4F72A

Crystal structure of had family enzyme bt-2542 (target efi-501088) from bacteroides thetaiotaomicron, asp12ala mutant, complex with magnesium and inorganic phosphate
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
201
structure length
195
Chain Sequence
GIKNLLIALGGVLINLDRERCIENFKKIGFQNIEEKFGIFLQQEKGLITPAEFRDGIREMMGKMVSDKQIDAAWNSFLVDIPTYKLDLLLKLREKYVVYLLSNTNDIHWKWVCKNAFPYRTFKVEDYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGISTYTPKAGEDWSHLFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative haloacid dehalogenase-like hydrolase
publication title Crystal Structure of Protein Bt-2542 from Bacteroides Thetaiotaomicron (Target Efi-501088)
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 67
structure length 195
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4f72A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4f72A01
2HHLA 1T5SA 3WGUA 3VAYA 2P9JA 1VJ5A 2G08A 3K1ZA 4EENA 5AI8A 1RMTA 3M9LA 3ZX5A 2OBBA 3N8GA 3KC2A 4UARA 3D6JA 3ET5A 3MMZA 1JUDA 2ODAA 5ALVA 3OCZA 1SWWA 5ALQA 1XP5A 2PR7A 3AR7A 3PGVA 4YIHA 5AK5A 2ZOSA 2O9JA 3MN1A 1Z5GA 5ALGA 1O08A 3BWVA 4HGRA 4EZEA 2IOHA 3QNMA 2JGAA 1Z4KA 3AR5A 4OHFA 3WK5A 2HF2A 3RFUA 2R8XA 3QUCA 1RC8A 2WHEA 2AUTA 2FPUA 4CF5A 3L0YA 2YMLA 3EF1A 1O03A 4ZEWA 4JB3A 5AM0A 4HYTA 4BBJA 4JDPA 5A3SA 2NO5A 5AW6A 1YDFA 1VFPA 3TLMA 3MC1A 4FE3A 2VKQA 2W43A 3W5BA 4RESA 4UASA 2P11A 3NUQA 2Q5EA 4QQFA 4UU1A 1QYIA 5A3RA 2GHTA 5AVTA 2WF5A 1SWVA 3CNHA 1VJRA 4L6CA 1J97A 3L5KA 1ZD4A 3QU2A 3W5DA 5AKHA 4E88A 2X4DA 2YY6A 4XOUA 1CR6A 4KNWA 1RPZA 3ZX4A 3HYCA 2WM8A 2MSNA 3N07A 4KX5A 5AW2A 1YV9A 1RLTA 4KX3A 4ZEVA 5AIAA 2FPXA 4CF4A 2C8KA 4BNDA 5ALUA 5A3QA 3U7EB 1RKQA 2YJ3A 5AW3A 4DCCA 3BA6A 5AVZA 3QUTA 3F9RA 5AW7A 4UU0A 3FPBA 3AR3A 2YJ6A 5E0OA 3ZWDA 2CFRA 2DQSA 2JAUA 3SKXA 3A1DA 5AK3A 4HGNA 2Q4TA 2G80A 5ALSA 5AVVA 1U7OA 3L8EA 4Y2TA 2EATA 3OCUA 3ZI4A 2AH5A 1XPJA 3R09A 1FEZA 3AR8A 1TJ5A 3NAMA 5AESA 4UATA 2I34A 3OCXA 2FPRA 4NABA 1X42A 5T41A 1L8OA 4Y2PA 2ZBDA 3EWIA 2HCFA 2AGVA 2G1AA 3MPOA 5JJBA 4CNQA 3WKEA 5AVQA 1Q91A 4DWOA 1Z4LA 3NALA 1EK2A 3I6BA 2FEAA 3A3YA 4G9BA 1J8DA 1RLMA 1RRCA 2QYHA 2MU1A 3M1YA 4BX2A 4UM7A 4MWOA 3ZVMA 1YNSA 3L0BA 5AKIA 1EK1A 1QQ6A 2R8EA 5AKJA 3ZTYA 5ALFA 4J03A 3R9KA 3L0CA 4BEVA 1WPGA 3ZUPA 5AKGA 3KOOA 3B8EA 4OFZA 3ZTWA 5AVWA 1QQ7A 3U7HB 2NO4A 3KDPA 4C4TA 1RLOA 3QX7A 3U7GA 5AVSA 2B0CA 3UMCA 2FI1A 3OCVA 4Y2YA 4EX6A 4KN8A 2OM6A 4XPZA 3PGLA 5ALRA 4H1WA 2YJ5A 3DNPA 1Z4JA 3NRJA 5AW4A 2YMMA 1YS9A 1YJ5A 1ZD2P 3IRUA 5AI5A 3SMVA 4UM5A 5AW1A 3S6JA 4UAVA 3L1VA 3E84A 2HDOA 2IA5A 2CFTA 4UW9A 3DDHA 3WK6A 5AM5A 4C4SA 2I7DA 2WF7A 3QUBA 4YCLA 4IFTA 4NV0A 3I76A 1L6RA 1ZJJA 5AM4A 5AK4A 5ALWA 1TJ3A 2HSZA 2EARA 3OCWA 4Y2QA 1RDFA 2R8YA 3NIWA 4J2TA 1NF2A 4AS2A 4Y2JA 2IOFK 4RETA 2BY4A 2I55A 1T5TA 3B9RA 2B82A 4Y2VA 2WF8A 4Y3UA 3UMBA 4EX7A 2G0AA 5ALHA 3PCTA 3P96A 2RB5A 2CFSA 3FPSA 4B6JA 1KYTA 5ALZA 3ONNA 5AW0A 3FVVA 5AVYA 2JARA 4DFDA 3KBBA 1TJ4A 4HAIA 4C4RA 1U2TA 1LVHA 1L7MA 2C4NA 5AM3A 1RQLA 2B1RA 3QU9A 3QUQA 3ED5A 4UMDA 2WF6A 4EEKA 3E8MA 5ALTA 1Z4OA 3WKBA 3SKYA 3L8GA 5ALPA 4ZEXA 4NFLA 1L7NA 2RBKA 3GYGA 2W11A 3R4CA 2HI0A 1ZS9A 3N28A 3SD7A 3SF0A 5ALNA 1ZD3A 2P69A 2I33A 4DW8A 2G09A 1ZRMA 1ZD5A 5AI6A 5AW9A 3ESQA 1S8OA 3WK4A 2C9MA 3L8HA 5IT4A 1Z4IA 1AQ6A 3UM9A 2ZBFA 3N1UA 2G07A 1L8LA 5AW8A 3J7TA 3FZQA 5AVUA 2YMPA 4YH1A 5ALLA 2CN1A 3U26A 4FYPA 5ALEA 2D2VA 1Z4MA 4L6AA 4Y2UA 4YCMA 2YMQA 5ALDA 3FM9A 3L8FA 1QH9A 4AP9A 1WR8A 4FFDA 4GIBA 3B9BA 1ZOLA 4GXTA 1L7PA 2Q4RA 4NWIA 4I9GA 4L57A 2YBDA 4XQ0A 4BKMA 2B1QA 3ET4A 2WFAA 1CQZA 3AR4A 2ZXEA 2GO7A 1ZRNA 2B30A 3QXGA 1MH9A 2HX1A 1TE2A 2ZBGA 2RARA 4BEWA 4CE6A 3U13A 2IOFA 1NRWA 3OTQA 1K1EA 4MUMA 4UMEA 3U19A 1RKVA 5ALYA 5AICA 2ZBEA 3IJ5A 1N9KA 2YJ4A 3DAOA 3ZU6A 3ESRA 3W5AA 5AI0A 1Z5UA 3OCYA 2GMWA 5AKYA 2FDRA 5ALJA 5AI9A 1YMQA 4CF3A 5AK6A 5AIBA 4BNDB 1F5SA 2HF7A 5AHXA 5AKZA 4Y2XA 4YGYA 4UAUA 3ZWKA 4OCZA 2FPSA 2FUEA 3L7YA 1LTQA 2OYCA 2I6XA 2YN4A 5ALKA 2MU2A 2NYVA 1U7PA 3SHQA 1Z4QA 2HOQA 3A1EA 4Y2RA 4BX0A 2JAWA 3NASA 1RMQA 1QQ5A 4PNHA 2C8LA 4YCNA 3QU4A 2B8JA 3EF0A 1RQNA 3AR6A 2HEGA 5IT0A 3ZVLA 3A1CA 5ALOA 4HGPA 3U7FB 3FGOA 4XE5A 3QLEA 3WK7A 3WKCA 3HLTA 1SU4A 1Q92A 3EPRA 2BDUA 2FUCA 1Z88A 2PQ0A 3DV9A 1T9ZA 5AM2A 1Z4PX 3E58A 4UMFA 3QU7A 3KD3A 4BX3A 3SLRA 2HO4A 3PDWA 2EAUA 3ZW7A 5AVRA 2OA0A 1RMYA 4HGQA 2AMYA 5ALMA 4AS3A 5AKKA 2FPWA 4OD0A 3L1UA 2O2XA 2JAOA 3OPXA 3ZVNA 3KZXA 3WK9A 2B8EA 1S2OA 3AR9A 1Y8AA 2R8ZA 3NANA 2PKEA 3I1YA 1N8NA 1IWOA 1PW5A 2ZG6A 4UMVA 3IB6A 2W4MA 2G06A 3WGVA 5AVXA 3WKDA 2GFHA 2P27A 2BDEA 2IYEA 2QLTA 4BYGA 4KNVA 4O8CA 1TA0A 1WZCA 4I9FA 4IG4A 3N5KA 3QYPA 5AKXA 5AW5A 3QGMA 2RAVA 1WVIA 5AI4A 3W5CA 3I28A 3RF6A 5IS2A 3QU5A 3CZ4A 4F72A 4HGOA 4KYTA 4YIKA 3AR2A 2GHQA 1U02A 4Y2SA 4F71A 2WF9A 2I54A 5AKEA 1L7OA 5ALXA 4EELA 1Z4NA 5AKLA 5ALIA 3E81A 3WK8A 1U2SA 2YFYA 5AM1A 1XVIA 4G63A 1RKUA 4QJBA 5FP0A 1NNLA 3WKAA 3UMGA 4NAVA 2C88A
chains in the Genus database with same CATH superfamily
