4F7CB

Crystal structure of bovine cd1d with bound c12-di-sulfatide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD1D antigen, d polypeptide
publication title Crystal Structures of Bovine CD1d Reveal Altered αGalCer Presentation and a Restricted A' Pocket Unable to Bind Long-Chain Glycolipids.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 12
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f7cB00
3AREC 3QDJB 4ZUWB 4KMQA 2NXZC 1AD9A 5F7DB 3IDXL 3KLDA 3PHSA 4KK8C 1MWAH 1WBYA 4L8BA 5TF1L 3DLQR 3CSGA 4JR9L 4MAUL 5IEKA 5MHSE 1JZ6A 4I0PA 2AJZB 4KGLA 4U6YA 2OQJA 3EIFA 2DTML 4GSDL 2EXYD 1CYGA 3P73B 1NGWB 1IGCL 2BK8A 4WFFD 1RJCA 4F33A 4TNVF 2Y7QA 4TVPH 1KLUB 5T1KD 5KVDL 1WTLA 4PV9B 5DTFA 2ZUWA 2HFGL 2GFBA 3NCCB 1EO5A 1RVFH 1QSEB 1J0JA 1T7YA 4PG9B 3S6CA 1OAKL 4JRYA 4LCIH 2FB4L 3TBVB 1A6WL 1P9MC 2OS7A 5MENE 4X5WA 5EOCJ 4BH7B 5KS9E 3S96B 2ICCA 2YC1B 4MD4A 3VDCA 4X4XA 1W72A 3H3PH 4KMTL 5SWQB 3VXSB 2A83A 4G5ZH 4WV1B 4BQ8A 4LDLB 5I1DB 4CW1B 1I3RA 1ED3B 4XB8A 3U6RA 5KBNC 3U7WH 4KRPD 5CEZD 3I9GH 3V5DB 3QIWA 4M5YH 4B53A 4U1JA 5FCUL 1SY6L 3OR6B 5I16B 3MCLL 4QHLA 3V5KB 3VFMB 4KHXL 1OSZA 4JN1L 4K71B 2XQYG 1Q9OA 1QFUL 3W2DL 1FYHB 5DK3A 3R1GL 2VDQH 4NWTL 3HZVB 3LKNB 4RMWA 1G9MH 1U8LB 1LO4H 1L7IH 1D9KA 3ILQD 3L3JB 1CQKA 1H3GA 1SEQL 1UENA 2SEBA 4OT1H 4WJ5B 5D7SL 5EZIL 2UVEA 1XR9B 4OZ4A 1IMHC 3K8KA 4KMLB 4PJ7F 1YEHH 2C3VB 5CSZB 3T65A 3P4MB 4MJIA 4NDMB 1G7MA 2DTSA 2YBRB 3CAFA 1KF9B 1OAUH 3VMOA 1T04B 2W9EL 4QTIH 3BZEB 3KPRA 5C09B 1MELA 1ZLVK 5J06A 2BMKB 3LV3B 5KZCD 4EI6B 4FN0A 4X98A 1QNZL 1FFRA 1MLCB 5DRWA 5L2JA 3CFEB 2I07A 1TVHB 4O51A 1BOGB 2RBLA 1FPTH 3U4AA 3HR5B 1JMXA 3QEUB 4FFYH 5IVXB 2AP2A 1RMFL 3HCVB 3C60B 1Y6NR 4JB9H 2ERJC 3AS2A 3G6JF 3N85H 2EO9A 3U36A 2ZUQB 4HKBA 2EE9A 4ZO6A 4YDVB 1QACA 2Z31A 4WRLA 1PG7X 4WW2B 5D8JL 3MRCA 5DVOA 4N0CD 2VLME 5ACMA 1FSKB 5E99H 1IKFH 3JXAA 4Y4FD 3EGSA 4KVCL 3D9AH 4OZIE 3MA7A 2H6PA 5HGBB 1GGBL 3LQZB 1A3LH 3WIFA 2XTJD 4JPVH 1F42A 3OX8A 5IV2B 2ZCKL 5EOTB 2VUYA 3CMGA 3H7BA 3GIZH 5T5NF 1FL6A 1RUMH 4H1LH 4OI7A 1WT5C 1CGXA 4JPWH 4H5SB 3R8BB 4GRLA 2J2ZA 2XWTA 1Q0YH 3NZ8A 3VD4A 3CMOL 1H3PL 3T0WA 4YAQA 4HUVB 1GPOH 3BP6A 3FFCD 4OB5H 3E0GA 4ONHA 1KJVA 5E6ZA 5D96B 2B1AL 3VFWB 5CKGA 3IGAA 3IRZA 3KJ4B 4EXKA 3UTZB 1ZGLA 3BSZH 4P3DB 3U4EA 1V05A 1L6ZA 2WBJC 1LK3H 5INDA 2DIAA 2QBWA 3X3GL 3GRWH 2D7PA 2QSVA 3OJVC 2BHYA 4O5LL 2F8OA 25C8L 5JXAH 2Y72A 1PKQA 1XIWB 4IS6B 3VXQB 1DBAH 4HWEL 2AV7B 5FA3B 1EJOH 3OGOE 4YEEA 5CGMA 1QO3A 1KB5L 1FL3A 1OW0A 2X4NB 4LK4A 1HKLL 4G6JL 3ISWA 4WUUB 3QIUC 3DGGA 1XF3A 3MR9B 1D5ZB 4CNIA 1E4KC 1B4JH 5E56A 2Z35A 1MHEB 3JWDC 3VI3F 3IU3B 3FZUC 3ALPA 4LCWE 3RIFF 4R4FL 1KTLA 4NZUH 5DSCA 1FLRH 4LASL 3G5VA 4HEME 4M6ML 4HC1A 4Q74A 4XHJC 4FQ1H 4JM2F 2DLFH 5IQ9A 5BVPL 1KIPB 1T66C 1NGYA 1B0GB 1NMCC 4Z18A 2EYRB 1QFWM 5DD6A 4PGDA 3QIBC 3QWOB 3S4SA 4NM8L 3RWDA 5CSGA 3LPGA 5T3XD 1QRNA 3F7VB 4RMTA 4R7NB 1KEGH 2YZ1A 5MP6H 4NKOA 2VL5B 4ZOAA 4X6CE 4N5UA 3ALXA 3ZKQD 1EHAA 3ES6B 4FQHA 2X4TA 4Y2DD 3P40A 3CU7A 2PYEB 1KYOJ 5F1OB 2EYTB 1CXIA 4NP4H 3DV6B 2D31B 5IT2L 1RD6A 2AXFA 3N0PB 5F9OL 3VA2C 1FNSL 3KR3H 3PWJA 3VFVB 5ENWA 4JKMA 1X7QA 1ZXQA 4Z7VA 4ZUUB 5IB2A 3WNLA 3K46A 4OZFH 3WCYA 4Q0XL 4K8RC 3KPOB 2Z8SA 1CVRA 3O3DB 1DUZB 5I1EL 3LN5A 2WMPA 4UI2A 5F97E 5BV7L 1CICC 4P23D 2EDHA 2Z9TA 5EU5A 4ZTPL 2UWEA 5BRZB 1NEZA 2HLFD 4K3DH 5C0BB 3U9UB 2IPUK 3ULVE 1LE5B 1IAKB 4FP8L 4PGJA 4IM8A 1MCLA 1Z0MA 5I1JL 3P0YL 3ZE0F 4JQVC 4GG8A 3RL2B 3LN9A 1UB5B 1WCQA 3G5XB 2RCSL 1HH9B 3NIGE 5E1AA 1NC4B 2VDNL 3VXMB 4U7MA 4IHOA 1P53A 4JRXE 3CC5B 1U6AH 4V1DE 2FATL 3T0BA 2PCPB 4ZAKA 3U4BH 5BJTB 3ARFA 5GGTH 5JOFB 1LK2B 4FFVC 4H0HB 2I27N 3RDTA 3STBA 2R9HC 2NX5A 1M7DA 3BH8B 3FB7A 3MCKB 2YN3A 3A67L 3SO5A 2EEBA 1FH5H 5J8OA 4OUUB 1I3UA 1GC1L 1YNLH 2AJSH 4L8SB 4WEUD 1CD9B 3G6DH 3M17B 5F3HB 4YDKH 1VGKB 4ZSOB 2WIIB 4KDTA 2WBWB 2FCBA 5DMIH 3M8OL 4P2QD 3NPSC 1Y6MR 5FUCE 3GMPA 5D1XC 3ME0A 1HWHB 4DUXA 1Q94B 1KXTB 4KKCD 1KT2B 4HBCH 1FV1A 2X05A 2UY7A 5DF0A 3LOWA 4K71C 2MOVA 4OSUL 3S5LG 1DEEA 5IESH 3FHAA 4FQIH 2GJ6D 1MH5A 3GO1H 4URTB 3ARDA 1C5DB 3PGDB 4UILL 2YSSA 4JO1L 2YUVA 5C0JA 2CIIA 1YEDB 3S5LB 1JGDB 4XC3H 5KN5B 5I18L 1I85A 3FO9A 1WZLA 1MWAB 1EK3A 3C5SB 1DN0A 4JAMB 4OFVA 5IOPB 1Q72L 3RWHB 5E2UH 4GUPB 1DSFL 2IFFH 2MMXA 4Y5XA 2F5BL 3IS1X 1JI1A 3IDYB 3VXRA 5D7IF 5E1HB 3RWEA 5I30H 4P3CH 2BVYA 5F6IB 1LO0H 2VLLB 2IJ0C 3TWCL 1J0YA 2Y6SC 1T0MB 5D6DA 3EYFA 5D7LA 3HR6A 2AJUL 2E6JA 3GSNH 4Y1AA 2X4QA 3DTXA 4OD2A 2P5WA 1WITA 4XRCA 3QULA 3HTLX 4HKJA 2O5YL 4Z7OF 1RHFA 4GW1B 1QFOA 1GZPA 3V0VA 2ZUQC 5M94B 1FIEA 3OKEB 3JWOH 1JNJA 4WW2C 2VXTH 4P46B 1AXIB 2OR9L 4F7PB 1MCEA 3BP5B 4C4KO 5TE7L 2H41A 1MOEA 5FOBB 5E4IA 3FQUB 1A1NA 5BS0B 2BXYA 1U42A 2R2EB 1CR9L 3G6AB 5ICXA 3F12A 1E4XH 2P47B 2NY6B 5LWYL 1BBDH 3PDOA 4L4VD 4AL8H 3TO4D 1CLZL 2DM3A 3TA3D 4OCRH 3GBNH 5KSAC 2W65B 3MLVH 4E41D 1J0ZA 1IEAA 3WHE0 3P4NA 3U0TB 1F3DJ 4HIHA 1J1XL 4BZ2L 1IKNA 2H2SC 3OAYK 1UVQA 2VSDA 1NFDB 4F2MA 5HYQA 3RBSA 5BO1L 4KAQL 1DVFB 3MJ6A 4PV8A 2R0KH 2D7QA 1J1OL 3VCLA 3TO2A 2BP3A 2W60A 2O5ZH 