4F72A

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, asp12ala mutant, complex with magnesium and inorganic phosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
195
Chain Sequence
b'GIKNLLIALGGVLINLDRERCIENFKKIGFQNIEEKFGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 67
structure length 195
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4f72A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4f72A01
2D2VA 2EARA 2PQ0A 2BY4A 4NWIA 3DAOA 5AW0A 3WK8A 4QQFA 2NO4A 2C88A 3SKXA 2GO7A 2JGAA 3CZ4A 2JAUA 2JARA 2YJ5A 3U26A 4KN8A 3UMGA 3ZWKA 2VKQA 4C4TA 1RLOA 1U02A 5AVSA 3NASA 2Q4RA 4FE3A 4B6JA 3RFUA 2JAOA 5ALQA 2ODAA 4CE6A 1Z4QA 4Y2QA 3DDHA 2CFRA 3QYPA 3SHQA 3WKAA 3I28A 3QNMA 1U2TA 2FPSA 1Q92A 3U7GA 4QJBA 1CQZA 1O08A 5AK3A 3N28A 5AKGA 4J03A 3UM9A 5AICA 2G0AA 3OCUA 4JDPA 3QU9A 1WR8A 3DNPA 2IA5A 3AR6A 5ALSA 2FPWA 2O2XA 3PDWA 3L0YA 1QQ5A 2ZG6A 3UMBA 2FUCA 2HI0A 2P11A 3IB6A 4KNVA 2MU2A 4PNHA 1U7PA 3OCVA 5AM0A 2O9JA 4KNWA 4NV0A 1VJ5A 1XPJA 2AH5A 1RMQA 1XP5A 3ZTWA 5AKIA 2YJ3A 3ZU6A 2W43A 1ZJJA 5AM2A 4XE5A 2WF7A 3MMZA 4Y2JA 5IT4A 2OYCA 5AVUA 3M1YA 5AVZA 3R09A 4Y2YA 3ZUPA 5FP0A 1T9ZA 4CNQA 3EWIA 3KOOA 3NALA 2Q5EA 1PW5A 5AVWA 3FM9A 4BNDB 3QU4A 2FPXA 5AW7A 1T5SA 2HO4A 1T5TA 4Y2RA 2R8EA 3EF1A 2RARA 4YCNA 4UAUA 3QUCA 5A3SA 2MSNA 1L7NA 2P9JA 1Z88A 3E84A 2W11A 4NFLA 4L57A 4Y2XA 4RESA 4EELA 3W5DA 2I55A 2HOQA 2ZBEA 1SWVA 5AM3A 3AR2A 3VAYA 1TJ5A 4AS2A 2I33A 4GIBA 1YV9A 2YY6A 2FPUA 4I9GA 4EX6A 3OCZA 1RMYA 5ALXA 2C8KA 4UARA 2HCFA 3SD7A 3FGOA 3ZX5A 3SLRA 3QUTA 5ALVA 5AIBA 3ZVLA 4YH1A 5AVVA 2OBBA 4YCLA 4ZEWA 3N8GA 3NAMA 3NRJA 2FDRA 3E58A 4UW9A 1Z5GA 3NUQA 4KX3A 3EF0A 4J2TA 4AS3A 1YNSA 2GHQA 3L1VA 1SU4A 2ZBDA 3ZX4A 3E8MA 2GMWA 5AK4A 4G63A 1RKUA 5AW6A 1Z4NA 2NYVA 2PKEA 5AVQA 1K1EA 2YBDA 3IRUA 4UASA 4HGPA 5ALUA 1TJ3A 4Y2SA 3WKCA 4EENA 2PR7A 1J8DA 5ALTA 4RETA 2B1RA 3KDPA 3L0CA 5ALHA 1L7PA 4OCZA 4EX7A 1Z4PX 3L8GA 2C8LA 1RQNA 2I54A 2IOHA 2HSZA 1QYIA 1S8OA 3A1CA 3ED5A 3QX7A 3E81A 2YN4A 1ZRMA 3J7TA 1NNLA 2IOFA 3ESRA 2ZXEA 1ZOLA 1QH9A 2G1AA 4F72A 2W4MA 3RF6A 4KX5A 5ALGA 2RB5A 3N07A 4F71A 5AI0A 4Y2TA 3WK6A 2WFAA 5T41A 3W5AA 3ET5A 1TE2A 2WF9A 1Z4KA 4E88A 2GHTA 3BWVA 2B30A 3ESQA 3WK9A 1RLMA 4CF3A 3S6JA 1EK1A 1U2SA 2C9MA 1L7MA 2Q4TA 5AW9A 4YIHA 3WKEA 4CF4A 4KYTA 2I7DA 1YS9A 2AMYA 2AUTA 4BBJA 2HDOA 2B1QA 3N5KA 1L8OA 4MUMA 1N8NA 3K1ZA 5A3RA 5AVXA 2CN1A 1ZD4A 3L0BA 3QU5A 2YMQA 1MH9A 5AK5A 3OTQA 5AK6A 1Z4LA 3I1YA 5ALDA 1X42A 3EPRA 3B9BA 1KYTA 2WF6A 2B0CA 2HHLA 2IYEA 3HLTA 2R8YA 5AI4A 5AIAA 3I76A 2WF5A 3FPSA 3SKYA 5AW2A 4BX2A 3ZTYA 3MC1A 1ZS9A 3P96A 1WPGA 5IT0A 2HF7A 2HX1A 1RQLA 3U13A 1Z4JA 4UMVA 5AKXA 3PGVA 2ZOSA 4HAIA 1Z4MA 3QXGA 1Z5UA 1Q91A 4XPZA 1J97A 4H1WA 4IG4A 3IJ5A 1VJRA 4BYGA 4Y2VA 5AW5A 2I6XA 1Z4IA 4IFTA 5AKYA 2BDEA 5ALFA 5ALWA 1QQ6A 2CFSA 1RPZA 5AHXA 3ZI4A 5AM1A 3FPBA 4HGQA 2DQSA 2G06A 3MPOA 1RLTA 3ET4A 1ZD3A 5AKZA 4UATA 3OCWA 2FPRA 1YMQA 2FUEA 1N9KA 2G09A 4DW8A 1Y8AA 3A3YA 2BDUA 3FZQA 2R8ZA 5AI8A 1F5SA 4C4SA 1RRCA 5AKHA 3F9RA 5AKJA 3FVVA 3QU2A 2YMMA 2RAVA 1EK2A 4ZEVA 2EATA 4Y2UA 2HEGA 3I6BA 5ALYA 3L8FA 5ALZA 2RBKA 4MWOA 4G9BA 5ALNA 3HYCA 4OFZA 5ALJA 3U7EB 4BX3A 1JUDA 5E0OA 4BNDA 2OM6A 3WKBA 5AKLA 3R9KA 4EZEA 1TA0A 2OA0A 1NF2A 5JJBA 4Y3UA 5ALIA 1L8LA 3M9LA 2EAUA 5AESA 5ALMA 2MU1A 1ZD5A 3AR8A 3WK4A 4UMEA 4BX0A 1VFPA 4XOUA 2IOFK 2B8JA 3QUBA 2HF2A 3KC2A 3SF0A 1RMTA 3PGLA 2CFTA 4UAVA 3ZWDA 3OCYA 3GYGA 3AR5A 5AVTA 2P69A 1SWWA 2C4NA 2FEAA 3QLEA 4I9FA 3L5KA 1IWOA 1CR6A 2YJ4A 3ZVNA 1AQ6A 1XVIA 1WZCA 1ZD2P 3QGMA 4YGYA 2GFHA 1RKVA 3NANA 5ALEA 4C4RA 2X4DA 3TLMA 2B82A 5AI5A 3R4CA 3QU7A 5ALKA 5AW8A 2QLTA 5AW4A 1RDFA 5ALOA 3WGVA 5AKKA 3U19A 3PCTA 3AR3A 4CF5A 3OPXA 1LTQA 1O03A 3DV9A 2G08A 4UMFA 5A3QA 3W5CA 4L6AA 1RC8A 4YCMA 3WGUA 2YMPA 3ZW7A 3BA6A 3N1UA 3UMCA 1U7OA 4L6CA 2QYHA 3L7YA 4DWOA 5AVRA 2YMLA 3A1DA 5AM4A 2FI1A 4FFDA 4AP9A 3WK7A 2ZBFA 4XQ0A 2NO5A 1ZRNA 3OCXA 5AI9A 2AGVA 4BEVA 5AM5A 4HGNA 4HYTA 3ZVMA 2R8XA 2B8EA 4YIKA 2WHEA 4ZEXA 3U7HB 3A1EA 1L7OA 4EEKA 5AW3A 4BEWA 3KD3A 2P27A 4UU1A 4JB3A 3KBBA 1FEZA 3L8HA 4NABA 2YFYA 2JAWA 5AI6A 2YJ6A 2G80A 2WM8A 1YJ5A 4UM5A 1RKQA 3B9RA 3L8EA 2G07A 3AR9A 3SMVA 1LVHA 3WKDA 5AVYA 3WK5A 1WVIA 3CNHA 1S2OA 3AR4A 1QQ7A 4O8CA 4UU0A 5AW1A 1TJ4A 3NIWA 3D6JA 4GXTA 4OD0A 3KZXA 5IS2A 5ALRA 1L6RA 3ONNA 1YDFA 3MN1A 4HGOA 4FYPA 4UM7A 1NRWA 5AKEA 1Z4OA 5ALPA 5ALLA 2WF8A 4HGRA 3W5BA 4Y2PA 4DCCA 4UMDA 4OHFA 2ZBGA 4NAVA 2I34A 3B8EA 3QUQA 3L1UA 4DFDA 3AR7A 4BKMA 3U7FB
chains in the Genus database with same CATH superfamily
