4F7CB

Crystal structure of bovine cd1d with bound c12-di-sulfatide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CD1D antigen, d polypeptide
publication title Crystal Structures of Bovine CD1d Reveal Altered αGalCer Presentation and a Restricted A' Pocket Unable to Bind Long-Chain Glycolipids.
pubmed doi rcsb
source organism Bos taurus
total genus 12
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f7cB00
1I8MA 3VFSB 5F3HA 3TH4T 5F7KC 3T0XA 5HI4C 2CRYA 3ALPA 1FFPB 4AEHL 2E8YA 4OGAC 4F80A 3AFLA 4XCYA 2C7UA 4HK3N 3FTGB 3VI3E 3DYPA 1NBVH 2IAMB 1A6TA 4BK5A 1S7QA 3MUZ1 1BOYA 4L1DA 3UTSA 2ORBH 1KXQE 2AS5M 3V52L 1JWUA 3ULUL 4ONOA 1S7WA 3WIFB 4RISH 1HILA 2F19L 2PNDA 4M1GL 5ICZA 5GJTH 4HIJB 5GRUH 2PW1B 1TZHA 4LSUL 4Z7VF 4L4TA 1HINL 4N68A 2NY4D 3T77A 1EIBA 1FHGA 3O3EB 4KUZL 1N26A 3CVHA 4Y5VB 4TUKH 2W65A 2Y72A 4NQSB 4N5ED 1S9XA 3O8XC 3KPRE 1NC2A 5IM7A 3ES6B 4ODHL 4M6OL 4M4PA 4KV5E 4P4RB 4S1SL 4M62L 2XA8L 3QZWG 3RWIB 1KJ2B 3ZE1F 2ICWI 1BBJA 1LE9B 1NLBL 2H26A 2MSPA 3HE7C 4X7EC 1P1ZA 1T1YB 3NMEA 4EVNA 2GT9B 4S1DC 3IVKB 2ITCB 3WE6A 1I1YB 4V2BA 1BF8A 3QEQB 4JM4H 1G7JA 2FL5A 1N5AB 4QRRA 3HE6D 1IKNA 3E6HB 1Z6JT 1UT9A 4DCQA 5HI3C 1FGVL 4PGBB 3MGTA 4Y4KB 1T7XA 1RAMA 1HYSC 1T83C 3UTQA 3ZKNC 4UQ2A 3MFGB 1NCWL 4UDTB 1UXSB 4XT1C 3WD5L 4MJIB 2XKNB 4FNLH 5HGHA 4M5YH 4YHIA 4OCLC 1ZVSA 2XZCH 4ISVB 4JN1L 3WFBL 1RI8A 3K80A 3OKOB 4NRXA 1UKTA 4TNWF 3V6OE 3P4NB 1HEZB 2VZTA 4XGZB 1URLA 4ONFL 3O3UN 1A7OL 3CFEB 5FKAB 1ES0A 3DXAE 3QAZB 5E6IB 3SPVA 4L9DA 1D3CA 4PJHE 5FKPB 4R97B 1Z0NA 3OKDB 3REVB 4KTEH 2H3NB 4CVXA 4ZUUB 5J6HB 1A6ZA 2CKNA 5CKGA 1U3JA 4YHOH 3G08A 1NSNH 2QR0B 4TSCL 4F33A 2AQ1A 5IOPA 3CXDH 1GGIL 2FEEL 3LEXA 3QUZD 4P46D 1U8NA 5D1ZB 4MCYA 5L0QB 5SWZD 2VABA 3DI3B 5AYUL 3LIZL 2VLJE 4NIKB 5I18H 1J1PH 3S34L 1U6AH 3REWA 4MJ4A 2B1HL 3RFZC 3SJVD 4FS0A 2YWZA 1RU9L 2ZJSL 3H3PH 4WU5B 3RGVD 5FECB 3TNNA 5F7EL 5I8KH 2E9JA 1NGXB 4X6FB 1TJGH 1RUQH 3RTQB 5IP4A 4HT1L 4MHHI 1NMCC 5GISH 