBFO 2REQB 3BDVA 2BYTA 2WIKA 1UZNA 1KI6B 2YASA 4FYIA 1S6YA 4YACA 2DCMA 3JQEA 1N8KA 3AW9A 1NE2A 4OOEA 1EAYA 2QAIA 2WPDA 3WL7A 2BHRA 3NRJA 4X1OA 3D54D 4OL0A 3O83A 4UKDA 5F9LA 1U2PA 4KCGA 2Q3DA 4FBGA 1DRVA 5BN5B 3NUGA 4AYTA 3GPIA 1H8HA 3EVTA 3VPSA 3KQTA 5DG7A 2PMFA 3FDXA 1AKMA 1EDDA 4KXVA 3D5TA 5H8WA 4TYPA 5LLSA 3CEAA 3B1JA 3R7WB 2IU3A 1Q57A 3EMBA 5C51B 2Y0DA 3K2EA 3ZHUA 1DIAA 1WZ2A 3BMXA 4ID3A 3ZZUA 2WVHA 4ER0A 4BKRA 3OIYA 3F6CA 4RD4A 3E1SA 4KUHA 3ZHZA 3FLEA 3B60A 1ZX1A 5HWSA 2HDWA 4B34A 4MVJA 2WFMA 4ZAGA 5B3LA 4I1YA 3CBQA 3RSOA 4LJ7A 1T3HA 5COAA 4YR7A 1QYXA 4PICA 1UWVA 1CP2A 1KSJA 4FMDF 1JNXX 4PEVA 2VKTA 4P4NA 2FEMA 2II6A 3PIRA 1JJBA 3N0RA 2G6BA 1DFIA 5AUNB 5I9SA 4RKQA 2WB1C 3T12A 2XHEA 3HU5A 4WCFB 1OKKD 4MA0A 2GPWA 4QHTA 4JI3B 3JQ9A 4MZXA 2FVYA 3JZDA 3D8BA 4YMMA 2BGKA 5CGQB 3RAJA 1Z68A 1G9TA 3A6EA 3FXAA 5FBHA 5H3LA 4MF2A 2XNDA 1G3QA 4KN7A 3P7MA 1G8PA 2FFAA 5KIAA 4YDRA 1P74A 3W5IA 3RFXA 2RARA 3HXOA 5BV2P 1D8LA 4N3AA 1NMYA 4EZIA 3AO0B 4UBBA 3SYMA 1DTSA 1UH5A 4WKOA 1D0SA 3F7OA 3TAQA 2VTDA 3AY7A 4KR9A 2W2VA 4RELA 2PQ6A 3HRDD 3GLIA 1F38A 4TV8F 4PYRA 3ZLBA 1VRWA 1QLWA 3RVRA 5JS8A 2DPJA 1C9EA 4BO3A 1IY8A 5H9WA 3UXMA 4MQEB 5CVVA 4W4TA 4OK6A 3JCZA 1S1CA 1ZQYA 2IP4A 1NPTO 4GZMA 4AWBA 2UZIR 3KEGA 3VDNB 5KNCD 4UVDA 2NO4A 3JQFA 4BN5A 4Y1RA 1ZUIA 3PFBA 2BC9A 2Q4DA 4NFSA 1AS0A 1TYZA 3OSUA 5CFPA 2NOAA 4JSRA 3E4DA 1OX4A 4PYQA 1MT3A 1PUXA 5F7ZA 2ZRKA 4M86A 3T9FA 4BFVA 2V0NA 1N2CE 3I9KA 3NHRA 1YQXA 3O3MB 1P1HA 2O7VA 3NH9A 2RH4A 4Y67A 3MTBA 1NNEA 2HSWA 2Z6AA 3Q7PA 2FYTA 1M1NA 2EX0A 4PRZA 3QVGA 1AV7A 1FS5A 3R7LA 4FOPA 3P2JA 2J4DA 1Y4ZA 5F78A 3W4IA 3KOWA 2A5JA 5JANA 1UJNA 1H2ZA 1YA4A 3FWZA 5E95A 1SWWA 4TLAA 4ZVMA 3T3EA 4PZYA 1X86B 1UEJA 3PRKE 2IHVA 1MAVA 2OO5A 1UJCA 5HQTA 4B7UA 3PF8A 3HBAA 3IVRA 1I2MA 4IKEA 4WD3A 4MV1A 3RRXA 4YMHA 5DULA 2HZBA 3FB4A 3KKZA 1MHPA 3VHXB 4XDHA 4IEFB 1JAYA 1R9MA 4BO6A 2PVCA 1L4MA 4HVAA 5BURA 4IDPA 3HN7A 3AFGA 4UCQA 1O1YA 3CT6A 2R6AA 2X2EA 1KI9A 3DF9A 4KPUB 4U2DA 2IYSA 3O1LA 2FUKA 4OK3A 4BWYA 4NJ8A 2E5WA 5B36A 1V1RB 5FO1A 1FSZA 1IJEA 3ZY6A 2NTJA 4Z0NA 5FT9A 2Q0SA 4ON9A 1YZUA 3HV0A 3K9GA 5GJVC 4QLAA 3LUFA 3RPEA 3SAFA 4PJ0U 1RRFA 3HH8A 3B9RA 1CUFA 1TMYA 2YICA 1GPWB 5GOZA 2BDPA 4M9HA 3KXIA 2BFCA 2C9MA 1CWUA 2OGZA 5DLDA 1CDZA 1ML3A 4D9GA 4XH9B 4JS0A 1BPEA 3EK2A 4DF3A 2GDZA 3KG2A 1CUJA 3COYA 4E1VA 3C1OA 1OFUX 3PT9A 4XDZA 5DU2A 1YIOA 3IRVA 2F43B 1M7HA 3NWJA 4HC4A 4P3KA 3MCZA 2VSXA 4DUGA 3Q8QB 5JAQA 4DIEA 4XSVA 3LDFA 2YXEA 4NLNA 3ALRA 3W8DA 5IK2D 1OQAA 2WKQA 3JRXA 1H9AA 1K1SA 2XWPA 5J4VA 3EHEA 2X1HA 3RVSA 4QKQA 2YX1A 5J2IA 1GNTA 1RHUA 3KL2A 2PUGA 5TEVA 3TRKA 3PX6A 5LLTA 3QELA 4X7MA 3R40A 1RHQA 2G0TA 4BV3A 4FD3A 1KFDA 3U2QA 2J7KA 1U9YA 1FXSA 2Q6OA 1JHAA 3K0CC 5AM1A 3NUQA 1JX6A 3RYFB 2C28A 1N6IA 3I2GA 5SV2A 4U02A 4JFRA 4FQ7A 5JBQA 3C6KA 3GJ0A 1KIFA 4CG0A 1SA0A 2BI4A 1RKBA 4L8VA 3PEYA 1H2FA 4JJAA 3MILA 2BRUA 5JAPA 8ICOA 1LXCA 3VUEA 3H0RB 2X8WA 4TVKA 5L3VA 2UV8A 3TLAA 1AS2A 4CI9A 4EG4A 5DKWA 1DNPA 3X2EA 2NSYA 2NX2A 3WB0A 