4NWIA 2ONYA 5DM2A 3GLRA 4QA9A 1NZDA 2O3RA 1ISIA 4JHXA 1GA1A 4DG8A 1PGJA 2FE1A 3SFVA 3DBRB 4IMJB 4WZBE 5CJJA 5CEFA 5L51A 2FSPA 3NEPX 2XA9A 4G0VA 1E5QA 3B3JA 1NUAA 2WVAA 4R66A 1UXKA 1SUCA 1Y3DE 3G6VA 1EXNA 1BD3A 2QUKA 4JJFA 2V59A 1IY9A 3IJEB 2XR1A 1SA0B 3ESZA 2QZ9A 4F04A 4KVAA 2YJ3A 1I3MA 2ANBA 5F1PA 2XNHA 2F59A 2W6NA 3KIPA 2CL5A 2O2YA 4J16A 2OAEA 2XGQA 5AUPB 1JSRA 2R7MA 3AUYA 3GFQA 4JYZA 5GTIU 3Q85A 1C1DB 2IH2A 3VR5H 1CBUA 4ZK2A 1ORHA 2IBTA 2J59A 2BI4A 3A6DA 1MAHA 4Q03A 1WVGA 3LDGA 3W4JA 4WEQA 3IPCA 2XUQA 1H2EA 1EX7A 4HUQB 5E2BA 4XTCS 3LLCA 2FU5C 2RHJA 4LX0A 1T0BA 4AN4A 3LBNA 4GGPA 5B1IA 2DFVA 2J7KA 4BYMA 4KX3A 3FTQA 4DV7B 5L3RA 4M8SA 3ZWPA 1VMEA 5F73A 4UUBA 3HY3A 4M53A 3M9XA 1PNVA 5F9FA 4HXFB 2YBDA 1RBZA 5COQA 4CPDA 3KQHA 5JVDB 2PKXA 4EECA 4GPZA 4QREA 5JS7A 3UQZA 2EFJA 1J0XO 2Q1UA 2IHJA 2BLNA 4JR1A 1E5TA 1R0BA 4Q1AA 3IA7A 3VTAA 4FX2A 4EBBA 3BMQB 4MVWA 4OUDA 4Z8XA 5EMMA 2X2EA 2G9QA 3FF4A 2Z1NA 2FUG6 3HI6A 1JVBA 2IYLD 1ZJWA 5FCDA 1N1EA 4Y9SA 3ZUGA 3DB1A 4AJHA 4YMIA 2FLLA 3CVYA 1ISPA 1KGDA 5AW2A 5ISMA 4EPRA 5BT9A 1B42A 3FUWA 4DRXB 5JO0A 3S5UA 8OHMA 1XAHA 3PWZA 3O0DA 2GZDA 1ZI9A 2FZEA 1HQDA 3ZCQA 1XYGA 1CJSA 3TQTA 3WO0A 5BVGB 2P2ZA 3AWDA 3G23A 3G68A 4KIUA 4YPFA 1K6EA 4MZXA 5FOUA 3Q98A 1M2KA 2GSWA 3ERCA 2ISOA 1QF6A 1E6LA 2AD5A 1BJRE 1ZITA 3QW2A 1PDOA 2ZTDA 1WHSB 2H4YA 4DRZA 4XCQA 5A6SA 1WQ3A 3FGNA 2GAFA 2F8MA 1Q77A 1MPTA 3S1SA 3FFAA 4BDSA 2V3CC 4H1VA 3EDCA 4LPSA 4YYZA 4BVGA 1J49A 3EGIA 2OTCA 2W6MA 1KXZA 4DR2B 2F1HA 4EY8A 1IG0A 1NDHA 1N7JA 4FDVA 5ESXA 2WZCA 4CODB 3RHZA 5HHHA 5EINA 2Q7DA 4MF2A 3WG9A 1EX9A 1H6AA 2DH5A 4IXNA 4L5IA 2VKTA 3B1VA 4FZRA 3EQZA 4O25A 4GP6A 1Z7BA 1IMJA 4MUBA 5JRZA 2GERA 1GM5A 1M0TA 4DDKA 5LNK1 1A4IA 4NLNA 1MC8A 2Z5VA 3SNHA 4UTOA 4MPJA 1H2WA 1XDDA 3ZY2A 1OFTA 2QGZA 3H9EO 5KOIA 2XDAA 3GDGA 2O4UX 4H0CA 1OXXK 4YCJA 4CG1A 3CPEA 4O6VA 3B0YA 3RTGA 3LO5A 1WNFA 4ZO7A 3SJUA 3B8EA 1I7QB 1IM4A 1AXRA 1CZLA 3TTSA 4NLCA 3K9FC 1Q3UA 4ROSA 8LDHA 3GLFE 2ZAIA 4DNFA 4LF5B 4M9ZA 4DLTA 5EFOA 1SELA 2Y6UA 3MWDB 3KSUA 1Q16A 4MLCA 5EWEA 4F4ZA 1AGXA 4U3JB 2ZGVA 4R2JA 3VCBA 4O59O 3ZEIA 5KFUA 4J7AA 5CGQB 4RF5A 4AD8A 3Q8SB 5KQGA 1FXSA 1XPUA 5K9ZA 2KB0A 3VNVA 4XEHA 4UBIA 1EVQA 3PIRA 1XU4A 2A0KA 1KLNA 4MYCA 1FTWA 2VDRB 1TNDA 5KNDD 1NSYA 1LBHA 3HCFA 4PWZA 2QYOA 1EI9A 3GEPA 2HO4A 3QXCA 2GJAA 1OC2A 2DP4E 4GD3Q 1L5FA 5IULC 2I55A 5I7WA 1XS9D 3JY6A 2DPGA 4A8JA 3C8UA 4ZOCA 2C82A 2HRRA 3SZLA 4A9AA 3BS7A 4GOND 3STTA 3DV2A 1OAOA 3C6QA 3DBOB 3WGHA 2Q46A 2WQZA 4HZIA 4GUAA 2HNAA 1EEHA 5B3AA 2JEYA 2LI6A 2OBMA 3JVIA 1A2BA 1RWKA 2J6UA 1LD3A 4WNYA 2QTFA 5ALUA 4CQJA 1TLFA 1D5CA 3CNNA 3OO0A 4CG2A 1N8TA 5DTEA 3L8GA 4Y67A 3VKGA 1V1RB 3PSPA 3LOPA 2I76A 4OHXA 2ZWIA 1ECCA 2C7GA 3IQHX 1QH9A 3PSIA 2Z4TA 4JSYA 4EYSA 2R6HA 2FPGB 4WAUA 5DG9A 4GE3A 3JWEA 3GGDA 1D0VA 4HRXA 4TV9B 4KVGA 4R1PA 1Y9EA 2DBRA 3L79A 3OF5A 4PHCA 4BBJA 1L8OA 1PVPA 2YMQA 5LA6B 3R9XA 1L3TA 3STYA 2FW7A 3C85A 3DA8A 2N46A 4DLWA 3JRXA 4ZCPA 4RQ3A 4CGYA 2XLCA 3FDSA 3CW9A 5FUMA 1QGED 3CYFA 1TAMA 3ER8A 3E22B 2BJHA 3H0CA 1EK6A 3ZWWA 4RLHA 3NYQA 2VHQA 5J2EA 3C0KA 5C32A 4RQ1A 1IN5A 2DUUA 3W8DA 4QFDA 5LJLA 1O9BA 2XTMA 1PR2A 4GXNA 4C4SA 1N92A 1AKEA 4I4IA 1Y8CA 5C4MA 5JY6A 4PCLA 3UHFA 2JD0A 3U7EB 3B1FA 3NOVA 4KBFA 1A95A 1YR6A 4Y3UA 5TIIA 2O2DA 3BCHA 4LJ9A 4DWVA 3GVCA 1IUNA 2VPIA 2OGUA 3DMHA 2DQ4A 3GIWA 1B0XA 2RJ3A 2FCAA 3RG8A 3GEEA 5AVTA 1KI6A 5BQ3A 1KTIA 4IKEA 2UU9B 1O57A 1K9SA 4F93B 2MYUA 2X2PA 3IQXA 4RANA 4ZI7F 5BN3A 1LSJA 2CGEA 1AK9A 4J9OA 2AFVA 3AEKB 3AY0A 1WL8A 3PGJA 4HEQA 4QZBA 4YRJA 3JD4A 2H65A 4CTJA 1VLLA 1E2IA 3RTBA 4P4MA 5DDYA 3ORHA 1DC6A 5JLJA 3ZJ4A 4YMHA 3PIDA 5KT3A 4RUCA 2D7DA 2AEFA 5DGAA 4EHBA 4H4DA 1KFDA 4JI2B 1UADA 4DL9A 1NZBA 4P5EA 3LK7A 1YJ5A 3HVKA 4FQ5A 4KE7A 1OU4A 2VXOA 5IXSA 3TB6A 1ACJA 4B73A 4E11A 4BRUA 2QVYX 2ORWA 3MIIA 2OGSA 1J9GA 3IG8A 4P4PA 2RGNC 1JZSA 2ZYSA 3P19A 1OHHD 4CM5A 1U8TA 3RJMA 5L4LA 3KSDO 3GUCA 1E62A 1N5WA 2FN9A 2VNAA 4RULA 1JEYB 2PZLA 2MHCA 3AKYA 1J5EB 1HE3A 2PKQO 4J9LA 1N33B 3TL3A 3M5DA 1FRFS 4CMEA 3LT4A 4EI7A 3OQIA 2IQIA 2QRHA 5CB8A 2VYND 1RQ7A 4KN8A 5KFWA 1LKZA 2OHIA 4EJ0A 1ZYQA 2WUWE 5ALQA 5JQWA 1IHUA 1PYDA 3UBMA 5L3QA 3Q8LA 2J67A 5DCYA 3TM5A 4CQMA 5JARA 2WWIA 3OQVA 1XTJA 4NK5A 2WV9A 2KOBA 1MX5A 1ND5A 3DNPA 2F17A 2WJ6A 1RWNA 3UMRA 1QKIA 2C7PA 4DIFA 1XWIA 5JCJA 1ZVVA 1YKGA 1ZGZA 3ZGYA 3RRNA 1XCBA 5KMGB 3OCCA 4CIAA 1CUDA 2YWCA 1JAYA 1P2SA 3T5PA 2IDZA 4M99A 4WECA 3NT5A 3E2MA 1U5CA 4R4JA 1Z0JA 2G77B 1OZFA 2SCUB 1MT0A 1Z6QA 3M6WA 4N7MA 4J6EA 3W9SA 1YL5A 2C4UA 1YOVB 2PZEA 4DDHA 1J7JA 2OCEA 1V39A 2AIRA 1JFFB 1U2RA 2VDMB 2D5IA 4CDNA 4US9A 4MWBA 3S55A 4M4SA 4C5AA 4L4UA 5DJ5A 4IGKA 4QPNA 3Q7RA 4C7OA 3IEIA 2G71A 3GJTA 3GDFA 8ICOA 3DZDA 3LDUA 2Q0ZX 4YLGA 5F2EA 3OQBA 3N97B 5CNIA 1OBVA 4DAEA 2AHOB 3TZEA 2BGJA 2Z2JA 2VA2A 4KQGA 2R6FA 3DEHA 3LRXA 1DBIA 5T4HA 5JU6A 2W4MA 4F6CA 5EWGA 3MWFA 5KSPA 3FYHA 1L1QA 3BWVA 4JL5A 4AX8A 4Z0HO 1HA3A 4JB2A 1ZCBA 3NR2A 4IIUA 3HCAA 4PRZA 5BR7A 3QUSA 1OWLA 2JRLA 3SXJA 3CN9A 5JJIA 4RHXA 2FJ6A 1QFSA 3OZAA 1AROP 5F52A 1JU9A 3PI6A 1TQHA 3F0TA 3JQCA 4JX9A 2C2BA 3QFSA 4UB2A 1KFJB 4YAEA 3U4CA 3FBGA 2OXCA 4J0QA 4PZDA 1I0IA 1I7LA 3SEAA 1YE8A 1XD2A 5J4HA 2H51A 4X5VA 4H4CA 3GVXA 4ZO8A 2P9EA 4TLEA 2VA3A 5DW3A 1S2NA 2X5NA 3EB9A 2C84A 3O8LA 3NBZC 1EM8A 2ZRDA 3Q1KA 1ODLA 3IHWA 1YRLA 1VXOA 1JDVA 1KMHA 2X5XA 1BQ3A 1L8XA 1NE7A 3C16C 3CH6A 4JBNA 5CW1A 2GGSA 5CNMA 1MR3F 3AVTA 2JGJA 2GNAA 1G3MA 4IIFA 3M3PA 4ZYLA 4QE3A 3B5JA 3KSRA 2Y93A 2E3TA 4RKEA 2R18A 1XAIA 1FVHA 2V6MA 1R8SA 3ND8A 4X3OA 5ELXA 1U3FA 2GD6A 4KGVA 4X63A 1N4DA 1VGQA 3VU1A 3ONFA 3EBPA 4KUEA 3N0VA 