4DJAA 4XWWA 4C4YA 4KBGA 3SQXA 5KFWA 1H8EA 4DFKA 1KRPA 1R37A 2XQKA 3W4JA 3AINA 1MMFB 3WU2U 2HPAA 5DJ5A 4DLSA 1KQOA 4L78A 3RABA 5DYTA 1W75A 1I14A 3EFBA 3C98A 3I9NA 4EA9A 3KQLA 1VL6A 5LLSA 2MSLA 1X9SA 4ZRMA 2C5SA 2HHTA 4ED2A 2F62A 4B3MB 1XMQB 4C0WA 2VDWA 1FDUA 3PYMA 3IN5A 3E27A 2DPHA 3VAAA 2XXJA 1YACA 3K15A 1L4NA 2WUWE 1V48A 2WIFA 1P6QA 2BI8A 4TUYB 1YZLA 3TZBA 3RVLA 4QODA 2D3WA 4MV4A 5JR3A 3NWOA 1M72A 3VPDA 4FYIA 2QJOA 4NBSA 5J2UA 4IWYA 2FPRA 1B2RA 3NM6B 3L4SO 2EFHB 3ONWA 2PS3A 1XEWX 5JU5A 4P1ZA 4M55A 2PVPA 3DFUA 4GC7A 1IK6A 2MAXA 1R4ZA 1Z8FA 1HJPA 4MVJG 1G66A 4OGFA 5JAUA 2D74A 1L4HA 2WTFA 3INNA 3VR5A 3GCDA 2HCRA 2JIBA 2BQRA 2IZOA 4GP6A 3KDPA 4MQFB 1Y1TA 1ISSA 1J09A 5IU6A 3SMVA 4DZTA 1JVSA 4E5UA 3E84A 3NWJA 4J2OA 2H0AA 1JB1A 521PA 1CY8A 4EO9A 1BNPA 5EJGA 3FE2A 3KYCB 4DV1B 1CHDA 1M8GA 2C3YA 2R8YA 1YJXA 3PQEA 1K1QA 2VHEA 3D6MA 2IRWA 1M1UA 2QB1A 4JD5A 4XR4A 3DPIA 1BMFA 4Q03A 2HSEA 2II6A 4QVKA 2REQA 4ETIA 2ZLBA 3H0MB 2JFWA 4N40A 3E1KA 1GTRA 2Q1YA 1NXVA 3LFUA 3NHLA 3AUJB 3CN7A 1U81A 3I9JA 2YHAA 4J0KA 1NULA 3B20A 1C1XB 1ABEA 2WT8A 3RS4A 3MDCA 2CN1A 3SIRA 2V1XA 1TT7A 4BQIA 1R18A 4Y2UA 1BKDR 1KWKA 1R9JA 3HACA 3Q8LA 4BWMA 2RH8A 3UK2A 1NG9A 3E0XA 2X14A 2UUPA 4G2NA 1ULAA 1XQWA 1NR7A 1QS0A 3DAOA 1GCOA 4JJ4A 3N86A 2ZB2A 5EA2A 1S96A 4L2IB 4B17A 4UBJA 4G4JA 5EP4A 2MSDB 2GNPA 1OXKB 3UK7A 3VC7A 1KI1A 2PT5A 4UUQA 1I1NA 2MU2A 4AP6A 2HWXA 4DFMA 1FVXA 5BVGB 3OZXA 4N0EA 4AJOA 1N63A 5EZSA 1U63A 2Q6TA 4C3ZA 4IXMA 3R23A 3O47A 1GKUB 1ZUWA 3OTGA 5CDGA 5EUMA 2JEFA 5LDGA 4DUGD 3MSCA 4FN4A 3EPRA 5G0SA 5FBLB 5IG2A 1L1RA 4ECTA 4MPPA 4CMHA 4OF4A 2BEWA 4A0GA 3QFCA 3GGJA 3KVNA 3TLKA 3CH5A 5EMJA 2NPIA 3LZDA 4M0EA 5DHTA 4CKCA 5FV4A 4QUHA 1ECJA 2UUAB 4BGDA 4YUZA 1D2AA 3LLSA 3VA7A 1DQRA 2XOKD 4RLFA 4HH1A 3X2EA 1QWOA 1A8UA 1SBYA 4K9LA 3IP1A 3P9SA 4CMCA 2PKRA 1EJBA 4WN3A 4Y18A 4QUKA 1G98A 3ZV5A 3H0KA 1LDMA 3CRXA 1G3MA 1EDDA 5B4UA 5T4HA 3AGQA 4ILEA 1FTGA 5E4TA 3HUDA 4R98A 3B5JA 2JLAA 3WBBA 4BU0A 1WG8A 1O9GA 1S8AA 1N2GA 2OFFA 1BXGB 1B1AA 3MTJA 4ZRDA 4DOAA 3RFUA 2C2BA 2NRZA 3WRXA 3L3BA 1XMSA 9ICFA 3NFRA 1KDVA 5AJZA 2X2OA 1OWOA 3EQ8A 3AEUA 3H8SA 5DXAA 4JC5A 1XZQA 5J2DA 2P68A 1ZGBA 2EFGA 2WIJA 3KOMA 3DTTA 2J6CA 5CB6A 3KJXA 4KRFA 5BPHA 2PO7A 3THWA 1SN7A 4X1KB 1DIHA 4LEIA 1GAJA 5HDQA 4ZPXA 4FHFA 5FI1B 2WKRA 2ZI5A 2O7RA 4M9HA 1UAAA 2PS0A 2O14A 1XD2A 3ZNPA 4GLBA 4AF8A 2XIDA 3R09A 4LBVA 1Q84A 3RIHA 3EG9A 1GZDA 2WYIA 2VQ6A 4BLQA 2IYOA 3IQWA 2XJ9A 1Z5ZA 5FA8A 4KE7A 4R8LA 3JWPA 1M9NA 2P6RA 1KKXA 1PD0A 4OHWA 2XTMA 2FWAA 3G9QA 2NV0A 4DABA 3TI7A 3W2HA 4CM3A 2FI1A 1ONOA 2F55A 2ZI7A 1O9HA 4JODA 5AHKA 1CS0B 3NC0C 4YRJA 3C8HA 3DDCA 3KAPA 3TIIA 3K0CC 4Q1FA 1HEIA 4G37A 2NUTA 3BS5A 4ZMBA 3V4SA 4LZWA 2CNLA 1NC3A 3UWKA 5LBUA 1C7JA 5IAOA 2Z04A 2HA4A 3T99A 1X0VA 4BKRA 2DLCX 1RADA 1WU8A 2IGBA 1DE0A 1ZQ1A 2QUJA 4K6CA 5AOCA 1IBRA 3RAJA 4DZRA 2FPPB 3A9SA 2BPFA 2OHXA 1VJGA 4KIUA 1JH8A 2HFJA 2PUHA 2AZXA 3DP9A 3DLHA 5FLYA 3RS7A 3A2KA 4DA6A 4LCBA 1RM0A 3L4EA 1ZD3A 4GI3A 1FTNA 1KJZA 4MA4A 1GNVA 2BUAA 2O2ZA 5EKXA 4BO9A 2OO5C 1WV1A 2IX3A 4OJMX 2CNWD 2WYVA 5EUBA 1CZKA 3VZDA 3QEBZ 4N8DA 3OWOA 1RPAA 1BRTA 4YONB 5BNTA 3EQ9A 4U0JA 3N6VA 3WV5A 3L43A 3RK0A 9ICWA 3EGWA 1A5TA 1J4AA 2ZXHA 5KJFA 3U9TA 4FYJA 3GG2A 4TVSA 3GZTB 3DL4A 4RNCA 1OXTA 3PFNA 2OBLA 3K1AA 3PR3A 4Z3DA 1CSEE 3S2FA 2G1KA 4GQBA 2ON6A 3EXIB 1M1XB 1RYEA 2X5JO 1U0FA 4ZZ2A 1E9RA 4M1EA 3G79A 1MN8A 3ZY5A 3RS8A 2BEJA 3EPJA 1XRRA 2AI2A 4YFVA 2PKYX 1RFLA 4YQZA 1SQ0A 1F48A 3RNLA 3NVDA 2DX7A 3X1KA 1I7NA 3LDUA 4FD2A 5E4JA 4JOBA 3GF4A 1QLNA 1COWD 1EZZA 4NJMA 3N7PD 2YQEA 5HR5A 5JJCA 3R41A 3HCNA 4AL4A 3FYUB 4C21A 5DX8A 1IMOA 4ZU1X 3PE6A 4YR9A 1G8KA 4BLUA 1ZK0A 3HCPA 3UIEA 1PGOA 4KSBA 2OC4A 4FI3C 1F0YA 2QA5A 3CLTC 3PXAA 4ONEA 4P58A 2X0KA 2DCMA 5FCDA 4E1AA 1KARA 3A1VA 3VKFA 4YLYA 5CJ7A 3O4GA 3PDIB 1Z00B 3NWEA 1RC1A 4YCXA 4EG4A 2ZROA 1ZIOA 2X42A 3CTMA 1T91A 3IUNA 3KTQA 3F1KA 5JS7A 2ODPA 2YYZA 5DV9A 1XZAA 1QOQB 3W5CA 3W1WA 3TOVA 3SHTA 3W1EA 3ZY3A 1WLYA 2EZYA 2HPHA 3DHVA 4N47A 2N3ZA 2Q7XA 4TKUA 5F7XA 4LBZA 4RAQA 1K86A 4DLTA 1SOUA 2YXLA 3I72A 1OYWA 2G08A 4LPSA 1WDMA 3SDBA 1SGGA 3ZXIA 1FNDA 1SXDA 5L3SB 5CITA 4JNCA 1DWOA 3TADA 3VR4D 2X77A 3W6ZA 3W9SA 5MDHA 4IYRA 3QMMA 5T57A 7ADHA 5IZ4A 1JE0A 1YOBA 1AE1A 4NOJA 4LXUA 2R6R1 3LMKA 4DT1B 3HL4A 2UUCB 4TLBA 4XGNA 4E5SA 5LQSA 3LTNC 1FFDA 4IZ6A 2K7FA 1JR3A 4RD2A 1GO2A 2FJ0A 3GNQA 3FPFA 2G6TA 4XUGB 1QZZA 4KNWA 5CFRA 1DC6A 3H9QA 9ICCA 4DJDC 3UT5B 2H3IA 2GAAA 5DNYB 2YIVX 5HGJA 4I50B 3PW2A 4AUKA 3W8FA 2B5OA 3LBNA 4GG1A 5JNRA 3NTLA 5E0OA 1XDSA 3LK7A 1ZH4A 4OFXA 5AVVA 1G38A 1OH7A 1X8XA 3RVSA 4BNTA 1ISPA 2WE7A 2C4UA 2CPRA 2JI6A 2QX6A 2P5TB 1EK2A 4IG9A 1MN6A 3GIKA 3JRXA 1SKMA 1LWOA 3C3EA 1X0XA 1JYSA 3JYLA 1GTVA 4RK4A 4XR9A 1FC0A 5COBA 3T35A 2PLAA 1MABA 2GLXA 2MYTA 2O23A 3PUKA 1PYOA 3R5XA 1D1PA 1IM8A 2LHTA 1D5WA 4HR7A 3VX4A 4IJ5A 3AKDA 1XT6A 4KMOB 1PHRA 5JO0A 1EFKA 3FGPA 4LZGA 1ZQXA 2ROQA 5FUXA 1UPFA 1YCDA 4NDZA 2J8ZA 3RC3A 3KQTA 5KAMA 2BPCA 3EPHA 3WB0A 2ZUTA 5LQCA 4UB3A 3WTCA 3E8MA 1GZ3A 3TR0A 4FKZA 3SD7A 3AL2A 3ZWAA 2NXCA 2Q2QA 3EVTA 3KE9A 2GETA 3ODGA 4B0OA 4OGGA 4N03A 3ZWVA 2QE6A 1AMOA 4C8LA 1QAOA 4QUGA 1GILA 4S1WA 2YMPA 4I2JA 1UC9A 4CWAA 2K89A 3TZ6A 8ABPA 3GLFA 4UVIA 3FGNA 1WXEA 1BVUA 2B8TA 3ZLTA 