1ORWA 1U0OC 2RAUA 3PX2A 4D82A 2X8JB 4HQRA 1APBA 1QP7A 3DL7A 2NRZA 4ZVQA 4WX2B 4ZEMA 3CU5A 2R6FA 4KTVE 3F5AA 2BKEA 4P4PA 3ZJ5A 5FOXA 1VJRA 1Z12A 2FFJA 1E3SA 4MUAA 4YRJA 2K60A 1RADA 1J5XA 4RH3A 3O7MA 3OU2A 1SPBS 4HRYA 1KZ1A 3UKJA 3R24A 1KJQA 1OH8A 1MJFA 3GILA 3B85A 3W2IA 1YACA 2C57A 5KFRA 4O59O 2AN5A 2SKEA 4BJ1A 3DTVA 5JCOC 3MLBA 4H16A 5JU5A 4JMLA 4LJXA 3NVZA 3HCFA 3A27A 1L4FA 1W76A 2BFBA 4I2FA 5ALVA 3K5PA 3U9SA 1JSRA 1DC5A 3U13A 1FMCA 4Q05A 4J2OA 3KCQA 5AOAA 2ZIFA 3PZBA 4RL6A 4JJKA 3BHNA 2VP3A 3HYRA 1NW9B 1RQPA 2XUOA 1YKSA 1BVRA 1EGHA 3SM9A 1FF9A 4IIHA 2ZW9A 1BXGB 5KNDD 1C30B 3WNVA 1G41A 1J00A 1KKLA 4XYGA 1EGAA 1WSBA 2W6IA 1Y7HA 2EG5A 2AJQA 5THQA 4XLZA 1Z36A 3W6ZA 2ZTDA 4NV0A 3NYWA 2VTBA 3H65A 5CHYA 5TMPA 4Q16A 4EYHB 4M1TA 4PQGA 1K9VF 5IM5A 3ZLVA 3HJGA 4LVCA 3HR7A 4MAFA 2JARA 2PSHA 2I29A 1FUEA 2R6R1 1J2RA 1TAMA 3NGDA 5BPHA 4C01A 1EWQA 4PX9A 3TINA 4FR2A 5SZJA 4RBNA 2PV0A 1I3OA 3F8SA 1T10A 3FR7A 1N33B 3PK0A 3TK1A 3MWDA 13PKA 1O96A 3I9MA 1P17A 4O1HA 4EMTA 3KU1A 3T1NA 4YTEA 5JLJA 5IJZA 1OZFA 2RHDA 3RT1A 3V3KA 2A1TS 5HG0A 5JHGB 1C80A 2ZAYA 3QWAA 3TTXA 4Q1FA 4YWJA 3H11A 1O94A 3IP9A 1Y5IA 5LCXA 2ID4A 2A58A 4PCAA 4CMKA 1TM4E 2IY8A 1N2JA 3E8SA 2HK6A 2JAUA 3U19A 5ALKA 5KS2A 4CHGA 3VSCA 4E4TA 3M4YA 1CRQA 4DJFC 1Z7YA 5AYVA 1X70A 4YT4A 4O4IA 2QJTA 2ZG6A 2OORA 3PHJA 2ZXHA 2OD7A 4KWCA 2YHIB 2OUKA 2HWXA 4LJ8A 4MEXA 3THWB 4CDMA 2QG6A 4C0ZA 1J8VA 5CFRA 2CFTA 5IMBA 1N2GA 4Q7JB 2PWZA 5L7WA 1VKRA 3PITA 3KVOA 1K4YA 4BDPA 4GSYA 5EMKA 2ZRGA 3PKZA 3FUCA 3UQ0A 2PCJA 2XXJA 4HWGA 1FJGB 1E2JA 3LSYA 3G8CA 1J5PA 5CJPA 1OZAA 1T8PA 1A82A 2Z4SA 1JDPA 3BD6A 5E38A 2QT0A 1GRRA 3NTOA 5EXEA 4FS2A 4M9NA 2V6JA 4Z9AA 2QGFA 3EAQA 1Q83A 1W6UA 5LIPA 1UOPA 5AVJA 1MX3A 4RD6A 4O0MA 4PSUA 5HUHA 4TT3D 2E2WA 3H0LB 4F1WA 3R3ZA 1ZUD1 2FR8A 1E32A 1X1AA 1YR1A 3IIMA 1HQCA 2VCEA 2Y77A 1U7OA 4D44A 1NK6A 2BISA 2B3DA 3N2KA 1U7DA 3KQVA 2H4XA 1RYUA 4JNKA 4Y2QA 2WICA 1NPYA 4FT2A 4F2DA 2K2QB 4RZQA 2FCAA 1KH1A 4MP3A 2P0EA 1GZHB 1M0EA 4DRZA 1TCUA 2NO5A 1DEHA 1KWGA 3CZPA 1K1QA 2IHKA 3RSFA 4HQKA 3GJ7A 4P83A 4RD1A 4PXYA 4RNCA 1DT3A 3LDUA 4NCNA 2FP3A 2ZPAA 4ZQBA 2YV2A 3ICEA 5B3AA 5DYWA 1U2RA 5A5EA 2G7ZA 2VHXA 5F77A 4ZXFA 4EGAA 3V7JA 4RIIA 3FYDA 1YB6A 1QRTA 4YCCA 4D6PA 3HLKA 5BN4A 3ZK8A 2XYQA 1FUKA 3V4LA 3AJEA 2OB2A 1SQ0A 3WVNA 3O8QB 4PZDA 3PDCA 4H1VA 1O5TA 2AYZA 2VPPA 4AO6A 1IQ0A 4E03A 3PC2A 4BQPA 4CKCA 2C78A 1OXBB 3SC6A 1ZQUA 1CY0A 4HZUB 3SSAA 5DHAA 3WIBA 1TLTA 2XX3A 4GE3A 3IV6A 2JFXA 3ZE7A 1NW6A 3OM1A 4V1CI 4IYRA 3AJRA 5K09A 4INOA 4JL6A 8ICVA 3GL9A 4Y9UA 3V1YA 4DWIA 4B40A 4KWTA 1IM8A 4L6AA 5BMVA 4JGGA 2YHBA 3IDZA 3MUOA 2IW3A 2QQGA 2WYWA 3UMYA 4X00A 1IZ0A 1U28A 4KI0A 2WLTA 3V1LA 3IKVA 3OQPA 3ET4A 3VR5H 3NTVA 3IBYA 1ZMXA 1O4VA 3AJDA 4M1WA 1QSYA 3BEOA 1VCIA 3UGTA 2G77B 5JT1A 3Q8SB 2I9PA 4P2HA 3I2KA 3SZRA 4GEGA 3LPMA 4H7JA 2IA5A 2YZGA 2PZMA 3C74A 2R2AA 1ZM7A 3KEQA 4HNRA 3DNMA 4QAQA 1HNXB 3PQ3A 2LIPA 3UWSA 1E3EA 2I3ZA 3QIVA 3OP4A 5IINA 5JJKA 2X0KA 1T34A 2F2TA 5J4HA 1UXHA 2VSYA 1L1FA 3DPSA 