5PNTA 5IJWA 2V7UA 5FJJA 5FFNA 5B5SA 1XRSB 3OHBA 1NW4A 5F7OA 4PVCA 4OQEA 4EW3A 5IASA 4HYTA 1SKUA 1SKAA 4V3CA 3R5KA 2GLTA 4GOLD 1CF9A 3WGLA 3GJ3A 1L7OA 1SXDA 5AWFC 1R8XA 3H5VA 1B2RA 5CXXA 5KTRA 1XVLA 3BGWA 4B6QA 3ORSA 2ISPA 1GSOA 4HUJA 1QXSA 5CP8A 4AUMA 1CNMA 2VQ3A 2HHHB 1CYDA 3CZCA 3AESA 4YQFA 3K96A 4XVRA 3KKEA 3OBIA 3GJZA 3PY8A 1AS2A 2RAUA 1G3RA 5FA5A 4D26A 2H2DA 1ORWA 4IQWA 3QUQA 2OV3A 3GUZA 2YWEA 1QX4A 2OZLB 4CEIA 5GY7A 4FMPA 2ZTMA 3NS1A 2RHTA 2ZRAA 1D9ZA 3RLFA 3BEDA 2IYYA 4RQBA 3B3FA 4HSEA 4AF7A 2JGMA 2NU6A 4QHTA 2PEZA 3EVFA 3OCUA 1KKLA 4X24A 1YBFA 2A67A 1L4EA 3ANTA 5HBGA 3U16A 1R4NB 3MXOA 4WKOA 1QYVA 3FCUB 1A9OA 2DFLA 1QFJA 2POQX 1JG1A 1WCNA 5JUWA 3G2NA 1QG4A 5KG6A 3S8MA 1TK2A 2D2EA 5D6OA 1AQNA 4LQ4A 1L7NA 5G0SA 5JJLA 3UHJA 5LQAA 1NJZA 1JBKA 2FJUA 3HKZC 3ZDDA 3G2HA 4D96A 4PC7A 4RWEA 1E2PA 4ZJZA 3L0OA 3H3FA 3FKQA 3K0AB 2YXNA 5FPSA 2CL6X 4W5JA 3R3UA 4YA6A 5DLPA 7ICHA 3O3CA 5E6UA 5MN5A 3JALB 4ND4A 1G8AA 3AIIA 4DG9A 3DKIA 4GMKA 3E9ZA 2NYVA 3LPAA 3A4YA 1Z12A 3KJFA 2AYZA 5C1DA 1H2RS 1WMSA 3VC7A 4B32A 1CZRA 4HHEA 4LN1A 1LNZA 3M6UA 1A5AB 2JI4A 4EX7A 3R0QA 2YVKA 4ZODA 3U1TA 2WFLA 3JQ7A 1S2IA 3QX7A 1I2BA 1VDZA 3WQRA 3UKJA 2XCSB 3FROA 3IULA 1Q22A 2CLKB 2DULA 4NBLA 4KPUB 4TTRA 4YIHA 3AJ9A 3UUFA 2AUTA 2X3FA 4E5YA 1ZM9A 1WB6A 2GVNA 5LDGA 1IE3A 4Q12A 1KYTA 2PSJA 4DB2A 1NUSA 4F3CA 2CMKA 4Y98A 3IEKA 1C7FA 5EC8A 4ZYYA 4F92B 3BTSA 4MGEA 1Q0PA 5BSTA 3RAGA 4IIBA 4UNIA 1LH0A 1G18A 2BFWA 1BSVA 4BYGA 1P72A 4C20A 5AKYA 3KQVA 4PLYA 3K0EA 3VR0A 1FRZA 3HM2A 3OLCX 2Z2YA 4KDRA 4YRQA 1K68A 5HUJA 2XJ9A 2I1QA 4PY2A 1DKUA 4Z4IA 2XXJA 4WI1A 1EK2A 2GJ8A 1PR9A 2XY7A 4O2AF 1O77A 1Q0HA 3U0VA 2JKYA 3OSNA 4DIDA 3PJRA 2RI1A 5DEIA 4G24A 2QLMA 2W0SA 4LWZA 3ZKWA 3MOGA 1Q50A 3AGPA 4Q3KA 1W36D 3D81A 3FDFA 2VJPA 1DXQA 3V9PA 1ZETA 2ZJOA 3C4QA 4OIMA 4EH1A 4ZYUA 2ZAYA 5EZ6B 2JASA 4QTXA 4Y7DA 1SBTA 4LCJA 5FA6A 3LK9A 3U49A 3KQLA 5AJVB 1KEWA 1PGPA 3WGNA 3QOWA 1O58A 1A96A 2F2TA 1QS0A 3L2OB 5HBRA 3N6RA 3DTVA 2FSVA 4FYIA 3BIXA 4RD0A 2NU8B 5H02A 5FI0B 1U94A 5FV4A 3U60B 5KFPA 3W06A 3O4IA 2YR0A 3MRTA 5P8WA 3DULA 3LJKA 4UM5A 4PH5A 5DQGA 4RVCA 1COZA 1BHSA 5IH3A 3GRZA 3HH8A 3FTEA 3RYCA 1IBSA 1JX6A 2EKZA 1U5BB 3T3HA 3GR6A 1YVEI 2XMCA 1PLJA 1THGA 1DARA 3QTTA 2C2XA 2IVFA 4M0FA 2XITA 1G5QA 2O8NA 3LSTA 3IC5A 1PDWA 3FPJA 3NBYC 3UMFA 5K8IA 3S8YA 5LQDA 1BE8A 4BNUA 2YBEA 2KV2A 3HMKA 4RPGA 1ZEJA 5G0VA 3D2CA 1W44A 3K1TA 3EW9A 5JW6A 4MRMB 4ETMA 3RWOA 4MS3B 4G1CA 3RW9A 5CYGA 1G4AE 1UJMA 2HA5A 1NMXA 4KLOA 3N74A 4LYGA 1EFVA 3O75A 4R9VA 5J2BA 3GRRA 1SQGA 2QL5A 7ICIA 4P4NA 1D2MA 4L8GA 4JDPA 3DFZA 3N0XA 1ZK4A 1Z5WA 4AECA 1IN8A 4IRXA 1LLQA 3BXPA 4YV7A 1Z38A 3VSCA 4JLSA 5DM0A 1WXDA 3ZH2A 3RO7A 1H2ZA 4D5GA 3PFNA 3K6KA 5FYQA 2P4SA 1X70A 4DXHA 3BJMA 2RSLA 1P17A 5TPWA 3EWIA 4YUYA 4F8JA 4KV9A 3VJMA 1U7UA 4CKBA 4RTLA 1C3XA 4W7IA 4MFAA 1ZMBA 1N2OA 1UUFA 2P6NA 5IAAA 4XCVA 4QO7A 5FUYA 4FLFA 4RVDA 4G2TA 2VHTA 2OWOA 1N6LA 5DMHA 5A2QA 5ALXA 3VPBA 3CGGA 4ZQBA 4OTZA 1QHGA 4ACAA 1M7BA 4YAWA 3V6MA 3A2NA 3EZLA 2GXQA 2LKYA 4MP6A 4GSLA 1U1EA 3C29A 3O83A 4AJJA 4J2HA 1RWMA 3DXYA 1CEZA 1J56A 4P93A 1ABEA 3EGXB 1XEWY 3RYTC 4GPAA 3NEYA 4F5ZA 5J0SA 1CUXA 3GZFA 2AOWA 4YT4A 2ZRJA 1JT2A 3P9XA 1POWA 4LZZA 1Z4PX 1RQNA 4L7VA 1E98A 3HNPA 3U6BA 4TVOA 1OCEA 5I48A 1UZMA 3HKDA 3BCRA 2PMFA 5CR0A 1OVGA 3WYAA 1I01A 3EQ8A 4OKSA 1Q7CA 1DFHA 3IBSA 2YKGA 1XSNA 4LVCA 2Y0EA 2JGEA 4WW0A 4LNHA 1U3GA 3QZUA 1S0OA 2XXAA 4YECA 3FDIA 4K4IA 3NVDA 5HFNA 3JPOA 5JCJD 1F6DA 4G8JA 4M1KA 5KYUA 1EZ1A 5CFPA 1TYCA 4QRDA 4N3BA 4RMGA 2PS3A 3AVUA 2CXUA 2HHLA 1V0JA 1P5FA 4WCFA 3GJ5A 4OSOA 1M5UA 2QS9A 4DLVA 3GRVA 5CFZA 4V1CI 3EZGA 4NMMA 5DNEA 4F4YA 4HDNA 3BD7A 5ILGA 1P9OA 1W6UA 4LV5B 3SHWA 1HKUA 1F51E 4WBSA 4JIMA 2G8NA 3NBKA 2RKWA 1UJNA 3ITNA 2OCKA 3U1BA 3HB5X 4F8RA 5C37A 4X1YA 3PKJA 4DW8A 4JYCA 4EHLA 3IURA 5K4GA 4I14A 4L5CA 5IMSA 5DI9A 1K8YB 1PJTA 2XMDA 2XBUA 1BFKA 2W48A 1RM3A 4R2HA 2HJ9A 4PCAA 2PX4A 5HKKD 2UVUA 4ZT6A 2FH5B 5EGSA 4PX9A 2F62A 1PSWA 3ZWNA 4Q8FA 4B33A 2QAGA 3OHSX 2ZT7A 1XB2A 3E7DA 1G60A 2VP4A 1FF9A 3AHIA 3ZE6A 4OLBA 3IKJA 3OC6A 4RQNA 3C8DA 2KM1A 3PXBA 2W6QA 3E9CA 3QWHA 4F5EA 3T34A 3FCOA 4QG3A 4PQYA 2NNLD 1DRJA 3H1PA 1FUKA 1GO2A 3A70A 4OH1A 1SBNE 1ADFA 3C1ZA 3CPJB 3FVQA 3KJXA 2BQRA 4L73A 821PA 3KVRA 4DLGA 3L7IA 3DBRA 3KNZA 4X91A 3PI7A 4Z7OB 2AU0A 2E1FA 4NU5A 4OGKA 1IBKB 2WRZA 5KYGA 3PR1A 1CR1A 1N48A 1WE2A 4FDAA 3I2YX 9ICPA 5B36A 2OB2A 4KFCA 2AXPA 5C34B 3GEDA 2VPXA 4W5NA 5EFZA 4LOKA 1SA0A 4B9LA 3D6JA 3BE8A 1P0MA 1KF0A 3RAEC 3TTYA 1VLVA 1LDGA 3WOVA 3B38A 2YASA 2DRIA 3IUNA 1K5DA 2FMHA 4JUBA 1GARA 2RG7A 2C2HA 2IPNA 1IL0A 3RSCA 3O6VA 3KOZA 1VSVA 2C88A 1NTRA 5G3ZA 3X1MA 2QXYA 1YUNA 3O0TA 3GILA 3W0LB 2AXTU 1PBNA 2AEEA 3MJTA 1P8JA 2Q2VA 3LHFA 4WKNA 4FYKA 3LUFA 5IKEA 2V74B 1YS2X 2ZG6A 2KQUA 4I4TA 4KCGA 3ICQB 2OZVA 2XDQA 2YHUA 5ICMA 2XZTA 2WSSA 3A31A 1EZZA 5JU5A 4LBVA 1IK4A 3M7DA 4Y2JA 5I7UA 5JVDA 2EAOA 5J29A 4J43A 3ESBA 4LRUA 1ZCFA 1MGOA 4RE6A 2OAP1 2A1JA 3A6EA 1NG9A 1VKHA 5B3JA 1GUFA 4TM8A 1WCLA 1VE1A 2XUHA 3DLAA 4QBIA 1YB2A 4BN5A 2H54A 5LFAA 2YS7A 