5E6IA 5JO5B 1I3GL 3TBYA 4YHNB 4O9HL 5E95B 3C08H 5F1NB 1X6NA 4G42B 4PLKC 3MOBL 1QPXA 4HJ0D 3VGEA 1A9BB 1F4YL 2R8SL 3O3AB 5EN2A 4I9WD 1I1RA 2NX5D 3PV7A 2JCCB 3FJTA 5HHOB 4YXLL 2FO4B 2P8PA 3D0LA 3E6HB 3C5JA 1F02I 4Z95L 1RZKC 5D7KE 5CGYD 3MC0A 5EBMB 3H2WA 5IFJB 2E3VA 4YX2L 4GLRH 3ROOB 4EIGB 1P1ZB 2P5ED 2HH0L 3RUGB 3OMZA 4PTTA 2VJXA 4LHUA 2P4AB 1DLFL 5I19L 4K7PX 1I1FA 1KCSH 2NZ9D 5TFSH 5GRYA 2EEDA 3GNMH 2J1KA 2WWMC 4ZUTA 3HB3C 1IC4L 3TEUA 1F2QA 3DSFL 3G5YB 2X4OA 4H1LG 5T1DL 2GY5A 5HHMD 4HV8B 4LAQL 2IADB 3O2WL 2IPTL 1JWUB 1BM3L 4X9FA 5ISZA 1ZVSB 1T1XA 2EIDA 3CJJA 3KPSA 4C83A 2FHBA 4H1LB 5KSBA 5C86A 3JV4A 1DBBH 5HYEA 3TYFA 3Q3GB 3B2VH 4Z7WA 4BELD 4XAWH 3LIZH 5INCB 4XMPL 1R3LB 2VR4A 3GHBH 3UTTE 5C9JB 3WUWB 3STZB 4TSAH 3B9AA 3P4OB 2XZAL 2DQJL 1NBZB 2F58L 4O2FA 4CJ1A 1WT5A 2ZG1A 1KJ2A 3ARED 2H26B 1VHPA 3DIFA 4P57A 4CU6A 4JY4B 4JFXA 1ES0B 4M1CC 3VE0B 4KK8D 5HHQA 1FGNH 4H25B 3B5GA 1E6OL 5GGQL 3MGAA 2D7NA 3MLWH 4OCNC 1U8IB 4DVRH 1WCBB 4UQ2A 3IDMB 4MD0A 3AU1A 2APVA 5C0RL 4N90D 3QUMH 3BVNA 3I75A 5EO0A 4UU9B 1MFDH 2V5TA 2C4FU 1OAZL 4PREB 2OMBA 4PRPE 3QEHA 3OKMA 2OTWA 2VLJA 3CFBA 4BQCA 4XVJL 4N8PA 3BO8B 3QHFL 2VUOA 4M8VA 3R06B 4X9IA 4RNRB 2HAZA 4G6KL 2JIXB 3QUXA 3U83A 5DMJB 3Q6GL 3ULSB 3BMVA 1YMMA 1BVLB 2G5BB 5HXMA 1NL0H 3IFOA 1TNNA 2AK1H 4R90L 3BDYL 1FFOA 3KPLA 2DS4A 1E4KA 5C6TL 4MQSB 3TFKD 1HCFX 3WIHH 2DQTL 1MFNA 2IG2H 1D6EB 3CNKA 1CF8H 5LVEA 1WAAA 3ZKSD 1OB1A 1P4BL 4OUOA 3O41A 3HRZB 5LAXA 3W81A 2EKSA 5EFIA 4MMZC 5IK3A 3DXAA 1A5FH 1X5HA 2R1XA 5DC0A 2NY7L 3O0RL 4L3ED 4IRSB 4OIAA 4U0RB 3HMXA 1J8HD 4PJBE 2QHLA 1YEEH 1MREL 2NPLX 4WWID 4Q9CA 4IOIA 3V5HB 4YBLB 1C08A 4GT7A 2DQUL 2OK0H 4R2GC 4ELKA 1GVIA 4NZDA 1QEWB 1XGTA 3HC4L 1FNFA 5E7BA 5BCAA 5C2UB 3BQUA 5DT1H 1H5BC 3DROA 3VXME 1D5XA 4Z7NE 4RRPA 1FYTB 4JM4L 1AH1A 2BRRL 3OKNA 1B3JA 2HRPH 3TIDB 4PJEE 3S37H 4NYLB 3B4NA 3UC0H 1ZHNB 2N7BA 4OD3H 1CFQA 1AGEB 4JGMA 4ELMA 2F9BT 2AERT 4K94H 3MZGB 1JZ5A 1VKXA 1AQDA 5DVKA 4XBPB 4U1HB 4UOJA 3T4AA 1CL7L 1XZ0A 4WW1A 3RU8H 5FYJD 5IROC 4JFPA 4OLVL 3FRPA 3WBDA 3C2AH 3QDMD 1RZFL 1FZOB 4JKLA 5EIIA 5M7QA 3GKZA 3HNVL 1OTUC 4PB0L 1I4FB 4G8EB 4AT6B 3QPXL 1HHIB 4QCIA 1N6UA 1BX2B 1YECL 4W81A 4O2EB 3RWJA 4XP5H 4FQXB 4IIQA 5I74B 3QWRD 1LD9A 4OLYH 4XPBL 5DHYA 4UNUA 2XWJA 4CMMA 2V17L 1TMCB 5F6IC 2QR0B 5D1ZA 1J1PH 4RAUB 2P48B 1ZAGA 2Y5TB 3HG1B 1F8TH 4KRMB 4ZFFA 1FZJB 2LU4A 4EI5C 5I76A 1YQ2A 4PUBL 3LN4B 2XRAH 2O5XH 2P24A 1MAML 3V79C 3O3BB 3PQYD 4P3WA 4R4NC 3FT3B 3AAZA 5MEQA 1OY3B 3TJEH 1DUYB 3F65A 4JFFB 1J05B 5J12B 4F80A 3NFPB 1A7OL 3I2CL 1VPOH 4I18C 5DRXB 4CVXB 1RHHB 3BAEH 5KS9F 3T8XB 4ZFOA 4E42A 5D7JC 2FGZA 2WBJD 2FZ3A 2OSLB 3IU4L 4KROB 1C5BH 1YEIH 4S10A 1DZBA 1YDPA 2I9LB 4ENEC 4XMKH 1YEGL 1NCAL 1IFHH 1S78C 5IQ7H 5D1QB 1EZVX 3L5JA 3OF6A 5DRNB 3GGWA 3MRKA 1RZ7L 5FM4A 1OAYL 1VFBA 4PJIA 5IP4A 1CU4L 1O7VA 1G9MC 5I1GL 2CDEA 4CADB 5FUZH 5FUOL 3I3DA 4MWFB 5HHVL 3VGAB 3IFPB 1BQLL 2YWYA 5JDJA 5HYJE 4RMSA 3QIUD 1J9CT 2FJGB 5DD3H 1YEKL 2CLZB 4ZXBA 2JJTC 1BD2A 1P4IL 2WUBL 4PJ7A 1T1YB 5E2TL 4CVZB 3FZUD 4AH2A 1UXSB 1WSST 4OQTA 1EFXB 1R3IH 4WI5A 5DS8A 1BGXH 4KTDH 4LLAA 1MY7A 3QRFM 3UJIH 4RFNB 4LVHB 4XHJD 3QRGH 4CDGC 3GSNB 3QNZA 1KBGH 1T66D 1HHJA 5FA4B 5D71H 3QXDA 1RZIB 5CCKL 5A3IC 3TYGL 5H35B 3QIBD 4YBQD 2DWDB 3GB7A 3LD8B 4MSWA 2V5RA 1ORQA 4X8XA 4YK4C 3ULUH 4JY5H 2GUOA 4Q9RL 4M7LH 3ARGA 4PGCA 3G6JA 4HWZB 3FMGL 3MUY1 3C6LA 1AXSA 1GOGA 4XVUC 5C0IB 3FB8B 5ALBL 4HIXH 5EO9A 3LSOB 2F74A 1SEBA 5L2KA 1MFEH 4EBQL 5TH2A 2R4SL 4JDZB 1U58A 1TVBA 1CFVL 5D72H 5DJXB 2QTEA 5SX5K 3KYNA 4DGYL 5C08B 2B0SL 2JCCE 2DOCA 4U6HB 3GSXA 4S1QH 4K8RD 5HTSA 5JW4M 1OPGH 3RVWC 1HINL 2DDQH 1TXKA 3HAEH 4HHAA 1DL7L 3K2UH 3KDMA 4Z5RB 5C7XL 3D18B 4L29B 4MNQE 4OZIF 3F8UB 5F93C 3K8LA 3PABA 3ZE2E 1CICD 4JKPH 4X8JB 5JR1L 2Y5EA 4RFOH 2OL3L 5IJVA 5FO8A 4PB9L 2VZ1A 2BCKA 1HQ4B 2BSTB 4KK9C 1R3HB 2GK0A 5IBUG 3PP3H 4GW4A 4F7TB 3QDJD 4XWGL 3MJGX 4XMLL 1AHWA 1B4RA 3BIKA 2ATKA 3PL6B 5DUBA 1TJGL 2BHZA 1U8MA 1G84A 4WFGD 3A0OA 4JQXC 2JTDA 4XCYA 2XNAA 2JELH 5FHBL 4R7DB 3D3VB 4OF7A 3O6FB 2KUTA 2VQTA 4XX1E 4UT6H 2F54E 3WLWC 4NJAL 3O6LH 4BSWA 3SDXB 3D2UA 2DYPA 1IGIL 2YKLH 2HKFH 5JORB 3GIVA 3AMKA 2MCPL 2GTZA 3MGTB 3CSYB 3RI5K 4FFVD 3TZVC 1GOFA 3BGFB 1QSED 3WNMA 4QXWA 3S36H 4F8TA 4U6VH 2ESVB 3BGAA 3O8XC 3IJYA 2R69H 8FABB 4N0UA 3WO4B 2B4CL 3DBXA 2YOCA 4WDIB 1WBXB 3O3EA 4PJGB 3H9HB 2ZPKH 5GGVY 1OARH 1PEWA 1V3KA 1D6VH 3GMOA 3MSPA 4FQPA 3K2MC 1U93A 1V7NL 5ITFB 2JK5A 4LP5A 2K7PA 2HG5A 4HH9A 5D1XD 4BZ1H 4JM2A 3VRIB 1N0XL 4G9FD 4D0DA 3OGCA 2IANB 2HJKA 4QOKA 4ORGB 4MB5A 3S34H 2EZ0C 4RQQA 2DQIH 5D2LB 2YPVH 3BW9A 3IXTA 1MCCA 1CBVH 3TF7C 1NJ9B 2FSEA 2BNRE 5CJOH 2N56A 3GJFH 4U49A 4P2RA 5DMKA 4BZYA 1R5IB 5EU6B 5IIEA 3QEQA 1PZ5B 2DL9A 4B41A 4ZMAT 2ENSA 1WC7A 1PKOA 2YRPA 4TNWK 3WD5H 4OLXH 4M6AA 2VXQL 1B2WL 4EQ2A 2Y25A 3R4DA 3LB6C 1NBYA 4K2UH 1I1AB 4YO0A 1BP3B 4JO4L 5AEAA 3VXTA 4GO6B 5JW3H 4DEPC 1S7UA 4I77H 3QUMB 1YNKL 3T0XA 3L7EB 2D0GA 3MLRL 1TIUA 5C09D 4P2OC 1E4XI 2HKHH 4UT9H 4JREB 1U0QA 4JZOA 3MJ7B 3QFDA 2OJZH 1VGEL 2Y6SD 4Z0XB 2DWEA 5LXGH 