4YT8A 1O57A 4W1QA 4IXDA 2BTOA 1RJ9A 1DOZA 5D7BA 4A10A 4JXKA 4GXJA 5I48A 1D1TA 4XD7A 4LWZA 4TTIA 2R0QC 4J9SA 1V8PA 3VSEA 2V4MA 1T8UA 2OBMA 2W0MA 3T3OA 3A1DA 3CUKA 2EDAA 4KZPA 2I7XA 4HO1X 3N2YA 2PDAA 3A1FA 3U1VA 3FGPA 4P4LA 1ACLA 3JALB 3QBVA 4GE0A 1OI2A 4AZTA 3GRYA 3UXHA 1E5QA 4FZMA 3L0YA 3HRIA 3HBNA 5TXGA 4JVLA 4ZO7A 1USGA 2AV6A 1JLHA 4J0IA 5H80A 2KZZA 3BD9A 1MP0A 1R9NA 4Z53A 1C7YA 1BEUB 3AHGA 4USAA 1Y82A 4XYEA 4K6MA 3RS4A 3L0DA 2R8JA 4H59A 4LWQA 1ZQMA 4FONA 2EW1A 4W1PA 3G6VA 5AESA 4F9FA 1E1MA 1J5EB 3RR7A 4Q1EA 2G5IB 1U81A 4YJ2B 2TMDA 5HZMA 2W7TA 4QBHA 4K9KA 1NXOA 2GWHA 1EJBA 4Q9NA 3L8YA 1QCKA 1TJPB 3R7AA 2QI9F 3A3PA 3K0HA 4IDAA 2PS0A 1XC7A 2FRDA 4TKMA 5J23A 4CG2A 4ERXA 1A4IA 3C1YA 3NHBA 3E8MA 4Y2YA 2XB6A 1T0IA 2GZDA 4KWIA 3WLTA 4PWYA 1VDZA 4MCIA 1OXXK 4DEXA 2ZE8A 3GGSA 1YTLA 2D1YA 4GXQA 4EBBA 3ME5A 4CCYB 5CA1F 1GPDG 2QRVA 3PNVA 4DWVA 2G28A 1MA0A 1JHPA 3MTGA 2IPNA 3EXIB 5KFOA 2D1RA 3FBGA 3SC3A 2EBUA 3UXOA 2QZPA 3WNCA 4YHHB 2B5VA 5B58C 1T9HA 4RGQA 5FEUA 1ONOA 2EQAA 1R7RA 3QPCA 3RARA 3WWPA 3IO5A 1EM8A 4QVKA 4ZO4A 4QXMA 4JKYA 1PO7A 3TTVA 3FRJA 1Q16A 5HVNA 4ROSA 1TKRA 4I4LA 4YO7A 4HLNA 1OI3A 2D3WA 3KDSE 1S2NA 3DJYA 2QN2A 1NW3A 2VTKA 3F6SA 3A04A 1I4DD 4KR3A 3JPPA 5K0NA 4X85A 3HJRA 2PKQO 3JZFA 4A26A 1VPVA 4C3ZA 3I2JA 2BFNA 5H2FU 3C0KA 4HDAA 3DLCA 3UA3A 2HMSA 3EFOB 3P2MA 1H2AS 3N5CA 5CD9A 1ZW6A 2WK1A 4Q01A 4FCTA 3GLHE 2UZAA 4LBWA 2RDIA 1BPZA 2CMHA 3LX8A 3R6WA 5L4SA 2V1XA 7ICVA 4UAGA 3ZZNA 3VMFA 4IZIA 4A16A 4YGYA 1BA3A 5ERYA 2NSDA 1UKEA 5TT0A 3OETA 2NTVA 3T9CA 1A7UA 4DPKA 2X3FA 4HOYA 3LW7A 4LHYA 1P1JA 4I4TF 1JDSA 3QVWA 5AJVB 2Z43A 3JQ6A 4EYSA 1FFBA 2K2WA 3ORSA 4IZOA 2ASEA 2BFDB 4R01A 3L6EA 4IF4A 2AN9A 4A73A 4JAVC 4QELA 3N4MB 2IH4A 1TNDA 5D6NA 3ED5A 1I1OA 1TM1E 2XMCA 3RYCA 3MR5A 2A5DA 1X2EA 4QOSA 3UOGA 4QSMA 1ND5A 3L6CA 5TLSA 3MJ4A 4LZLA 2AXPA 3COJA 3SAHA 1AMNA 3UC9A 1U7HA 5AM3A 5BSMA 3K70C 3EQ7A 3AJAA 1I2DA 1UQTA 1ORHA 3AVQA 2QG4A 5KJCA 4LBYA 3GRUA 5F3WB 4UMVA 5EZYA 2Q8NA 4E6EA 4X6LA 4XD2A 1TIKA 1C9YA 4A9AA 3PV0A 4K03A 4WXPA 1L4EA 5JARA 3CF4G 5AK5A 2OHJA 1QX3A 1GJRA 3G23A 3QXJA 1EIZA 2JLZA 4S2EA 3PYXA 4UNPA 3F5DA 2QYHA 2QY6A 4CM8B 4TXMA 1QU2A 1SM4A 4R9UC 1J1ZA 4DA0A 2RJOA 3NTUA 2H9YA 4DIDA 4QWAA 1PGNA 2XECA 5LQJA 4Y1GA 3E0QA 3JYPA 3QNWA 2YUIA 5IF9A 3GNSA 4EPRA 4B81A 4IAOA 4KLTA 4ZPXA 3UGJA 1W19A 2PT5A 2X2OA 2XOXA 1E5TA 2I6TA 4EKIA 5BWBA 1N32B 1Y6JA 4WN9A 4Q4JB 5MFZA 1QLHA 2ZCUA 4JHLA 2CL0X 3BTUA 3AVTA 1Z6TA 4JP2A 2CMGA 2ZREA 1X9XA 4YQYA 3VHQA 1Q6ZA 1VECA 1QGZA 1G63A 1DAPA 3AQIA 3WLEA 3QX7A 4OKIA 3GD7A 2EKDA 3U9TA 2F59A 1BDHA 4RF2A 5FFNA 3R3HA 1VXRA 5JQGA 3ZY2A 4UCWA 3PVZA 4EZBA 721PA 3IUQA 3DCIA 4QD3A 4GMXA 2I4OA 2Z58A 4R2HA 4PFKA 2NSHA 4RF5A 4FFRA 4M1ZA 1WHSB 4IGKA 1J23A 2IYZA 1FQKA 2O7RA 1SBHA 5JTUA 3V8RA 2KHZA 2WU1A 3AXTA 4ZZ1A 5E3JA 1VOTA 3IIEA 2DLNA 2HA3A 3L8EA 4ASUD 3ADPA 1GAJA 4N54A 5T8KA 3DFIA 4GLFA 4NCIA 4DLGA 5JDIC 4N6NA 3ZV5A 2CYAA 5CVCA 3IR5A 2WUVA 2XICA 4OMFG 2R8OA 5HUJA 1QVVA 3UW1A 4HAYA 4LJRA 4S0XA 2IBMA 1FFXA 