4XWGA 2JIRA 2J4FA 4FGUA 1QHGA 2YC2C 5G3ZA 2PD4A 1M2OA 3ZCPA 3B2EA 5JVDF 5DSXA 4IGEA 2QE7D 5CM8B 3T0IA 3RHFA 1MFZA 1U6IA 1OFHA 2DKFA 1CF9A 3MQFA 5F1KA 3P2IA 3NCTA 3PNVA 1XAHA 1M6YA 3V7JA 4KIGA 2QD3A 3DUFB 1FMTA 3LF1A 1N0VC 3KR0A 5NULA 4CM9A 4OO1J 4MWTA 2FPSA 2WM9B 1UJ5A 3BGSA 1R0WA 4DPKA 3ENQA 4OHBA 3W5SA 5EKTA 3DLAA 1QZUA 5KKAA 4QHYA 4RW0A 2DUWA 4XYMA 4H4CA 2FWBA 3C3XA 2AOUB 4HGPA 2RAUA 2IFTA 2IU4A 3ROFA 1V9CA 1KA9H 2VPXA 1I7DA 3FPCA 4IQ4A 3ZV7A 3KKZA 3CW9A 1E2PA 3LL7A 2QMHA 3SSMA 4AURA 1P0CA 2J3MA 1MJNA 3DWEX 5LZ4A 1ZQGA 1JG1A 3OQBA 1NN1A 5FB3A 4OQQA 3P8ZA 1T43A 4AJEA 1BE8A 3WRYA 4ERXA 1DGJA 1DWUA 1CVRA 1OT5A 1X87A 3UJ9A 2WHPB 5LJIA 3KHSA 2J3LA 2WP8J 2I54A 2G36A 3ZC3A 3SYLA 5F77A 1F2UB 5T8KA 4JP8A 5DGBA 4O63O 3BFJA 4YDQA 3O4RA 2X5OA 2I67A 2RDMA 3BDIA 3VNUA 5ICFA 4UBNA 1CIPA 3WGNA 2PA3A 3ZX5A 2IW3A 5DBHX 3OLCX 2XA1A 1JKXA 2E37A 2QLLA 3CZCA 2ECQA 2CHFA 5C37A 2KG5A 2LCQA 1OLUB 2XNKA 3H5VA 2ATXA 3PVSA 4KR6A 2YJNA 4E2YA 3AEXA 4QXRA 4B76A 3QW4B 4X1OA 1O8BA 1XOIA 2GPSA 1H6AA 3CRW1 4AXXA 4L4YA 4EZBA 2VHJA 2UZ0A 4A2WA 4EGFA 3QEOA 4QRDA 4B3SB 2X23A 1NU6A 3DF7A 4LJ4A 3WIUA 2PMZF 1Y9EA 2AMLA 1IUKA 3QU2A 2AOTB 1ISIA 4YRDA 3Q1LA 4I1VA 1VFNA 3KR9A 5AUQA 1FTQA 4C7OB 5D49A 3N0RA 1S97A 3HYRA 1DBQA 2QM8A 1PW7A 3SZRA 3BA6A 4GZ3A 2HL6A 4ALJA 1LB1B 4MW0A 3K92A 2Q46A 1DZ3A 2AWOA 5EIFA 3X1YA 2O5EA 3F9CA 2QAGB 2NZ8A 3P4XA 3LUDA 4F3TA 3PNLA 3C3YA 4RNMA 2WUVA 1TLTA 3AIMA 1NNI1 3U17A 1YDHA 4R69A 1VJTA 1IY0A 3OQPA 4PLTA 2H57A 2C20A 3HGTA 1O94C 4H59A 3DMHA 1JZTA 3QA3E 3VJRA 3ETJA 1EPUA 5C1OA 1J1UA 1DT5A 3EC2A 4IH9A 4CMGA 3ECCA 3UF0A 1RLOA 4BFZA 1UJ4A 2B20A 3DD5A 1PFWA 2QMQA 1RI1A 1CERA 2NADA 2I5PO 2Q4BA 3AERB 3BILA 5JE8A 4EF5A 1SCUB 2JLSA 4JA2A 4KKXB 3GUUA 1REQB 1BIFA 3CPHA 4IX1A 4KQMA 1JSCA 3E1GA 2VA3A 4P35A 5KL8B 3UJ7A 3QHAA 1X7HA 3NJ4A 4D0SA 4EGQA 2Y77A 1X1TA 4AF7A 2ZJOA 3PJFA 2FHSA 2ZRJA 4D4KA 1FDIA 5BN3B 1J2NA 2GBLA 3FWPA 2H3HA 2QW0X 2FP4B 4D42A 1JHXA 2J31A 1QUEA 1Z4OA 2GWHA 1PR2A 1ODKA 4MIOA 3RUCA 4MRAA 2QPLA 2OFOA 1YT3A 4GSLA 5C3UA 1GPJA 1XXHA 1RT9A 3BSWA 3M3HA 1DL5A 5KFLA 4IIEA 4QTUB 3G68A 3WWZA 4F5YA 2Q41A 2JV3A 1L7PA 4H3VA 5T67A 5EEGA 3TB4A 1SVUA 3LVVA 3ET4A 1FPQA 4IF4A 4MMXB 1OZAA 4MEBA 1VE1A 2UVRA 4P3YA 3QVVA 3DR5A 1DHTA 4FNOA 4XX1A 4DMHA 1XROA 3KWFA 1SC3A 1RCFA 3RBEA 5KFXA 1IUOA 4CM4A 1NBIA 1WXXA 3FJOA 3OA2A 2CCJA 4WUTA 1QX3A 1HUOA 5DHQA 1I7SB 3RAXA 2F3RA 5EGSA 2DPLA 1UPHA 1BDMA 4HQOA 1VA5A 1V3UA 1ZNWA 4MVWA 3PTLA 7ABPA 4JT4A 1R0SA 1U8YA 5JPIA 2ERCA 1CZRA 2NOAA 2NXEA 3VZCA 5CRXA 2HEGA 1M6WA 2NUAA 4RL4A 3GARA 1M10A 5JXHA 3NNDA 2WNSA 3H5TA 3C16C 1SXIA 1C8LA 4LZJA 1Y3HA 4IMPA 2KVCA 3WMGA 1N5WA 1C1HA 1EX1A 4H2DA 4CLEA 2V4MA 4ZI5A 3EXG2 4P82A 1DIRA 4QE3A 3V97A 4C0AC 2HUNA 5LMNB 3FVRA 1I2CA 5ETJA 5A9SA 4F4HA 3P0EA 3L0OA 4DJFC 5IN4A 2XZOA 3IOCA 2YWHA 3TQFA 2IHJA 3IA2A 4GGPA 5JVDA 2BFBB 3M5WA 4TSFA 4TURA 5C5EA 3HDGA 1H6DA 5I6DA 1GFWA 3QPUA 1G19A 2EL7A 4UBKA 3DVLA 5DHFA 3AXSA 4D0RA 2WAQF 1Z6GA 4FR2A 3SJZA 1WW3A 3IQXA 5EZYB 2W9CB 1RMTA 1E1CB 2VJPA 1JNXX 1N75A 4D6PA 5HF5A 4X7MA 1Z82A 1XP5A 1FDVA 3SIWA 3WLFA 2WSIA 5K3EA 1ORIA 1JLRA 4ARIA 3QUCA 1JKIA 4RK0A 2R9VA 1JA9A 2KB0A 1W19A 4R31A 5CDSA 4QVGA 1NVVR 5DYGA 1ZXXA 1LBHA 3W5BA 1YZGA 2WM3A 3WLEA 1QP8A 1WHSB 1BS2A 3JAWB 4OLHA 1RWBA 5KU1A 1L4YA 2OHJA 5J23A 4Q9HA 1RHJA 1G5QA 4IBOA 1KW4A 1KFSA 4R2KA 1Q1ZA 5ECDA 3ETDA 1YQGA 4L85A 1LTKA 2E4YA 3ZLVA 3EXHB 1WQ1R 4YCSA 3MFIA 3RKRA 3PO5A 4TKLA 2GF2A 2LYAA 1JBEA 4MJXA 1MX3A 1F9EA 4HMPA 4WADA 5FWNA 2HDNB 1VHWA 5B2ZA 5K45A 3A3YA 4CNBA 3HDHA 3ZVMA 3QX9A 5T3YA 4YO7A 3M4NA 3GV5B 1NF8A 3K1JA 1BVHA 4G1FA 5CB1A 1EX7A 1HIWA 5ALRA 4BS9A 1GUDA 2NVBA 1GQOA 2QD1A 2ZJZA 4N54A 1K7FB 3FNEA 4LMRA 1KFBB 4RENA 3OO1A 2UVPA 3HEAA 3B9RA 5G1PA 4Y3UA 1BS1A 3PVCA 2PUTA 3GDGA 4JBIA 2OD9A 2ADMA 2IJGX 3UQZA 2IKSA 5J2EA 3QV1A 1OKKD 3UWDA 2DPMA 3HI6A 3L8GA 1NUPA 1YU6A 4J9UE 1JAZA 4M9SA 4AQ7A 2M6RA 1RXWA 5DNWA 1FJ2A 1GPDG 1I80A 3O90A 1E62A 3AY0A 3ZV4A 4YMNA 3SSOA 4U1RA 2B1GA 3UKDA 4BU1A 3AVUA 4OKNA 2H9YA 2XWPA 4YN4A 1H22A 5AUOB 1Q8KA 3UAGA 1UXGA 1WR8A 1XNHA 5EOZA 2NM0A 4S24A 1IWPB 4PNPA 3IP3A 1LNZA 4U3JA 3I62A 2PFPA 5L3QB 1WMDA 3IQEA 4E21A 1M7HA 5CYPA 1B16A 1U0BB 1M33A 4GUAA 4MQLA 5DMXA 1U2GC 2RK3A 3EOAI 1GL7A 1JTEA 3STXA 3B51X 4U7DA 2IY9A 1QE0A 2BTOA 1Q50A 4G4GA 1Q1EA 2OGZA 4GOND 3OMWA 4GZLA 3WNBA 3IDOA 4XDYA 2BTQA 4OHKA 3ANSA 3CF4A 2I6XA 2OKGA 4HQLA 1JTVA 2Q5CA 4WNIA 4GT1A 1JBKA 2HN9A 4TTSA 1EJ2A 4J0JA 3HKCA 4KGDA 4GRIA 3U7FB 4QGFA 5TPZA 3WK7A 4YCCA 2AN3A 4QBFA 5F9FA 4NE2A 3R9XB 4CLRB 1XYYA 3GLUA 2VYQA 3C5FA 3CT6A 1JKMA 3X1XA 5JRDS 4B81A 4PLVA 4QUIA 3C8MA 3KLBA 2EFEB 2V7EA 3L92A 4URWR 3PWKA 3ZVNA 2GF9A 3T7TA 1ZM2A 4BCBA 1KQ3A 4E5YA 4BIIA 2GXAA 4PC1A 4R84A 2VJOA 5AVXA 3W3AA 4N41A 1JEOA 4J0DA 2RBEA 4R1NA 4B9AA 2W9BB 4O25A 1SG9A 2X58A 1Z16A 2VP2A 2F3UA 4ZARA 4M9ZA 8ICCA 1OUQA 3TECE 3BE5A 3I2KA 3OLYA 5HRAA 1SB9A 5GZ1A 2JIPA 5LUBA 1NATA 2EH9A 1W581 7ICKA 1XHFA 1U3UA 3BULA 5LSAA 7ICJA 4G0UA 3BTVA 1WMFA 4PEVA 3KKLA 3WQQA 3L7NA 2WKSA 1BE6A 1Z83A 4Y9UA 1E2LA 4MWEA 5K8TA 4V0NA 4QPNA 3GT7A 2IYLD 3GDOA 4BHTA 2AUTA 4J0IA 2CJPA 1TUEA 1L7DA 4R2MA 4U7CA 