3T0DA 1A7BA 4L4TB 2FL5A 3MNVB 4ESKA 1LP9A 1NDMA 1LO5A 3PV6A 3EO9L 2X4UB 3I6KA 5J6GB 3C60D 1KJ3L 1PYWA 5E94B 3L6FA 4LSRL 4DN3L 3JTTB 5EWIL 4XCNA 4L8CB 4OIIL 3HE7B 3I6LD 4FFZL 4TUKH 5I74C 2Z4QB 2V9QA 1R3JA 5EUKB 3ULVF 1P5VA 5E9DA 1PSKL 2ORBL 3TT1H 2A2QT 4EDWH 3G9AB 4XVSH 2R0ZL 1CE6B 4LLQA 3U2SB 5BXFA 2ZSVA 2XN9B 5I9QC 4Q6IA 3NIGF 4ZOCA 3X13A 2YWZA 3ZTJH 4FTVD 4PRHA 1TTUA 5EH1A 5KSAD 1TQCB 4OD1H 1YYML 2UZIH 4U2YA 4GLRI 3JTSA 4U1KB 3V7MA 5A43C 2Q8AL 3MUJA 3CCHB 1U3ZA 2R56H 3L5XH 2A1WL 2H2SD 4XP9L 5GSVA 4NO0A 5KANG 4DZBA 3EO1A 5C0DB 1XGPA 1AGDA 2GQHA 2NY2C 3VXUE 5E8NA 1JUFB 2G9HA 4NWUH 4GG6E 3BPOB 2VDRH 2A9MH 2RR3A 3SQOH 5HJ3B 4X6DE 4MX7A 4U1GC 4R0LA 4DGIH 5TDPA 5EU7E 1X5YA 1H5BA 4PLKD 1H8SA 3OZ9H 4G3YH 3MV7A 1F3JB 1GZQA 2VXUH 5D1QC 3UDWC 3FQRB 1UCBL 3ECBB 3IJHB 3PF2A 3DRQA 1LEIA 3BIBX 1YY8B 5JHLL 1JHLH 2EDFA 2VH5L 3F62A 3CX2A 4WTZA 4QXUL 4M03A 3VMNA 4EQ3A 3MNWB 2PXYB 2Q7YB 3V4VH 3VGAC 3U0PB 3SGKC 2R0LH 4WUUD 1ZLSH 2FEEI 3D85A 4MZ3A 1TZHB 5CSBA 4KJQC 15C8H 1UXWB 3GHEH 1RQ5A 4X4ZA 3SE8H 3G04B 4FNLH 4RGMB 3GMNA 2WWMD 1KELH 2CUHA 5FK9B 3HB3D 1IGMH 1WBZA 4NUGL 1KYOK 2XYCA 1LDPH 3TBWB 4AQ1B 5KW9L 2GSIA 5FYJU 1TITA 1IC7L 2BSRB 3VGBA 1CGYA 1TCRB 4B5EA 1PG7W 5DWUL 4NGHH 5EZOL 4MA8L 2FHFA 3GI8L 1GAFH 4Z77B 3MO1B 1IJ9A 2AABL 4GXVL 1J86A 3ZZ1A 2IQ9L 3FQWB 5EORH 3LD8C 1LEKA 5CEZL 3HZYB 3CUPA 4JFEA 1OCWH 1FCGA 3QI9C 4MAYA 4MQTB 4G80B 4WI7A 2APXA 2A9NH 2IAMB 1A3RL 4CN1A 2ZCLL 1X5AA 3S35L 4XTRC 4JO2H 4EI5A 4PTUA 1SYSA 3JWOC 3DRTA 4APQC 1Y0LB 3MOQA 4PJXB 4NC0B 5ALCL 4YHKH 1MHPL 3WXWH 1RUAH 5ADOL 4M1CD 3C8KB 5FKAA 3KWWB 4R96B 1U95B 1ZSDB 1FO0L 3BUTA 2BNQB 4HF5L 4L9LC 1FVEA 2H8PA 1T4KA 1KCRL 5DC9B 3EOTH 1AO7A 3VD7A 1E27B 1AQKL 1MUJB 1ACYL 1ZVHA 3DI3B 1TJIH 43C9A 1N59A 3IXAA 4HQQL 1CQYA 2E27L 1UKSA 1C7TA 5D7JA 5I1IH 4UIMA 3RGVB 1NQBA 2P43B 3L3KB 4HUWB 2DQFA 2CMRL 3BD4A 4NNXB 3IYLW 1FDLH 1FIGH 3WJLC 4ODTL 5GS1C 4UQ3B 1KCUL 4LOUC 5BRZD 3VG9B 2VDKL 3ZL4L 5C0BD 4Y16B 3V4PH 2LTQB 3N9GL 3SDDB 3D5OF 2WIMA 2E7BA 4HLJA 4NZJA 2Y07L 1S7SA 3ARSA 5J56B 3MLUH 4LBEA 3IAGC 3PL6C 5TPWH 3H9SB 3EHBD 3CVIL 3IAPA 1ETZA 4DUWA 3O6FC 1NBQA 4JZJB 2VKWA 1RIVL 1NC4D 3BKYH 2V2TB 3D25B 3X14A 2YUWA 3B9KA 4YHZH 1S7VA 3DI2B 3DMMA 4KQ3L 3L5WA 3L7FB 2CJUH 3QAZB 2X40A 3PWVA 3EBAA 3KPQB 1HHGB 1NC2A 4WUKH 4HMDA 1N5YL 3IETA 4WWKC 2VAAA 3PWPA 1T83C 4MJ6B 4LSSL 2H9GB 5JIIA 5B8CB 5DVNA 1H0DA 4FZEH 2APWA 1G7JB 1OGAD 4AYFA 2D4DA 4RX4A 1FG9C 4R2GD 1MI5A 2XG5A 1L0XA 3NACL 1XF4B 2EYSA 3ARQA 1MJ8L 1H3VA 2W92A 3A6CL 4J1UB 5C0AA 3HAEG 5DURB 4DW2H 3P9MA 3AC0A 2X1OA 3FO1A 3SDXE 1SMAA 5CWSA 1K6QH 4LU5L 4TNVK 3NBNA 1DBJH 3GSVB 3WFDL 1S7QA 3NFSH 3W5NA 5IJKA 4YFLF 1I8IB 3HAEB 2G2RA 4BSVB 1II4E 4J8RB 4WU7B 4KKAC 3OQ3B 32C2A 4M1GL 4M00A 5LGHL 3V6FA 3QO0A 1LE9A 1U8HB 1B9ZA 3EYVA 1K8IB 3QQ3B 1BBJA 4BK4A 2MHAB 3QBTB 2ZOKB 5CBEA 4LLWB 4YDJA 4PJGE 5FYLH 4H0GA 3KLAA 2MFNA 1KNOA 4W68A 3TNNA 3W0WA 3MJ8B 3NN8B 1U8PB 1QSFD 5L6YL 4YHPB 3WJJC 1CCZA 3QEGL 4NRZA 4PR5A 1I7UB 3KYKH 1IT9L 4Y5VB 4XPHH 5HBBA 1IC5H 4FQQA 4PJ9C 2AXJA 3D39E 4TVPD 3EOAB 4KDVA 1S9YA 4X7TA 5IFAH 3MRGA 4HUXB 4MA3A 3O9WA 5CIPH 4LLDA 4EI5D 5DUMH 5HYSA 1OT2A 5K33A 4B7IA 2ZUXA 2AS5M 2I5YL 2R2HA 3LPWA 1N5AB 4NT6B 5FECB 5EOQL 1HH6B 3P77B 4GAFB 1ZV5A 3BGMA 4R4ND 3TZVA 1BF2A 2XQYK 3QHZL 1P7QB 1RUQH 4M8QA 5T3XL 1X5IA 1JHTB 3A6BH 3E2HC 4ODVL 5GGVH 3HE7C 4P46D 5GISL 2J4WL 4FQ2L 2VLRE 3SO3C 2R2BA 2JJSA 2R4RH 3RTQC 4UINL 5BS0D 3MA9H 2LV4A 4ENED 3BRGC 4DN4H 1LGVA 3FO2A 1RK1B 3UX9B 4MD5B 1JZ4A 3VH8A 1GL4B 3GJFB 1GRWA 4X7SL 5F88A 4I13B 4FFWC 4Z7QE 5JIKA 1E4WH 3P11L 1FBIH 1TQCC 4QKXB 4GKOA 3H3KA 5D5ME 1Q1JH 1AIFB 3UZEA 2B7DT 2R39A 2Q86B 4XH2A 4NHCL 2ADJB 2X9YA 3MRPB 3MRLA 1JPGB 1ZT7B 2CKBL 1EBPA 4PJBF 3E3QE 5BZWB 4OM1H 1IM9D 3BPOC 2ADFL 4YFLI 3LEYH 3RY6C 1RULH 5C9KA 5JHDE 1BWMA 3SDYL 3L95A 3CPLA 2DLHA 5F96L 4K94C 4OZHF 1K2DB 1S5HA 3HZMB 1FVCA 1NC2D 3JV0A 2EH8L 4DQOH 2DAVA 4Z7NF 3MRMB 4ZDHA 1T2QH 3QJFA 3LH2L 4HX1B 5HHOD 2E9BA 4PJEF 4HFWA 5A3ID 4P2OA 1WEJL 4JEGB 1WK0A 2Q6WA 2A6IB 1H15B 4XCEB 5IB1A 1OGTA 1AP2B 5JOEA 1IM3B 3MACL 3FOLA 4I48A 3TGXA 3L3DA 2FECI 1HIML 1HKFA 4UDTB 4Z0BL 4UV4H 3EYQC 1KULA 1NMAL 3HLAA 4ISVA 4ZUSB 1RIHH 3KS0H 2VN4A 1G7HA 4QHMB 5HHNB 3B2UC 3ZTJG 1BF8A 3KPNA 3QXAA 4TRPL 3RBGA 5T1MA 3OR7B 2VB5A 1WICA 4LSVH 4KV5E 1W0WA 5E08L 4HS3B 4BJLA 1RY7B 3RVWD 3L3OB 1HK6A 5EPMA 1N64H 1Z9SA 1LDSA 2G60L 4JGJA 1U8KA 3QCUL 1MFCL 3CDGA 3RY4A 1OSPL 5FEBA 4RGOL 4EUPA 4PRIE 4LSPL 4OF0A 2IAMC 2R0WL 5JW4R 3S37X 4MCYB 4AIOA 5BVJB 1G6RH 1CXLA 2J12B 4KK9D 1I9RH 4QTHA 4LSTH 5ESQB 4XXDB 4P5TA 2CDGB 1YNTB 4YHLH 5L88L 3PHQB 5MENA 2PO6A 4BFEA 4KKLC 4KTEH 4Y4HB 4OCYH 3UMTA 5FXCH 1N6QL 2X4SB 3NVQA 3HPJB 1CGWA 3UPRA 3RVVC 3RX5A 5CEXB 4U6XB 4EXPX 4XPFL 2J8UB 3TVMB 1UZ8A 4U2ZA 1XF2A 4M93B 1KTKE 4MHHI 3CFDA 1IAOA 4OLZH 4JZNA 5KAQG 3I02B 3MYJA 1S3KH 4YGVA 4M7JL 3T09A 4U1IA 3NZHH 2WBKA 4Y16C 4L8DA 3O8XD 3WIIH 2GHWB 4JFQB 3LKQA 1UM4L 1F6AB 1MCNA 5F70A 5KVEH 2OZ4A 5SWSA 5FKPA 2WUCH 3U0WH 1F4XL 5TGBB 5SWZD 4LFHD 3BP7A 4PP2A 4HPOH 4NQDE 4NFDA 1ODAA 1PX4A 4JZJC 4ZNEE 1WQVT 