4R9NA 4LZWA 5LMCA 2NUBA 3BMQA 3HW8A 1HYBA 3VPHA 4G3IA 4UARA 4TT8A 2I4RA 2X1VA 3BXXA 1JE0A 4GQIA 3IODA 2J6HA 2FFBA 1S2MA 1HFJA 1O94C 1PZGA 4H60A 5JTUA 1A0PA 3KQPA 4IBOA 3OSPA 4X95A 5E7JA 4P32A 1CJTC 2B2CA 2MWMA 5AXDA 3QYAA 1QC5B 2B83A 4PAWA 1UPXA 2C5AA 3MTDA 1QPZA 1PW7A 1W4ZA 2WUGA 2HBJA 1ZM3A 2VJMA 1UT5A 3TVYA 4DRXA 2W8BB 3K16A 3TE6A 2JFNA 4LZJA 4H6WA 4TWRA 2QTHA 4RY0A 2VJYA 5BVGA 3RS2A 4EARA 1NG1A 3M6XA 1ZIYA 5EHNA 3CF4A 3SZ2A 2Y1OA 4DIUA 3ET5A 3TTTA 1IFXA 2HJSA 1SXIA 3GRPA 1LBQA 2VJBA 1R4ZA 5IDQA 4ALIA 4I2DA 5IWCA 3SZRA 3S4YA 5L1JA 3R7DA 1JWAB 1GPAA 4LE2A 2HJWA 2IYEA 4IF4A 1CUFA 2YN2A 2ZT5A 1KU0A 5TQJA 3KPUA 4L2IB 4L4RA 3UOWA 4F3YA 2Q21A 4IWYA 1U8AA 2HXYA 4M83A 1FFUA 5PGMA 4V38A 5C52B 1NMZA 4KL8S 3ZI4A 2REXB 1PGQA 2VJLA 2G5HB 3ZLTA 1LC0A 3DCJA 5D7NA 1OPRA 3QUAA 1NNI1 5A04A 3HUEA 4QAJA 3STXA 3ZY6A 1Q0QA 2BDUA 1RVDA 3SBDA 1SOWA 4X0EA 4Y2UA 2Q5JA 4HEJA 1HH4A 2EFHB 1V71A 3TR5A 4Y9UA 2IIQA 4EZEA 1MA3A 1V5IA 4UU8A 5F4BA 1ZQQA 1XJ5A 1P0QA 1PEKE 1ZA1A 4LGVA 2TMKA 5JNLA 2QPLA 1HUZA 1WZCA 3RIMA 3G1WA 4LJLA 4Q7JB 4CT5A 1ZQCA 5LMNB 4A82A 5A9RA 4PX3A 1RDFA 3ZQ4A 2QN9A 1L5RA 4ELTA 4ARSA 1UODA 3C3CA 4MUHA 1HZZC 1JAZA 4DFJA 2QBYB 2HF9A 4K86A 4LE0A 3ANXA 3FNBA 4JJ4A 1T2FA 1KI7A 3JZIA 4AYWA 3N59A 4URHA 3PDHA 3HHEA 4QDOA 3K9CA 2R6CA 5I4CA 2CNBA 1T6NA 1TCCA 5DNCA 4U3JA 5GAJA 3NDJA 4MTCA 3I8OA 3GJ0A 1RI3A 5FPTA 9ICWA 3NHSA 4EK9A 5CBKA 3C8HA 3T94A 4LJYA 4YP9A 3OFJA 2Y0PA 5F1YA 4LCEA 5AW1A 2QXUA 2I9PA 1VSQA 1BX3A 2JZBA 5DLDA 3G9ZA 4M9NA 3EHDA 4EF4A 2KMDA 1Z4OA 4N18A 5DNVA 3G6XA 4WD3A 2XBLA 2R2AA 2ZYDA 3S68A 5KG1A 4OQPA 2BGUA 5KFIA 3ZCPA 5J5CA 2ETVA 3PPVA 1V7ZA 1I7PA 3D8RA 1NUQA 5AVSA 4Q24A 3V1TC 1C8VB 1EG2A 3DB2A 4BOYA 1P6XA 5KT7A 2O8FB 3M70A 4LSZA 5BOVA 4TS4A 4URWR 4OHPA 2PYDA 4EI2A 3K0HA 1U48A 3JQBC 5C5IA 2OVBA 1AO3A 1Y3BE 2BCQA 4DSOA 1P39A 4WUVA 2P8SA 4A0GA 3CONA 3ETEA 2A88A 3BQ1A 5EJ9A 3MTGA 4H18A 2LGJA 4WBNB 5T6BA 1Q57A 3TMAA 5BMVF 4TGLA 4Y30A 2PJZA 4WZAE 4X65B 1W30A 1M8PA 2RARA 5AT1A 1UPAA 4OV6B 1BC5A 3DZCA 2W03A 4J9KA 1D07A 3MCZA 2VUIB 3ML1A 3PVSA 2D6FA 3D6AA 4JWNA 4OMFG 2PUTA 5L1MA 2OHXA 2VH1A 4YRIA 1JEEA 4JVOA 4OHRA 1TMKA 1AXGA 4OI4A 1KI4A 2UZ0A 4NPAA 1KTVA 1UM8A 3R3YA 5LA6A 4YR9A 1VL6A 4JXKA 1LLDA 1JLLB 2J6TA 5HF5A 5ARCA 4PZ0A 1R50A 5J2TB 1BXGB 3QTLA 1OJLA 5I5GA 4LKRA 2GUGA 3CY6A 2IITA 4L9RA 3VUFA 4HCJA 3PTAA 3V55A 3NOXA 3E22A 1TFRA 1XEFA 3OOSA 4NCBA 4AKIA 4AJ4A 4IXDA 8ADHA 2EV9A 1BMFA 1K8QA 1ND6A 1SBYA 5BURA 3N0RA 1NTOA 1C9NA 4DNOA 4F71A 4D4IA 4U7GA 4MQ4A 2Z43A 3U39A 1NV9A 4WHMA 1U1IA 3PW4A 4KLLA 1G291 1QH1B 1JAIA 4QNLA 1FNSA 4PZNA 2AXEA 2BGTA 2FMUA 2EL9A 3UA3A 3FPSA 5LQJA 4ER3A 2G76A 2JFFA 3ZWYA 1Q91A 3MYRA 5EMNA 5HQTA 3D3KA 3ZLUA 5FFMA 1JG3A 1HDXA 2OCPA 4BP1A 4FEYA 2AWOA 3L4KA 3CMMA 3L05A 4BX8A 5HMLA 2GN4A 2VHWA 1U7XA 4WA7A 4DKJA 1QVAA 6GPBA 4UOZA 3SAFA 5CEJA 1E7RA 4AKEA 3DZBA 2NT4A 4NBTA 3K9BA 4YRZA 2UYGA 1T0IA 1F8FA 3WLIA 3OC0A 1JUDA 2BMVA 2OM6A 3ZZNA 4ECSA 2JR5A 4UMEA 3LGAA 2PFQA 2AGQA 4XA5A 1SV4A 3KL2A 1NJWA 8AT1A 1II9A 1JALA 4PYIA 4DCJA 4P0PB 4Q3LA 2BM8A 4Q0MA 3OWXA 3ZG6A 3EZ5A 1B0AA 1X1CA 4F2PA 2J4FA 2WKPA 5CJPA 4XX0B 4G81A 3LC1O 9ICQA 4DLBA 2WUDA 5DGBA 4H7KA 2JLRA 1W5FA 4EHJA 1KAEA 4EGCB 4LZLA 2AUMA 2BFCB 3R23A 2JEGA 4G8BA 3RRXA 1RJFA 2EZYA 1D7AA 1ZNYA 2JLVA 5KFBA 2XADA 4O08A 4PEVA 1N60A 5FKJA 3KE9A 2WU1A 4Z54A 2ZVJA 4MR9B 1B73A 3IP4B 2AYXA 1YO6A 2XYGA 5F1KA 1FIQA 2P9QA 2CC2A 3IMEA 4XQGA 4JJGA 4XDGA 1G5FA 4ECWA 3ZIUA 4DHWA 2H92A 2SCUA 1UDCA 3PA6A 3E8XA 5M34A 3W8RA 2PSEA 4P7FA 4RIEA 4CGZA 3ZWKA 1AM4D 3ZK7A 4DCOA 3H86A 2JAHA 1YOVA 2ENWA 1FQKA 5SY4A 3WWEA 4RZXA 3VXKA 4ZT2A 5KUTA 4UTRA 5EIBC 5AK3A 1UAYA 5BV1A 2Q5OA 2XZDA 4MCIA 4M9XA 4YRAA 3FI9A 1YB4A 4OJTA 3N5CA 3JZFA 2C5EA 2SICE 5HKAA 5AM0A 3JYQA 2C4MA 2OM2A 3OPYI 4XE5A 3GMTA 2YZ7A 2JIQA 3CJTA 1A3CA 2AHOA 3BH0A 3UJ3X 3BE5A 4EJSC 4MQUA 1ZJYA 1KDZA 3O4GA 4MS4B 8ICHA 5HK9A 2VO1A 1M33A 3O4VA 3K09C 3Q7IA 3THYA 2WLSA 3PDUA 4YROA 4S12A 3PK0A 2BF7A 3Q7QA 1ZWKA 5IBRA 4MHOA 2AI2A 1AGYA 3F8WA 1PP4A 3EFOB 1E5VA 4QOSA 4P3PA 3ZDXB 4BJ3A 2RKBA 5B4TA 3OPNA 4HFRA 2NZ2A 1VG0B 3ZHRA 3IOCA 4B3TB 4LCBA 1Q46A 3C23A 2GYWA 4QM7A 2A5LA 1JQLB 3NVVA 4G1BA 2HJVA 4XRGA 4R7GA 3UF0A 4Z6KA 4JOQA 4I2VA 1AH2A 5BR8B 3M3HA 4LYAA 3WLJA 4TV8F 3PX3A 3VO8A 2MR6A 1OXSC 4TT3D 1R5BA 2LDXA 1BGVA 1YHNA 1MNQA 2EF0A 2E85A 5H4HA 3DAYA 5DMXA 1ZGBA 2VPYA 1SD1A 3BB3A 5IW8A 2AOUA 2IHVA 5HFJA 2G9VA 3PZBA 1B6GA 9ICRA 4EG7A 1GFZA 4D4GA 3CNEA 2PNFA 4BIIA 2EEPA 5TQ2B 4J7XA 2NU7B 2WSSD 3H1BA 3HMQA 3WE7A 1JDBC 1P1FA 5L95A 1BDBA 3PXEA 2EG9A 4M9HA 4CLOA 4OJQA 3HB0A 2X8LA 3G7NA 4I3GA 1OGYA 2ZXHA 2VPWA 1FYEA 1YQEA 4YI3A 4QQ8A 4RV5A 2C0QA 2ZSFA 3EQ9A 4DOCA 5LOVB 2CNNA 4IV8A 1SG6A 4JKYA 3QPWA 4NE2A 4UBCA 2PXXA 4ITVA 5LYJB 1KEVA 3ZDAA 3DZHA 3KB8A 2P5SA 1O5IA 1X7XB 3LY7A 3RS5A 3KPYA 5AI8A 3O1IC 4QPCA 1RRCA 2XOXA 4MJLA 4GZ6A 5DQIA 2DUMA 2A5JA 2VQ6A 1RZVA 1QPBA 3WKBA 4M55A 3T7IA 5LDDC 1W2GA 2R4QA 4DIKA 4MWEA 2D54A 5F3RA 3IDQA 4OXNA 1P4HA 1YVPA 3LM8A 3RJZA 2HWWA 2LMRA 3QGMA 4JA0A 4R7TA 5EOVA 1OX5A 1OXKB 1JYEA 1U98A 5K51A 4DT1B 3L7AA 