3TW8B 3C2MA 3RJIA 2MJLA 4MS1B 2IYPA 2HMSA 2YCLA 1XFDA 5LZ9A 2IZ1A 1RW4A 2VDLB 3TD6A 1MEJA 5LWQA 3IDAA 4C04A 2QGFA 2JCYA 2MSNA 1KEWA 4ER6A 4CF4A 3ZNNA 4NLBA 4ZYWA 3R0ZA 4NM2A 4ARVA 1P0MA 1MKYA 3KB6A 3F2DA 2VCEA 3HM9A 1E3WA 5CYGA 4BCDA 2XE7A 2C5HA 1JNYA 1JU9A 3AVPA 3VC1A 4YLEA 4NABA 3HLYA 4NSNA 3AFIA 3I4FA 4KLHA 3EK2A 3O8CA 4PX9A 1XZKA 3F6YA 4HQNA 4X41A 2B0JA 3RC9A 2D00A 4P0QB 2JBAA 5A0TA 2BE7A 2FUNB 2DC1A 4RQBA 2C3PA 2JLVA 5IULC 3AVWA 2VOEA 4WBNB 4J03A 1HSOA 3BIOA 2B5VA 4WLNA 5KQSA 2BZ1A 5FADA 1A0PA 4EG8A 3Q8RB 3FWZA 3DJYA 5CDYA 3DBLB 1WKCA 4HDNA 5BN4B 2Q1SA 3QEMB 3V7FA 5EXXA 3V2UA 3ND5A 1EFCA 3PFKA 1ZCFA 4RXMA 4D46A 1R4AA 2MINB 3RI3A 3A70A 4N5DA 3C6ZA 1GQSA 1WUJS 1YFLA 3I76A 1ZQZA 2G9VA 4D8UA 2IOFK 2DU8A 4ZHSA 4K9MA 4AULA 2ENUA 4XXHA 3G7SA 1JDUA 5KYNA 4V0MA 4R64A 5DTQA 1E5XA 4RUAA 3EZ9A 4Q16A 2FTKE 5JISA 5EIXA 3RRZA 1RP1A 3RQIA 1UJCA 3OY2A 2ZYVX 4ZJPA 2HI0A 1ZS9A 4GSKA 2UU9B 3G0CA 1X80A 1ZJ5A 1X7WA 3I9OA 5EY5B 1PR4A 2XRYA 3EN0A 3L6DA 4JLUA 3O1HB 5KMGA 4AG6A 3ZKWA 1E9SA 4JA0A 1K7YA 4D7AA 1T0BA 2HXSA 4JEMA 3TFRA 4ZQEA 4BGUA 1ZJWA 4HUTA 2ZYWX 4OI4A 1CB7A 1EFDN 5LYYA 1NP3A 1R27A 3G7UA 4O3RA 4KGZA 4A0RA 3HJHA 1PZFA 2JA2A 2WIGA 2GDZA 1JIXA 2VRCD 3IBGA 3W79A 4NZMA 5CBKA 4YJDA 2G8NA 3MUOA 5FLXA 2ZIWB 3DDWA 8ICXA 4DCGA 2AJTA 2DKNA 2JZBB 2HMVA 4GLLA 3P2MA 1KAQA 4QBGB 4JYCA 1Z47A 4PJ0U 5GV7A 2ZJ0A 1L3VA 3N2KB 4Q3NA 2ISSD 4J3NA 2YHSA 3NGXA 1ZJ6A 4R1OA 4M83A 2F59A 4X97A 3AR6A 2GD6A 3UJHA 1BGVA 3JQ7B 2LIVA 4C6TB 5BNIA 4DIKA 2GUGA 4TTRA 3WBKA 1KZ6A 4ND2A 3ILXA 2BPGA 3JARA 1T4BA 5K4LA 3R9WA 4FNGA 2IL1A 2VPQA 3GXBA 3DTVA 5BYJA 3T3DA 4GO1A 3DVAA 2J9RA 4YALA 5A2QA 4FFBA 3J80A 3OU7A 4EHFA 5C8XA 1XZEA 4PTLA 3L7OA 6ABPA 4QARA 1NZPA 3JQCA 1I3CA 3VHXB 4MXDA 3JATA 4EBEA 2IHKA 5DKWA 1OTXA 5E3JA 5HIAA 1ZBQA 3CF2A 3JASB 3ZE9A 4Q7EA 1DJOA 5E7MA 1XYVA 3KEFA 1KJNA 4BE7B 2QVZX 2BBWA 7ICIA 4AKEA 4D9JA 3K1ZA 3L40A 4CM8B 4CMKA 3R7DA 3SYRA 2JD0A 1PR9A 2CVFA 1TGYA 1CUBA 5AK5A 3N0VA 1X14A 2VPIA 1L5HA 1AQJA 3M2TA 1KMMA 5GJCA 2JF0A 2P2GA 4E7OA 3LP6A 4IC9A 1B0ZA 1WTCA 3K6RA 2IYYA 3SYKA 4A15A 3F3YA 3TLMA 4HXEB 4F2RA 2HMYB 2QP4A 2P9GA 1GTMA 3TFWA 3I9FA 5B64A 5I4CA 4IQTA 2YR0A 2ZBRA 1MP0A 4WXPA 4LAFA 1EE9A 1O7JA 2WC1A 4FP9A 3H04A 4LMBA 2G63A 2A5GA 1ZISA 3O8BA 1XAJA 4I7EA 1QIFA 2EGGA 4JVMA 1XFAA 4GDFA 3N8NA 1CY6A 1X1SA 4D5GA 1Q91A 2FKNA 3K8YA 1OGYA 2HZ7A 2NG1A 2A1IA 3U2QA 2Y1LA 3FG9A 1AK1A 4FOPA 5KSYA 1KWGA 1GN9A 2J7PD 3HVUA 1ODCA 2NACA 5BW5A 1H5UA 3GMTA 5A4MS 1ZD2P 2LWIA 2BMJA 4XQ8A 4TMVA 3SBDA 5L40A 4NCKA 2IDMA 2J9FA 4DADA 5C46F 3EZ2A 4EVIA 1I2ZA 2BP7B 2HV9A 1Q74A 2FX5A 3KV3O 2PWBA 1QX4A 2HWUA 1OTHA 4UTPA 5FBQB 2QXUA 1C2TA 2BY4A 1IXSB 4YEDA 1THZA 1URJA 1T1IA 2YVQA 4U2EA 4LF8B 3II6X 4FS8A 4G81A 2UYHA 1NJ8A 3RFVA 8ICPA 3N8HA 3N0TA 4DHEA 3HYLA 3A28A 4Z9YA 3U4CA 1JB9A 1DPGA 3OQMA 3IXQA 3R0IA 3TNLA 4CM1A 4NBTA 3QSYA 4OXIA 2I0FA 1XDUA 3T7JA 2C9MA 4V2UA 2ZYDA 1AQ6A 4LN1A 1N2XA 4BO5A 4XLTA 3X2FA 3FXAA 4CYMA 4EUNA 1Z56C 4MRPA 5DBCA 1JMYA 1P6XA 3Q9LA 5F52A 1C3EA 4AY2A 1R8XA 2HHXA 4OGLA 5HXAA 2VIIA 3JU3A 2YZKA 2HJRA 1B8UA 1PT8A 1K66A 3MT8A 3PB3A 1AKUA 2ARKA 3Q7EA 1DC5A 7MDHA 2J7KA 4RHEA 3L4BA 3U19A 4W1QA 2WYOA 2ZRPA 4ALNA 3AU8A 4QM6A 1BH6A 4R16A 2XB4A 3U9SA 4AN1A 1E59A 1G9TA 4CTOA 1MH1A 4EKDA 3D2QA 1RI4A 1VE3A 4FGKA 1QHYA 4ZAFA 5K3CA 2ZS8A 3EW7A 1Y3BE 1HYHA 2NXNA 1YA6A 3UGQA 3BIFA 2XDWA 1ZU5A 4K9RA 5FWXB 2QUIA 4YLGA 1Y9ZA 1ZZGA 3RCBA 4U8GA 2BRUC 4FCVA 2ZIFA 1U8TA 1UKEA 1ML3A 1G20E 1BWPA 4B7ZA 4IUYA 5DK6A 5EJEA 3GZJA 1KVTA 1GCAA 3GEBA 4PS1A 2H1RA 4HTFA 4FYMA 1JEAA 3FDJA 3KSBC 2W2MA 4ALKA 2CMGA 4EHBA 3PD7A 1G7TA 2P2SA 4YJFA 5I8ZA 4CHGA 4OY3A 2FR1A 1YS2X 3A11A 1DRWA 1BJTA 4LYYA 5EI5A 1D0VA 4KWHA 3CSUA 3ZK7A 2RHGB 4B79A 4UBMA 1S2LA 2WIAA 2XB6A 2VA9A 4D81A 1MJGA 2Y1DA 5SZHB 3W6OA 2H2DA 2PD6A 4D9FA 4DFPA 2K8BB 3T6KA 5C8YF 1FMLA 4AB1A 1I1HA 1CDZA 2C2YA 4EPTA 3D5TA 4IYJA 1CJMA 2G9UA 4MUNA 4M21A 2IODA 2BI4A 5IZCA 1U04A 1ZOSA 1Z4NA 5F2EA 4D2IA 4MCAA 2HEIA 1VIDA 1XMPA 5TPWA 3TNYA 3GDWA 5C81A 2I3BA 1LX7A 2FGJA 1ZU4A 3GIIA 1X74A 3PGVA 3GA7A 3PPIA 3TZEA 1I3MA 3PJRA 4UHJA 2FUG6 4I2CA 3DKIA 4AYXA 1YL7A 3P4UA 1WRBA 4R0NA 2RHJA 2OZPA 3QKUA 5BOSA 2OV8A 4E88A 5D3MA 3QLUC 4C2AA 1JEQB 1CETA 3K5WA 1NJGA 3UMVA 5HOQA 4DSUA 4HSGA 5IKMA 1TCVA 3I64A 1L5ZA 3C5HA 5G3YA 5CLHA 4DBLE 2PRJA 3VOAA 3GAMA 2E4WA 1Z5VA 1LD3A 3L8EA 3ONEA 3CUTA 2KJ8A 3D1JA 3QX8A 4DV5B 1RCUA 4AJ2A 5D1HA 2EKQA 5CDTA 3L05A 1FQWA 3PL5A 2O8DB 2DPXA 3NBKA 3CTPA 3HDTA 2P5YA 3P1JA 1XEXA 3UTCA 1AF7A 3KLPX 1N56A 4BWFB 3ZE0B 4GWKA 1K8RA 2WFMA 3PXEA 4CIYA 1FDRA 3IT3A 4MV3A 4L9AA 3F71A 5GONB 1ODTC 1RZUA 4OX9Y 4HAVA 2WWVD 3GJXC 5ER6A 3TMKA 4US0R 4YDSA 4OHVA 3LGSA 3OD5A 2Z2YA 2WV9A 3LYSA 4UAZA 3IELA 2OO3A 5JU6A 1TM5E 3EHDA 2XUQA 2Z83A 2IUUA 3KJNA 3IX7A 1VBNA 2AHRA 1U4NA 2I33A 2Q21A 2KWIA 4F3KA 4RLSA 1U8EA 1Z4IA 1ETHA 4DNFA 4V03A 1EVEA 3E0FA 1A2OA 2ZSHA 2R65A 2W2LD 3WHKA 1P4HA 3NVYA 3R4VA 4ZVMA 2LP4Y 1EM8A 4PXYA 2C9ZA 5JW6A 3MWDB 3D2BA 3R7WA 2PZLA 2QVXX 4KLNA 1P2FA 1HOXA 1MAAA 1SBHA 4RPHA 2EBWA 2XIQA 1F60A 2V8OA 5KNDH 3IGFA 2Y0SF 4P4OA 3FI9A 2Z9CA 3EIOA 5DULA 4DEXA 5DI3B 5CG2A 3P0HA 1C3OB 