1GL4B 3UC0L 4NO0D 3PP3H 3VH8B 4J3UA 3CU7A 4U6XB 5E94A 4JO2L 3F58H 1C5CH 2V17H 4U1NB 4G9FD 1U3YA 1VEOA 2VXUH 2DQDL 1N0XH 1UM6L 1ZHNB 1WIPA 1IJ9A 2K9UA 5BS0A 1A3LL 5ANMA 1K5NB 5DRWA 1IGCH 1JZ7A 3JWDL 4BKLB 5GZNC 1INEL 3RUGF 3UTTA 4M6ML 4F8QA 4JKMA 4P4KD 3QDAA 1NCBH 3P9LB 5CMAB 1R5WB 4F58H 5IF0B 4ZNEA 2BC4A 1PAMA 1BJ1H 1UCBH 3HNVH 4PB0H 1IKNC 1Q0XL 2NR6D 1UZ8A 1VB9A 3BHBB 1HIMH 4LKXB 3S8WA 4GW4A 3QHZL 2JTDA 3B3IA 3ROOB 3UMTA 2UUDH 5IMMA 3SBWA 5DMKA 1DBJL 1F4XH 4XCCH 2ZCLH 3VRLE 1FJ1A 1MSPA 3V5HA 3O41B 3N1QC 4O9HL 1ZWIB 2VLLA 3LEVL 4R96A 4KKLD 4AZ8A 1F11B 4HWZA 3E8UL 4OB5L 4LGSB 7FABH 5C07B 5H94B 1AXTH 4RAVB 2WWMD 4ACPA 4NUGL 5AZEH 2UWEF 4C56A 1R0AH 1BIIA 5FGSA 1UWEH 2ATKB 4Y89A 2DBLH 3EO0A 1HHGB 4P2RD 1RJYA 5D1XA 3MYJB 4XPTH 1Q94A 3PXJA 5D1QD 3WXWL 3LH2H 1T0MA 2X1XR 1KCRL 4JHAH 1AE6L 1MFEL 4PRPA 2J8UE 1QVOB 2A1WL 4CVUA 2R2HB 4FQ2L 3VWJB 1LO5B 4JHZA 1UWGH 5FUOL 1FNLA 4TSAL 5HYJE 4EUPA 5IHUL 1OAXL 3WFCH 5I71B 2OSLB 4G8GD 1CS6A 3NCBB 1N6QH 3N85H 5HDBF 3BKYH 1BREA 1QR1B 3BXNB 3CFBA 4OLZH 4EBQL 2NY5H 3FB8A 4DN4H 2XA3A 1MCWM 1E0OB 1PZ5A 5FYKH 1CYGA 1CZ8H 4UNUA 1CLOL 4XMPH 3HAEB 4CVWA 4XP6L 1I9EA 4LASH 3VGEA 1NKRA 3CPLB 1BD2E 4MB5A 5TF0A 4D8PA 3MLWL 4WCYL 4JO4H 2H45A 2WUCH 4LQFL 1T4KB 5IB2B 3MODH 4PJDA 1N5YH 5DF0A 2ICWB 4XCNA 1A14L 1F6LL 3MRLA 2QADD 2VLKD 5I1LA 4K07A 5DK0B 4GRWF 1OAQL 1MRFL 4JZOA 2EIBA 1FSKC 1JL8A 2F15A 4IRZL 4TUJA 3BP5B 4K94C 4QRQA 1QRNE 2NY7L 3PJSB 4JVUA 5GGUB 5A40E 3QDJA 2E9WA 2FIKB 1NGYA 4JFZH 3HG1D 3A6CH 3QB7C 4KI5C 3MJ9A 3MGOA 3MRFB 3PP4H 4JREB 3C6LD 2EIZB 4RMQA 5MEPB 1KPVB 5KSVA 4FFVC 3V5DB 2YD5A 5E99H 3MTRA 3RVXC 2XKSA 3H42L 3O2DH 1K8IA 5EULV 2G75A 1FO0L 4WHTB 1EFQA 5DJCB 2AKRB 1ZEAH 2F8VA 3OXRA 4JKKA 4ONGL 3KJ4B 2F53D 2BMKB 2PO6D 1KBGH 4LLAA 1TFHA 2B0SL 1G7IB 3SBWC 4I0PA 2DDQL 1DQML 3FRUB 4NQEE 1RJZB 1X5ZA 4X9IA 2ARJQ 3PQYA 1WISA 3QIWD 5JA9A 4ZUVA 2EH8H 3KXFB 1JF1A 5I16A 3O4OB 1MH5A 3MCLH 3ZE2E 3VG9B 2OL3B 3L3IA 4I2XB 1CGVA 5T1LA 