3VSDA 3HK2A 4AICA 4LX0A 4BKMA 5L3SA 1DTEA 2EJTA 3KZMA 3E5MA 2A0WA 3D7RA 4ZOBA 1XL1A 2JA1A 2LP4Y 5KTKA 4G89A 2C29D 4ZHQF 4OH1A 1ZI6A 2Y4OA 3OCZA 2REXB 2Q3LA 3DOOA 1OAOA 4AROA 4AWXA 1UXGA 1W4BA 2RAPA 4HWPA 3CVXA 2JIZA 3BAFA 2H06A 3V3TA 3I72A 1YDWA 3A4YA 2RHRA 3STXA 1ECFA 1Z63A 2R25B 1UFKA 5J2TA 5TF0A 2H31A 3SZ2A 5DI9A 3FZGA 3TSOA 5DBOA 5ICGA 1PYGA 1I51A 5E6UB 4DUYB 2D4AA 3NAMA 4FWTA 1WX1A 1C8BA 4EI7A 4NE7A 5DX1A 4Z54A 1RP1A 4FO6A 3M3DA 4UXIA 3JZAA 2HRCA 3DTTA 5GINE 1KP9A 4LV8B 2RJ3A 1A9QA 3ZNNA 4DA8A 2BPFA 1V85A 5CTJA 1YHYA 4U7CA 4AXXA 3WISA 4F91B 1T94A 3SDZA 2VDKB 4I1PA 1OFVA 2H51A 4MSUA 1UT5A 4JI7B 2B2XA 2EH9A 3DUFA 3B5JA 3TD9A 1BEZA 4TXHA 1JHYA 1OLOA 4LXQA 2MAXA 4XPZA 2ZRQA 1PSWA 4G9BA 5HKKD 3B6EA 1P1IA 1PR6A 3G2NA 3RSQA 3JPYA 2AL7A 5CB4B 1P0CA 3QLVA 5FADA 1NVVR 3HNRA 1TIBA 1KZYC 1UJ5A 3CF2A 1PK7A 5C1PA 1D9XA 2K8CB 2A0UA 2J85A 5F7OA 3QU2A 2D3DA 1OR8A 3ZGOA 4LYEA 1AG9A 3HFGA 1BRMA 2IZ7A 4NXNB 3WGUA 3NC1C 3K4PA 3W9UA 5K99A 3LCVB 2IITA 5CB0A 1VJ5A 3TJMA 2J9FB 1LX6A 1MJ5A 3B9JA 4OPMA 3UB3A 5C18A 5TY0A 2IYRA 3EY4A 2VXBA 3P9PA 5SZHB 4FCVA 5L53A 1WR8A 2ISQA 2ZS7A 5I7FA 3P0IA 1MAAA 3W5CA 1W5BA 2Z4TA 5C8YF 5I7OA 2D1TA 2BSAA 3KAQA 1NR1A 4DF8A 4ZO6A 3P52A 2OZEA 4FWBA 2NU9A 4L7VA 4QBIA 3DO5A 4PIVA 2ZXFA 5CEHA 4V1CB 3W8RA 3LUPA 1WIWA 2HWUA 1AHHA 4DOMA 2CB9A 1H93A 4ITUA 2EFEB 2CXXA 3T7CA 4JUBA 2R79A 2NXWA 5G0TA 4F4XA 5EE5B 4HMQA 1DRGA 4TYQA 1LZKA 4EMUA 2AN1A 4XUSA 4KW7A 1KR2A 3W6NA 2X7XA 5HIMA 3KJZA 2XC9A 2H3IA 1TAGA 1ZGJA 1Q12A 1QUFA 1HE5A 4QBFA 2CLKB 4RVUA 3B1XA 1JYFA 5BUCA 3KWLA 1AUOA 5I7VA 3F73A 3W7BA 3ASUA 4MV4A 1FTQA 2J6CA 2QUHA 1SVSA 3ILHA 1QAOA 1ECLA 1Z2NX 4TN5A 2X4LA 1DAEA 3W79A 1HV8A 4J9NA 1N0VC 2C31A 3K15A 5KYYA 1FLNA 3SVLA 2Y1WA 1CUSA 5G0UA 3DEHA 4FI3C 2OAGA 2FXVA 4UB6U 4HDMB 3GPLA 3IKMB 1Z5OA 4WKGA 5KYGA 5C9ZA 4BWMA 5GY7A 4EFMA 1EDEA 2B2NA 2JVJA 4RMHA 1II8B 1XMIA 4ND2A 1U0FA 3OEED 4Y6GB 4K5QA 3SMVA 4QUHA 4RIHA 1KO5A 4NU0A 2E48A 2WA1A 1COWD 1FLAA 1RI5A 3I52A 1Z33A 5EHZA 3FYSA 4ZI7F 3UJBA 2SKCA 5AKIA 1V48A 5HCNA 1V6CA 2OBFA 4MFFA 2A14A 3PX3A 2G8LA 3AL0C 1YRLA 4B6SA 1HE8B 1KKXA 4O4HF 1MIOA 4DFPA 5JVDA 2AEMA 2C2GA 1IHXA 2EGUA 3RC7A 4QRIA 2BI7A 1JBQA 5K05A 1KDHA 3F5EA 1YL5A 3NHAA 3V7UA 4QDZA 4CZ2A 4GZLA 4BLTA 4BV9A 1NAIA 2QX7A 4FEAA 1N7JA 1QQ5A 1XNJA 1QMPA 3M4ZA 4TQGA 1V7ZA 2VJLA 4MB0A 1IZ9A 2ZUTA 1SB9A 4C2BA 2W9MA 1C9NA 4I5DA 1BFDA 1KRHA 1L5ZA 3H8WA 3AUOA 3GEDA 4R9VA 4R51A 2LPEA 1GA4A 4JJ8A 1T8SA 2W5UA 4MUFA 2A0KA 3THSA 1Y33E 4DXDA 1QYCA 4BJ3A 2QW8A 4Y8VA 2XD9A 2B7CA 2V7XA 1OWNA 3I4FA 3EAFA 1T29A 4ND8A 4H6PA 1QS0B 3IP1A 4C0LA 4BKQA 3ZJUA 5D1NA 3LLMA 3O8DA 1OFUA 3SGLA 2CUKA 3H2SA 3CR8A 3NM5A 2JIMA 2RI1A 4RUKA 2QZJA 4IKOA 5BW4A 5AXDA 1CQXA 2BP7B 3H9EO 4XCQA 1TZKA 2WBLC 5EXXA 1O77A 2GPTA 4ER6A 1XNHA 4D5EA 3JRWA 4RVOA 1AGYA 2W0SA 3CVOA 3L7OA 3MEQA 3MELA 4BJHB 3RS8A 3RYIA 4CR7A 4DIFA 1X7YA 3K32A 3ZCXA 3ZG6A 1YONA 1M67A 2Q7XA 2Q0HA 3KYBA 2R18A 5IG2A 3QKSA 1H23A 3HJUA 2OLKA 5DZSA 2ORIA 4BGVA 1DQRA 3KB8A 1VI6A 4PAOA 3MFYA 1A8HA 