2CRXA 4MVJF 4D44A 1ZIXA 3I5AA 4TT3D 1GU1A 5TGDA 1Z4QA 2KSOA 3EG5A 4J9LA 1AKVA 3LUBA 1QLWA 3HUFA 1OTYA 1WWKA 4ER0A 3ZLUA 4L4XA 3NDIA 5FOTA 3D7KA 4L07A 3BH6A 3DBHB 5JYEA 3R7BA 1V5WA 4AN0A 2G76A 1GP2A 5A6SB 1BWRA 3OIDA 3UMSA 5FHQA 1KERA 1DOZA 3KQHA 3KQKA 3PPWA 3GUZA 5DHUA 5E7JA 2CLKB 1Q7TA 1BN6A 3TRKA 3M9NB 4GX0A 1TECE 1JXOA 4PPQA 4LVCA 3I1YA 2LPMA 2ZIUB 4I4TF 2JEYA 4MUEA 3NC1C 4YP3A 1TA0A 2QT9A 1YZHA 4ENTA 2YOFA 3QGMA 3AU9A 2EP5A 3QMPA 3U7JA 2EJTA 4H60A 1R5JA 2A9OA 3I6ZA 6AT1A 5LB4A 1W8IA 5HWSA 3W78A 4DQSA 5DG7A 1DOHA 1FMJA 3UFBA 3IBTA 3KQQA 2BCGY 4DVJA 4UJ5A 3TUJC 1QTNA 2AK3A 1JU3A 1HE3A 4XVRA 3N6RA 3O94A 4WZ6A 3OCZA 1X1AA 4XA5A 3ZE1B 2UAGA 5C5CA 2AN5A 2J5QA 4W1RA 3HKDA 5F78A 4ZAXA 1ZO8A 4P7GA 2Z08A 1LS6A 2RH9B 1RABA 3Q9NA 1E0DA 4RGQA 3QYAA 1E63A 2F9LA 1WE2A 2D8CA 1MFPA 1SCAA 4XOUA 2O2YA 4Y6RA 5L4SA 1OE0A 1ABFA 4UVDA 4DWJA 1UP7A 2WJPA 2AQHA 1E4YA 1G9XA 1W34A 3DEYX 2IPNA 5C8YA 4WKPA 1PSWA 3T34A 4YUWA 2QRPA 5E6RB 1YL5A 4BMDA 5IM5A 1LSJA 3STHA 3HXOA 3P7MA 1E94E 4GX5A 1FTSA 1Z0IA 4KXMA 3STUA 3EIEA 3RO7A 5GOZA 2ZBDA 3FZNA 3S8EA 1X1BA 4NE9A 3JPNA 4RQMA 3OZ7A 5TGTA 3ZY2A 4B71A 5ABPA 4OHCA 2J67A 3PGMA 5BNFA 3GLIE 2ZBQA 5FA5A 2UYOA 3TCKA 3FMFA 4YMOA 5BUZA 4BNNA 1L5FA 1WKVA 1Z2PX 1TO6A 4V02A 3IDSA 3PLAE 3ES9A 3WLMA 4M47A 1E7YA 4GYWA 3NRJA 3FNGA 2XZDA 4ED6A 1O6FA 1UK6A 3OE5A 5THQA 2O8BA 2BOVA 2GYWA 1Q77A 3MAAC 2IYRA 4IFTA 4KUHA 4HDRB 4OLFA 2IYAA 3TOSA 3RSFA 4TV8B 4IPTA 2YS6A 5J0RA 1ZICA 1KI9A 3EMVA 4G36A 4XWTA 4JITA 3TX2A 1UWCA 1QR6A 2MWMA 2YXBA 5FUBA 1HNXB 1QFZA 2IEDA 4HS4A 1E79D 2G0TA 2QLFA 1O0BA 1T6BY 3LM8A 1KS2A 2XY4A 2D2EA 1OW5A 4J16C 4PW0A 1JEJA 2VDMB 2V0NA 2WFLB 4Z4HA 2PHZA 4Y9TA 2X86A 1Q6YA 5CDHA 1P80A 1DBWA 1RYFA 1HKHA 4C7VA 2BM0A 5FPHA 1QCCA 1MB9A 3V6MA 4RTPA 2VHTA 1XWIA 1TPZA 3BFXA 3W7VA 4R7GA 5I4KA 3OZCA 1UH5A 5ILOA 1TM1E 1KMIY 2DHRA 4YAWA 3LQKA 1OZFA 1NV8A 1QM5A 1I4WA 4F4CA 4D4LA 2GK4A 2VCHA 2W2VA 4NDNE 1L6IA 5DXJA 5DNCA 2Z7JA 4WY2A 3JQBC 3DFFA 4V24A 2DHDA 2YINC 2QSJA 4HNAB 1OR8A 3DE1X 1ZYUA 4L22A 3LKBA 5A02A 1E69A 5ARCA 1YZKA 2HNKA 4RSMA 3BM5A 1S1CA 3INYA 4L02A 4GFDA 2HA2A 2UUBB 3Q3JB 2XDQA 3C1OA 1EWKA 2HSJA 2XT0A 4WZBA 6YASA 1PTJC 2KJ9A 1QRSA 4TQ9A 1QORA 3JQFA 4RVGA 3RLFA 3PHCA 5BURA 1W1UA 4JLDA 3FWNA 5KU7A 2QP9X 2GBIA 1RHQA 3ZG6A 3GRAA 1IZ7A 3ITDA 1Q95A 4BNMA 1DCKA 5B1YA 2PVSA 3P97A 4RQ0A 4IH4A 4IOLA 2R4QA 3GVPA 3ENWA 4JI8B 1OJ7A 5JAZA 1VCHA 3TLXA 1NI3A 4IUDS 3FKSD 4GICA 4IOJA 1W8DA 3H9BA 3SJAA 4NYMR 1NOIA 1MX9A 2LXNA 4WCFA 1DAKA 1HG0A 4CGZA 4MVJA 3D2LA 3V00A 1MQ3A 1U8UA 1LRLA 1XTVA 2E89A 2H5LA 7ICFA 3PUJA 4Z0NA 3L8ZA 1H85A 4AJLA 2UXDB 2KLBA 1G3IA 4ZXPA 1OFVA 3EZXA 3UJDA 2XH8A 3C28A 3H40A 4WA8A 2OXFA 1TUGA 4EDFA 2J09A 4CRXA 1VL1A 1F2TB 4MVXA 4HXGA 1RWKA 4JV5B 1YR7A 3QI7A 1F1BA 4JDPA 1WBJB 3AHDA 1F7VA 1Z2NX 5IJ0A 1FW8A 3HYCA 4MHVA 4C43A 3G5TA 2FMXA 5AIAA 3HYTA 2ZCJA 4I4TA 1EB9A 2WSLA 3PE3A 3DP7A 5AVZA 1JQKA 2ISPA 3B8HA 4ANFA 4J4HA 5KOHA 2UYQA 1E9FA 1GT91 5FFFA 1Q15A 2QTBA 1T6YA 1XJQA 2H0RA 9ICPA 3ONVA 4PIMA 4A6PA 1CJSA 3V8RA 3M1YA 1RFGE 3EULA 3HP6A 3RIYA 2JFBA 3H0LB 4Q44A 5DGHA 3FCOA 4FXPA 1KZYC 2D2IA 1LJ8A 4L6IA 5MN5A 4FZNA 4DR3B 4DDVA 5B3KA 4AJKA 2Q99A 3IV9A 5KC8A 1N1DA 3PX3A 4EI7A 3GGOA 1UDXA 3OGUA 4P33A 5I9NA 1GPH1 5J8YA 1QIHA 2QZZA 3OQ1A 1GCUA 2RJ3A 1SD5A 2XO7A 5ELMA 1Y4SA 1WWVA 3FTCA 3MS2A 2ZS9A 2A33A 4JB8A 3SAHA 1P2VA 4Y2JA 3OG9A 1P2TA 1GFSA 5EJ4A 4R7ZA 3PCTA 1E2NA 4F3CA 4JXXA 3LK9A 5KX5A 2PNFA 1ZQRA 2C2HA 4PAWA 2D3DA 5BSGA 4HDAA 2ZT8A 1O97D 3WYNA 3S5UA 3D2NA 3HCRA 2V9ZA 3INGA 4NFLA 5H3CA 5BYBA 4OYHA 4PYMA 2BKXA 4KP7A 3O2QB 1T0UA 1WIWA 3RNOA 1KOGA 4G5RA 3L6EA 5JD5A 2DY1A 2ZUVA 1P4AA 1U3TA 4P54A 5E8JA 2ZYAA 1G8GA 3BXOA 1CRZA 4RY8A 3Q7TA 1GL9B 3B9BA 4RPZA 3LW7A 3E03A 4MVYA 3TQTA 4WDRA 5TJ9A 1EX6A 4FJ2A 4ZCTA 3RSCA 2RGRA 5EJ9A 3D3EA 1IOZA 5DM4A 3GJ5A 2JGIA 5FPYA 5DBAA 1WUDA 1V41E 3MCUA 3RPEA 4QNLA 1KEVA 4F50A 3H2IA 2OXOA 2HHSA 4LVOA 2AFIE 4ZV9A 5B5SA 2A30A 4EUSA 4YRBA 3DTNA 2FFJA 4A8JC 1VG8A 4X20B 4TM8A 3G0OA 2RE8A 2NYVA 3ZKAA 4OJ5A 2A19A 3DOIA 2DTEA 3O4HA 4FDAA 4YCNA 2LKCA 4KHPB 3A1CA 3ZWCA 2CBZA 2HHAA 2VPYA 4BC1A 1JDVA 1B73A 1KYVA 4NBNA 2WU1A 1QHSA 5YASA 1T94A 3ZJ4A 4FKMA 3RS2A 3HCAA 3PLRA 1ED1A 1E6KA 1JSZA 3P20A 3E22B 3GGDA 1N5RA 4A0SA 2IVZA 5DEIA 3NANA 4E0DA 1M2HA 4PLWA 1N77A 4H7DA 5EYPB 1PR6A 1RRGA 3BJMA 4TMYA 3H1FA 2CVZA 1BX3A 4KNVA 2ZRIA 3TIGA 2OHOA 2BM8A 3SAFA 1KO1A 1JQ5A 3IQDB 4IVRA 1U0SY 1YZUA 1SKYB 3IEPA 4KWCA 4EQ6B 2XMCA 4EEYA 3SBEA 4IV0A 3T3IA 4JNKA 3E15A 2OLKA 4C22A 1JKFA 1BN7A 2ZWOA 3QJ5A 4CFSA 2HF8A 4KO2S 1ZX1A 5IH7A 1XPRA 3L01A 3R3ZA 1T6XA 2JKYA 3TZCA 1XTQA 1XTBA 1P1CA 3KT8A 2R68A 5FX2A 4ZAWA 2PM8A 3IKLA 1QV9A 4C8KA 3HBJA 2A57A 4FE3A 2VK8A 1KJYA 3I04A 5FYQA 2FG5A 3LZ6A 1JQLB 4H31A 3V32A 5AJYA 3OWXA 1M1YB 4XQCA 2GAIA 2CWDA 4YRIA 4B2YA 4MARA 3E0QA 2N42A 3SKXA 3ILSA 2HHCA 1UPAA 3JQPA 4FPXA 4JY7A 1IY9A 4OMDA 1T3GA 4F2HA 5I9MA 2JHAA 4DS3A 1QONA 1VE7A 3KKAC 4DIFA 4XVQA 2R5WA 3NRZA 1QKIA 1M6HA 2EANA 2PWZA 4YR2A 4DRXA 4ZV4A 2H29A 3HGQA 4DA8A 2LM1A 3B52X 4W6QA 4NAUA 3LL4A 4PRZA 3GLGE 2WPDA 2ZB8A 1YDEA 4JLNA 3BXFA 4DLWA 4B2IA 2NO4A 5F7ZA 4R05A 2PMCA 4LS3A 