1LK2A 1CL7H 3VA6A 3CX2A 4OIBA 3NZHH 4HXAL 3LDBC 5EORL 3R06A 4G42A 3DO3A 1SBSL 4CNIA 5ILTL 4BUGA 2FYYB 4LPCA 3BUYA 5D1XC 4YDKH 3QDMA 2XOTA 2ZKHL 2GTWA 4YHZH 5F7HA 3NA4A 4OT1L 1U91B 3BAEH 1BLNA 1J0ZA 2CUMA 3MOBL 4LEXL 3U0WH 4BSWA 1J8HE 4Z7UB 4Y16B 2HFFA 4PG9A 1BJMA 3VCLB 2IH3A 4CJ0A 1IZKA 2DWEA 5I9QC 1U8HA 1O7SA 3GSUA 5GHWL 1KCVH 3RBGA 5DD0H 2YXMA 2MKLC 3SO3C 3DBXB 1P2CB 4U1MA 1SJEA 4TQEL 2R0KL 4GXUN 2EKJA 1JJUA 5I15H 1K4CB 3DURB 1WITA 3EOBA 2Z4QA 1BQHA 3RWHB 5F88A 1WEJL 4BSJA 1QSVA 3L5WA 1KYOJ 1P9MA 2H32H 3NFSL 4N1CA 1GYAA 1ADQL 4Z77A 5IFAL 5C3LD 1EO7A 3WUWA 4Y4HB 3VWKB 1Y18A 4JQVC 2XWTA 3ZE0F 3CLEH 4PJFF 5D7LB 4HAGA 4BELD 5MENE 3SE3A 1KTDB 1IAKB 4HZAA 1KIRB 4RMWA 2XQBL 1IL1B 3GMMA 4M43H 2APWA 5JW4R 4O2FB 1J05A 4I0KA 1NGQH 2A9NL 3WFDL 3BP4B 4KK6D 4LHUD 3I75B 2Y5TB 4P0DA 5FIEA 3U7AA 4J3WA 3UXFA 3GMQA 3ARRA 1P7KA 3GSNL 5F71A 3BZ4A 4WO4B 3VXNB 1WCBA 2HFEA 2Z8WC 2B20A 3HFML 4TUOA 2MQCA 5CJXA 2EYRB 3D39B 4ZTOH 4UILL 4P99A 4X6CB 1CFBA 5GRJL 3WKMH 1KOAA 4UB0L 4JANA 5DUBB 1CVSC 1MAKA 2AI0L 2B4CH 4P5TB 3F7QA 2Z9TA 1J1XL 1MNUH 1JWMB 1Z9LA 1UWXK 4WHCA 3BPLB 1S78D 4KI1A 4L3CA 1DANU 5E8OA 4DTGL 3UTTE 3FO0H 4PJ7F 4UT6L 2DOCA 4NBXB 5EPMB 3WS6A 5DFVC 4TULL 2DMKA 1OTSD 4PJ5B 1BQLH 3A67L 4MD5A 1PEZA 1A9EB 3CD4A 4OCMC 4K3JH 3B2VL 1MI5A 4L8DA 4FQLH 1DQLH 2FO4A 3FO9A 2FZ3B 3CJJA 1XF1A 1RK1B 3CVIH 2X4RA 5I8EA 3DGGB 4PJGE 5JMRA 3X14B 1NAMH 2GI7A 5FB8B 4CJ1A 1NFKA 1MFBH 1RZIA 2HTKD 3QO1B 3GMLA 3OR7B 1UB5A 4GXVH 5J1AA 1AD9A 2Z8RA 3SKNB 1TTFA 1UC6A 5E2TL 2FSEB 1LO4H 3IXTA 3TN0B 5ITFA 5B8CA 2XFXA 1W72L 3DRQA 4IIQB 4FG6D 4G6ML 5C0CA 4ZYKB 5D96C 4KQ4H 3QA3A 4KUCD 4C56E 2X9WA 3BD4A 5MI0C 2BJML 3MV8A 1T89A 4UV7L 4EOWL 5GRXG 3EYQC 4ORGA 1HZHH 1PKQA 1T7VA 4URTB 3VXSE 4JM2B 1KEMH 2R0ZH 4QXTA 3FO2A 4M7JH 3CUPA 4P2QD 1WSST 2X4OB 1UH3A 4K8RC 3NIGF 1QQDB 3D69A 3VXQB 2BSSA 4OCYH 3HMWL 3P4OA 4A2LA 2I9TA 5CEZL 2YKLH 2OI9C 3VXMB 2ZUWA 3SE3C 1FNGA 1B0GA 2ED7A 3KPNB 5C08A 3PWVB 2Y7QA 2HRPH 2F9BT 