2DT8A 4RA6A 2ZBEA 1SZDA 1QK4A 3EIEA 4RAQA 2ESEA 4BYMA 1ZINA 2KE5A 4DNPA 1YOVB 3T5KA 4OF4A 4RLQA 1U5AA 4ZHSA 3DZBA 3EQ2A 4IOKA 3MWGA 4JWNA 4MYHA 4W8GA 2NU6B 3CRXA 2YRXA 2EATA 5L3ZA 4QYTA 5KFHA 4BLWA 1C3EA 1T2CA 3JD3A 4G1MB 4C5CA 2Q4TA 2N42A 3LTNC 1DRKA 5JXWA 4YLGA 2ATIA 3M6ZA 4WZ6A 2HQ1A 4MQLA 4BNKA 4YJFA 1G3RA 5LD2B 3EIQA 1V8DA 3L4BA 1MRZA 5ALIA 5IRCD 1Q11A 2Q4BA 1Y8QA 2V0GA 4EENA 4BOYA 3SLGA 4FNOA 4LYAA 2G08A 4DOBA 1N2IA 3ES9A 2WT9A 3ROEA 2CK3D 1WZCA 3MTIA 9ICIA 3IEUA 2FLWA 3Q98A 3WKAA 1SHKA 1W25A 3DLBA 2X6TA 2G40A 1MB2A 4CUJA 1EXWA 4LHSA 5AR1A 3WRXC 1DAKA 2ZJ2A 3G85A 1QZTA 3G1TA 3PTAA 2Z09A 4OQMA 2BCUA 1A88A 7MHTA 4IWXA 2OZLB 4BTVA 1EFAA 2FZEA 4QRDA 4BMNA 2I99A 2D74A 3SEAA 4J7UA 1DQZA 1T9ZA 4D43A 1UKCA 2OG1A 1F20A 4TSRA 3FPSA 3S8MA 3P2EA 4EY5A 1P4HA 2WYVA 4DSLA 2VH2A 2G6TA 1YU6A 5IEBA 1ZH6A 2I9GA 1EK1A 2VRCD 2ADOA 1Q3VA 3PC4A 5KOYA 3OIDA 2ZUFA 1L1EA 5KYUA 2C9DA 4CCSA 3ZI4A 2LKCA 4RQ1A 4R2LA 2C04A 1QE0A 3DTYA 1AN0A 1B22A 2W2NA 5JDCC 2P1DA 2KSQA 3RJFA 4QFCA 1V5IA 4BAZA 2D3TA 1YJ8A 2EZ8A 1TKCA 3TTYA 1YZ7A 2V8BA 2VHCA 2HK7A 3OCWA 2HBMA 2JBHA 4UOZA 4EFKA 1P8AA 1LK0A 4JYZA 1NQAO 1P8JA 2W2KA 1WU8A 2OHFA 4TURA 2J3KA 4EW3A 2R5FA 2GBLA 4GHWA 1C14A 1IJFA 4QZFA 2HRZA 4FEGA 4B71A 3E35A 4EHKA 1IXRC 3I76A 3V8QA 1XXLA 5CH5A 3HKCA 5ITZA 3ZS8A 1VZ3A 3D7MA 1EK0A 5BSVA 1UP4A 2I2BA 3U3RA 2J3IA 1ISIA 4AKIA 1MR3F 5FEMA 1SUWA 1EI9A 4RVSA 5FPSA 3W6PA 1PHPA 3AHFA 1KJZA 4IDQA 2YWCA 3UXPA 1MGOA 1YU9A 4RPXA 4JSTA 1JMVA 1X77A 3KB2A 1E9EA 1XLWA 1EFVB 3HCBA 4LPKA 4B87A 1FRZA 3PDIA 4WKNA 2QVGA 2ODEA 3PQ7A 3JVUA 2A9JA 3BF7A 1E1DA 1W29A 1PJQA 1XWWA 3ZE8A 1GVHA 3VU0A 4NFYA 2GJKA 1MO6A 3TDNA 5FNVB 1XTJA 4KQ9A 2HHAA 4PRKA 4X1IA 1EA5A 3H1EA 2P9CA 2Q7OE 2O9JA 2X5OA 3AUXA 4WHMA 2WWTA 2PD4A 4M8SA 4L07A 2XZDA 5E6RA 3NPAA 2J3MA 5J0XA 3AM3A 1PQ4A 1L4UA 3ROGA 2PVPA 4RY9A 1YZTA 4WNIA 3S2ZA 2YV3A 4NJMB 4NARA 2MTBA 1X8JA 3PUWA 1L7OA 3COSA 2D7DA 3OAAD 5EQFA 1QIKA 5L3QB 4N1AA 3H5NA 5AQ1A 2JFZA 4YAJA 2Y1JA 4Q9AA 3WLOA 1CUWA 2AHOA 2O7NA 3NIWA 4AF6A 2X5JO 4NCKA 4JBIA 2P27A 3N6XA 4KNWA 4PY2A 1GKKA 3NRBA 1VHQA 2CCKA 1Y63A 1GPAA 4DCUA 3JY6A 3CY6A 1M2OA 5EY5B 4F6LA 1B1CA 4ED0A 3RANA 1VPDA 4EHAA 5G0VA 1Q19A 3O0FA 1BTOA 2WF9A 1GQQA 4Y30A 1JDUA 5AJXA 4EY7A 1O87A 1UPUA 2OCXA 2VXOA 1UK8A 1S2GA 5BT8A 4OU4A 3LZCA 4N5HX 3LVFO 4RVHA 3W5DA 1XL0A 1DKPA 5EESA 4FOLA 5HR5A 4IDOA 5E9WA 4DLNA 2DQNB 3VNRA 1LQ2A 4IJUA 4G0VA 1LKZA 3AHDA 4QO8A 2WJ6A 4TV9F 3WBJA 1I4TD 1VKNA 4E0DA 3ORRA 3E9RA 3DE0X 3WLQA 2QTCA 4NXMB 1F2VA 4R8SA 4QIWF 4BL5A 4R8VA 1O8BA 2GETA 4V0QA 3RC3A 3FKJA 2B4TO 4R1OA 2VANA 4PRLA 3GLTA 4HNQA 4YXJA 1QSLA 5GVRA 3LC7O 4MIOA 2B34A 4UBIA 2GPAA 4KRXA 3B6MA 3O31A 4L3WA 1RDFA 5AICA 2IYLD 2BEWA 4IBOA 4OAQA 3UK0A 1NQVA 3VYTB 3F2DA 3I9JA 4II7A 4P7FA 2Y9MB 1L3CA 2AA3A 3M5DA 1P3JA 3ZQJA 4O3FA 3EEOA 5HZHA 1L5HB 4GAEA 3Q9SA 5EXDA 3WB2A 4A5SA 1GU7A 3R7NA 1XZPA 3UAXA 3KKMA 2NUAB 1W85B 2X22A 3LKZA 2QXUA 3E81A 4ZDJA 4Q7KA 5EJ7A 5KINB 1OT3A 5L7YA 3F98A 1CSEE 2WAQF 3DP7A 2YVQA 4LDPA 1PQWA 2C88A 