1I1QB 3BWDD 1UFRA 2DUYA 3ESYA 2R6CA 3VYTB 1FW6A 1GSIA 1K5DA 3NQ41 3ABSB 3F2CA 4NYJR 4G0YA 1TKBA 1C4OA 1Q7CA 1CUXA 3DBIA 3I2FA 5AM5A 3TPFA 4Y7DA 3EZYA 3Q88A 4FU0A 2ZTVA 4Y2QA 4JCOA 1D4AA 1W0KD 1UBOS 5BYKA 3IAAA 3T61A 1XZGA 2ZM6B 2CJFA 2EZ4A 2WWXA 1OXVA 2KEYA 4MYRA 2Q9BA 5KG4A 2IXGA 4X64B 2RB5A 1LPAB 3CX6A 3QVKA 3WWCA 4G86A 4UAYA 3JAMA 2PSSA 3LY7A 1JS1X 5EE1A 2PY6A 2WWYA 4PE5B 1ZUD1 1MB4A 3N1UA 1NVUQ 4OOFA 2ZRBA 4IHJB 4M9QA 3DMGA 1XGKA 3REGA 3K6SB 3TE7A 3JQ8A 3E9YA 1LTHR 3F53A 1IJFA 1Y4ZA 4AYTA 3QYFA 4DA0A 2HRCA 2JEZA 2QDXA 4HX5A 4M8NE 4F2PA 3OA0A 1UCFA 5ITZA 1N6IA 1PEDA 2QRVA 2XY7A 2HYIC 1JSLA 2B4YA 1YJAA 1K4KA 2I2DA 3B1FA 5BMVB 3I58A 3VNAA 3UN1A 1VA4A 1Q0PA 2ZBGA 4BEWA 4K0RA 1FA9A 3W5AA 4YQFA 1WVGA 1I6KA 3DPSA 3B1ZA 1EWTA 1CRXA 3SZGA 4F7DA 4GMGA 5KTOA 1P7DA 4MV8A 1C7FA 3R74A 4H7JA 2SCUB 1UADA 4R2LA 1AA9A 2ASEA 4RVNA 4CG3A 4OJQA 1TB4A 2CF6A 5B66U 4IINA 3P9YA 4PG7A 3EF0A 1FK8A 2SBTA 4LYHA 2ODWA 2K4IA 3QEKA 1Y6QA 2QQFA 1N2CE 2VSYA 1NYLA 1GPNA 3WDLA 3KD3A 1FJGB 4QGBA 4BQQA 5AHRA 2AJDA 1YUBA 5ECYA 2CXSA 3DV0A 2ZYTX 3K9BA 1CUCA 2PGJA 1K4YA 3GPLA 1PVPA 4LGCA 3L9WA 2YVAA 1D6NA 3BJYA 5KT7A 3ZHOA 4DC1A 5JSYA 5CD9A 3HLKA 1WB9A 5FUWA 3LDAA 1NK5A 2A9KA 3KSZO 2YZ7A 3R0QA 1U28C 1JDBB 3PQ5A 1I4DD 3C45A 8ICTA 3AF4A 3CLSD 2F3TA 2HBRA 2MSKA 4Q0MA 2KNJA 1RXEA 3PQ4A 1KSPA 3LWZA 5IFLA 4I9UA 2RGGA 2HK7A 4RGBA 1E1RA 1UXIA 2BMDA 3V4LA 5I48A 2QR3A 5BWCA 2H1LA 4KFRA 5JJKA 4FYYA 2R6ZA 1V2HE 3E9RA 4YP5A 5U4QA 5LZ8A 3H1BA 2NT3A 2R8HA 1BQ4A 4X3CA 3E7DA 5KFGA 3P0FA 4ZZ3A 4Q4AB 1WXDA 5TGZA 1Y98A 2P4EA 2CC2A 1E6WA 3DLIA 3QX3A 2BFAA 2RHBA 2AJLI 2W8BA 1R4MB 5A3SA 2FEOA 3B13B 2FRDA 1M66A 4PHDA 1R6DA 2WF5A 2J6HA 5B1IA 3RFCA 2X19A 5I4BA 5BQFA 1JJVA 5JLJA 4PZZA 3V1NA 5LB2A 4KQGA 4US2R 2Z5VA 3DQZA 1ZM4A 3USCS 2XBMA 1X1EA 3WGOA 1OY1A 4EBCA 1O95C 4YV2A 3LCCA 2YJ6A 1V37A 3JQGB 4BP9A 3ZD9A 1XIVA 3HX0A 3U4QA 1S7GA 2M1ZA 4DLZA 5IAJA 5D4BA 2HRRA 5J63A 1EFHA 4Q9JA 4UOZA 4ZT3A 1A71A 5L95A 1OB2A 4NONA 1W35A 2EF0A 3DVSX 1JQBA 2V9PA 5SY9A 3ZVKA 3FPEA 3O8RA 4MQEA 1YS9A 2GHRA 5JFTA 2OB2A 5B3JA 4I08A 1THGA 1E5VA 1IPHA 4DLEA 5TT0A 1AK2A 4YY3B 4WFQA 4COOA 5FI0B 4CZ2A 2B82A 2N0SA 4DC0A 4KO8A 4RV4A 4MFAA 3C1UA 3WRWA 2IX9A 4D45A 2LI6A 5EHXA 1KMHB 2B1RA 1QK5A 3KQWA 2ID9A 3H0EA 4BEBA 2C9CA 5FQOA 4B74A 1HL7A 1VG1A 3WYBA 1VMDA 1ZRMA 1J07A 4QG3A 2W48A 3RREA 4B3IA 3VZRA 4H7FA 1CQJA 4FOTA 3JYOA 4YMSA 1V26A 3UJ6A 4QXQA 4AM8A 2JIOA 5HE9A 3AMVA 2WOJA 4W7IA 3R5SA 1PJAA 5A3JA 2QI9F 4AP5A 3VR6H 1GQQA 5CVUA 4LZOA 2I7VA 2GXQA 2VJQA 1T9AA 4WOBA 2PGIA 1LNQA 1UOQA 5CVJA 1TZKA 3EMDA 1ECGA 4B8WA 3D8NA 4QNNA 2ZVPX 3ZJUA 2O1EA 1XO0A 3I73A 4YYEA 2BFNA 4MR8A 1G3RA 3G5LA 3P5SA 3E8XA 3RROA 3VM6A 3VR2A 5KT4A 2AK2A 3ZWKA 3FDSA 1D7OA 2ZIVB 3VH2A 3C4JA 3EFEA 1M2FA 1M2GA 2ZSEA 1WZUA 4Q8EA 2AF4C 4FEEA 3ZQJA 4Y2HA 2IDZA 2AXQA 2HQBA 2C42A 1DCTA 3OUUA 2IE8A 5HJ7A 1NXWA 2JFUA 2QV0A 4C07A 1KOJA 3H2HA 4UU7A 7ICUA 2ATCA 4JQYA 1S4QA 3I9LA 4UNPA 4E08A 2OV4A 1YIDA 2BFOA 4DCUA 2DUUA 3THOA 2FOIA 5F2OA 3H19A 4MPRA 3HW8A 1P4RA 3LCUA 2DUJA 2HIGA 1VGRA 2JJ2D 4Q3CA 1N5OX 1RPLA 2CFCA 3ZCQA 3ZGOA 3SQMA 3WGQA 1JV2B 2ZITA 2B8NA 5FTKA 4YMIA 3RAQA 3ESXA 3FJYA 1OH8A 1SPXA 3NDPA 2IE0A 2CSUA 1ADBA 1OI7A 4MRMB 2XXAA 1L8XA 4BMCA 4M9XA 3S8YA 2MIIA 3CRNA 2QVBA 5J0UA 3MOSA 4FQ7A 2NZVG 1Z8HA 1Z0FA 1MQ8B 2D0PB 3D4IA 3I52A 1T2NA 6REQA 1EBFA 4QJ5A 3RLIA 4V3BA 3M3PA 1S3GA 3MMPA 4HX9A 4NQZA 1W52X 1IBKB 4RMJA 4N39A 3D31A 4DQVA 2CJWB 2NQ2C 2NU7B 4GXNA 3NVZA 3FMOB 3KK0A 4LF9B 4ZI7B 3H7AA 4A2PA 4GZ6A 2XQFA 2IIPA 4HYQA 5JSQA 3ITNA 2HQSA 3ORHA 5CBPB 1K0FA 4EHAA 1Z06A 1GARA 1FB5A 1BA2A 4WZAB 5ED0A 3JQ6A 1WVMA 4BBAA 4EUEA 1SH7A 4XTCS 3COSA 5BXQC 2RGCA 1I1OA 2ACEA 1ZN9A 5AK3A 3JZFA 4F2WA 3NRCA 3T52A 1Q1AA 1MX1A 2YN0A 2P6UA 3E7XA 1FU4A 4DSFA 1ZI9A 3EWIA 2PRIA 4DV0B 3NOOA 2JIZA 3GK3A 1QFJA 4ZOLA 4ZREA 2IQIA 3VDMA 3I6IA 4TN5A 4DF4A 2OWDA 1FE8A 1I6MA 4CKBB 3IUYA 3ZU3A 2GZMA 3ELWA 3G0GA 3ASZA 2RHLA 4LW8A 3IBSA 1MQSA 2HXGA 4ZEMA 3SMQA 1EQUA 1FUUA 5LD2C 4FHEA 1QHEA 2XYPA 1AJEA 1GVHA 1NJ6A 1C41A 3E9QA 2I5HA 2ZSJA 2BONA 4JL6A 3RH6A 3G9ZA 4C4RA 4ZPJA 2JD2A 9ICLA 3WLSA 2EX4A 5FWYB 2ONCA 4X44A 3WX0A 2JEJA 3OP1A 4MYDA 2H5IA 5JMOA 2GRJA 3QELB 1X9HA 1HYBA 4U2DA 5DHRA 3CC8A 2WU8A 3HCDA 3W34A 4DOBA 4E0BA 2VR1A 3A1WA 4PO3X 1C8BA 5IYZA 1F17A 5B1DA 2Z0MA 2ANCA 5GADl 2JAPA 4OAQA 3DMPA 1ZXLA 3K8ZA 1IAVA 3BD6A 1ESNA 2GPNA 4F6CA 1SM4A 1R6TA 3GAFA 2EF1A 5ALJA 3N8IA 4M1ZA 5A2GA 4RJKA 3VPGA 5AHXA 1TTPB 1ZEMA 2PU7A 3S27A 1EBBA 3LTEA 2MCFA 1C9NA 4PFJA 2LMRA 4PICA 3I5XA 4YFKA 4P6VF 1E9DA 2Z30A 2QR2A 1V25A 1DG9A 3PDHA 4H18A 4BX0A 3T41A 4MJLA 1GCIA 4A9AA 1IHUA 2W9AA 4DLRA 3ORRA 3WLIA 4HEHA 3L7CA 1UOEA 4JLPA 5IJ9A 5EEHA 1IN5A 3USES 5CB8A 2Q4DA 3AONB 3RYHA 1SY7A 4FGWA 3BXPA 2V5VA 4UAWA 1CTQA 3VMFA 2B4KA 2IUEA 1I2AA 4LGYA 2D1FA 1P9WA 2WZQA 4IILA 2OHHA 3THVA 3LLVA 3QWBA 5D46A 1Q0HA 3O26A 4Q9AA 4WCDA 3KYDB 1IN7A 1XD8A 2R4TA 1A69A 4DJTA 3RTCA 1JHUA 1LI5A 4KN4A 3NG1A 2IPXA 3N5KA 3Q8MA 4P5EA 1RQGA 2VRBA 1IN6A 2NN3C 1GEEA 1M73E 4FYHA 5AOVA 5A4KA 1JJBA 3PJDA 4PHHA 2UZ4A 1ACJA 2BFMA 1UXHA 2PLNA 2C22A 4KVAA 1P1KA 4YRZA 3GNSA 4P4PA 2RAFA 1JFFB 3MT0A 