5GS0H 4RAUB 4MA8L 1CT8B 4M6NL 4MD0B 5ESAB 4CU7A 2F58H 4P49A 1JYNA 4G43B 3E1F1 1F97A 5I2IA 5JXED 3VXOA 2H2SC 3FQWB 4FQQB 1NCDH 3N50A 5CGTA 1T5WB 5CJXC 1JNJA 1S7VA 5I75B 2MQ0A 4FQHB 2UZXB 5IESH 5TFSH 2FHFA 4KMTH 3O3DB 2XV6B 4Y19B 3IDGB 4GKSA 1B90A 4NM4H 1T1ZB 2DQEL 2DWDB 1QKZH 4NP4L 4ZS6C 1LP9A 4MD4A 3VE0A 1CFQB 3O6LL 3KYNA 2PTTA 3MOAL 2MTPA 4XMKL 1XCQA 1S7RA 3ARGB 5HHNA 5JLZA 3WFHB 3QCUH 3ILPB 4FRWA 1HOCB 1WCQA 1UJTA 1RURH 4LRNL 4PJCA 4NQCA 4IOFC 4TSBL 2BHYA 1RZKC 1N59A 1I9JL 4O4YH 5C2BH 3BN3B 1YEGH 3MCKA 2AXGB 1NGWA 3IXAB 5HGAA 4HV8B 1AP2B 3O6FD 4I18A 1G7LA 1NAMA 2OJZH 1RZGA 5C0AB 4CN4A 2XZQL 1MWAB 3I9GL 2LVEA 4MA7L 1IAIH 1JP5A 5I17A 5EFIA 4PV8A 5I74C 3UJIL 3OG4B 4JPVL 2Y9RT 5LAXB 4KVCH 1EDQA 1AO7E 4AY0A 3BH8B 5B8CC 3IKCA 1SYSB 3CFJA 4QF1A 3LKSB 3D2UD 4QHLB 4OD3H 2LU4A 1DVFB 4I77L 1OQOA 5FHAH 5ACLA 5HDLA 4NUJB 1OPGL 1NCCL 2CPCA 4PJIF 3RZCA 1PSKL 4PP1D 1W8NA 3QDME 2OS7A 2FGZA 1T89C 1VGEL 2VL5A 4YO0A 4F7MA 4OZIA 4WY7H 4KDWA 5FYJL 4IRSA 3F5WA 3QULA 1AD0A 3I3EA 2KL6A 2OXGA 4MAYD 5F6IB 3GMNA 5MEQB 1INDL 5L2JB 5H35A 1CR9L 2PCPA 3UYOD 2WLZA 3O4LD 1DQJB 2EXYC 3MA9H 4YEFA 2IQ9H 3GO1L 4PJBF 3KAAA 4PV9B 2AV1A 3BN9D 4BZYA 4W6WB 4FQ1L 3V8CA 1DE4A 4FQXA 1LE5B 1QO3A 4BA8A 2LAAA 1IC4L 1OAYL 3VFVB 3CMOH 1RJCA 4OSUL 3KWWA 3GRWL 2WUBL 3MRHA 4XB8A 5FYKE 3T04D 3PDOB 2XWJA 4HX1B 5F8RC 2R1WB 4PGDA 3D3VA 3QWOB 1FRGL 4F9PA 1MCJA 5M95B 3BIBX 4HG4J 5A43C 1SVZA 5FF6B 3QXAA 5EUOE 4K2UH 4F7TA 1X5LA 3RDTA 3ULSA 2R9HC 3NTCL 4HWBL 4TNVK 1JPGB 1NDMA 3KLDA 5AWNH 3L7EA 4XXDB 3F7YB 1VA9A 5KSBA 2DLFL 1OGAA 2A83A 3BWUC 3K81A 3IFLL 5BJTA 1XF3A 3BZDA 3TA3D 4LSPH 4IS6B 2DYPB 3QIUA 5JMOC 1BFVH 3U6RB 4RMTA 2VXVH 5FO8B 5ACMA 5FYJU 5INCA 5IB5A 4G7YL 4YXHL 1FZOA 3QI9D 5CLTA 1RULH 2XQYK 3O3BA 4OLUH 4JFED 2QSTA 4GQPH 3F6LA 4XPBH 3GFUA 1INQA 2VXSL 4HLZH 5K9KB 3QUYD 3I02A 2P5WA 4HFWB 4I18C 4ODUA 1KT2B 4NZRL 5IB4B 3U1SL 3IJSB 4NPYB 1FC2D 4CGTA 4JHWL 3S3PA 4KDVA 3FFDB 3QUMB 3BEWA 1GOFA 2A77L 3C5JB 