2ZYRA 4LWPA 3VKUA 1II8B 2YH2A 1AHNA 3QXXA 1DRWA 3EASA 2AMJA 4MI9A 1SZPA 3FR7A 4O0IA 4I1OA 3PE6A 3W78A 1DAPA 3EG5A 3GLQA 1XMPA 2KEYA 2EJCA 4FZJA 3C5GA 5C8ZA 5ED4A 1HQYE 2CE7A 1PJQA 4HFJA 3CNQS 4RIGA 3DOOA 4E13A 2VA9A 5I45A 2VAPA 3KKOA 3DEYX 3EXHB 4KWHA 1TT5A 1FJXA 2B8WA 1I32A 2XA1A 3PRHA 4EG3A 2F00A 5I7VA 3OETA 1R4NA 2RHOA 3A4IA 2HO5A 5IAEA 4KKXB 5TVKA 4ZOLB 4F5DA 5K0FA 4ZJUA 1XAGA 3HCPA 2AOTA 2MYNA 4NAVA 1BKYA 1SD5A 2P7HA 4HWSA 1A50B 3GJ8A 4NJEB 1PWYE 3AV3A 2ZJ3A 2RC6A 1K06A 4FNMA 2GVZC 2DXIA 2C9CA 2M1ZA 3KVYA 4AY4A 2I78A 3U81A 4Z4CA 4B2IA 3L41A 4MW1A 1DFIA 3MOSA 4GMDA 1SVLA 1JIXA 1WDKA 3W2TA 2FPWA 3LTNC 3JALA 4RTSA 3DMTA 1HG0A 3WV4A 4M0KA 3WSVA 2X7HA 3N2NA 3UMJA 2W7OA 5TVGA 4YUXA 2F55A 1P73A 1MRZA 3PG5A 3HWRA 5HIMA 5JS8A 2XYPA 1QCDA 4ZHSA 3V8QA 2EBWA 1BWQA 1GAJA 3N7AA 4II3A 4KWIA 3V4LA 4JAVC 3HKCB 3JZDA 2W00A 4B3RB 2R8EA 2H9YA 3DEEA 4INZA 4UHBA 4NFLA 3OT1B 2P91A 2R11A 4LYHA 2WJVA 1KZ7B 1ADGA 5KBYA 1GZVA 7ICMA 2F8KA 3GK3A 1JRPA 1KJYA 3IAAA 3RIGA 5AIBA 4AIRA 1PYOA 2LCQA 3F3MA 1H05A 3D7MA 3NRJA 3BRSA 1VRVA 1A9ZA 5ADWA 1F5NA 1FW6A 3KT6A 4TOIA 4M1YA 5LQSA 4I8DA 1U4SA 5AW6A 4GRIA 4EYIB 1L5VA 3TWOA 3EPIA 1X1AA 3P27A 1XDWA 1G2PA 2GFIA 2X4LA 3KDPA 3Q9SA 2C31A 4ZMRA 5DBIA 4QJ3A 2G88A 3T5DA 3GNTA 2FKNA 1TT7A 1YTLA 1KY5A 1I4EB 4EY7A 4N3NA 1B00A 5G1NA 2ESRA 4OI2A 3D8TA 4HAZA 4BMNA 4YXFA 3FMPB 1VL5A 1IM2A 1F38A 3GMSA 3W34A 4LXTA 4BGIA 3TFWA 1G21B 2FZCA 1GAQA 5L40A 1DRKA 5CD9A 4PGAA 4QEZA 3AI2A 4OAOA 3H9BA 1KH2A 3I2KA 4WUTA 5KFLA 2EYQA 3OUTA 1QJCA 3C14C 3M7IA 3EA0A 3M49A 2UYQA 3P9QA 1PUZA 3NIBA 3ADCA 4A0RA 5JTIA 4ZVKA 2WINI 1CUVA 4MQMA 2P6PA 2H0RA 3WSTA 3HL4A 2MUTB 4ZREA 2XSZA 4IQGA 4ED6A 4RD4A 3Q3VA 2RHFA 1U90A 4EYQA 4HGQA 3CLRC 4H77A 5U1PA 4PC3A 2GJKA 1VHQA 2ONKA 4FO6A 5SY6A 3TXAA 3M8KA 3UG7A 1ZN8A 3PT5A 3W1EA 1Q2UA 4KDEA 4W8GA 4FQ8A 2NU8A 4OXKA 3ESAA 1GLVA 2BUAA 2JFQA 4R7ZA 2XKKA 5DTQA 1QCZA 3K4QA 1QIKA 2ZPUA 5AKLA 3CLSD 1MA7A 2H7YA 1ZY2A 4B6PA 5CB4A 3TNYA 3RC9A 2P6UA 3PMLA 1UJ5A 3ZWDA 2LYAA 3GYGA 5JSQA 3OQ1A 1XCMA 1BMFD 1EFPB 1U5BA 1GZUA 1QGDA 5ULLA 3KEFA 5IYZF 2BM0A 3RF7A 4R1TA 1AU9A 1MV8A 3OF2A 5KC9A 1SG9A 1Q1GA 3TQOA 1FDIA 1WXQA 2H7VA 2BBOA 3UV6A 1O8BA 4RDXA 3HCCA 3L7YA 4K3VA 5AM4A 2I62A 1OFHA 4R05A 1IOVA 1LI4A 4DF3A 3BIFA 4MRMA 2WHEA 1G7CA 2OK7A 4DQKA 3CZAA 2GTIA 3QVVA 6REQB 3P0IA 2X9NA 1Z16A 1E9RA 1U7WA 3BH6A 1WDWB 3MWEB 1YJAA 2XI9A 1T4DA 4V0KA 2W9XA 4DLRA 4DLYA 4R9RA 5SYMA 3RB6A 1NRJB 1Q0RA 4E5SA 1DZIA 4QECA 2Z57A 2VUHB 2FEOA 1VIYA 4DLAA 3GJYA 16PKA 4Y2PA 3A58B 1CV2A 2BSAA 4YWHA 1ONOA 1T8SA 1QFYA 1UBUS 3H2GA 4DFDA 3AUOA 3GNQA 5LZ5A 1NLYA 2EFEB 4V03A 5KTMA 1XPOA 4E5KA 4C4YA 3ZNNA 1CC1S 1UWVA 2HQSA 1NXXA 1KK2A 1PG5A 1GITA 3L7CA 3DO5A 4FGLA 3SM9A 5FI3A 1BNOA 4ECAA 2GCGA 5J43A 1GNLA 2NTNA 4LS3A 4DSEA 3ZWCA 4FOSA 1XVUA 3FFBA 3B20A 3I64A 3NHRA 1U3TA 3HCDA 1VRWA 4JOSA 4FGJA 2J5QA 3RRMA 2PO7A 2A7XA 2FUCA 2OV2A 3W7VA 6Q21A 4IUYA 1I9GA 4IGAA 3LF1A 4UAYA 3A26A 4IMPA 2ZIVB 1L5KA 4ZI2A 2FN4A 1VJ5A 1VYTA 1PVOA 2WD7A 3EGXA 1DCTA 1GTSA 2ALZA 1ZJNA 4EG1A 4DYDA 3L6OO 2GRAA 1ESCA 1RVV1 4Y2RA 1VI2A 1OMOA 1ZOSA 4UAUA 1X77A 2IPMA 4FBGA 2FSGA 2AKEA 1U0FA 2D8AA 4UBBA 1T8YA 3I53A 5J2KA 4ER7A 2P2YA 5IKOA 2QY6A 2AJBA 3E7WA 1TQ6A 3EGWA 1OYWA 2CCGA 2HWXA 3V7LA 1QRUA 3EBLA 2XVTA 4ZAZA 2VSQA 3QEAZ 1QHNA 3KAJA 2WKQA 3TDNA 4QZGA 1KAHA 3IHTA 3WLMA 3BS5B 2NSJA 1GRQA 2FMFA 1YVRA 4RZUA 1CUBA 1OLXB 4DF4A 1EZ4A 4EENA 1N2ZA 3K20A 1X80A 1RYYA 2OXRA 1QCCA 2IKQA 1CP3A 4D4LA 2O4CA 2VBCA 3LA6A 3ZZTA 1EXWA 4RT2A 3HO6A 5BYJA 1P80A 1PIWA 3KKKA 3CM0A 4KLHA 4Y6LA 2B4KA 4XXHA 2Y2UA 2B30A 2QDKA 1EK1A 3S7TA 1KP9A 1SHUX 1JT9A 5BYAA 4MULA 1TPYA 1PSDA 4V3BA 1ZQZA 3BMNB 4D9KA 2PFGA 4JGGA 1HE4A 3RI3A 5IKXA 2KZZA 2PH5A 4PGXA 3NTVA 4G09A 3L7DA 4I6GA 4NR0A 3S81A 5CITA 4AUEA 2AN4A 4EFMA 1M0SA 1RHMA 3KB6A 5FPKA 4KE6A 3BGDA 1CXZA 1EJ6A 1VPDA 4AMVA 4U39A 4Q4HB 5FWAA 4OSPA 4IIHA 3R9IA 1HBJA 2JLCA 3HVUA 2ZVQX 4N8SA 1X6IA 2JIBA 3RC1A 4UZSA 3GV8B 1RC1A 3PXUA 3M3DA 4KBYA 3O2NA 1CJBA 2CDBA 2IIVA 1FFSA 2IS1A 3K9LA 1C9KA 3GHHA 1LX6A 2FNAA 1WUTA 2WE7A 5TMDA 4GC6A 1KR2A 4CI9A 5MN6A 1VCHA 2HHWA 1L4UA 1OGJA 2QTNA 2CJYA 3VOBA 3VH2A 4IZHA 1E59A 2ZAOA 5E6RB 4QASA 3BJRA 3NW9A 3KVVA 4F8EA 3TLCA 3WBKA 2FW0A 3UUWA 5IZ4A 5CX4A 1KJ8A 1L3CA 4O2RA 4UE2A 1F20A 2NO1A 5MGBA 2IBMA 2NSHA 3B70A 3TSCA 3B3GA 3E3AA 1DX6A 4C7XA 5F9HA 2OO5C 1XHFA 3P9SA 4HQKA 1K97A 3VO9A 2B21A 4AQ7A 3DLPX 2ETXA 4DE5A 5J4KA 5BN1A 2R1UA 4U2DA 3IP3A 4MJ7A 2VUUA 3IQWA 3OE7A 3U7IA 3EMDA 3PGKA 2HMUA 5J2UF 3RD5A 5K0JA 3GLUA 1HOTA 1W75A 2JIOA 4P3NA 2OHOA 1NAIA 3ZY5A 1M2VB 7ICEA 4DCCA 3CXRA 1K7FB 1Y89A 1BWPA 2D1SA 1LV5A 4RKWA 3MBYA 3KK0A 3IV7A 1E6KA 3HV0A 2OHGA 2Q45A 5GOTA 5F5LA 3ZV7A 1E2BA 4MWGA 4C03A 4MA4A 4B4KA 2XKAA 3ZR4B 5AJWA 4C4TA 2X40A 3G1TA 3DXXA 4HH1A 2CFRA 1EP9A 3QNMA 4R1SA 4HSGA 5IAOA 2IYQA 4QJBA 3ZPXA 2AI3A 3FWYA 4ISCA 4OP3A 3HCRA 4RLQA 1QRRA 3GJ7A 3KFLA 3SDZA 5K09A 2QP3A 4ZH4A 3PQCA 2AH5A 3EOBI 2FEKA 1BPZA 1KI9A 3LDAA 5JSFA 5EKUA 2OYCA 3GGSA 3RVOA 5TZVA 2PTGA 3UJDA 5A0VA 4YG2A 4TKMA 3LVFO 1J2EA 4R71A 3FPCA 3JD3A 4UBNA 5EOZA 4K9RA 