1BZ7A 3HUJB 4S11A 5CLWA 5GRWA 3FTGA 1Z9OA 2P8MB 3MMEA 4KU1A 4JFOA 1EPFA 3BEVB 1DQMH 3ULUC 2DQGL 4D3CL 1PQZB 3BPLB 2Y36H 2B20A 1LNUA 1QLFA 4PG2A 4IRSD 5B8CC 5KVGL 4EN3A 1YEFH 3VGFA 5FYKU 2DQEL 1HILB 3TCLB 4MNHA 3P9LA 3VFGH 1MJ7L 3QQ4A 3QI9A 4YDIH 3T2PA 4CUCA 4NBXB 1AJ7H 1H3PH 3STLA 3T04D 2I9TB 1UM5L 3IKKA 5AAMA 4ETYA 2P44B 4APQA 2WQ8A 5A16A 4P9HH 2IH1A 3PWUA 1BZQK 2YPLE 1MRFH 1FN4B 5DLMH 1NCBL 5HGDA 4NQXA 3OHXB 3S88H 1JGEB 3ROLA 4JO3L 4OZIA 5C07B 3THMH 4TULL 4DTGH 1Y6KR 1P4LA 4L1DA 2V2XA 1CLCA 5ID0A 1CGUA 3MV9E 4KZEH 3BEWA 2YMXH 5MI0C 5CD3B 4P4KA 3KYAA 1UACH 5I75B 3HE6B 1U8QA 4DKEL 5C0CB 2CO7B 3JWNC 3ZE2F 5AWNH 3QG6A 4U1SA 2YEZB 1C12B 1IGTA 1MJJA 4UIKL 4FQXD 4ZYKA 2EDKA 4HIJB 3MJ9L 2RFXA 1FZKB 4NKMB 1G9NC 5IW1B 3B8YA 3QFJB 2A6KA 5GJTH 1W72H 3MV8E 5DJ0B 3NCJH 3HG1D 1KJMA 2A0LD 3BDBA 2F53B 3MOAL 3SJVA 3LKSB 1Q9WB 1ZHKB 1PLGL 4U1LB 3VFPA 3HI1A 3ETBF 4Y2OA 4HKZA 2E7CA 3QZWA 4NQCB 3BD5A 4LNRB 3Q0HA 5FV2A 3VFUA 3LHPL 5GXBB 2CLVA 3DARA 4YHIB 3RAJH 1ND0B 1GOHA 1Z9LA 4NZRH 3EFDL 5DJCA 5LQBL 5IT2H 4Y4KA 4RGNE 5J4MA 5IKCB 1BOYA 5DA0B 1QA9B 4LCWA 2D7MA 1T2JA 1NSNL 3HC3H 5I1KH 1B90A 1DTUA 5D1QD 1N2RA 4NQUA 2C1PA 4JFYB 4S1SH 4M3JA 1D5BA 1UA6H 4ZG1A 4JHAH 2HVKB 2PR4H 4XGZA 2DBJA 3T1FB 1MRDH 3WEXB 4O00A 5GGRA 1NANH 3P0GB 1T7WA 1MCFA 3LRSB 4XBGB 2VRAA 1A9EB 4P5MB 4OJFH 1N8ZB 2WSKA 4ZTPH 5DEGA 3OB0H 4HXAL 5EDXA 3QJHB 1UB6B 4OLWH 4QRRB 1RAMA 2HLAA 2R15A 4X6CA 2DIBA 1KFAH 2A6DA 4KJQD 4P4RA 5D93C 5BQ7A 2XZQL 1OTSC 5J57B 5JXED 4AG4H 4X4YA 4C56E 4FZ8L 4PYGA 3P0YH 4RZCA 4UUJA 2X1PA 3S36X 3JSSA 3BWUC 4GRMA 1XGUB 1OP9A 1F3RB 3PGCA 4PJCB 4A6YL 3DYOA 2FJFA 5CIPB 4GXUN 4L4JA 2B5IB 4D9RE 3BMWA 1XFPA 2NY4B 3QDGA 1ZT1B 3RWCB 1WV7T 4PJ9A 4RWHA 4J4PC 4WIQA 2IQAB 4HK0A 3QI9D 5IHZB 4G7VH 4ZOEA 5K9JH 3UTSA 1IL1A 4XTRD 3PWLB 3V6BR 4PJHE 2BJML 4I2XB 3NA9H 1CZ8L 1BIIB 12E8H 5CAYB 1XH3A 2IPUG 2VDMH 5GIRA 4M7KH 2HVJB 2WNGA 2VSCA 1ZHBB 2N4IA 2ZUTA 3AY4C 1GGYA 3U48A 1RZ8A 4NQVB 4JFDE 5C08D 4QRTA 3RL1A 4AMKH 1T7ZA 1PBYA 2PW2B 1MQKL 1P5UA 3SDCA 2OJEB 4FXGB 1AI1H 5EUOA 3RTQA 3NAAL 3MRJA 4V1DA 4M7ZB 4Y8DC 3SKJH 3V6ZA 3RFZC 1DE4A 3U46A 1KN2H 4PRNA 5DZNA 5JPMA 1CGSL 2H32A 3RX7A 4I5BA 3CVHA 4UILH 1U2CA 2QKIA 1Z3GL 3QXTA 5KJRL 1S9XA 2H2PC 1N3NA 2AK4B 1JNNL 3T0EE 1QKZL 2V5SA 3PL6D 1WF5A 5D70L 4U6TA 4L5FH 1KPRB 1EEZA 4Y4HC 3O6FD 1B0RB 1A6VH 4BQBA 1QFWH 2Z8RA 4M48L 4HDIB 4GG6F 3SBWC 3RY6A 4X6DF 2OP4L 3MXVL 5E00B 5KSVB 1KCVL 1EGJA 2DIJA 3OKLB 1NLBH 2B8OT 5IHLB 1KLUA 2AJUH 4PV9A 2B39A 4HC1H 4WWKD 2HWZH 1Y18B 4XNXL 4LLVB 4N0RA 1A0QH 1S9WA 2XWBA 5HYFA 3R0MA 2ESVD 2ZUVA 4QRQA 5CHNB 4PG9A 4NKIH 4WY7L 3KPSE 5D2NB 2VLKE 1I7RA 1FL5A 1UQSB 2YC1A 2J3SA 2PNDA 3NGBB 1C16A 1JYVA 4WV1A 1CS6A 1JI2A 4CW1A 5IMOB 2AJVL 2X6MA 3HPLA 4JE4B 4K3EL 4ZQKA 5F1SA 4MJ5B 4CGTA 4M6OH 2A73A 5I71B 3FQNA 4YDLB 3HA0A 2YD6A 3LQAH 3V5DA 2IAND 3TT3H 4NNYB 5I8EA 4LEOB 4J12A 5IB3B 2GCYA 3LEXB 4JPKH 4KKAD 4EDXB 5IG7B 3VFMA 4QHUB 1DQJB 2FO1A 1BAFL 2EO1A 5EU6D 1G6RB 1MCOH 3HZVA 4KRPB 1TZGL 3LKNA 1SYVA 1U2HA 2CD0A 5CBAB 2HN7A 1OD7A 3QDAA 2VOTA 5BO1H 2AJ3B 4H8WH 1U8JA 2BOBA 1A7RL 4AENA 4ODXA 2F15A 5HI3C 3GM8A 2GSGB 1E28A 3P4MA 4FABL 4NDMA 5J7CC 3GJEB 4XPTL 1I3GH 5LBSH 4O9HH 2D7TL 3BZEA 1REIA 4DK3A 4PJFE 2FLRT 1ZLWH 3JWDL 5ERWB 1UWGL 3IDJB 5CUSH 1IGJA 2LAAA 4DOHB 2K9UA 2I60L 2P7TA 4HGMA 4L4TD 4QRPE 4JLRA 4PBWD 1EFQA 1AFVH 1DR9A 1D7FA 5DJ6A 3HR5A 1SBSL 1EX0A 5I75C 1WAAE 5IVXA 1DANT 3HE6C 3HZKB 4O02L 4PJ5B 5JTWA 3F58H 1FFQA 2WP3T 1BEYL 2DN7A 2NW2B 1CLYH 5DRZB 1KLGB 5CILL 3KPMB 1VACB 4GRWB 4WHCA 5ILTH 5IEHA 1S9VB 3HE7D 4Y19E 4BFIB 5C0NC 5I19H 1HYSC 3WXVL 1FFPA 5JLZB 5GHWH 4Q9QL 2QQNH 2KZWA 5CZVL 1ZS8A 3TH3T 1SHMA 4JRXD 3GI9H 4TTDC 4NPYA 4P59H 1AGBB 2GYSA 2FBOJ 5HGBA 1ZANL 1MAKA 1RURH 1DQDL 2XN9D 4KKNA 4LP4A 5CZXC 2Y06L 4FFWD 4KVNL 4JCLA 5ICYA 1XCTA 4BUGA 5DJDB 4ELME 4Y4FB 5EOCH 5FO9B 2W91A 4K8RL 3ZKMC 4H5SA 1JGVH 1A4JB 3RQ3A 2QHRL 3LMJH 3PHOB 3MRIA 2XTJB 3ZYZA 3ZDXE 4LQFH 5T3ZH 1S7WB 2ITCA 1RU9H 3DV4A 4LIQL 4BQ9A 2F58H 1F90L 4MZ2A 1CDUA 1ULVA 3OTTA 5L8KB 2W1NA 2JLLA 4OBRA 1PD6A 2Q87A 1JHKH 2WANA 4KY1H 3H42H 1AD9B 4Z7UE 5T1LD 4XNQB 1WBYB 4L8BB 2YXFA 1I9JH 4WHDA 5IEKB 4I0PB 2OQJB 1MFAL 3VFOB 4LCUA 1XIWA 3VXQA 4NQCE 3HKFA 4PS4L 3VWKC 1KOAA 4JHWH 2LFGA 1FE8L 5DHVA 4F33B 2Y7QB 2YPKB 4HUUA 2H1PL 2VE6A 4WGVB 5F7WC 1G7LB 1WWCA 3EYSL 1XR8B 2EC9T 1MPAH 2DLEA 2GFBB 5I8KH 3UTTA 3MR9A 4JGUA 2APTA 5E8OA 4JRYB 4TPRH 1FORH 1T2XA 1MHEA 4XNZB 3SE3A 4X5WB 4HK3N 4P0DA 3NCMA 3B2UD 3KXFE 3MLYL 2V9RA 4MD4B 3MZTA 4M6NH 1W72B 4X4XB 2A83B 2KL6A 4JQIL 4LRNL 2FLBT 2DD8L 1YJDH 5C70A 1XGQA 3DURB 1JMZA 3U6RB 2X9XA 1KIPA 3GMMA 2NY4C 1K4CA 3PXHA 4QY8A 5I0DA 2Q8BH 5GS3A 3EFFB 3QWOA 4BM7A 4U1JB 3ZHDA 3RIAK 4AEHH 4K9EH 1K9TA 4XP6H 2NY1C 4R97B 4PRPA 1OSZB 3O4LE 5SV3A 2IAMD 1BWWA 2NY7H 1Q9OB 4NQEE 5F9WB 4AIZA 1KC5L 3O2DA 1GGIH 1YYLL 2X4RA 4PJIE 3U1SH 7FABH 2PYEA 4F58L 1A14L 4IDJL 1BZ9A 2DQUH 3UBXI 3SGJC 2LVCA 5H2BB 4OFYA 2FX9L 4KKLD 2SEBB 3B9VA 4QGYA 1YUHA 3VFVA 4PRAA 4LLYA 4MQ7A 3WSQH 2LQRA 4KTYA 5AZ2H 4OZ4B 4YXHL 1T89C 4DKFL 3CFKA 3GMRB 3RVVD 