1YEKL 1A4JA 4Y5XC 4WTWA 5AG9A 4RCAA 4JPWH 1LK3L 1AXSA 1RZJL 1U8KA 1B0WA 2EDJA 1QOKA 4S11A 3D0VA 2GSIA 3TO4B 3T2NH 5EZIH 1NDGA 2X4PB 4XPGL 2P5EE 4QOKA 5J1SC 3PGFH 3DVGA 3M1BA 4HQQL 2MHAB 4RZCB 3VXRB 5E8EA 1I3GL 2AP2A 1G7MA 3NAAL 3BQUD 5J4MA 4F2MA 3EDDA 3MPCA 4MDIA 1F00I 2E8ZA 3GBNL 1ZHBA 4E41D 43CAB 5IVZA 4JKWA 4EN3B 4Y5YA 5CBAA 4JRYA 1B6UA 4XP9H 4XNYL 5CWSA 5IKCB 4F15B 2ARJB 1E6OL 3GIZL 4QCIA 2BVPA 2CO6B 3VDCA 2X6MA 3HC3L 5GPRA 1IM9B 4FQXC 2FD6L 3DRTB 3CXHJ 2H2PD 4DWHA 2HMID 1IEBA 4XWOD 1KFAH 1SY6L 2KH2B 4U6YB 4TVPD 3TYGH 3ZZ1A 5DC4B 1VACA 3T0AA 4UUJB 1CI5A 2Q8AH 4FP8H 1FNFA 4LAJH 2ZUYA 4JRWA 1FV1B 4PJAA 2VDNL 4EXKA 3VJ6A 2DM3A 5LWYL 2R23A 5KZCB 2EDRA 1A9BB 1JRHL 4F9PC 2OTWA 3HZVB 5ESQB 3TCLA 4JFPA 3B9KD 5ELIA 1FVEA 4LARH 4Y2DA 1RJLA 4N9GA 5CLWA 3ZO0A 1LHZA 5INDA 4JRXA 3ARDD 3RL1B 1NUFA 4KXZH 4LDOB 3TYFB 3UTZB 4ELMB 5DD1L 1J12A 5KW9H 1I3RB 3SCMA 5JO5A 4LLDB 4DQOL 1F6AB 3LV3A 4AQ1B 1DLFH 3MRKA 1JBJA 4HK3J 3RNQB 3FT3A 1GOHA 3MLUL 3QIUC 5ICXA 5C8JB 4RMRA 1RIUH 2BY3A 3R8QA 3BPOC 3VFWB 1QSZA 4MWFB 3QIBB 3VXPB 4P9MH 3FQUB 1SYVB 5DR5L 3QCTL 1G6RB 1ZT4B 2DQTL 3UX9B 5J57B 1LMKA 2QKIA 3MV9D 1KN2H 2AEIT 3LB6C 3VRJB 4AT6B 2RCSH 3VFSA 1FFPA 5DT1L 3BRDA 5E2UH 2MFNA 2YPVH 1KC5H 3RWFA 3LS5H 3VMPA 4IRJB 3M8OH 1CD9B 3P9MB 4MQSB 2O5XH 2BVOB 1NCAH 2JCCE 2DQHH 3SQBA 2XTJC 4YHYB 2M2DA 3WIFA 1NC4D 1VHPA 4HIJA 4KVNH 4F37K 2PW1A 2ZNXA 5T33H 3GMRB 5D2LB 1D6EB 5C7XL 3G6DL 4MAUH 3CK0L 5IBUG 2L0DA 1H3XA 3DPBA 2A38A 1JHLL 3O3EA 3BKMH 1R3JB 4Y5VA 4POZD 4XWGH 4WHYG 4NQSA 4ODTH 3LHPH 1L9NA 3ES6A 5J13C 1YC7A 5EU6D 4XAKD 5CEYB 1RD6A 3QRGL 4YGVB 3HUJF 5EOQH 4P4RA 1D7FA 1F4AA 4WTZA 1C7SA 3GSQB 3L5HA 4Y5YC 3RY5A 4MDJB 5FDWB 1G7QB 4XHJD 5DC0A 5E0QA 3RWIA 1KJ2A 1P7QB 1YEIL 2CSPA 3KG5A 1LE9A 5D2NB 3KPSE 3EYFB 3FRPG 2NX5B 5E8DL 2VZVA 2ZPKH 1JGUL 1T1YA 5IHZB 1YJDC 8FABB 5DJ8B 4JZJB 1FBIL 4MXQC 3WDIA 4P2OD 4KDTA 1H0DB 1LEIB 3IVKA 3STZB 2ITCA 1I1YA 3QEQA 1D6VL 1N5AA 1WUNT 3DTXA 2FGWL 1MOEA 1JZ5A 