3H97A 3O31A 2DKZA 2G9NA 1KDHA 4J3JA 4UNPA 1E61A 3M89A 1NYQA 4XOIA 5F9NA 2IXTA 4JLWA 1PAUA 3LBAA 5HF9A 5LU8A 1WZNA 5K2OA 3SAHA 1TVKB 3ZVLA 5C8XA 4UZFA 4N0DA 1KPIA 1L5MA 1P1RA 1OXMA 2C4TA 4JT2A 1YZNA 3AKEA 4L51A 3H4TA 2LW7A 1NVGA 2WQ7A 4LJSA 1XFDA 2RBGA 3KYCB 4WOCA 1WV1A 4L2IA 1EHIA 1YR9A 3JYOA 4PO9A 5ALHA 1LS6A 1N6RA 3T7CA 4ZGGA 4NCAA 3QI2A 4TS3A 1Y3IA 3UT5B 2EBFX 3A28A 3K72B 1DJLA 1J25A 1D3AA 4DMMA 2HHXA 3U4IA 4NF2A 4Y2TA 5KL1B 4X1IB 1YF3A 1LDBA 3GVHA 3DXFA 1SXJC 3F6EX 3X43A 2P7IA 3UQ2A 2C2GA 4L0QA 1CE8A 1FS6A 2QTAA 1USVA 1Q7BA 5IT5A 3COVA 3WAJA 3L0BA 4M8IA 2QP9X 4UTNA 4MNTA 1C1YA 2VP3A 3KQMA 2P2GA 4DLSA 2SECE 2WTAA 1KFKB 4TL6A 3KU1A 4PHEA 1I36A 3PU6A 3VAAA 4RBNA 5GGYA 3OFVA 3DHEA 3ZE2B 2JPDA 1FDSA 1XCOA 1IQRA 1RHRA 1E9AA 3QEBZ 2BDEA 1FUYB 3OSZA 3HR8A 3SPXA 4PS1A 1N25A 2WHQA 3BG5A 4LRYA 4EJ6A 2ZROA 3MHTA 2QBYA 3H5IA 4H3VA 4XJXA 1XMSA 3OI7A 3ZXYA 1JG7A 2BGRA 5DYYA 3RK0A 3HYSA 1OUMA 2VUTA 3CQ9A 4JFAA 2P5UA 2P3OA 5E2AA 3UOGA 3AG5A 1Z0ZA 2ZIXA 3KFXA 2WI8A 4JELA 4YAJA 3RASA 3CV3A 4J9RA 1RYZA 3AR8A 3S1AB 4CL2A 3WRXC 4EF6A 4IS2A 4DL4A 1R37A 1WEHA 4TTJA 2QTZA 4YGYA 3ZGXA 3Q3JB 3ZCVA 3SAGA 1OSNA 1DO8A 4B43A 4FZ5A 3PCTA 2JHPA 2N1RA 4XLTA 1R0SA 4LC0A 1Z0DA 3VOTA 3PGA1 1GAWA 1ZINA 1BKDR 1MIHA 4UMFA 2FMSA 3Q8KA 1ESNA 2IRWA 3PHBE 4KLDA 4W6ZA 2QLJA 3KYBA 1BCSB 5IJ0A 3AMVA 3C4VA 3H5AA 2WIGA 4GRDA 2BONA 2UUAB 2Z04A 4PZAA 2M6RA 2LP4Y 3T3NA 1T3GA 2F9LA 2ZYWX 2HGZA 2O8FA 5KFCA 4CEHB 7AT1A 3PFGA 3AW8A 3NCTA 3MTAA 4OPMA 4B40A 2MA1A 2NYRA 4IOJA 1JA1A 1G3QA 4L78A 3RRYA 2QUBA 4GXIA 5FUXA 1FFAA 5E3JA 3UANA 1DT3A 2KKVA 4BMYA 2W2XA 1W5AA 3EWSA 3L04A 4WBNA 4JN6B 5IT9A 5IAKA 1IU9A 1PLLA 2XVAA 5BV8A 4X3PA 1QHFA 5M3BA 1JE1A 2XMBA 3ESXA 7ICFA 5BV2P 3FETA 4OGLA 4REOA 4MVJF 1LCIA 3IE2A 1CRLA 4WJZA 4R8MA 4QOFA 3LX5A 1E63A 1LJUA 4OXQA 4PFKA 4UHFA 4FXOA 4IDGA 3HFJA 1VM6A 2UZ3A 2QPAA 3HGMA 1V1MB 2WWYA 4PZOA 2GCOA 5AKGA 4D9IA 3FNGA 1IY2A 5FLYA 2Z2ZA 4W6QA 3VAZA 1JLLA 4CQMD 2CLMB 5JAMA 3UGQA 4QNNA 3NJ8A 1BXGA 2A58A 5HQ3A 1SEVA 2O23A 3ZTWA 4BVFA 1TO1E 3FHJA 1XO1A 1PJ2A 4C05A 1SM4A 3CF6R 2FPXA 1XA3A 2IYAA 2J3JA 4KACA 4GZ5A 2ZE6A 4GX0A 1KRWA 3P2OA 2K4EA 1FOEB 1WX1A 4PG4A 1ZVKA 3UN1A 1KYIA 4NL9A 1BYIA 3LQ4A 1EA5A 1Z18A 2Y1EA 3RKRA 1TJ5A 1N1GA 4AUNA 4M7PA 5JSZB 1KW4A 4PL1A 1DAKA 1NT2A 3DO8A 3HBFA 3PPWA 1MIOB 4HAWA 3FCSB 4JSRA 1GEEA 4PYOA 4IO0A 3IP5A 2YIDA 5J0TA 4II7A 1QH1A 5BSHA 3RROA 4URXR 4L08A 3VDRA 2V9ZA 4LV6A 4ARIA 4FDTA 1YRBA 1XD9A 1P1KA 4IWNA 2GKOA 1I10A 2QAIA 2A4KA 4UHKA 4M9UA 4D8VA 2FJ0A 3RF9A 4EPVA 4AZ3A 1TAGA 2FFQA 1M2FA 5IVDA 3X2SA 2B4QA 2HSZA 4JJ6A 4QUHA 1IHXA 2XQGA 2QV7A 3ZGOA 4XWGA 2H3IA 1WCV1 2C5SA 3WZLA 4A2CA 1HWYA 1ZM4A 4PXAA 2OCXA 3SHOA 1GWNA 1B1CA 1ZEMA 4D8XA 2VYVA 3QPUA 1H5UA 3RH4A 1S7GA 5ALDA 4HWGA 2DR2A 1S1MA 5EHXA 2IUFA 5FOSA 3N2ZB 3FJYA 1TEZA 1JX4A 1T2CA 3ROMA 5H9WA 1SCJA 3ZWVA 1MOSA 3IMFA 4C0LA 1ZNZA 2B1IA 3RVRA 1E9BA 2O5EA 1EDBA 2Q0HA 4IGFA 1G4UR 3VVBA 2XVYA 3WLFA 4PW0A 3HXMA 1MAVA 1IRXA 4OHZA 2WAAA 1PLKA 4LY9A 1OA0A 1X9HA 4F56A 4FKMA 2BGMA 3IVXA 4XX0A 3Q7SA 4XVHA 2O8BB 3VYRB 4EQZA 4AKGA 3H5OA 4UB4A 4GPTA 4RQ0A 4S1PA 4UBOA 3MABA 4FNOA 3SYKA 1FRNA 5GJVC 2ZPTX 1T0HB 2BFCA 4Q4CA 3MTBA 4G86A 4BUJA 5IHPA 1ZD1A 3BTUA 1C1DA 4DWWA 2MU1A 2QZSA 3ZWBA 2HF2A 3A6FA 2DU8A 2LCIA 2BRUC 3CW8X 1FFGA 1Q0SA 1HI9A 4LYFA 1E2FA 4RPIA 4MR9A 3CC8A 1JDJA 1CB7A 4HUQA 5ALEA 1S2LA 3FOWA 2O2IA 4RK0A 3VU0A 2C83A 3E3LA 4F50A 3LCRA 5KFGA 3DMYA 3RDPA 2ZI9A 4BTEA 1CY2A 4F85A 4P3KA 4ZHQB 4B3GA 2CCJA 4NCNA 3EPGA 1W88B 1QH0A 2DL0A 3LLSA 5KFVA 2EQAA 2I3DA 4ZU6X 1SKQA 2RHCA 1RQPA 3UXPA 4IDNA 3EIQA 2LYBA 3BQTA 1SUAA 4PL2A 2D3TA 1ZZEA 3BCSA 2DYKA 3U7HB 1U0NA 2EP8A 2JGFA 4B8WA 5KFEA 1DKQA 3DH0A 3WR5A 3P4YA 2BE7A 3G2QA 4J1NA 1H66A 4XVCA 4NYJQ 3LWMA 3V8BA 1XTUA 3WAGA 1GCUA 4O8CA 4I2CA 2CFOA 3HX0A 1GTL1 1XRRA 1ZL0A 4DQLA 2FZLA 4JLOA 3FPKA 4PZPA 4RS4A 1QRDA 3DOHA 1BOFA 4ARAA 1FFCA 1PQPA 3K7EA 3AYXB 4KSBA 4UMDA 2HEIA 2ZWVA 3TD6A 1NVTA 3FBWA 3QFHA 1NLZA 4CRXA 1VBKA 1WPRA 4OG2A 3OT5A 3NT2A 1ADCA 4C0JA 3PZRA 4HWRA 1J20A 2GRUA 3L92A 1MABB 3SXPA 1UDAA 3NM4A 1FX1A 3EFOA 1V25A 3I12A 1Z73A 2GRJA 5DXAA 3B2EA 1Y3HA 3R0IA 2OY0A 4UNSA 1WP4A 1YA4A 2YXPX 5CD1A 4EHAA 1HMYA 1AKRA 3MZ0A 2NO7A 4Z4EA 1IZ9A 1P9NA 1AMOA 2H2HA 3I4FA 3T54A 2QLNA 5JG7A 1LBSA 4I3FA 2BW0A 3PHCA 1WHSA 2HN9A 2GNOA 1JXAA 1ZRSA 4Y2YA 3K30A 4YP3A 2XT9A 2QM0A 2XGMA 5G4LA 4J90A 3PF9A 4QWMA 2Q5QA 3P9NA 2J0VA 4JJ7A 4DJAA 7ICNA 3VFDA 4CU2A 2NACA 2Q3HA 4H6XA 3OE7D 2JRZA 3T79A 4Z6DA 5C7OO 2C8KA 4PLVA 5A4IS 5DDIP 4OJNA 4MEAA 4MGIR 5BNIA 3VPFA 3NIDB 5TQ2A 3WZMA 2RAFA 2NU7A 3FSRA 4NU8X 3R3SA 1NJSA 3VR5A 4JEIA 5JYBA 2HL6A 4UB5A 4A15A 1KNQA 3RR7A 1U8UA 5H82A 4CZ2A 1YZKA 2EOAA 3RC7A 3AP1A 1FYXA 4G8CA 5FBRB 4YRNA 2KVSA 2BZFA 3MR5A 1EDEA 1AHHA 4IS3A 3R75A 1DJQA 1QG2A 5DP1A 2OB1A 4IV0A 3UGKA 1KQPA 1X14A 4LBZA 1HUOA 3T7EA 3KXPA 1EGHA 2QE7A 5EESA 3L9XA 1DEHA 3UFBA 5EVJA 1OW5A 1ZQJA 4IW3B 4URFA 5KNBH 1Q0TA 2YHBA 1P7ZA 4D2IA 2MRLA 1LWOA 4MUMA 3A0RB 1JDNA 2PVPA 1QIHA 3PD1A 4XSVA 5J2JA 1MG5A 4LOIA 4C87A 4XQCA 9ABPA 1U0LA 1B8UA 2OP0A 5IT0A 1WZIA 