3SKUD 3T65B 4MJIB 1JGLH 4JG1H 2I24N 2DQHL 2X10A 3KPRB 1KGCD 4M7ZC 2DBLH 2XICA 4JDTH 4L3CB 1NCDH 2XV6B 4X98B 1CDJA 4JFHE 3C5ZA 3IJSA 5JNYA 4Y16D 5DRWB 2I07B 4Z7QF 3SDDD 4OGXL 5KOMC 3U9UA 4W4OA 2AI0L 1MNUL 5AG9A 5J1SC 3L5IA 4P2YA 4PJBA 5D5MF 1A64A 2BFVH 3H9SD 4X80H 2AXHA 3F6LA 3F7YA 1HHKA 4K3JH 1MCIA 5DK2B 3G5XA 2Z31B 1HH9A 3QISA 1PFCA 3VXMA 3O4OB 1INEL 3UJJH 5IFHL 1U91A 3MRCB 3RZWA 1RJYA 1HEZB 5K9QG 3ULUD 2FBJH 1FG2A 5D7KD 1LK2A 3MA7B 2H6PB 3UROR 5DEFA 1I8MA 2LABA 3NTCL 1QUNA 3WIFB 3D87B 4FQCL 4UT7H 2GIYA 3KHOA 4S2SA 1A1OA 3OX8B 3AM8A 4Y89A 3ZHLA 3EZJB 4OAWA 4UNVA 5IHUL 4J4PA 2CR6A 1FL6B 1TZIB 3P3YA 1CIUA 2AJYL 4KZDL 4L8SA 4X6EA 3NGBC 1DCLA 2XWTB 5DVMA 3NZ8B 5I8CB 4PJDE 4NHUA 1N4XL 2CGRH 5DURD 3PWNB 3K1KC 4X7CC 3MXWH 4YAQB 2A77L 4X9GA 3M1BA 5I71C 2QADC 3BP6B 4Q2ZA 2GAZA 2Q7NA 3HI5H 4ONHB 1H3UA 1KJ2H 5J3HC 2CUIA 3N06B 3BKMH 5TDNA 5FGBC 1ZGLB 1IGFH 3U4EB 5DD1H 4AIXA 1INQA 3NOIA 4RWYH 5LG1A 4AEIL 4P2QB 4LVEA 1CU4H 1C5DA 1PKQB 3PGDA 1IGYA 4WFFE 4XHQA 3S5LA 5F9DC 3LZFL 2NW3A 4LGPB 5E5UB 1JGDA 1Q9KA 1EEYA 4QXGH 4HZLA 2QSCL 3ARBA 2GJ6B 1X6LA 3RZCC 3DGGB 4CNIB 3T0AA 4PGZA 5I17B 3AROA 3EYUH 2W9DL 2WWKO 4HCRL 3SGDH 1MIMH 1YN7A 2MWCA 3TNMA 2VLLA 1KTLB 4YUEH 5DSCB 2MSPA 1PEZA 3FT4A 3G5VB 4AY0A 5L7XH 3PNWA 1V7ML 4U7SA 1QPPA 3U7AA 1P6FA 5IQ9B 1NANI 2AEQH 4F9LC 2ZCHH 1NGYB 35C8H 3BKCL 4LGRB 4P9ML 5DD6B 4POUB 1JNLH 5CS7A 5C2BH 4R4BA 3HNTL 3RWDB 1U92B 2GT9A 4GW1A 5DUPH 3VFSB 3U9PL 3MLXL 1QRNB 4TOYL 2BZDA 1ZA3A 2NY0B 1LVEA 3VWJA 5HYJA 1AE6L 4D8PB 2X4TB 3HMXH 1KACB 2KPNA 3CFJA 2ZG3A 4Y8AA 3DO7A 2AXFB 1OP3H 4QXTA 4UAOB 5ENWB 1KENH 3CZFB 3ZTNH 2FJHB 3X17A 4Z7VB 2W65A 1BQHA 3MLPA 3UTQA 1GJIA 2VYRE 4UTAL 4H88L 2RIKA 4YPJA 4WFHE 5DFVC 4XVTH 3F5WA 3MROA 4KUCF 4YFDB 1EEQA 5AG8A 1LP9E 1NFDA 1NCWL 2D0HA 4XC1H 5I66B 3UYRL 3ZKXC 4JVWA 3UZQA 4P9HC 3WLBA 1BFVL 1DVFA 1NEZB 3CFIC 3D69B 1GYAA 1OTSD 4IJ3B 5TE6H 4PJAE 4E41B 1A7QH 2X89D 5FHBH 2UWEF 1NKRA 1JIBA 4F7EB 4Z9KB 4GG8B 4GAJH 1A9BA 4RISH 4ZFGL 3VW3L 3T2NL 1QQDA 1INDL 2JCCA 1S7XB 4IHOB 4UV7H 5D9SA 1MF2L 1TDQA 4J4PD 4MA7H 1C5CH 3SDAA 5IF0A 5IFJA 5KSUA 1ORSB 3UYOD 2XTJE 3DPBA 5E2WL 3ARFB 4N0YL 5GRUL 1NCTA 4ZO8A 3RDTB 1P1ZA 1LEGA 3GUTB 2FX8H 2NX5B 1RFDL 1M7DB 4J3SA 5H94A 1A6TB 4N1CA 3QXUA 5DD0L 4Y5YB 1NCNA 2JB6A 1NLDH 5IM7B 4JY6B 1QFWI 1L7TH 4GH7B 3AFLA 3BE1H 3G5YA 3FFCE 2ILLA 3OAUL 3Q6FA 2QSTA 1JYXA 2YK1L 1OHQA 3V0AC 3QNXA 4LVOB 2F54A 1TVDA 4PJ8A 1BQSA 1ZVSA 2UVFA 4KXZH 4LEXL 3QIWC 1FNLA 5L8JB 3HHRB 5KOVC 1U8OA 3CSBA 1G1YA 1FV1B 4R97C 3X12A 4YHML 1R3LA 5F9WC 3OSKA 2XZCH 3STZA 3O2VL 2ADGA 2H2PD 4I3GA 3NCYS 1NBZA 3EOBA 5E8PA 4G8IA 2YSSB 3FOMA 5C0JB 1I9EA 2H26A 2CIIB 2X41A 3FKUS 3HS0B 1D9KC 4JO4H 2FYYA 1ES0A 3VE0A 4H25A 3JUYA 3FO9B 4Y4HD 2WINA 4P48A 1AGCA 1MWAL 1WZ1H 3NH7H 2Q76B 3IDMA 4S1DC 1FCCA 3LRHA 2X70A 4ZPVB 4G7YH 3DX8B 4WFED 5LGJA 3VXRB 3RWEB 5BV7C 2NXZB 4OQTH 4WCYH 1F3DH 4LLMA 4TVPL 1GGCH 5JMRA 5D7LB 4R9HA 5J1AB 2BNRA 2DM7A 4Y1AB 2X4QB 3DTXB 3EO9H 4OV5A 1RVFL 2P5WB 1JTOA 3EJZC 1QP1A 4W6XB 4OFIA 2ITDA 2JIXA 4LCIL 4LPTA 1QRKA 1AD0B 4JJ5B 5T3XE 1J5OH 3QULB 4HKJB 1BVLA 2HJFA 3KPPA 2L0DA 4OCWH 4ZNCD 5KG9A 1GZPB 3Q5OA 3V0VB 1GSMA 3EKCA 3H3PL 4G5ZL 1CFBA 5C0EA 5J11C 3ZLQC 4XBEH 1EMTH 1IRAY 3U7WL 2FHCA 4D9LH 5IUSA 3IVKA 5JW5B 3I9GL 4M5YL 1A1NB 2R2CA 5DJ2A 3DSNA 3VXNA 3K74B 4OKDA 4J3XA 2DQCH 2R23A 1KUMA 1JFQH 2XKNA 4E5XA 4HK3J 1JP5A 2VDQL 1KIUA 3WFBL 5E4EB 1ZLUH 3CZJA 1V3LA 1R24A 5FM5M 1IEAB 4J3UA 2Y4SA 1G9ML 3MLZH 1LO4L 4HIHB 4GRLC 1L7IL 1IAIM 4OT1L 1MJUH 3CFCH 3H9ZA 5HI3D 4LCYA 4PJHF 4F2MB 2Z92A 4PV8B 3TIDA 3GSUA 3JBG7 1YEHL 2AJXH 3V6OE 4S0SD 2VISA 3TO2B 2W60B 5E6IB 1OAUL 3TN0A 3QDHA 4QTIL 4X99B 4HAGA 3QUKA 4M5ZL 5C07D 4X5LA 4MNQD 3RKDC 3DHJA 1CFTB 2DMBA 2VTFA 5EN2B 1ITCA 1U36A 3MRNA 1AR2A 1NAMA 1A1MA 4PBXA 3T2OA 3HE6D 1CXEA 2P8PB 3D0LB 3C5JB 5C0CD 1JN6A 4HIEA 4LHUG 4FFYL 5DD5H 3FL7A 4JB9L 3N85L 1OW0C 4XXCA 5CFHA 4PD4J 5C0ND 1HYSD 3SQBA 1LWRA 4PPTA 4PTTB 4LHUB 4U3HA 3VXUA 1NGXA 2V9TA 1RZKH 1I1FB 1QR1A 4GG6A 3QFJD 4TTDD 2QR0A 4NQSB 5E99L 4JPIA 5I1HH 1IKFL 2Y1VA 1BREA 5C0AE 3ZDYE 4ZUTB 3ZSSA 4N5EC 3D9AL 1MHCA 2F53D 1IEBB 1SM3H 1ZEAH 1A3LL 4GXVH 5HDOA 4JPVL 3P4LA 3RP1A 5ISZB 5FYKH 2BVTA 2Q3AA 1T1XB 3GIZL 4C83B 3ZKMD 4IMKA 5KSBB 1RUML 3DOSA 5DHXB 5GRJH 4G8GD 1UYWH 4GQ9H 5E5MA 4HJGA 4Z7WB 2GJ6E 3S35H 3FT3A 3GKWH 2NY0C 4F7MA 1Q0YL 5HYIA 1QOKA 3WKNA 1KIQA 4JFFA 2OTPA 1J05A 4Z78A 4NOFA 3NFNA 1GPOL 5ADOH 1RHHA 3LQAC 4OB5L 1KJ2B 3DIFB 2Q20A 4P57B 2OSLA 4OQ1A 4JFXB 2XKSA 4R6UA 5HHQB 1YN6A 3MRDB 1PVHA 4PY7B 5D4QA 3N1QC 1LK3L 1ACYH 4UQ2B 3AU1B 5DRNA 1SY6A 3EJJX 3BVNB 3GRWL 5FYLD 5EO0B 1JWMB 5JXAL 3VWKD 4CADA 1S8DA 1T0NA 1FZMA 3LQMA 1X4ZA 1DBAL 3ABZA 1EJOL 1WJ3A 3QEHB 3OKMB 2OTWB 2VLJB 4H8WC 4QRRD 1UFUA 2CLZA 1T1YA 4IJ3C 5DK0B 1OLZA 1B4JL 4AQOA 4CMHC 3QUXB 1JF1A 5HVHC 1EFXA 1YMMB 3RNQA 3IFOB 1MSPA 2VZ3A 4NZUL 2GTWA 5C71A 1FLRL 3QIUB 1F11A 3RZCA 3SE9H 2VDPH 1FFOB 2JKXA 3KPLB 2NY4D 1ZA6A 2ICWJ 3ZT6A 5I73C 4QYOB 4FQ1L 3GJFK 5H35A 4PJFF 2DWDA 3MRRA 4ZAKC 1MCWW 5ETUB 5K59E 2NY1D 3QT2A 3ARFC 2X9WA 4POZC 4Y7MA 4NCDA 