5EL0A 2ZW9A 2JNWA 1Z38A 3KO8A 1US8B 3UBTA 5ED4A 5JZVA 7ICRA 1J20A 1ZGAA 1QBKC 4DSAA 2YQ4A 1OWLA 5I4IA 4UB2A 2SKEA 1I5RA 5TMPA 3AM3A 1NF3A 4DFJA 1TYDE 1V5GA 2YMLA 4D56A 3JPSA 3E3LA 3PICA 4Q6BA 2Q4OA 1HDEA 2W43A 1BPZA 5JZMA 3TZQA 3LSYA 1YVUA 5EXPA 4OIFA 1OV6A 1OX6A 2DHCA 1CKEA 3PPYA 3A10A 2C4TA 2R1ZA 4B3XA 3IP5A 2ZJ1A 1AY0A 1ZMRA 2Z1MA 5UKDA 3G17A 1EQAA 5EP1A 1CQXA 3MDAA 4WFIA 4M0AA 3W5JA 4N6GA 4H6WA 2XPCA 2FJUA 2HK8A 1QPGA 1NMYA 4JBLA 3CVUA 2YY7A 1EFRD 3BC1A 3HRKA 1W46A 4LRWA 1ZQTA 2VLIA 4I55B 4RYLA 4IDQA 4P86A 2ATEA 3LYHA 5GJWC 2QQ0A 2OENG 4I1IA 2ZUWA 3OCVA 5EE9A 4JI7B 4LJRA 4E2ZA 2BR3A 4YHBA 4G09A 3N75A 1L4UA 4EI8A 5HPYB 2R2AA 1LSSA 4UNNA 4Z3OA 4DL6A 2Z9BA 1KFDA 1P19A 1ZH8A 4YRQA 1SAYA 2M1XA 2IV3A 3GRYA 3UV7A 4Y2VA 2CXPA 4AMGA 2OWEA 5IWCA 1ODFA 4PAQA 3S28A 2R8RA 4S0XA 4UREA 3K4GA 1KU6A 2NSJA 2P8SA 5CGQB 1MJGM 3KKPA 1TK2A 1XSEA 2A9RA 3H6KA 1IOWA 3BAZA 3KVOA 4YQWA 2EKDA 4GS5A 4GMHA 1WP9A 4R5HA 3ZHZA 3QPVA 4KQ2A 3X1MA 4K6MA 3VRHA 4P31A 4ZAVA 1W87A 3RFXA 1C29B 3ROQA 1C9DB 1SR8A 2C78A 3MWYW 3V6HA 2QTLA 4NE7A 3G8BA 2VN8A 1PQ4A 2X15A 2NMVA 1I4EB 1U0HC 4D1YA 1IXRA 3LGAA 3KB2A 1WB4A 1G16A 1BXKA 1O57A 1T6NA 3OX1A 1IHPA 3B70A 5T4EA 1N78A 1W4ZA 2R00A 4G1UC 3O0DA 2BGUA 4JJZA 5EFOA 4BO6A 4UMEA 3K3PA 1TJYA 4D9NA 5JG7A 1GRVA 1Z5UA 4F3NA 1YE3A 3A6ZA 3OU6A 5CX1B 1CC1S 2QNIA 3ME5A 3F3SA 3VHQA 4R68A 1FYDA 1N2CA 1KZ4A 2F9MA 3P9CA 3MUFA 1K8YB 4XARA 3OBBA 4IP0A 1HK7A 1Z2EA 1BJRE 1EWVA 2W6PA 5TC4A 2CK3D 3LFTA 4DLNA 3BJRA 1M3SA 3D6AA 1RQRA 5DW0A 1QSSA 1FVFA 1NMQA 1GPBA 4FMCB 2WTAA 1YBMA 4UDYX 1YUMA 1VMEA 3EOZA 2ZRLA 1M5UA 4MF8A 3HB5X 4UXIA 4ED8A 4QZDA 1PSZA 1E8MA 3MJSA 1VHDA 2VF4X 3CWQA 5DX1A 3EGDA 3RJFA 5KNCH 4BRZA 2Z4SA 3U4HA 1VIVA 1C0LA 2F3PA 2FW9A 4HL6A 4UMVA 4B8YA 2FMQA 4IRMA 1Q1GA 3GEMA 4HYEA 3WKDA 4HNRA 2RG1A 4URFA 3K9NA 3OZUA 5LQMA 3BRSA 2HMWA 1KI2A 2RHMA 4Z4IA 4YP9A 3HMKA 1XTTA 2PCLA 4UZFA 2QK4A 4DOCA 1L9KA 4Z1OA 2C9DA 2VNJA 5E7IA 4EELA 3WK8A 2Z5LA 3SJ7A 4WCVA 3OE7D 1XJ5A 5EGNA 1XZMA 1C0PA 5KFJA 3WKAA 3ZIAD 3OTOB 2XQJA 3VVLA 1JI3A 1R9NA 1A0OA 1N92A 1ZD9A 3ICVA 1TQ6A 4Q66C 2XCAA 4KPUA 4WFJA 3CONA 2ECKA 1KOFA 1UT8A 1Y7PA 1BU5A 2JG3A 4KVZA 3CUSA 1CU1A 3G2NA 4WLUA 4OHFA 5FL7D 3ODPA 2I7XA 5H83A 1MU0A 3KP1A 2H8GA 3ELDA 5KHLB 2QW1A 1J21A 3MUNA 2G28A 3OJEA 1T5LA 3C3PA 4MUFA 1DK2A 1V3TA 3U81A 2XVMA 5AKHA 2F43A 4UBBA 1OA0A 3RC7A 3WRXC 4G56A 4DHWA 1P7ZA 2EBFX 4JJ6A 5C0YA 5IBQA 4YWHA 1RYUA 3NP7A 4PO9A 4QJIA 1Y3AA 1NBME 1LA2A 4BP1A 2HA3A 2B4TO 1JIUA 1A72A 2WWGA 4RH3A 3TN7A 1GAQA 2IYSA 1OI4A 3TDMA 1AHIA 9ICNA 5BSHA 1GNTA 2R44A 2PFGA 1GPKA 1R4NB 4MS3A 1G6HA 1EESA 3CRMA 2BFPA 3L0CA 2BSAA 1WXFA 1J7KA 4UUNA 3Q6IA 4BBZA 1KKUA 3FCCA 1NY5A 4H7EA 2CDBA 2AKEA 3PDJA 2QR5A 5KAPA 3RR8A 4B45A 3I2GA 1BVSA 1M0TA 3SIPA 5H9VA 2DFLA 2YICA 1V8BA 2EFYA 4EY5A 1JAIA 2H07A 3PNOA 3UG6A 4KITB 3OCWA 1RDFA 2FR8A 2FXVA 3WWPA 1V3QE 4PAOA 3PI7A 3QSGA 4W5QA 1LFAA 4FHZA 3EZ6A 1HDRA 3BAFA 3VPCA 3WOHA 2ZJ6A 4KXLA 5ENZA 1ZQ1C 2HVIA 2Q62A 1DKRA 2HGSA 3CVWA 2WB1F 2W11A 4FWBA 3HSKA 4CR8A 3O83A 1VDZA 2Z1DA 4L5JA 2G09A 5P8WA 3NIBA 2HJVA 4NM1A 2O2EA 2UXCB 4BGIA 5JCJD 4L5BA 2W3SA 3C48A 1IBMB 4H6PA 2OGUA 3O8QB 4BO7A 2QSYA 3HCEA 2LCFA 1FS4A 4OQPA 4FC7A 2Y1KA 4JWNA 1GA4A 3EGCA 4L57A 1E66A 1K6EA 3PX0A 2HCTA 7ICOA 2LDBA 5KFOA 4QRHA 2RARA 4O4LB 2PL1A 2DLDA 1VJCA 4F2GA 1JDZA 4UULA 4I4CA 2P9CA 1V97A 3OECA 2VRWA 2V7TA 1WZNA 4YAEA 3P71T 4CU2A 1IE3A 4AKSA 5BW8A 2QB0B 3U3OA 4RORA 2XGGA 4A6XA 4IY1A 5SY6A 3ZDRA 1TYBE 4FYWA 3VMMA 5KOJA 1XCLA 2IWRA 5L1LA 4EYOA 5LQKA 4ECEA 3HABA 4LJYA 2KZZA 2CDAA 4E4TA 1TIBA 1NN3A 4GBGA 2FMUA 1Z3EB 4ZOQI 2ZJ7A 4D4MA 1RMYA 2BISA 5KX5F 5CYFA 3H75A 2HJWA 4MGIR 1YGYA 2LM4A 3LVWA 3L1UA 1N2BA 4PR0A 1Q1BA 4CLOA 2ZE6A 5KYWA 1Y63A 4RWEA 3IAXA 4KZPA 4P81A 5GAJA 4PFSA 4OKIA 3TQHA 2ASJA 1OZGA 4C5AA 1LDGA 1SXHA 2BZSA 5CAEB 5FR2A 5IDWA 2QRLA 1LLUA 3FYSA 1BXRB 3C7DB 1OX4B 2KOBA 5CA0F 1TM2A 1ISMA 2EAPA 3BL8A 5B57C 3TINA 2WWIA 5I51A 4WQMA 2Z3ZA 3AP3A 1UZLA 2X9LA 3UOWA 3VC8A 4RUKA 2ZDQA 1A9YA 2BYTA 5AT1A 4EP1A 2PUEA 2FW0A 2NO1A 2V8BA 5EMLA 2G7ZA 4B34A 5K01A 2JW5A 3ONFA 1L8QA 1SCDA 2C1ZA 4YJ2F 3EXEA 2E4XA 2BEUA 1XRLA 1LKYB 1J1ZA 3E4DA 2JCSA 4JSRA 1V16B 2QYTA 4G1VA 4NV1A 1Z75A 3GEHA 3E9CA 4B46A 2X5XA 3ZD7A 3R3WA 4QO8A 7REQB 2BGJA 2PI4A 3TADC 4MP3A 3D0OA 3PKJA 5B1HA 2NZJA 3Q1KA 4QYIB 4BFYA 4OH7A 3H1GA 2DF4B 3D43A 1VI5A 2CMFA 2QU8A 3Q6NA 9ICXA 3KUDA 4BVBA 5M04A 1IY8A 4NRDA 4CM6A 5L3ZA 2FN8A 2JFXA 4IM7A 2ZIAA 3PEEA 1WOMA 3F9RA 2Z2KA 3QVOA 3WXMA 2CL5A 3ABIA 4UUOA 4B9EA 4GD3Q 3WMEA 3OFND 2I34A 4Y2PA 1C9MA 2AI3A 4ND6A 4OHXA 2AI1A 4FDVA 3IODA 1G5RA 5JD6A 5K0JA 1UC4B 3OLQA 4K5QA 1YNSA 2Q5LA 3R9KA 1USUA 1PJTA 4Y6SA 2GM9A 1JG7A 2YC4C 1NK7A 3H17A 2AYXA 1PFQA 2ZJFA 3N2GA 1PJ2A 3EVFA 1VL8A 5HS4A 2HCBA 4F5WA 1ZQHA 3F96A 2AQKA 1V1MA 4FMPA 4C3UA 1E3EA 3IURA 2QARA 3OPYI 2F8MA 2AKAB 2V7QD 4JJIA 2GWSA 3KVVA 3OHSX 1UT6A 2TECE 4AXBA 3FMIA 2BGRA 2Y1XA 2R84A 3MXTA 5DI9A 2ZJYA 2OAP1 2VWGA 4WA7A 4I3GA 4XDZA 2I99A 5KNBD 1IXKA 2J3EA 3CRZA 2Z2ZA 2P9YA 4F0JA 3RYFA 1P9LA 3R6GA 3TAQA 1E1LA 1PV1A 1OBFO 2PN1A 4K9KA 2ZWIA 1R6BX 5JZBA 4RKQA 4A16A 2Z4TA 3RS9A 3DAYA 5JV5A 