3QU7A 3OQVA 5KFCA 2Q9UA 2C54A 4JJ4A 4FJ2A 3IEPA 5JXIA 1VE1A 5B6JA 4RK5A 1NVFA 2RH8A 3DAGA 2RH9B 4KN6A 2PHZA 2PUEA 2ALJA 4B6OA 5JS6A 4X65B 3TFSA 3ZIAD 1U0EA 5JSHA 2LXNA 4LRTB 2Q6TA 1VC2A 1RYFA 1VFNA 5HBRA 3RVKA 5A6SB 4HEQA 3F6BX 2CSXA 4NZPA 2QQ5A 2I03A 4EBCA 2ZPTX 1KYWA 2A1IA 4QPCA 2ONJA 4F21A 1EZ4A 1OXUA 1FMTA 1JZQA 1LKYB 3RADC 4WT7A 2PX5A 3DE7X 3GFRA 2XQKA 2FPKA 1RKUA 1L6IA 1N7IA 4C0XA 2OBLA 4BO5A 4EG3A 2BI8A 2WSSD 5HCIA 2DF8A 3NEYA 2K89A 5T41A 2B1GA 4G0QA 2FMSA 2X13A 2BBSA 1YJ5A 2GF9A 1FXWF 5AJWA 3QXGA 5JNLA 4JJZA 5G1PA 3PUXA 4KVAA 3NAZA 1N56A 1OZGA 4LZWA 3K0EA 1I7DA 2W43A 5CW1A 2ZJ0A 4R5HA 4NLLA 4G1CA 4BYGA 4CTOA 1DT5A 2H4FA 3G8DA 2X14A 4NEQA 2CNNA 3A1VA 5BOSB 2I3GA 3ETJA 1P9RA 4RK0A 1KK0A 1U8YA 4W1SA 1T6YA 1ZJNA 2V6BA 4K88A 3L46A 3VR3A 4HRVA 3PGKA 3AERA 4TKLA 2PMEA 2RGXA 1E66A 3AHHA 1G3IA 3E23A 2GR9A 4ZT5A 4Q43A 2JFOA 1OLUB 4PHCA 3ML1A 1D0IA 2WPNA 4EDHA 2PK3A 2QDXA 3C3WA 1L4GA 4DMLA 4ZJPA 3KO8A 2ZWMA 1AY0A 4BBAA 4XIFA 4HS9A 3MPOA 3M9MB 3FYUA 3QVLA 2DKZA 4Q3NA 2VJOA 1JEJA 3HEAA 3QMWA 4B9LA 2EAMA 3I8XA 2KJQA 4LSGA 1C0PA 3TCKA 5DSXA 4RTQA 3G2PA 4B44A 10MHA 3DOJA 1ZIDA 1RYYA 1SG9A 4EUHA 1XBTA 2JH3A 4EFNA 3GQBB 2PYZA 3QEMB 5U9CA 3PMLA 4OQEA 4R0NA 3ZDRA 3DMPA 4WEOA 4L78A 7ICIA 4B5LA 2LKYA 4O4LF 3SBDA 4H6VA 1SXIA 2QB0A 1XMOB 1M2HA 3HBMA 1P80A 2AN3A 2FMPA 4URHA 3HO6A 2JHDA 4U2BA 5F5XA 5JU6A 4KB5A 1AZLA 3TLGB 2J7PA 2PY6A 1R6DA 4BB5A 3HWSA 2FPUA 2E4UA 1XNQB 1H8ED 7ICPA 3SZLA 2ZAIA 4AU1A 2L19A 2Q07A 3MBYA 2ZJFA 1U0JA 2QTMA 2BDEA 2NZUG 3P0HA 3CO5A 3AI7A 1JQAA 3KT0A 4JL8A 5CA7A 4AVYA 4MNTA 4UMFA 1N1GA 1ZUHA 4DC0A 1GO3F 2ZU6A 4OXIA 1M2VB 2A7XA 4QU0A 3E61A 3GZ4A 4QOJA 2H11A 5DNDA 1XVLA 3KLNA 3BFPA 1IN4A 4BC1A 1SL2A 2IL1A 3BE5A 3BAZA 5IZCA 3KTAA 1NLUA 3PC8C 4P5EA 4IFBA 4OQ4A 2MUTA 1JZTA 2HF7A 2Z04A 2Y1DA 1RABA 4NYIQ 1CIVA 4Q1CA 3OZTA 2ZJ6A 1M6EX 3OU7A 1RACA 5CEJA 1TM5E 4HBZA 1VQ1A 2QTVB 4YYEA 3JPRA 3SS7X 4IXNA 3H05A 1BN6A 4Q7MB 2D00A 4K1XA 3ZQ4A 2C61A 3SJZA 5AVVA 5I8ZA 2VQSA 4GOMD 1GRQA 4IINA 5BWLA 3RTGA 2AZMA 4XM0A 3KUXA 3V72A 1LK7A 1Y9JA 4CUZA 1JQKA 4KGXA 2XW6A 3OJWA 1YO6A 4LCJA 3QX8A 4V0OA 1NU6A 4O4JF 1PTJA 1NVKA 2VP6A 2BQUA 4O2RA 4HNVA 4Y9TA 2HD4A 2UVPA 3TYXA 2IHMA 2E1RA 4UAJA 2WV9A 3LCUA 4R6XA 1DEXA 2W2LD 5EN4A 5KOHA 2COEA 4N03A 2O2DA 2GD6A 4QXRA 4XOIA 1VTKA 4RU1A 2YVAA 5FPHA 3QSYA 2PM8A 2VAMA 4QX6A 2FF5A 1R9JA 4ZT7A 4NLZA 3BEDA 5LJIA 1D8AA 2V65A 1NJYA 1NP6A 5AHOA 4B32A 1U45A 1IE3A 4DPMA 4C05A 3NHFA 3G9ZA 2DPGA 3EG9B 3ZBUA 1PV2A 2R8XA 2VBGA 2GZ3A 4OFWA 1XCGB 1XTTA 1NOIA 4WZBA 4HI0E 1RJFA 2W48A 2O5VA 4F93B 4M55A 1JW9B 1DI0A 3TW8A 5CK5A 1L5KA 5TNXA 1UR5A 4HRXA 3EY9A 4DR1B 3FWYA 4H6XA 2VHWA 1V3QE 4DREA 2NO6A 3IUYA 1AURA 3MZ0A 5EJ8A 3H3FA 4R2WA 4OREX 2HZ7A 4TV8A 3VR2A 5LB2A 2ZJAA 3H0EA 1MVNA 4QT0A 1H5QA 4DSAA 1U0NA 4OATA 2BFFA 2HGSA 4BIMA 1F7VA 3U62A 1K7SN 2VQEB 3HUFA 4D3SA 2WHXA 2UVUA 1XA0A 4IG4A 1DC3A 2DBQA 2K4IA 2FP4A 3A1EA 3GBSA 4BLPA 5L1LA 5HK8A 5B1EA 4P1ZA 4G0OA 3GU3A 2HU7A 4LVOA 4UTVA 5KWJA 1Z00B 2CL5A 1FVOA 4IHJF 1MDBA 