4G6MH 3O41B 4HWZA 5LAXB 2EKSB 4N68A 3RDTC 5EFIB 4L4VE 5IK3B 3SKMB 3DXAB 1KEGL 2R1XB 5MP6L 2XY2A 1NMCB 2J8OA 3QUZC 3NABH 1WAAF 2HTLD 1A7PH 4IOIB 1C08B 4MXWH 4YWGH 4NP4L 3D1MC 4R8WH 3UBXA 1XGTB 3C8HA 3EAKA 2EDDA 4WEBH 3KR3L 3BQUB 2J8HA 1EHNA 3DGCR 5EIVA 1D5XB 1N6VA 1SVZA 5JDSA 3OKNB 1RJLB 4Z5RA 4L29A 1JE6A 3K3QA 4MA1C 3FRPG 3T77A 3WMSA 1VKXB 1OM3H 1AQDB 4I9WE 2FR4B 1A4KA 1I75A 3W9DA 2QEJA 3T4AB 4XP1H 1JF5A 1QLEH 4OGAC 1R3HA 4JFPB 1LILA 3ARDC 2OXHA 2AK4D 2ZKHH 4K3DL 3WN5C 4ELMF 1NGPH 5EIIB 4EVNA 1NMBH 1T21B 2Z91A 3KYOA 1VENA 4DZ8A 1I85C 2JB5H 1PJ9A 3ZDXF 2P5EE 1KXQE 4QCIB 4R7DA 2ENYA 3D3VA 5J1TC 1IILE 1A6AA 1NUGA 5K9KB 3RWJB 4J7RA 3SDXA 3MTRA 4Y5XC 2ARJB 1U8NA 4J6RH 1LD9B 1VEPA 5DHYB 2XWJB 4CMMB 5ITBH 1U6AL 3IB4A 4WI9A 3CLFH 5D1ZB 5DFWH 3EJYC 5HPOA 3MGTA 4Z7UF 4MCZA 3U4BL 5GGTL 5D6DC 5HHME 3LS5H 1A6ZA 4G8FA 5CJQH 3KJ6H 3OXSA 4KI5E 4YE4H 5AUMB 4ZFFB 1UZ6E 5I76B 4WDIA 5FDWA 1WBXA 4PJGA 1KB5A 3H9HA 1FH5L 2P24B 2IH3A 1YPZE 3O6KH 2AJSL 3BJLA 3WKMH 1S9KC 3G6DL 5C8JA 3LY6A 4YDKL 1YJDC 1RSFA 3C9NA 3SGDI 1BVKB 1OAQL 2QADD 3SKNA 5MEQB 4HZAA 3OKYA 4NOBA 5DMIL 3RNKA 5JMOC 3TV3H 5J3HD 4ORGA 4E42B 2BVPA 4ZODA 1JYWA 1YDPB 4K9EC 2AEPH 3D39A 3MODH 1HE7A 4HBCL 2W9LA 3O45B 4N90E 3NPSB 1R5IA 3AUVA 4LF3A 5GS2H 4AEFA 5IESL 4FQIL 1JPTH 5D1XB 3GO1L 4MXQC 4G9FB 5E4EC 2FD6H 2CDEB 1I1AA 5ANME 1G0DA 3SPVA 2B2XH 4OZGE 4XC3L 1IKNC 3DECA 1KG0A 6CGTA 1R3KB 3T4YB 4PJIF 5JW4N 5SWSE 4ZXBB 1BD2B 5E2UL 3L7EA 4M7LT 4PJ7B 2VLRA 2IFFL 2XFXA 2EDQA 4AH2B 5E6IC 1I9IH 3BDXA 2EH8H 5DS8B 5I30L 4P3CL 2QQLH 4Z0XA 3WFCH 1LO0L 4YPGA 5TE4H 4JVUA 5TQ2H 2EC8A 3QNZB 3QG7H 3OXRA 1SJHA 2EECA 4XZUA 4U3CA 1HHJB 3GSNL 3QXDB 2X4UA 1NGQH 4PJ5D 4MSWB 4NO5A 1ORQB 1QD0A 3IFLH 5D5MA 3JTTA 3EUUA 3BX7C 4PGCB 3G6JB 2VQ1B 2EE3A 4L3EE 3IRPX 1J8HE 1X5JA 4WI4A 4WHTA 3WFEH 1TNMA 3SY0A 2Z4QA 5EUKA 4WO4A 3V7AE 4I3RH 3JWOL 5J89A 2VXTL 5EO9B 5F9AC 2F74B 1SEBB 5L2KB 3BJ91 2JJVA 3DX6A 1CE6A 5FF6A 5JHDA 1U58B 1GIGH 1TVBB 5IW3A 5FOJA 3U2SA 4R3SA 3KYNB 3ILPB 1JL8A 1E4XL 4X5XA 1BBDL 1EHLL 3MRHB 5IMKB 3OBAA 4AL8L 4U1KA 3KDMB 3TPUA 5EZLA 4OCRL 3GBNL 2G75B 4RGOH 5FO7A 5DFVD 3MLVL 5ECJE 4JKKA 2CSPA 2KZ1B 3VJ6A 4AZ8A 3WNNA 4QF1B 1RZGA 5F1KC 1A22B 4GKNA 3DETC 5IJVB 2PYFA 3QDME 4YR6A 4FTVB 1JUFA 5FO8B 2BCKB 5L88H 1VFOA 2GK0B 5KSAB 4GW4B 3NCYP 3QO1A 3TC9A 2QLVB 1XGYH 2R0KL 1I7TB 1AHWB 3BIKB 2O5ZL 5DUBB 2PW1A 4PJDF 1U8MB 2UZXB 2FX7H 3I3EA 1HSBB 3C08L 2XNAB 5IBLC 4I0PD 2DKUA 4KXZI 3FQRA 1P7KA 1IQDA 3W5MA 1CXKA 1FFNA 3D2UB 3IDGA 1RK0B 1ZVYA 5E2VH 1DDHA 3GIVB 4F57H 4OFPA 2PXYA 1X5ZA 3SJVE 4Q9BA 5B3NA 4PRIA 1LHZA 1FNGA 4YBHA 4JRYD 2DMKA 3IJYB 4N0UB 3DBXB 3O3EB 3QUXC 1F58H 3PQYE 5A2IH 5TFSL 5FK9A 1NFIB 1AY1H 4C59B 3GNML 3FT2A 3TBWA 3GMOB 1IVLA 3BUYA 1EO8H 2BSRA 1K8DA 2HG5B 3UTPD 4HH9B 4JM2B 1WVZA 3QIWD 1JPSH 3OGCB 2HJKB 4O2CB 4QOKB 5CP3A 1BJ8A 4RQQB 1A6UH 3VRLE 1UH2A 1S7RA 2XA8H 1DBBL 2FSEB 3EW3B 3B2VL 4XAWL 2IF7A 3EDEA 3LIZL 4HT1H 5DMKB 4UOW1 3E8UH 4QHNA 1HHHA 2PTTA 1Y0LA 3GHBL 4PJXA 5IIEB 2ICWA 4G6FB 1MJ7H 4OCSH 4KWUA 4TSAL 1WC7B 4X7DC 3BRDA 3F7RA 2EDYA 5IMMB 1JK8B 1D9KD 1NBYB 2PETA 2FEEL 3ARVA 1OVZA 5IVNA 1U95A 4D9QD 3BQUC 1PY9A 2BNQA 3VXTB 1HXMA 1FGNL 4NQDA 5DI8A 4KC3B 1U9KA 1E27A 5M95B 4MJID 3MLWL 1S7UB 4JN2B 4DVRL 4ZNEA 1UT9A 1DFBH 3QUML 3KPRD 3RGVA 2D03H 2FIKB 1R5WA 1MFDL 2HT4C 4JZOB 3B43A 3HFMH 3QFDB 3CXHK 4HMCA 2ID5A 1BFTA 2DWEB 4HS8H 4UQ3A 2JF1A 1MFBH 1P84J 3QDGE 2LAGB 2FL5B 3EJZD 4KUZH 1NDMB 1LO5B 3HI6H 3PV6B 4HFUH 3I6KB 1E6JH 2ZP0T 3EO0A 1PYWB 3L6FB 1KEMH 4PP1C 3UTSE 1VESA 2XTLA 1JRHH 1LP9F 5I15H 4XCNB 3FRUA 4NNPH 2Z31D 5F9JA 2AK1L 2F5AH 1D5IH 3D25A 4LMQE 4IIQC 2VIRB 1RUKH 4PJAF 4QWWC 2YPLA 3FAXA 5TJWK 1B88A 1ZHLA 3WIHL 5D1ZC 3B9DA 1BLNA 4E0RA 1CF8L 4J3TA 2Q3ZA 4LLQB 1JPFB 5BXFB 2HT3C 2ZSVB 2H9GA 2R1WA 2DQDH 2GY7B 4P49A 3HC0B 3O6ML 5EUOE 3X13B 4ZD3H 4MNGE 3MV9A 4YFEA 4PRHB 3DX7A 1XT5A 1YEEL 3JTSB 4X7FC 4C4KT 4LIQE 4Y88A 4GRLD 4FXKB 1ADQA 1MIEL 2OK0L 4EUPH 4J1UA 3LEVH 4ETQA 4NO0B 4DZBB 3EO1B 5CP7A 4HGWA 4IRJC 5DT1L 1XGPB 5DQ9A 3WS3A 3QUZA 1A6PA 2G9HB 1DBMH 1MCWM 1OGAB 3GSVA 2CQVA 3QDJE 3N1GC 2XQBH 4I3SL 1DQLH 1SJVA 1I8IA 4R2GB 2HRPL 4MX7B 4BSVA 3S8WA 4R0LB 4WFGE 4J8RA 3S37L 2E7LC 3UC0L 1H5BB 3MV8A 3RKDD 4OD3L 3MV7B 1GZQB 4K94L 4WTZG 1U8HA 4MXVE 5IW6B 4FQJH 1QYGH 2ZOKA 3DRQB 1LEIB 4F15B 3RU8L 1E0OB 3C2AL 3H8NA 4RAVB 2GJZA 3SCMA 5BMFH 3L3GB 1QSEE 3V9FA 4RDQF 3P0VH 2FNBA 1J0HA 3D85B 5FAAA 2CKNA 3WN5A 1P6AB 4ZXBC 3Q48A 4XP5L 2E6QA 2OZ4H 3VXSE 1AXTL 3GMNB 5GZNC 4OLYL 5IB4B 5D7IB 2C3XA 4N5ED 1WBZB 4PY8J 1QSFB 1J1PL 3B3IA 5ID1A 2C7UA 4S1RH 2GSIB 1VSCA 1F8TL 2P46B 4NT6A 4I0KA 3WHXB 2KH2B 4LLUA 4ODBD 1PG7H 2EDOA 1LEKB 2YXMA 3CUPB 4JFEB 4CN4A 1QRND 2O5XL 3ARGC 4ACPA 4Q6YA 1Q8MA 1P7QA 2NY0D 3DX9A 2BJMH 5DJZA 3C6LC 1JHTA 4D94A 2HFFA 3GMLB 5BOZG 4EI5B 3H0TB 1SYSB 1FRGL 3DRTB 3TJEL 3IDIA 4UMGA 5DJAA 2BX5A 3IF1B 5ESAA 2AEWA 2J5LB 1VPOL 2JE8A 4C56A 3BAEL 1UGNA 5FKAB 1YEIL 4KI1A 3PDGA 4XMKL 1FVEB 5IVOA 4D2NA 1FVDB 1RUPH 1T4KB 1AO7B 1IFHL 3VFRB 4I18B 5C09E 5IQ7L 1N59B 1T0PB 1U3HC 3CXDH 5D7JB 4EZMA 4UIMB 2WZPD 