4MVJM 1Z5PA 5FFNA 2C31A 5TEWA 4KTVE 2BFFB 4OQXA 1SXJE 1L0BA 2ZU0C 5E7QA 1GEGA 4YVZA 2NZWA 1QGZA 1SU6A 2RSLA 2FG7C 1JPUA 4MPTA 1ONPA 2OXTA 3UJ8A 5TVKA 2XD4A 5EIBC 2XCQA 9ICIA 2EX0A 4HZGA 1ZLYA 3FF4A 1KHTA 4HK4A 2RKWA 2H51A 2C2RA 1O6BA 5EWFA 5U1PA 1ZNQO 4AZ0B 5HK9A 4UAUA 3JQ9A 3IAEA 3IEKA 2NNWB 3THYA 1Z3CA 9LDTA 4Q01A 2I87A 1CEEA 4NU6A 3GZNA 3DHNA 1BVYF 4K2HA 3ZDCA 3ZH2A 2G7MC 1PJSA 3I3SR 2MYPA 3FNBA 4WINA 4U0KA 4ZU6X 4O2BB 4PZAA 1H05A 1K3TA 4B82A 4PVCA 2VH5R 4RDCA 4XPIB 1NX6A 4PQGA 4JUBA 1W36C 5JMTA 1B0XA 5AXBA 3DAHA 4ZCMA 1Q0ZA 4NZYA 3GLSA 4HBZA 1FYFA 3EXAA 4F8EA 1CNEA 1L4LA 5I9BA 2H63A 3I0MA 3OPXA 4ZZ0A 5IDYA 2UZ1A 3X1JA 4DM4A 1GKYA 5KFYA 1E2UA 2IHMA 5CEEA 1QQAA 2C59A 4NENB 1DC8A 2B83A 2AW5A 2QLNA 4M86A 4UPDA 1V39A 2ZRFA 3WRYC 1KVSA 1F8YA 4QLOA 2HFKA 3THRA 2QT0A 3VJKA 1QHHA 3QQPA 3EAGA 2AHOB 1WHTB 2BF7A 1NURA 5T8KC 5DGDA 3D6JA 4Z1MD 3F97A 1E77A 1SWWA 3GW8A 2XWJI 2JGAA 4Y0NA 4OXRA 1OXBB 1PAUA 2A9QA 2O52A 3IR6A 2ERYA 1ZVQA 4BN5A 2O0MA 1CYEA 4GPBA 3AVTA 2E8PA 2WJ4A 4UU1A 1WPXA 1Y4AE 3CCCA 3HVJA 2F76X 2QVLA 1A4XA 4DQRA 5CA0A 3N7RC 4MV1A 1HM5A 4CR7A 1WB5A 4HNHA 1U7OA 1YFZA 1VE5A 3F49S 1ZNZA 1FFGA 3T7IA 3M70A 1D07A 5T6BA 3OCXA 4USAA 4JIMA 1TW3A 1C7YA 1LUAA 2XVXA 3LWNA 4J1SA 3BBLA 2XZLA 2QENA 4KLCA 3O4JA 1T7PA 1PT5A 4YJ2A 3GUCA 4B3HA 1QQ7A 4TWZA 4L95C 3VDNB 1CW2B 3QX7A 2B1JA 1OHHD 2K4MA 2P9TA 3FNQA 4JOQA 1QPBA 2NYRA 1YB5A 3GWGA 2Q2VA 5C0OE 4D3ZA 4YXWD 3NDRA 5J2TB 1G20A 1LBIA 1W93A 3MCVA 3WFJA 3BMCB 3QVGB 1TKCA 2VK2A 2PXHA 4F3OA 3GRUA 2PX5A 4QU9A 4RFLA 3OEHD 5C18A 4CCYB 1OX5A 1ZQIA 1AUVA 2FN7A 3EWNA 4XDHA 3W9YA 4NMXB 1IM2A 3UTDA 1EAYA 2EERA 2AEJA 1PS0A 3AESB 2GBLC 2PZJA 2QGNA 5MN4A 3AK4A 3WNCA 3K9FC 5K5EA 1Z08A 4NG5A 1S3IA 1OASA 3QHPA 1QP4A 4CU5A 1CZLA 3U6BA 4ZYXA 5IARA 3AETA 5TT1A 4EAAA 5EIHA 4L6AA 3CVXA 2G0NA 2PZBA 4MGYR 7ICTA 2V7GA 4HVCA 3FHOA 1V6AA 2BHLA 1LPOA 2NX2A 3WB1A 5HRCA 1T25A 4RMHA 3TO5A 3RGGA 3FPKA 3I12A 1BCSB 3HDVA 4XRRA 3M7DA 3DXYA 1RZRA 4MRVA 4QPZA 2V54A 5FOQA 1E1MA 1PBNA 5CD1A 1YASA 1Z2OX 5AKYA 2ZAOA 1A8SA 3FTDA 4NJOA 4JELA 3K9QO 2I6SA 4IXWA 3SXJA 3BKWA 5J0PA 4AW9A 3ZE6A 2W2PA 3O7WA 3KZVA 3I04M 2O6HA 4L16A 1O5TA 2HT1A 2QTAA 5A4FS 2YNMA 4GVLA 1YK0A 3AEKB 4ZVOA 3GILA 4ZO4A 3UK6A 4JK1A 4WVFA 2VXBA 5BY2A 4BXOA 2CZCA 4U2BA 4RHUA 3K72B 1U7TA 1H9AA 5EE3A 4TTTS 4X63A 2I9GA 3G13A 2CNBA 2XA9A 3IIJA 4N0MA 3VR0A 4MW9A 4OUDA 3W8RA 221PA 4HEQA 4DJEC 1TPYA 3L3FX 4EHJA 1FFUA 4A8TA 4KIWA 3TMAA 2HTFA 1IAQA 1VCNA 4QU8A 1CUEA 1PRYA 1WSDA 4PBRA 4AKIA 2FQWA 1FP7A 3B78A 2ZG6A 1LW7A 4ARAA 3TFSA 5TJHA 1HDCA 5K0ZA 1U9LA 2O8CB 3PA6A 5KTKA 2FOXA 4RZXA 2AC4A 1XE3A 2VQFB 2PLWA 4QEZA 2JC3A 2Z09A 4LDJA 2QF7A 4BCCA 3GCXA 4ZK6A 4KLEA 3NHZA 5IW8A 1SHJA 4GI1A 4XUDA 1R0LA 2IH5A 2KS6A 2OB1A 1ZQMA 2ZYRA 1AT1A 2ONKA 4FLEA 4FBLA 1IG0A 5BMOA 4D4IA 1N1GA 1CR4A 4QOIA 1J8VA 2IEYA 2C28A 5EJMA 2PQ6A 4J1NA 4LJAA 4U9UA 3SPXA 3AF5A 1M2JA 2AOWA 1XHEA 1YT5A 9ICVA 1RC8A 2IYTA 3EDRA 5IAAA 4DB4A 3ZS9A 1J06A 4NIMA 4HYTA 5DF1A 5SICE 1X3LA 4KQ6A 3NBUA 4XVHA 1FU7A 1L4GA 3TAUA 2A84A 4HEJA 3VV3A 5HKAA 3ZWWA 1ZD4A 2R79A 2DPYA 1KI8A 3P32A 4R41A 4NL4H 5KTNA 5F5LA 4G3XA 3WGHA 3IKJA 3W2GA 1RKQA 3CFYA 4CKWA 1GN8A 1XVTA 5GY7A 3C5GA 4F9FA 1LLDA 1AB5A 5ALSA 3UT0A 3O1LA 3PSIA 5CA1A 3V1TC 1WCWA 1YGPA 1L8OA 1MO3A 4ZVLA 4U4AA 3K0HA 2VWQA 4BWGA 4XEUA 2RI6A 1RRCA 2EQ5A 2WPNA 1B93A 1BTOA 3IKTA 3BD9A 1T3TA 1P1HA 3M6LA 2J3DA 1XEFA 3GT3A 4REMA 3DCYA 2NU6A 1SFRA 3EQZA 1W88A 1E2FA 2H2WA 2H4ZA 2QRQA 3UJAA 5GPBA 4O4HB 3DO6A 3S68A 5LJLA 2JI8A 5AW1A 5JJ5A 3DKKA 5DB4A 4G4IA 3PHJA 3OKFA 1Z8NA 2RB4A 2HA0A 3FDFA 2INGX 7ICQA 4UPEA 3KAQA 1VM6A 3H6GA 1Q12A 2JCBA 2J32A 2PMZC 5GOTA 4O2AF 2VT7A 4B6SA 1TF2A 4US1R 1EI9A 3CG0A 1K8ZB 1PE0A 4AY6A 1J2UA 4ND8B 5K2MA 2PEYA 2R751 4C0QC 4Y1FA 3CSDA 4WVLA 3EB9A 4JUFA 5J1SB 1VE9A 4M89A 4Q7QA 2CZQA 1A96A 4W82A 3G0DA 1XRQA 2YWCA 2N47A 2Q3MA 2WM2A 1HFKA 1K98A 2PPLA 3TKYA 1T36B 5IF3A 1YZ6A 3LECA 3RV3A 3W4IA 1KI7A 2IUTA 4EG5A 5JANA 1CZUA 3N5CA 1EVLA 2Z4RA 3UAVA 4EJSA 1F8XA 3P45A 2X13A 4XSGA 1P77A 2IYUA 3HVHA 3WNVA 2DUNA 2XCLA 3LVRE 4NMMA 4FN5A 5TQ2B 2QAIA 3LY9A 3TJRA 1RYZA 5DHSA 4FFMA 1ZQWA 4ZOLF 1WUHS 4EPVA 4NESA 5IK2D 1VB5A 4RM2A 1OQAA 3C1ZA 2GERA 3GUHA 4R63A 2M2IA 2C07A 4JI3B 4B6EA 3RVMA 3RJHA 3UWOA 4UC0A 3GZ4A 3N3BC 4W9NA 3T1TA 4MWGA 2KZMA 2JZCA 1ZPDA 4YV7A 3DLBA 2HPVA 3ASYA 1K2VN 2WMOB 1TZMA 3F6CA 4X65B 1H5QA 5MN6A 1TJNA 1N4DA 1KSJA 2AVNA 4XVCA 3H3FA 4GBED 3QKRB 5ALMA 1T3QA 4FFNA 4KIJA 1YQEA 4OI0A 3NEJA 4DLGA 2O6LA 3HN2A 3M5DA 2OK7A 3OSPA 1X92A 3BZKA 5EUCA 4GPAA 5IDXA 3IL2A 4M3NA 3GEIA 1INLA 1XCJA 3GLIA 2QRGA 4EPYA 1NW8A 1HSZA 3F5EA 1EFTA 3COYA 1KVRA 1Q19A 2ADOA 1DGQA 4GQIA 2ZEJA 4WOPA 3C41J 4Y2SA 5JQGB 2WF9A 1ULBA 1NJ5A 4TTVA 4EYGA 1CUYA 1QB8A 5JBIA 4I2FA 3L02A 3VPAA 1PWEA 5IYZF 4RIEA 1Z0UA 4YI3A 1H3FA 4Z5XA 3L7LA 3Q41A 4DCOA 1KSGA 3FSEA 3G1WA 4QULA 4X1IB 1T9CA 4W5TA 2D0OB 4IHAA 3FFXA 3AGPA 3NEPX 5B7QA 2AUMA 2R1VA 4LXQA 3LVQE 4Q1EA 2QS9A 2H4JA 1FP4B 5K2OA 2V58A 5K0TA 4RX1A 3U5ZB 1ZWLA 4IUCS 4QIHA 1S2DA 1AKEA 1DGSA 4X9XA 5ESWA 2GN1A 2HM7A 3T12A 1UKYA 3V6JA 1L7QA 3ROPA 1ZJYA 3V2GA 1VZ2A 4UCFA 3JPOA 1VYTA 4YD1A 1SPB