1MT3A 5DVZA 4F2DA 4A0HA 1NJ2A 3COWA 2V7GA 3MWDA 1A77A 5SV2A 2XX3A 1RWPA 4W5HA 5DM4A 2ON6A 1U3VA 1RPZA 2CSUA 3L6UA 4G0WA 4DT1A 4YFYA 4AJEA 1LPAB 5E7MA 1II8A 1ZXBA 1ZIXA 3EYZA 1RS0A 2PL3A 3QHAA 4HNVA 4EFDA 3E9MA 5BSEA 2C2OA 5DWDA 4N47A 3RSGA 2DWPA 3DHVA 2CUTA 2P62A 1YBHA 2D3DA 3CA8A 3DR5A 1QZTA 3P32A 1VLQA 4Z0NA 2I9GA 3GP5A 4P4SB 1SCDA 1EWYA 2W2LA 1DAFA 3EXHA 4RA9B 1M1YE 1EXDA 4RK4A 4NYMR 1E1QA 3ZVNA 1HNWB 3OLYA 4RMNA 1AS3A 3ECAA 3MLEA 1GYQA 3DP9A 4ZOLA 4MGYR 4IOMA 4L6IA 4NDAA 5KC8A 2CDCA 3RS3A 3DZIA 3G6WA 3I04M 5BWNA 2VT3A 4HQRA 4FINA 4NAHA 4EYHB 5JBIA 1F44A 1QVWA 4NJEA 3E7FA 4FE4A 5L7WA 4HGNA 2ORED 2POCA 3DTVD 1LBEA 5KTQA 1XC9A 1DIGA 2HTFA 2CJXA 1GKIA 4ZVSA 1V1RA 3Q11A 3DMDA 1OYYA 1I3CA 4RVNA 3KM0A 2P9CA 2Q2OA 2YZMA 2CXOA 2BH9A 4MRVA 2FPGA 4RTMA 4FYMA 4RYLA 1UC8A 3EFBA 1ORVA 1W0KA 3KPWA 5AVKA 4OYYA 5FTJA 1RQ2A 4MUYA 4TV9A 1G17A 1BE1A 1U0EA 3ZEAA 3UNXA 3PKIA 3MS2A 3I8XA 5E8RA 2WF8A 3BZWA 1M8JA 2BHSA 3HKCA 3HK2A 4XYMA 3E9RA 2RH8A 4C2BA 3N76A 1JR2A 1V9LA 4ZP1A 4L27A 3PJEA 3OT1A 3JPQA 3SZUA 5EKDA 3U80A 1OAKA 1EGAA 1PUJA 3HA5A 2I3ZA 1JZQA 4MI6A 1MJGM 4S1OA 1U2TA 1Q92A 1YIOA 4BMDA 1TFUA 1F7VA 1PHRA 3ANNA 1FFYA 2IXBA 2ZEJA 4RF3A 1XX6A 4DOAA 3R7SA 4Y18A 4P38A 4HP8A 4KTQA 1EE9A 3VU9B 3GD5A 1VIAA 3KE8A 5JC1A 2QZJA 2C7QA 5AJXA 5J8YA 4Q3EA 4WKCA 3PQDA 2DY1A 4RTKA 5EXDA 1ZJMA 2BLLA 3PJGA 2VZLA 1T5TA 3IAHA 3NHKA 4KLNA 5F3DA 3R7WB 2NZUG 4U2CA 1GYPA 5IIJA 1PK9A 4A5OA 4FDUA 1E6EA 4UVIA 1B16A 1V2HE 3KZVA 1L7DA 3AM9A 4Y6RA 1K8ZB 1G21A 1YV9A 3AEKA 2ASJA 1OI7A 1JMSA 3KWLA 3IB3A 4QNMA 3PJFA 1BN7A 1RCTE 5ER6A 4NMLA 3VPAA 1MG0A 3ZDYB 2FUG1 4PBSA 1EJ2A 1QHEA 3SS8A 2DFDA 4H16A 1K1SA 4ZVUA 4D9CA 4EHFA 2K7ZA 2AG8A 4IZ6A 5JEEA 4PLTA 4ND2A 5K8UA 3AOEC 4ZICA 4BMXA 4M7WA 1X9XA 1C7YA 3FRIA 4YRCA 1AUXA 2Y67A 2K5UA 3WNCA 5GJCA 5BSGA 1DAHA 3JVUA 5HMMA 2RB5A 4KPGA 2UZ4A 3K6RA 2WILA 1GRCA 4EB0A 3DWIA 1G5RA 4CF4A 2A94A 4BJ5A 1LNQA 1F2UB 1YQ9A 1JEYA 4M8KA 1EBUA 1M83A 4EF5A 1VHWA 1GT91 2VJAA 1ARZA 2YWDA 5EIFA 3CLTC 4L15A 4FONA 3AEUB 4L3VA 2PH3A 5JS6A 2G04A 1WPGA 1PZNA 4RNCA 4R54A 1ATIA 3QY9A 3VR4A 3AUSA 1DBQA 4XFKA 3CVUA 4FCVA 1HYGA 4CCSA 1YRYE 3NVKI 3OQJA 4AWAA 3OMWA 4YJ2B 1V37A 4QICA 2AK2A 2XGJA 4IIGA 5BOSB 1SVOA 1VBMA 4BJ6A 3I1IA 1KL9A 1ULBA 2O0JA 2ZI5A 2W0MA 3NX4A 4DLKA 1C0EA 3K4HA 3SVLA 2H8KA 3A11A 2CV0A 5KMGA 2BMWA 3I6BA 1J24A 5ECGC 4C6RA 1XK6A 3JW8A 4E15A 1RRVA 4MUNA 1NK9A 2VF4X 3L18A 1XR3A 1NVVQ 1T1RA 3PICA 6REQA 3A0HU 2P2DA 4I1PA 2CJPA 3B36A 3MWEA 1GQSA 3AW9A 4QOHA 2YNMC 2Z98A 2WV7A 5FOWA 4UUPA 4DJ5X 4A1FA 2BKVA 3PEVA 3LUGA 1NKBA 1JQBA 3UCEA 1JFFA 3LUDA 1MHTA 3O8QB 4EW2A 2KYRA 1E4VA 1E96A 4HS4A 2CNLA 4Q9AA 3UMVA 3UHPA 4EI9A 2VYVD 3G2JA 9ICJA 1QAOA 2O0HA 3G2OA 2OXTA 3ICWA 2BVNA 4G5OA 1M34B 1DAMA 4HH4A 1YJXA 1OA1A 4YIKA 2Y9MB 3FI0A 2SKCA 1RI4A 1PJSA 4NBWA 4BBPA 3QLTA 3SQLA 4HN9A 2MTBA 3AR9A 4DFKA 1HQKA 3V00A 4KR2A 4IVQA 1LVHA 3ZLBA 5H4GA 3V2UA 1VL0A 4I2GA 4LZOA 5K8VA 3H75A 1DG9A 2ZIVA 2EH9A 1Z3EB 2WC1A 2JGNA 1QBKC 2PFOA 1YZ6A 1X74A 4L74A 1I7DA 3MUNA 3P2JA 2C9DA 2A4MA 1QVZA 2ODTX 1L5NA 2F1JA 1TQDA 3FWHA 3CZ4A 1OIVA 1FW8A 5F2NA 4G1VA 3F9IA 3DKKA 1Y4ZA 1V8FA 4ECUA 2ASVA 2AZTA 2CHEA 2BCVA 4H1UA 2D5BA 5CT4A 1RJ9B 2V0CA 421PA 1IN6A 5JT1A 3PUKA 5AICA 4EI8A 1QQ5A 4OBEA 3DZ8A 4B7ZA 3IB6A 1XIVA 3LQ1A 1A4RA 1OLXA 5DCLA 1XTKA 1F8GA 3LP6A 2JCSA 2NUPB 5KAIU 3VNAA 3ZI0A 3T5JA 2HH9A 2WU4A 4DXAA 2IELA 2KWIA 1UL1X 3C5EA 4AJNA 3BUSA 3RR2A 3SI7A 2P9JA 3QK7A 1KVTA 1TZ2A 4UNNA 3RRBA 1T1JA 4NTZA 1NQWA 3S2SA 3RRJA 5A2GA 2PBZA 2ZSJA 2PMKA 1JLSA 5IC6A 3CB2A 3VOSA 2X5KO 3B12A 2ZYVX 1UBRS 3RWMB 1SL2A 3RBAA 3BMNA 2PRZA 4KYVA 1I2AA 3MBIA 1PR1A 4IZIA 1Q1ZA 3EAFA 2AQKA 3HP1A 2XUIA 4ECXA 4IKOA 4GBGA 4YRGA 1RHJA 3AVQA 1XDZA 2CWWA 4BVAA 4D9GA 4C6TB 3I9KA 4P80A 4IJMA 3H16A 2ANCA 1CRQA 1VHTA 3PNKA 3KLPX 1HFWA 3PB3A 2RGXA 5EL0A 2WFAA 4I55F 3EX7C 3CH5A 4BPRA 4C0HA 2TRSB 4E2XA 1D8LA 1DV2A 1QKJA 1PWZA 1IQUA 2JC3A 4D0LB 4QT4A 3ALRA 2ILTA 4ZK6A 1SIBE 2OZLA 2R00A 5HZHA 2R7NA 2RHBA 5KYYB 5D3KA 3P8ZA 2XDYA 2WAYA 3GF4A 3V8NA 4BVHA 5JCZA 4OJPA 3AF2A 1PZEA 4IG4A 3KQYA 4Q9DA 3DEAA 2WIAA 5E6RA 3EWAA 1YRQA 3L07A 1DIHA 1I94B 2NT3A 2NZ8A 4XAQA 2V0NA 3L6RA 3ROXA 4MRSA 2QMUA 3TGPA 4EGQA 2P1ZA 3C2LA 2PUDA 4MVJG 3VR5D 2RBKA 1Q12A 5F5XA 3IHQB 5C51B 3KKQA 3ZJTA 4O4JB 4PRLA 4RXTA 1LPSA 1U04A 3HU5A 2DTEA 4PPQA 4O4LF 3VTZA 4QLAA 4ZIRB 4NK4A 1U49A 3DJYA 1U8XX 4XRRA 1Z5ZA 3FTPA 1N2CB 4LV8B 5K05A 3Q15C 1ENPA 3K0AA 5DO9A 4MVXA 4FFRA 4QOJA 1F6BA 2QE7D 1F8YA 1M2VA 1H22A 4C6SA 3TIFA 4BFZA 1QOQB 4L6AA 3D1VA 1TAQA 3JR3A 2FLNA 5KQMA 5I9SA 1F9EA 1NSTA 2YMLA 1PGNA 1KORA 4WH0A 5FL7A 2ZE5A 2RC5A 1DJMA 1LPMA 3OE1A 3MM4A 2GEUA 4LJ4A 2OGTA 1NJ6A 2I6FA 3AUKA 2E48A 2VUSA 2F76X 1PDVA 2ODPA 4R5HA 5JNUA 5EG5A 3A06A 4WCVA 1DDIA 3SQIA 2EFYA 2YWXA 4QBFA 4Z7NB 4P4UA 4KPUA 2C2KA 2FG7C 3LL4A 2FWNA 3VI3B 1E0AA 1L3VA 1A97A 4P2GA 2X9GA 4ARBA 3V42A 2ZBGA 1M1NB 2J5RA 2VSNA 1GUZA 3ZKAA 2KKPA 5LQKA 1WV0A 1NU8A 1ECBA 3I2JA 4EATA 3AY3A 4LNUB 4GSYA 2E55A 1QAMA 3DONA 4XIGS 3BF7A 4BLTA 3AM1A 1Z7EA 3UO8B 9MHTA 5ES3A 3SLKA 2C77A 1B15A 4NS4A 4W4TA 