3RHWK 2O61B 4XB7A 4Q74A 3E6HA 2DLHA 1I4FA 5L2KD 4YQXH 1WIUA 4CAGA 4PGBA 4OIIL 1WWWX 4Y4KA 3ARED 1KN4L 1YC8A 4Y2DC 5EOTB 1B4JH 1JV5B 3BP7B 2YEZB 1KB5B 3NFPA 1AI1L 1BJ8A 4B50A 5EIQA 1EHNA 1P4IH 4UDTA 5CEXB 2IFFH 5JPNB 3SCMC 1UXSA 4MJIA 2XKNA 2RB8A 2IFGA 4U1SA 3QUXB 2VN4A 2I27N 4ISVA 2GJ6B 2L7JA 3OKOA 2G2RB 3T0EB 1ZHKB 3P4NA 4N8CL 1HEZA 3H9SA 5DRNB 1DBMH 1NFDB 4HKBB 4QNPF 3BYTA 3MXWH 3CFEA 2N56A 5FKAA 4GLRH 3NIDF 5E6IA 1NJ9B 3UTPD 5DURD 5I1DB 3MUJA 3LZFH 1I7ZB 1J88A 3KPTA 5F7FA 1OP3H 2NY6D 3OKDA 2A0LC 5EZOH 3REVA 3KPPB 4W70A 2H3NA 2OJEA 5J6HA 3QDGD 2BDNL 3TV3L 2NXZD 3OB0H 2QR0A 1VDGA 4YFLF 2GK0A 4DOHE 2KZWA 5DUMH 4BQCA 1HQRB 5F9DC 5E03A 5D1ZA 1HSBB 1AJ7H 5IVXF 3MJ6A 3A6BL 2P5WE 4HDIB 4XVUD 1DQDH 1SJHB 1I8LA 3DJ9A 4G3YL 5B39B 2Y25A 4P2RE 3C60B 3N1FC 1E4WL 4R4BB 1KLUB 4UIMA 2CK0H 1GIGL 4APQB 1VKXB 4QRTA 1ODAA 4PUBL 4WU5A 3S4SG 3C08L 3WBDA 3B9AA 4Y5VC 1T03H 5FECA 5GJSH 1TENA 1NGXA 2LE9A 1FE8L 2XTJE 4X6FA 4QXUL 5FUZH 2EDWA 3VFOB 2YA0A 4Z7WB 1MREL 5F1OB 4G8GE 4G6FB 2DM4A 4U1GC 4WI8A 3MLSH 1U42A 4NN7B 3X13B 2D4FA 2GJZB 3VGHA 3ZDYF 1CK0L 4KDTC 1K5NA 3EJZD 2E27L 3PF2A 3SDXE 5TJWK 1WBXB 2OR7A 3VFPB 4Q0XL 3P9LA 1DUYA 3MO1A 5F6HI 4YUEH 4RRPG 1BFTA 3O45B 5IF0A 2MCG1 1LGVA 3CFCL 4OKVB 2YBRB 1CBVL 3UPRA 2WIIB 4M1CD 4GW1A 5BZDB 3F7VB 2ICEB 4FHBD 4XAWH 3BHBA 4GG6F 5C09B 4K3DL 4RMVA 4LKXA 2C4FT 4J2XA 4Y4KC 4I9WD 2OZ4A 4ZO8A 2VLKE 3TP4A 3U36B 1TJHL 3ROOA 2XTLA 1Y0LA 4R0LB 2BNRD 4ODVH 1DL7L 4NN5B 1NBYB 1SMAA 2Z8VC 4JPKL 1MQKH 3HG1E 5JR1L 5DO2C 4LPWA 3ZKMD 43C9B 3WMSA 1AQKL 1F11A 4HKJA 2OL3H 3TT3H 4D0DB 1I8IA 4JRXE 1EZVY 4J3SA 4PJ9B 4CMMA 5H94A 3KPQA 1K6QH 3LN4B 2JB5L 4HUKB 3O11B 3ZYJA 1A6WL 1WAAA 3QNXA 5E6IC 5ERWB 3C2SA 1ZS8B 3MBXL 4U1HB 4R97C 1QUNA 3MYJA 4RGND 4R26H 3INUL 3HRPA 3C9NB 1MRDH 1F3JB 4L8SA 1RVFH 1YN7B 2RBLA 3VWJA 1LO5A 4HW6A 4MNGA 3UO1H 4JY5L 5TPWL 1CICA 4TPRH 5L88L 4WFED 4LSTL 2DI7A 5JW3H 5DJ0B 1M7XA 3I6GB 5T5FH 3MUY1 4UDUB 2B7DT 2ZCKL 4LSRH 2AV7B 1QR1A 