4F3CA 2X41A 2M9NA 1ID1A 2Z30A 4Q4DA 1BVYF 4LZJA 4YS6A 1X15A 3SQDA 5DW0A 3SQWA 2BONA 3G9UA 5AKJA 3UT0A 4FX2A 3VNUA 5EWEA 4ARZB 6ABPA 3TPFA 2FPXA 5CPBA 3TB4A 2P4SA 7ICHA 4JJGA 5J0QA 4Y3UA 1Z4LA 4L2IA 1ZI9A 1ISSA 7ICSA 1KEZA 4OFXA 3FSJX 2UVQA 3ITNA 3WJ7A 3BMNB 5IBPA 5EWGA 2MR5A 2OCKA 3MGCA 4LOIA 1EZ1A 2PGAA 1USVA 3C8HA 4PLGA 4MQFB 1HY3A 2F00A 3ITEA 3C3BA 4IDBA 4LMBA 5HJ7A 3PPWA 4L0DA 2IY7A 1C1XA 5EQTA 1JKXA 4I55A 3C98A 5GTHU 4W5WA 4C8KA 7ICUA 4N5LA 2Z2XA 4BZXA 1CUUA 4V3CA 4FHEA 3NMUF 1JHUA 3AEQB 5CG1A 4Q66C 5T3UA 5J0UA 5J2AA 2BLLA 2P9BA 1WD5A 2VHYA 3P0FA 4CF5A 5ED0A 4LK2A 1E64A 1ZQLA 1D0VA 3P32A 4F2SA 3TVYA 3WWDA 4CIDA 3IILA 4N65A 3TSZA 4ADSG 1FBNA 2ZM6B 3OE7A 3K4QA 2FW7A 4PG7A 2GBCA 4XWTA 3FHOA 1TJYA 4MQ5A 5DYYA 5EKXA 3P26A 3RJGA 3FTEA 4BMSA 1DK3A 2YWFA 2YOFA 4C0SA 1O95D 2OV2A 2WF6A 1AB5A 3WSVA 1G6Q1 4K6KA 3DXXA 4CEIA 3IQZA 4Y6PA 4NAVA 1Z22A 4K0RA 3AN1A 5KAPA 4YV7A 2DFKB 2I54A 3FCOA 4F60A 5ECYA 4JUCA 2KE7A 4Q1VA 2ATCA 3DWEX 3RE1A 3LNTA 1U4BA 3GLFA 4QDTA 5IC4A 1YBHA 2QLTA 2WOOA 2GFHA 2R1UA 3UUGA 4G07A 1U9JA 1VE7A 3PL1A 1SK8A 4OYHA 2AB0A 3KQUA 4Q7QA 4F8JA 3OTOB 2LM4A 1PJCA 5KSOA 2B7BA 3EXHC 4NOMA 2JJ1D 4DZRA 1VHJA 4QXPA 3TZCA 1KTQA 4ZI2A 2CCJA 4PGAA 3KL4A 4HAWA 1PJBA 2QX9A 1MO5A 2J9ZB 1JU3A 3I3OA 2YFQA 1FU8A 1K5PA 1ZXIA 3L7NA 2UU9B 5FAKA 3MK31 3RUAA 4Q9DA 2J0VA 1T2FA 2WTAA 4PO8A 4D45A 5I3CA 3DDWA 2GAIA 1YASA 2CXNA 5CFZA 5L4LA 1Z7GA 2KV2A 4RHEA 2HJVA 3HJAA 3UCXA 4NU5A 2KICA 1DC8A 5JYEA 3B1KA 3PGJA 2G9UA 3OLZA 1PR9A 1T6ZA 1OXSC 1FUYB 3NBMA 3OQOA 2VZ0A 2QPTA 4QYSA 1M1ZA 4YCLA 3SJ7A 4BBJA 5FF9A 1D8BA 2PKQP 3ETHA 1Y48E 1HSOA 3PW2A 1UCVA 1QO9A 1VCNA 2NO1A 2PSSA 1KJWA 3ZD6A 3DM9B 4DPLA 2VNHA 5KBYA 2XCQA 3P97A 2HA2A 2QN3A 1V3UA 4JB8A 1G18A 1W0JA 4HVLA 3SI7A 3CLVA 3TADA 4B84A 4HH4A 2QF7A 1NC3A 2QPOA 1EUQA 4ZP1A 2QB5A 3HP6A 2QR3A 1ZW1A 1JHZA 4F85A 3QVJA 1KJYA 2M9MA 3DDOA 4RS3A 2X42A 3REQB 1O08A 1ZM4A 2GLEA 3VR5D 3HDTA 3UICA 3N7RC 2WTXA 1R12A 2Y99A 5BSHA 4JR0A 1SFRA 3VO2A 1WNTA 1ZZGA 3Q9LA 1GL3A 1ZN9A 2DM6A 1NJZA 2WYIA 2G80A 1WUDA 2IS2A 1XZNA 2X4DA 3S70A 1PUZA 1M8JA 3C1AA 1RT9A 3FNHA 4JB2A 4BC0A 4BVFA 2PFOA 2HK9A 4JLKA 3A32A 5IH7A 1S8OA 1Y4DE 1YI8A 3ZOKA 4WLNA 2VOEA 4NIMA 2O06A 4D3DA 1GTG1 3EEQA 4UTRA 5IM4F 3LQ1A 2QMZA 3PJDA 3ZH9B 2VYNA 1R6AA 3GG2A 1LTHR 1ZAKA 4Q7LA 5HM8A 1KAEA 1UOQA 2H65A 4IVNA 4RENA 4HDSB 2O8BA 2JGEA 4GX0A 3C2MA 1B15A 4LZNA 1MU0A 4CL0A 1JHVA 5HM6A 2FPGA 4RYDA 1KVTA 3KETA 4QFDA 1ZGHA 3LL7A 1L3UA 2F9LA 3G49A 1E7WA 1PD0A 4UM7A 2XUDA 3X1MA 4HP8A 3PFKA 3OZEA 4DLYA 2XCLA 3PNYA 1UBKS 4YXWD 3AEKB 3WXBA 5B2FA 4G0NA 3R41A 2PA0A 3RFFA 4KLMA 4XR4A 1K0FA 3FB1A 1ZGGA 4GQBA 5EJIA 4RH0A 1ZJZA 5CDFA 3P4YA 3EYAA 1K66A 2JFVA 2X7HA 4AQYB 2PKYX 2AXNA 2OQRA 4AURA 3VYWA 2JHCA 5B3KA 2VUSA 4DV0B 1ZBDA 4YUXA 3O74A 2YJGA 3PCTA 2ZIVB 1M3SA 1YJCA 3DT9A 2CNWA 2ODGA 3VDRA 3JQBA 1T2VA 3A6ZA 3HO8A 4KAXA 3QENA 3CRRA 5EUBA 3ZDCA 4C0WA 1SKUA 3D0KA 2QAJA 3HLYA 5KSYA 1WEHA 4LDZA 5LP6B 5LQAA 4O2AF 3LXMA 3ZR4B 2OGWA 1EP9A 4EUSA 3RREA 5FTJA 3VMMA 3X44A 