4M1OA 1D2RA 4QUKA 2PSHA 1CR0A 1T9AA 3UPTA 4C80A 2CYAA 5A62A 2FUNB 4CM4B 4ZVPA 1RMQA 5AKIA 4AMZA 3KYCA 3A9VA 3EE6A 3K0BA 2XC9A 2UYOA 1D03A 1UT8A 3QVGB 3SE0A 5J0WA 3UICA 3UT5A 1YS1X 2FQYA 1PZMA 5HW0A 4FKZA 2XCPA 3H99A 4PSDA 2QVZX 1R0LA 2JVIA 3IEUA 2CLIB 1KXJA 4DV3B 1NVMB 4X1IA 4C89A 3RYIB 1AF4A 2B1JA 3MFYA 4ZTZB 4YRKA 2Q62A 1FYVA 2JJ1A 1FC0A 3KU4A 4YT8A 4ZZIA 4WDRA 5EEHA 1W0KD 5AJTA 3O4RA 3E1KA 4NH0A 4MCHA 3SG0A 5I7HA 1K6JA 2O2EA 4OB8A 1VLHA 2QW0X 3DQQA 5EMLA 5CXSA 3V46A 5IWAB 2QSYA 1QTIA 1WSWA 2CXHA 3E5RA 2JEOA 4N49A 4XGRA 2BCRA 1SOAA 4FJ0A 1UDBA 2IA6A 3T1NA 1ECWA 2CDRA 2QTBA 3I2HA 2C7RA 3F90A 2G25A 3DOIA 2NMVA 4EYGA 3WISA 4UREA 3DLHA 5G0TA 3KZCA 4H6PA 2GUWA 2H31A 3HHPA 4XLZA 3KO8A 3ANSA 1A2QA 1ZN7A 4F5YA 5B4VA 2Q9UA 5AK6A 1J2NA 3FMVA 4D74A 4PF1A 4QUIA 1RAFA 1QWOA 2G9UA 3MB8A 4AYBC 1UFKA 3PC8A 4MS3A 1XKXA 1EFUA 2QI9F 4Z49A 4H1WA 1P1BA 3NEAA 4IDFA 3RJGA 1YIAA 5AW5A 1QONA 4RELA 4HEHA 2IHMA 2F8TA 4RJ2A 1IBLB 1DPGA 3OECA 1NXQA 2F1OA 3HQ4O 3PW0A 3RREA 1EXMA 2NUTB 2F3UA 3F5MA 1YMQA 1SUFA 4ZN6A 4UAGA 1BCSA 2E8OA 2Z58A 5C5CA 4DNPA 2C42A 3PS9A 5CK4A 1M0WA 5HR5A 2Z9BA 5E0OA 5FX2A 1YBAA 1DDGA 3QPCA 4PZLA 4F4UA 2V03A 3Q8XB 3WNDA 1G8HA 4Z4FA 4O29A 2FXIA 1H2FA 3V1YA 3A4NA 2IZ7A 3QLEA 5BRNA 2ILVA 1PJBA 1BS1A 1VJ1A 3G02A 5INTA 2A35A 1AT1A 1BS9A 9ICEA 3IFSA 5DPMA 4BNLA 5GVRA 3EK2A 2X1HA 4QGGA 4Q37A 5B5EU 4YR2A 5KTOA 4CKCB 3MT9A 2YMPA 1OW3B 3O95A 4XGQA 1P2TA 2PTHA 1HEIA 3K5PA 3OCXA 3RG2A 4DBZA 2IP4A 4NZYA 1QKKA 3KZNA 1M2JA 2XUPA 5M5BA 1XL0A 3VR4D 4LMPA 1V1MA 4V2IA 1B43A 4YLEA 2IEBA 2IHTA 4D9HA 3D0RA 4BLQA 4MW6A 2EQ5A 3L5OA 1RP1A 5D6NA 3T7AA 2HJGA 4TQSA 3NHAA 2BGWA 5IS2A 4P4GA 1YDFA 3M6AA 5ARBA 5TE9A 1F06A 4RH1A 2X8BA 1NVFA 1WS6A 3BWEA 3L1UA 4UEKA 4I08A 4TX1A 1Q7RA 2ZSEA 1SC3A 4NQZA 4OF4A 5CX1B 4BLVA 4LQDA 1PNOA 4NCJA 4ZCLA 5HF6A 4OAPA 4RL6A 2QNIA 1EM6A 4JZYA 1VKOA 3BWMA 5CYFA 4C7MA 2CNDA 3FZGA 3OO1A 3I28A 1MIOA 3JWHA 2P9BA 4LQLA 4YEDA 1HTWA 4KNVA 4QDXA 1LB2B 2JIRA 2PQ2A 3T6KA 2WIDA 9ICLA 1ANKA 5KSOA 1XT6A 4B9VA 4KAFA 3NETA 4ZCIA 5MDHA 2F64A 3O94A 1P81A 4C3OB 1JN0A 1HUQA 4D6YA 3NQ41 4ERNA 3FRHA 1EE2A 1PK7A 1KEUA 1Z88A 3DL2A 4YYEA 1NX9A 2G4LA 4J1SA 2V1UA 4HPWA 4LZNA 4GM0A 8GPBA 2CKMA 3K8QA 1JQDA 4RY9A 5HE9A 4P34A 4KQMA 3OFSA 1F1JA 2HPHA 2W9CB 3ETNA 2QM7A 2XRYA 3EUB2 2WAMA 2G82A 2HRQA 2HU5A 5BNZA 4J0IA 1HETA 3LT1A 4H7DA 2BKXA 3L1VA 2Q3BA 3E8MA 3GLHB 4JYBA 4L8YA 2FEPA 1TOAA 4IUDS 3PQ7A 3EIUA 1FDUA 4PXSA 4IRCA 2H1RA 1PJLA 1XRQA 3IBGA 4GP7A 3MJEA 3M6ZA 5CCXA 1FNDA 4J07A 2WB1C 3TD2A 4K46A 3ABQB 3QVTA 4YT2A 2ZR8A 5B58C 3SV4A 5IBPA 5DHAA 3DS8A 3H4VA 1DGQA 1C29B 4BB0A 4MV9A 3AV0B 2YVQA 2C2WA 2CD7A 4BJ1A 5D85A 2OORC 2MYPA 2R5WA 3C39A 1P4JA 2ODWA 2O8BA 4RJJA 3WK6A 3RSFA 4DHEA 1XQYA 4S04A 5IUKC 4E5VA 2ZSHA 1REQB 5A5FA 5DEOA 3TSYA 2CLFB 1DMRA 1X42A 1YRHA 4Z6FA 2YQ4A 3ZTYA 2W98A 4BO3A 3F46A 4ECRA 4U2EA 1JDPA 2I29A 3I01M 4NLBA 1VSBA 4L0CA 2X41A 3UXMA 2PL1A 1L8QA 5FBQB 1A2OA 3F4BA 3LX6A 3T3OA 1T3HA 5C9ZA 5KFTA 3IQIX 2NZWA 3RQIA 3V3TA 1XHLA 3CB4A 4ZHQA 1SRRA 1H0KA 3LVBA 3OIUA 1W88A 3WFJA 4I5GA 4ENSA 2QSUA 1G41A 3AILA 1GV1A 1VLJA 5EJGA 1PU2A 5ECYA 5DNYB 2JGIA 4L72A 1G0OA 5I9BA 2HPVA 2JIZA 3I3OA 2FPIB 4GOJA 5EMKA 1DCMA 4ZMBA 4D6PA 1VMDA 1F0YA 4JU8A 1ULUA 5A7HA 3SEFA 5J58A 2QTVB 3R1IA 1JECA 2XF2A 2ZI6A 4XH9B 2C3OA 3UAYA 2P3QA 1WUHS 2IZ6A 4C0AC 2E37A 1SHLA 1KOGA 4GG1A 1F8UA 2ODBA 1FTNA 4KYIB 4ZA2A 4P4OA 4HEA6 9ICFA 3II6X 3BBPA 1JHPA 3MCTA 1DGSA 1UFOA 2DUWA 1QC5A 4MW5A 5JROA 4WSOA 3JQ9A 2JVJA 4Q19A 2B69A 1MABA 2V7PA 3IUBA 2W8BA 3BRQA 3VDXA 5K0LA 1WIWA 4BQPA 4FP9A 2AN1A 3JSAA 5J0OA 1GG5A 4ZO6A 5JDIC 3PVCA 4AK9A 4CRWB 3B9RA 4V0LA 4C0KA 4UE3S 2AQ4A 2P4UA 4P53A 2H5JA 5BMOA 1OH6A 5L53A 1UDXA 5DXFA 2C9YA 5JAQA 1J33A 4JB8A 1IXRA 2DMRA 1EFDN 3FVWA 4L50A 1UPFA 2GZAA 2OOSA 1G1AA 3PSAA 1NPDA 4M37A 1SCAA 3H42B 4HTAA 1K6MA 4COKA 3DL4A 1NXTA 3WLQA 2GEBA 4HNGA 1Z8HA 3KEOA 1Q6YA 1TADA 1UEJA 2JAUA 2PD6A 3VH1A 5AHKA 1X7DA 4PICA 5IXYA 4GVXA 2HHTA 1LUAA 4DEZA 2VYFA 2JD1A 1W5BA 1VXRA 4C4XA 4KQCA 1PNRA 5CLJA 4L7QA 3TQSA 5TY0A 1U1DA 3FB4A 1ZK3A 3MVEA 1RR6A 4JROA 5FP0A 1X1SA 2AGOA 3OZEA 2FOXA 4R64A 2PWYA 4XA8A 4JZKA 4O5EA 3AZQA 2YJNA 2O19A 5GINE 4M9LA 4JC4A 4IOKA 2B92A 2DQNB 4YMMA 3DDCA 2FV8A 3BIOA 1FX0B 2PBLA 1Z6XA 3FSEA 4BKRA 4OREX 1CQIB 3O0FA 3L93A 3JQ8B 1ENOA 2GK4A 1E7WA 1A8HA 3O74A 4QUEA 4OQMA 1RCUA 4FHEA 5H1YA 4J4BA 5KJ6A 2A9OA 4CDGA 4DY6A 4HNUA 2KSOB 3FYTA 1L7PA 4BNZA 5J1SB 4W9NC 4UDNA 3B2QA 1N7HA 2X2FA 5IM4A 3E81A 4UBJA 4AFNA 2LV8A 4DABA 4HY3A 1ZOLA 1FLVA 4JLJA 2QSZA 2OPHA 5IVIA 3OKCA 2JIDA 3GD7A 3H4DA 5ECDA 4ZQEA 2XY6A 4IINA 2J8ZA 1SB8A 2YYZA 2GCIA 4REMA 3W6UA 1RZRA 1TK5A 3TI9A 3K70B 3DMFA 4P4SA 5JAUA 3GNLA 4RA9A 1T4BA 3LQKA 1RXIA 1X8XA 4JVNA 4A0SA 1RQLA 1PR0A 1GZ6A 1F3OA 3RE1A 2TECE 3AJ8A 3JZMA 4TRMA 3CEPB 1OV4A 4BNXA 1SGWA 1TM2A 3UH0A 4XUGB 1LDNA 1OI2A 5MFPA 1NSFA 5KFHA 2LDBA 4ND8B 2W54A 1VZ2A 1ZMRA 2XSZD 3FRJA 1MX1A 3LDHA 3K1JA 5AKZA 1RKXA 1ZR2A 4TVSA 4MV8A 1LXCA 4LMBA 2K2QB 4JP1A 1JIQA 2J0UB 3GBVA 4KAXA 3RSSA 4H15A 3TPFA 2GN2A 5F7XA 5IJ9B 1IJBA 1E9FA 3VHXB 3V2GA 4HWPA