4BK5A 5FCSH 1KN4H 2DQFB 5FUZL 3L3HA 2O93L 2YRZA 2Y9RT 1ZT7A 5KJRH 5IVXE 4PJHA 3AXLA 2ZJSH 4NQTA 4UBDC 4NO3A 5DD3L 5HGHB 4JHZA 5CD5C 1S5IL 1AHWC 4LBEB 3FQXA 4UB0H 1BFSA 3HZMA 2FIRT 1JNHA 4WHYH 1R3IL 1ETZB 2FWOB 2CK0L 1BGXL 5HVGB 3DNKA 4KTDL 3CDCA 4JFDA 3UJIL 2MPAH 1IM9B 3X14B 3QRGL 1KBGL 2EXYC 5D71L 4ZAKD 4DGVH 1S7TA 3BHBA 2P8LA 2Y23A 3PWVB 5F3BA 2OR8A 3ARFD 4POZD 1P69B 5GGUB 1IM3A 1NC2B 2QQQA 3FONA 3ULUL 4JY5L 3RDTD 3IETB 2VWEE 4LAJH 1SJEB 4M7LL 4U4BA 4UTBH 4EKXA 2VAAB 4FTVE 3PWPB 1ZT4A 3UYPA 3QHTC 4TQEL 1H0DB 5DEZA 2NMSA 3I50L 5ADPH 4G43B 4YK4B 5T5FH 1X3DA 5HHNA 3AMLA 1MI5B 4HIXL 3T0EA 4WTWA 3MUZ1 3MV01 1MFEL 1RJZA 1ADQL 1JYNA 1WLHA 4TYUA 4RMQA 3P9MB 5D72L 3FO1B 5CWSB 5E8EA 4JM2C 1S7QB 3L3OA 3WL9A 4S1QL 1CD8A 2DJ4A 5GQBA 3OB8A 1OPGL 3ZDYF 2DL2A 1TCMA 2DDQL 1L0YA 3T08A 3K2UL 3MLSH 4RFEA 5T3ZD 3MBXH 3QO0B 4JHBA 1G7IA 1LE9B 4JKPL 4OGAD 3EYVB 2C3HA 5ESQA 4OM0H 1BBJB 3ARDD 4RFOL 5CBEB 5IVZB 4KRNA 1YC7A 5FHAH 3QCVH 1A7NH 4YDJB 4HXBL 3WUWG 4KGJA 4GBXA 2N7AA 2VLKA 3PHQA 4P99A 1WFTA 1DLHA 1KNOB 3TNNB 2BNUA 3W0WB 5CMAA 3O3UN 4WUUE 4XCFH 5ACLA 2A38A 5F7LB 2X4SA 2CR3A 2JELL 3TVMA 4UT6L 3VXRD 4ERSH 2LU3A 3O6LL 4NFBA 2NXZD 1BFOA 2ICEB 5HYSG 2EE6A 2YKLL 2HKFL 1H8OA 4HS6A 3P30H 1S9YB 2J7LA 5D7LD 3MRGB 5B22A 1UJ3C 4MA3B 4Y1AD 3Q1SH 4LLDB 4N8VA 2P5WD 5HYSB 3S36L 2R2HB 2HFEA 2MQ0A 2R69L 4K3HA 3EDDA 1R0AH 2OX5A 4JG0H 1OF2A 2AGJH 5CILH 1BPVA 3BYYA 1TQBB 3BGMB 2ZPKL 3TZVB 1CG9A 1OARL 4ALAH 4M8QB 1D6VL 3FFDA 5TQ0H 2PYEE 5DDHB 3L3IA 3O8XB 4LFHG 3BP4A 3HUJA 4GKZA 1NPUA 4N0CC 1OP5H 2BVQA 4ODUA 2V5YA 3ULVH 3VH8G 4BZ1L 1ZANH 4P5KB 5SWZB 2GITA 2VR9A 3BEVA 4PJFA 5DA4A 1CDYA 1DQQB 2ARJQ 3S34L 3LKRB 2DQIL 2YPVL 3UO1H 4LKXA 1CBVL 1Q38A 2JJWA 3MBEA 3VH8B 2M1KA 4OTXH 4Q6IC 5DGRA 4QRPA 5CJOL 1TETH 1HQRA 4MXQD 3OB0K 5CJXC 4LRIC 2FGWH 5K59F 3WD5L 4OLXL 4K2UL 4XH2B 3B8SA 5BRZE 3MRLB 3ZE1E 5C0BE 1M6OA 2H32H 3HMWL 4XCCH 3CVHH 4FRWA 3ET9F 4Y19A 1AR1C 4U31A 5JW3L 1R5VB 3X11A 3PJSA 5E6ID 4I77L 5BOPA 2B1HH 4AM0B 4R0LC 1QBMH 2VZTA 3GSRB 4OZFG 3L95B 2HKHL 4UT9L 4H26A 2OI9C 1S5HB 1FVCB 2OJZL 1G1CA 4DEPB 2A6JA 1EUTA 4FQLH 5LXGL 4OZFB 1ZOXA 3QJFB 4F15C 4PS4H 3RWFA 1U3JA 1FE8H 4P2OB 4M43H 1EGJH 5F71A 3CH1A 2Q6WB 2BVUA 2YR3A 5EO1A 1W0VA 5IB1B 2OL3A 5JA9A 3FOLB 1AKJA 4HSQA 3RY5A 1IQWH 3L3DB 2VZOA 3JUZA 4LHUD 4JDVA 4M62H 4HIJA 5I8OL 1T22A 5HHXH 2EKJA 1HCVA 4TUKL 3HLAB 4ISVB 1G7HB 4ZSOE 4ODHH 3TT1L 4Z6AT 1QVOB 2PTUA 4LPCA 4EDWL 3KPNB 5C0FB 2R29H 4XVSL 3QXAB 4Z7UA 6FABH 5T1MB 2C1OB 4ZTOH 3C09C 1OLLA 5ISZD 1OT1A 1NKOA 3FCTB 3KPSD 4NQCA 5E2JA 4LNRA 4W6WB 4OD1L 2UZIL 5EPMB 1QBLH 1U8KB 4MAYC 3CDGB 3W39A 5C3LD 5DQDH 5I9QB 3L5XL 4YHIA 4KI5F 3DETD 2DB8A 1A14H 4GKSA 2VC2H 4F3FA 4U1NB 1UZ6F 3BKJH 4QTHB 2ATPA 3QUYA 4YQXL 5I1AB 1F13A 3W9EB 2FX9H 2J5LC 4NWUL 5D7IE 3BZFA 1FGVH 5MENB 4OF3A 2A9ML 3RWIA 1T1WB 1YPZF 2CRYA 3INUH 2MKWA 5KS9B 3KXFA 4DGIL 5B39A 1KTDA 3WFZA 4IRJA 2BY3A 5IBLD 1DN2A 3OZ9L 2NY2B 4G3YL 3JV6B 2V6HA 3U30B 3C8DA 4HUMB 4MJ2A 2VXUL 3VDBA 1MHHA 3UPRB 3OAZH 2D0FA 4KDWA 3N1MC 4Z76B 5B38G 4XP4H 4U1GB 1KPVA 1XF2B 3L9RA 1Q0XH 1IAOB 2E7LA 1JHLL 1G0YR 2HA1A 3LRSA 1WIUA 3IT8D 2VQUA 4XBGA 5EA0L 3VMPA 5IWLA 3MYJB 2VLJD 4MMXC 1N8ZA 2EH7H 4YGVB 5F89A 5B38B 3O4LA 3QJHA 1UB6A 3V4VL 4P23C 3ALWA 4RBPH 4NQEA 2R0LL 1BQUA 3E6FB 1QR4A 3CDYA 3VG0H 2ZUUA 5JPNA 1NCUA 3LAFA 3QUXD 15C8L 3GHEL 5FKPB 1YMMD 4N8CH 3SE8L 1RZJL 4FNLL 4TNWF 4OZGF 4PP2B 1KELL 1IGML 2ZZUT 4XAKD 1LDPL 2KQMA 3UZVB 1LO2H 2W38A 3FO0H 1BZ7B 1ZT1A 3B9KC 2VITB 3WS6A 3RWCA 4NGHL 5BS0E 3DMMC 3FTGB 1F4WH 2IQAA 3IKCA 1AC6A 4HWUA 3MMEB 4K7PH 4KQ4H 4JFOB 5EORL 3VXPA 4LARH 4F7CA 4MDJB 2QQKH 4C58B 1OCWL 3BPCA 3DXAD 1QLFB 2RHEA 3BYTA 2A9NL 4EN3B 4NSKB 2C4FT 1BIIA 4JO2L 2AW2A 4LPVA 1JRHI 4MNHB 4YIQA 2X7LA 5IGXH 3QQ4B 1VB9A 3QB7C 3QI9B 4YHKL 5DC4B 1NFDE 4LSQH 3WXWL 1RUAL 3BQUD 1ZLWK 4NQVA 2YRLA 4ONGH 4APQB 3V4UH 4ONFL 5A16B 1T03H 3MFGB 2F19H 2OJEA 4FXGA 4L1HA 3PWUB 3EOTL 1TJIL 4BH8B 5IJKC 4CN6A 2VXVH 3WE6A 5HGDB 4NQXB 5I1IL 4L9LB 3ROLB 4OZIB 1G7QB 1FDLL 1FIGL 1QTYT 3C6SB 1EAPA 3GFUA 1P4LB 2V2XB 5AYUH 5HHOE 5ID0B 1C1EH 2DM4A 3BEWB 4OCXH 1U3HA 4P4KB 4O58H 3OJ2C 5F7NC 3V4PL 4WHYG 3BIAX 1HNGA 3T3PE 1EUUA 2ZOLA 2IGFH 5DHVH 4PP1D 5LCVH 4CVUA 4YNYB 1IZKA 3MLUL 3RUGE 3QG6B 1NDGA 4U1SB 5F6HI 5GS1B 5TPWL 3ARWA 4PJDA 4OGYH 1MJJB 2XPGB 3RJDA 4YEFA 4ZYKB 4HDIA 5T33H 2RFXB 1C7SA 3GM0A 3BKYL 1YMHA 5E00A 5KSVA 1JZ7A 4H20H 2A74B 4XNUH 4YHZL 4HLZH 5D1ZD 3DUUA 5E8DH 2BDNH 5ICZA 3CLEH 2A6KB 2CJUL 5AD0A 2HT3D 4LLVA 4WUKL 1CLOH 4I4WA 2BC4B 3BT2H 5KTEH 3O9WC 5CHNA 2DM2A 3BKCH 1G9NH 3HI1B 4K23H 4FZEL 4HKZB 2NXYB 4X6FA 5GS0H 3MLXH 5E6YA 3QA3B 4KHTH 5IB5B 1KPUA 1TQBC 2VL4A 2DMCA 4QT5A 5T1KA 2R9HD 3WFHA 1UCTA 4WWKB 5IMOA 3VFUB 1J12A 3KYMB 4NM4H 1K85A 4MJ5A 1KLFA 3O2DH 1YY9C 4NRXA 5GSRA 2PUQT 1PGRB 4DW2L 3FQTB 5DJCB 2NNAA 3C87A 2JJSC 1K6QL 5DYOB 4OI8A 2MKLC 1DBJL 3UJTH 5SX4I 4LCWB 4F9PA 3SHSA 1DQJA 4HJJH 4LGSB 4IDLA 3O4LD 1CK0H 1N2RB 2C1PB 3OF6D 3PP4H 1D5BB 4N9GB 2IALB 4DFHA 5BW7A 4XGZB 5ACZA 3QCTH 1I8KB 1N7MH 3LDBB 4PRBB 5FYLL 2NYYC 3HNSH 3VRLF 3OJDA 