4QUBA 4INJA 1ZIYA 1HE4A 1NXXA 5FRDA 2DUMA 1NSFA 1CY4A 5D49A 1Z7WA 4GG1A 1WMDA 5KTPA 1U4OA 2J9GA 1X6IA 4EGQA 4R64A 1ZOOA 4IRUB 2OESA 1E1RD 2Q21A 2PA3A 2B61A 1WCYA 4KN9S 1K3FA 3C1UA 2E6UX 1Z5WA 1L8QA 1T4CB 2ECKA 4P0QA 2H1CA 1JU9A 5A0LA 3TKYA 2H2FA 5FWYB 2YL2A 3WS7A 3SZUA 3FMFA 1ENZA 4F3KA 4N5DA 5KNBH 4CMEC 2P2ZA 3AL3A 2XXAB 2WG0A 4MI1A 1MX1A 1AC5A 2XUGA 3GCDA 4IM7A 4ZVTA 1WBJB 2ACKA 3DFUA 3BMQB 4XX1A 4UCFA 2XKJE 1S2DA 4EB3A 5HKBA 1IMJA 3WLAA 2G9VA 2AG6A 4HDQB 2TS1A 5JNUA 1IEXA 3FNBA 1QVAA 3A9TA 3V97A 4YGXB 1WDWB 3FMGA 1RM4A 1LY1A 1N57A 2OAP1 1OLXA 2QTZA 1TUGA 2LGJA 3JVEA 4YCBA 4B3SB 3T7IA 1TZMA 5C1BA 5DT9A 3DOUA 1DPGA 1CJSA 3WA6A 1BVUA 4FHCA 2F64A 4YCNA 3H17A 4EHBA 5HMMA 1KK2A 2X76A 4JLSA 1ADGA 3KTOA 3IQIX 4RTNA 1FNBA 2Y0BA 1Y3DE 4F5PA 2O2XA 4P22A 2FVXA 4TUPA 5BSWA 5FBQB 2FZ5A 1SO8A 5JPDA 1V16A 2DQKA 1GTVA 1MRSA 3GMDA 3A1WA 1UC8A 4F5QA 4DT1B 3ET5A 4XVRA 2AMJA 3NNDA 5AM5A 3ETRA 2PXXA 1QIHA 4S05A 5CYOA 2VFAA 2V55B 4EUFA 3QW4B 3KZNA 2I67A 2J3QA 2O8DA 3FSGD 4Q1AA 2A9OA 5D5HA 2WKPA 4GM0A 4BQQA 9LDTA 1NXQA 1RRCA 2K8BB 1SR8A 3ZY4A 3MS4A 1AGNA 4UARA 5J1TB 3EXAA 3WQBA 5CIWA 1ENYA 1UAYA 3VX4A 4WZAA 1G8JA 2G5GX 1R6XA 2GHIA 2H7CA 5KX5B 4EJ6A 1SL0A 1YXMA 3EPRA 1G8AA 1BIFA 4IMPA 4GXKA 1XA3A 4K46A 4ALIA 4EYOA 2HYIC 1ORRA 1OGIA 1XFDA 3BMCA 3C5EA 1COOA 5AO9A 2HSJA 5L51A 4BFLA 4OQYA 4HZGA 1NVAA 4I2GA 4PZUA 2Z9BA 4C0QC 2XMDA 3OPQA 1OBOA 1KPIA 5CITA 2FMFA 3N7UA 1T1SA 3VAYA 4MICA 3RVOA 3N87A 1KDVA 4R0MA 5LIRA 1I94B 3EGWA 4W7SA 3VUFA 2KN7A 2ZWIA 3AL2A 1K2VN 2ETVA 2VNIA 3M82A 4PC3A 4I2VA 5KSZA 2IPLA 2PKCA 4UTNA 3IS3A 3DKIA 3R4VA 3U7GA 5CA0A 1X13A 3ZOZA 1DQYA 1N0WA 4OUKX 3FFAA 1Z0DA 5A4DA 1QMGA 5ICCA 2BCGY 4PFQA 4KDFA 5FI5A 2I65A 3H5IA 3AM5A 3AU8A 1QKIA 3SJBA 1QH8A 3ZPXA 2EU8A 3P45A 3FMIA 1HT0A 1EK2A 2GO1A 4JUFA 4YMTA 3MYRA 3HJNA 1LK5A 2ACEA 3H9JA 3WFZA 2WFLB 5CAEB 1NVXQ 1UBRS 2B1IA 2H59A 5C7IO 2BTEA 1FSGA 1RIFA 5EIXA 5A6VA 2PH1A 1NUHA 5KTQA 2FSHA 3DVRX 3AQ4A 2JI8A 1SVUA 4TRRA 5G0SA 1W581 3OFSA 3HXPA 4M1SA 1XCMA 4QYXA 3HCRA 1BAPA 4U0JA 4L7QA 1XDBA 2Q50A 1JKJB 2I6XA 2I87A 2K4MA 4FDTA 3WTBA 4XPIA 3QPDA 5KNIA 2WF5A 3ZZMA 2AE2A 1QR2A 3P94A 3AV0B 1EESA 4U6SA 2O2CA 2RIPA 1SU8A 1VGQA 1LLUA 5B66U 2W6NA 4BVHA 1UBLS 4DL7A 1OOEA 2GH1A 4L3VA 1QGUA 1A8SA 4U7HA 4CKWB 3H2BA 4PTYA 3JYHA 2BHTA 4UMDA 2GN4A 1GR0A 5M34A 3CHYA 4BX9A 1YUNA 3OFND 4J75A 2PZAA 3H6KA 1CT9A 2P7IA 1ZPDA 5GM1A 4DSEA 3PO5A 4P81A 1D1PA 1DWUA 4C0BA 1NONA 1Y4UA 4Z0HO 1JQ5A 4ZQGA 3MCWA 5DM2A 2G17A 1VKZA 4RLSA 1NPDA 4AMZA 1MAWA 2QQEA 2TSYB 3PFNA 2POQX 1U5CA 4QQ8A 4R5MA 3NGLA 4E31A 3SYKA 3E3AA 3KT3A 4YRKA 5I7HA 5KT2A 1ADCA 2Y2UA 1QP4A 1FOEB 2R1TA 1XZMA 2XMRA 4AUKA 3PLRA 4O0IA 4YB8A 2KFZA 3VNSA 2DVMA 3HL4A 2D5IA 1Y34E 4NL9A 4RAOA 1IN7A 5CA1A 3KSAC 3K0FB 3D3EA 2C8LA 3IBCA 1TO6A 1DL5A 1GY8A 5ITVA 3PKIA 1WO8A 4C7VA 4ZEOA 5E4YA 3JV7A 2KIVA 1NVGA 2CF5A 1MG5A 4QUKA 4ZREA 1Z83A 3NC0C 1L1RA 3J7TA 5C3UA 5J40A 4KLFA 3OX2A 3IHTA 3W7VA 4I7EA 4MS4A 4QOHA 5JBIA 2I7CA 3ZI7A 3MGKA 4BEJA 4OQQA 1MSWD 4CKEB 4JT2