3BXNA 5DA0B 3STBA 4NM8L 5DLML 2YPLB 4YBQD 4UINL 2EE6A 3AC0A 5EUKA 4ZAKB 2FWOB 3HAEA 1XGRB 4P5MB 1NMAL 1ZA3B 3TVMA 5HDQL 3O9WD 4NRZB 1BM3L 1MEXL 1QR4A 2KDGA 2MJWA 3RA7H 1T4KA 5IB2A 1M6OB 1WVZA 2ICWA 4HIHA 5I1CL 4PLNC 3GM0A 3QPXH 1FZMB 5JIKA 5DI8A 3VMOA 3U2SB 5CJBA 4U4BA 4PY7A 4Z18A 4TVPH 5SX5K 4JFXB 1CQKA 1IILE 2XRAH 1MJUH 2FIKA 3BFOA 3I6KB 3B9VA 3GHBL 2G60H 3MRFA 4YXKH 4HGKC 2EIZA 5BRZD 5MEPA 4KK8D 2IMNA 4QLRA 3V5DA 1JTOA 1VFOA 3VI3F 4YHKL 2FX9L 3RWJA 2Q8BH 4I3RH 1UYWL 5DJCA 2AKRA 3NBNA 3L1OH 2ICCA 4GH7B 3VFMB 4M61A 4FQIH 1C7TA 1MCNA 1G7IA 2X4SB 3SE8H 1TCMA 4OIAA 4LSQL 2FH8A 3FRUA 1IE5A 1MF2L 4WI3A 4PJXE 4RGOL 4KQ3L 3T4YB 3PL6D 1KG0B 4NQDD 1OP5H 3HI5H 4ZFFB 5JW5B 4YHMH 2CDFB 4ZS7L 1KCUL 2D31A 4WFFD 2DQJL 2QHRH 3BDBA 1RUPH 1MHPL 5EBWB 4LCYB 4OFPA 3TPUB 1Q9OB 1JGDB 1LEGB 1F8TL 4C4KO 3ULVD 2CIIB 1KJ3L 3DVIA 5ID1B 2VC2H 4HKXA 2NY2B 4OI9A 5D7IE 1S7SB 1U8LB 1U91A 3RY4A 3GBMH 2AVGA 4L8SC 2DKMA 5ICYB 1G9EA 5A2FA 4Z7UA 3UEZA 3VCLA 3VWJC 2DF3A 1CICC 1G9MC 3IU3B 1H3WM 3LQZB 1P2CA 3OHXB 5TH2A 3UZEA 1MCWW 3LRHA 1CVRA 1MFDH 1TNMA 5JUEL 1G9NL 1K4CA 1J1OH 2QQLL 3DURA 2KZ1B 2BSRB 4LSSL 5GRVL 1OSPH 4X98B 3RWHA 1R3HB 3CDYA 4QXGH 1FGNH 3W0WD 3VWKA 4C58B 2CK2A 3QWRD 3L5JA 3MLRH 3AGVA 3S3JA 2BOCA 3SGKC 3TVMC 5D7LA 1X6NA 5L9DL 1J10A 4F8TA 1BGXH 2IAND 4D94A 4JFFB 2FEEI 1IAKA 1KTDA 1KIRA 4TTDC 4ETYA 1CDIA 1IL1A 4RBPK 4H88L 1FFQA 2LAGB 1A6UH 4C83B 1GC1C 4O2FA 3WN5A 1KGCD 1FVDA 1OAUH 1Z0MA 1BZ7B 3GMPB 1K8DB 3GZKA 3I75A 2Y5TA 3RVUD 2E5EA 4OUUA 5JQHC 4WO4A 3VXNA 3ZKSD 5EZLB 4W6XB 1KYOK 5FGBA 4O51B 3RWDA 3RIFK 5K59F 2EYRA 5ITBL 4JREC 4L3EB 2ZSWA 3D39A 3N06B 4UV4L 5IGXL 1R3IH 4HBCL 3MBEB 3NIFF 4HC1L 4X6CA 3RX7A 2QQNH 5HGBB 3NCFB 5FO9B 2D7MA 1EH9A 5GGRB 5DUBA 5C3TA 1YEHH 3P0VL 5ESVB 4FFZL 4PRID 5B38B 4P5TA 1GXEA 4X5LA 3KJ4C 5D7JD 2FATH 1EGJH 3MJ8B 3AS3A 5EPMA 5GRYA 1ZOXA 3TH3T 3FONB 1P69B 2VL4A 1A9EA 2C26A 2VZUA 5DEGB 1L7IH 1II4E 2BFVL 4MJ5B 1MIEH 5KOVC 3VG9C 1XF5B 2FZ3A 2P45B 1KV3A 