2LVEA 4WNQA 3IDNB 4LSUH 5DEGB 5GRZA 5B21A 5HY9B 5J6HB 4ZXBD 3A6OA 1BD2D 2A6DB 3GJEA 1TFHA 1BJMA 5BZDA 4X4YB 4XPHL 1UWXH 1FO0A 3K4DA 4RZCB 4UUJB 5JQHC 4NZTH 1IC5L 3IDJA 4NO2A 2CXKA 4X6CF 4GRMB 5JOPE 2E7HA 4GAGH 5EC1B 5DR5H 3MNZB 5IFAL 1GXEA 3GSOA 2ED9A 1RV6X 4LCCA 5DUML 5GJSH 5EU4A 4PJ9B 4HH8A 4HK0B 1GH7A 4TSCH 3ARGD 4B50A 3V52H 4W70A 2NW2A 4GMTH 5DRZA 1MQ8A 1NBVH 8CGTA 1VACA 5AAWA 4HKXA 3C6LD 1UJ3A 1S9VA 1IL1B 4BFIA 3V95A 1RUQL 3QQNA 2AXGA 2BY2A 5JLZA 2UUDH 3A6BL 3I6GB 5GGVL 5TDOA 5HPMB 1XH3B 1FAIH 1JWSA 5L2KD 4U1MA 4PJAA 4XT1C 2R4RL 1FYTE 3MA9L 1FNHA 4XPGH 3E2HB 1TENA 1IBGL 1RZ8B 4DN4L 3RVTC 1VADB 4QRTB 3DYPA 1FHGA 3SO3B 3PGFH 3SDCB 4LEXH 4NBZB 1U3HD 4KI5C 1YEJH 1E4WL 2BXZA 4JRXB 3MRJB 4GQPH 5FO9A 3RTQB 2VABB 1FBIL 4RIRA 1A4JA 3U7YH 4TUOA 3V6ZB 1Q1JL 3U46B 1S7WA 4PRNB 1JCKA 5D6CA 5EUOF 2X44D 5HHPB 4I5BB 2DKMA 1PX3A 3CVHB 1LO3H 4LRIA 5CJXA 2QKIB 1M7XA 4ZUVA 4UBDD 1S9XB 4P5TC 3QP3A 1N3NB 5CD5D 2BY0A 4OM1L 3RVUC 2PO6C 3LEYL 1RULL 4XNQA 4KJPC 1EEZB 3U30C 2DI9A 3FFCA 4NRYA 3VFOA 4DQOL 4B0MM 4OLUH 2NLJB 3D2UD 2DYPD 1T2QL 4R26H 2EICA 3HG1E 1A02N 2BVOA 2YPKA 4IMLA 5T1LB 1G7LA 4X9BA 1XR8A 2VR5A 1UM6H 4MXVF 1S9WB 2XWBB 1KCLA 3KVQA 4QRQB 4TSBH 3CK0H 4GAYB 3OPZH 2WQRA 4XNYH 3BPNB 1I7RB 1FL5B 4UV4L 1JV5A 1I7ZA 4HIIB 4M9OA 5DFTA 4DAGH 1RIUH 1RIHL 1ZTXH 2KKQA 1B6UA 1C16B 4QRUB 4JFFE 3NIDE 3HPLB 2NY5L 5KVFH 3DURA 4ZQKB 3S97C 4QGTA 2A73B 3FQNB 4LSVL 3TFKC 4JM2D 4IRZH 5FYKD 1TJHH 2W0FB 3EFFA 1ZGLP 4QOKD 5I8EB 1OAXH 1XCQB 2GCYB 2V7HB 5L9DH 3VRJA 1N64L 4FOMA 4P2RD 5L0QB 4PG2C 5F6HJ 3BWAA 4EN3C 3QEQD 4G6FD 3WFBH 3BOVA 4YHYB 3FN0H 1CD1A 1G6RL 4ODWB 4ZS6C 1SYVB 1I9RL 1KIRA 4LSTL 3VFTB 1P84K 2HN7B 5H2BA 4YHLL 2AAVA 1MCPH 2Z0BA 1U8JB 2BOBB 3MFFA 4KTEL 4W4NA 3GMRA 3EYOA 4ODXB 4AENB 4Y2DA 4LMQI 4JFZH 1OQOA 4OCYL 1EVUA 4WI8A 1CE1L 4M9PA 1E28B 2OTUA 4M5ZH 3I84A 1HZHH 4LSDA 4L3CA 4OLZL 1IGJB 4BKLA 4WFHD 1NGZB 2P7TB 3QNYA 3OKDA 5FB8A 4LKCA 1S3KL 3GMQA 4JLRB 4EOWH 4PRDA 4DKAA 3NZHL 2PN5A 2V5MA 4P4KC 5DJ6B 2DICA 4XPAH 3WIIL 2CRZA 3GBMH 3MV11 5KVEL 2WUCL 3U0WL 4GW5A 2CKBA 3WNKA 1YQVH 5A2KH 4P23A 4HPYH 5DK2A 1OP3K 4K7FB 4HPOL 5IEHB 5E24E 5IVXF 3SOBH 1FFPB 1WWAX 5DO2C 5E9DD 1ZS8B 4YHOH 1HEZA 3V6OA 5ELIA 5I1CH 4NPYB 4NKDA 5C08E 1HSAA 4WW2F 1DQML 2CRIA 2RAMA 3VGDA 5J9PB 5IBTH 2Y36L 5ICYB 2AV1B 4PRHD 2HT2C 1XCTB 1RI8A 1YEFL 4NN6C 1TZIA 2NXYC 2OR7A 2ZSWA 2J88H 1MRCH 5HGAB 4QLRA 5EC2B 3VFGL 4LPYA 5I8CA 1EERB 1EBAA 4YDIL 4NO0D 3MRIB 2YZ8A 1AJ7L 4X6BA 3PWNA 4CRPA 1WFUA 2ITCB 3DV4B 2K3TA 4JJHA 1AR1D 3SE4A 4P9HL 4Y4KC 1MRFL 3QH3A 1CDHA 4FXLA 3D3VE 4S0TD 5DLML 3MV7D 3S88L 3ZT7A 4I1NB 3THML 4QRSB 4DTGL 4P2QA 3ESVF 3LS4H 4LCUB 1UH4A 1UWEH 4GMSL 4KZEL 5AZEH 2YMXL 1MCHA 1UACL 3LDBC 3OL2A 5DHVB 4U7KA 4YXKH 2NY3C 4HUUB 4FA8A 2VE6B 5JUEH 2ESVE 2O26U 1ZGLM 3AS1A 2VDLH 2GJ6A 5AWNL 4HLZG 3D85D 5MI0B 4CAGA 3UTTB 4FHBD 3TBSA 4ODSH 5E8OB 5I17A 5EBWA 1NAKH 5ESVA 4HD9A 1OTUD 1WWWX 2HTKC 3EOYG 1EJ6A 2OCFD 3OG6B 1NUNB 5GJTL 1W72L 3HN3A 1FJ1A 3NCJL 1XGQB 4PGBB 2MCG1 2OLDA 2IANE 3GMMB 5DGQA 1K4CB 4QY8B 5GZOC 4DKDC 5D2LE 1NCCH 1JGUH 2C26A 3ZHKA 1IAIH 4YBQC 4JFED 1U92A 5F1IA 4MAYD 3VFSA 3TIEA 2VDOH 1XF5A 1GHFH 4HWBA 4PRPB 5EU6E 3RA7H 3ZMRA 5DQJA 4AIZB 4D8PA 2R1YA 5F8QC 2X4RB 3RAJL 2ZG2A 4JRWA 3VI4E 4NZRL 1BZ9B 5A40E 1A2YA 3ULVC 1OTTC 4WENB 2EDXA 1CI5A 1YUHB 4PRAB 3CZFA 4LLYB 4MQ7B 2FJHA 5E03A 1AGFB 1AO7D 3CFKB 3HC3L 2J6EA 5GS2D 3SDCC 5I1KL 4MHHG 4FG6C 1J88A 4S1SL 3X3FH 2RJMA 5D7JD 3B6SA 4GFTB 1UA6L 4RAHA 4OF5A 4JHAL 2PR4L 3OKKA 1MRDL 4TVSa 4L4TE 1S78D 1IC1A 1UG9A 3W11C 3RRQA 5I66A 3C5ZB 3IJSB 4C57C 5JNYB 4OJFL 1DJSA 4L4VA 1CD0A 2BY1A 3TO4A 2BSED 3D69A 4OLWL 3O11B 3TA3A 1UH3A 2DKSA 1NAMH 4G9DB 4PJBB 1KFAL 3QQ9C 4E41A 5I6XC 1HXYB 4AG4L 5H8DA 4A2MA 5MERA 3ZE1F 4F7EA 4M1DL 2L4OA 3F7YB 1HHKB 4D0BA 4OZHB 4KPHH 2IBZY 5CINH 4ZS7H 3S3JA 5D93B 4CU8A 3L1OH 2EDJA 1S7XA 5IMLA 3B9KD 1U91B 2E9WA 2ADIA 3DMMD 3IDXH 5FUCC 3MRBA 1G9EA 1RJYB 4PJEB 5TF1H 4DJMA 4JR9H 4MAUH 5EB9A 1ORSA 3RVXC 2WW8A 2XN9E 1XGRA 1FG2B 1ZLUK 3FB5B 4H0IA 4G7VL 2DTMH 5DEFB 1EXUA 4TTGA 1I8MB 4GSDH 3PWPD 3GUTA 3KGRA 4S2SB 1A1OB 5K9JL 2ED7A 1A6TA 4NN7B 1IGCH 5DJ8A 3IFNL 4Y5YA 3DVGA 3BPNC 4OAWB 3NA9L 4RX4D 5KVDH 12E8L 1MI5D 2CDFA 5IM7A 2HFGH 2VDML 4JY6A 4F8QA 3WDHA 4X6EB 1IZJA 2WK2A 4M7KL 2D9QB 5MEPA 4XVUD 1NH6A 4NHUB 1OAKH 1OAQH 4WV1C 5C0AD 3MJ9A 4LDEB 2P5EA 2FB4H 1A6WH 4M02A 4M61B 3M1BB 1ERNA 4Q2ZB 4AMKL 2GAZB 3DO3A 3TBTA 4KMTH 1X5FA 1T20B 3MGOB 3MUGA 5CEYA 1AI1L 2XOTA 5TDNB 4B7LA 1F5WA 3SKJL 1INQB 3BXNA 5L0QC 4F37F 1CIDA 1KN2L 5F7EL 5FCUH 1SY6H 4UDUA 4YHYC 3MCLH 4PLJC 1IGYB 1M05B 4KHXH 4JN1H 3HS0A 2NW3B 2HJLB 3W0WD 1QFUH 3W2DH 1Q9KB 5F7UA 1EEYB 3R1GH 4NWTH 4HZLB 1YPZA 4ZPTB 3ARBB 1FNEA 3RWGB 3DHMA 3D0VB 4L5FL 2Q76A 3RIFK 1OOAA 4N0FB 5FGCB 2NTFA 1A6VL 1C8PA 1QFWL 4ZPVA 3DX8A 4MVBC 1SEQH 3AREA 5D7SH 5EZIH 3S98A 2IPKB 1YN7B 2HP4A 4CKVX 3TNMB 4LHJB 5I1LA 1NLBL 3FT4B 1ONQB 4C55A 1K3ZA 3O9WD 5J1AA 3PNWB 3OJMB 3WLWD 4DVBA 4HC1L 4YC2B 2W9EH 4LHQB 2HWZL 1A0QL 3NCBB 4ZFZA 3CH8A 2DJUA 4OI9A 3VD3A 1H3TA 4NKIL 4TN9A 2HRLA 1AD0A 4JJ5A