1RK1A 1T22B 3ELAT 3DGGA 2V2XB 3X14A 5FB8A 4X99B 5LXGL 2KQNA 2PYED 5D4QA 3QO1A 2F54D 2HTLC 3PDDA 2P24B 3OR7A 1NAKL 3S5LG 3B5TA 3SKNA 5SV4A 1OARH 5TF1H 2W0KA 1QLFA 3TN0A 5IFHL 4IIQA 4HPYH 5C07E 2W92A 5ISZD 1L0YA 1OTTC 1JNNL 5GGSB 5KVGH 1WAAE 4TOYL 3C5ZD 5I0DA 3ZSTA 1GOGA 3PWUB 1TMCB 2Z93B 1WZKA 2IPKB 1HI6A 1CE1H 1ZGLM 4M3KB 5KSAD 2BNQA 4ZFOL 4P3CL 4JM2A 3IDXH 3L3DB 2Z92B 1CXKA 3HNTH 3OKEB 4U1KB 3IJHA 1I9RL 4D3CH 1BEYL 3MJ7A 1QQDA 1YNKL 3LKNA 3VXQA 3RKDC 4XMLL 5KSUB 5E1HB 1GGCH 5K9OA 1MVFA 2JE8A 2EO1A 1CFVH 4P57B 4OQTL 3VXMA 4Z7VE 3KPNA 5IWLA 4ZFGH 5FO7B 3R4DA 1RUAL 1DBAH 1E28B 1HSAB 4RAUA 3WN5C 4OZGE 4MD0A 5ESAA 5ADOL 4G43A 4N8PA 4YFEA 1DZBA 4WO4C 5CD5C 2J8OA 1N8ZB 3O2VH 3FQWA 4FQQA 3BZFA 1T5WA 5FGBC 2J8UF 2RFXB 3F7RA 3G5XA 3B4NA 3TFKC 1I85A 1T1ZA 2X9YA 3UROR 3VXUD 1NBVL 2J6EH 3FAWA 3T3MF 4P5TC 2FIRT 2ORBL 1UXWB 2P4AB 3BPLC 2X41A 5E9DD 3ARGA 1QD0A 4RISL 2NXYD 3WFHA 1M71B 1TZIB 1EGJA 4NKQB 4NRYB 5GJTL 5GRUL 3ILPA 1ZT7B 1CGSH 1HOCA 4LLMB 2ESVB 4Z7OF 3MNVB 2CKBB 4JG0H 2C4XA 3TT1H 3EOAB 2CMRH 4MNQD 4TUKL 3VFNA 3HC4H 3QNZA 2AXGA 3IXAA 1XR8B 2VRAA 4OJFL 4RFNC 4HV8A 3RL2A 1AP2A 4YAQB 5BV7C 1KTLB 1QHOA 4KJPC 5C0AA 1MWAA 1NCUA 3CFKB 3RIAF 3KXFE 3OKKB 4GFTB 1BJ1J 5D5MB 1T66D 3T09A 4I2XE 3TN0C 4IIQC 1SYSA 4DZ8B 1W0VB 1DVFA 4NNXA 4JM4L 4DFHA 3LD8B 4R4FH 1YNTA 4GQ9H 5C0NC 3N1MC 4M7ZB 1KPRB 3NCCB 3BISA 3TPKA 1QPPA 1T3FB 3T8XB 5DYOB 3HPLB 4LP5A 4JM2C 5MEQA 2VLRD 5L2JA 4XC1H 2HFTA 1A1MB 3BO8B 1CDCA 1UA6H 5FHBH 1DQJA 4WI2A 2H41A 5DJDA 3VGGA 3KNBB 5E8PB 4M5YL 2XZCL 3TBWA 4BZ1L 4FTVD 5IWLC 2B5IB 1LE5A 3MRGB 3MRQB 1ETZB 4ZUTA 3VFVA 5CZXD 5HYSB 3MROB 1BVKB 5JHDB 4KK9D 3PDOA 4F7EB 4HX1A 4E41E 2X05A 2Q7NA 2YZ8A 2AK4B 4PRHB 3QWOA 4UAOC 1EHLH 4NHCH 3K74B 5T3XD 4XBGB 1NSNL 5KS9E 1ZLUH 5IEHB 3WNOA 1I85C 4J7RA 1JPGA 3CXDL 4NDMB 5GGTH 3E2HB 1F5WA 3L95B 2SEBB 2V7NA 1GVIA 4GW5B 3F7YA 4HJ0C 5J9PB 4TVPE 4X6EB 3DUUB 3HE6A 2R4RL 3ARGC 4OZ4A 5I18L 1J1PL 3RU8H 4IS6A 1U6AL 5EU7E 4Z76B 5JOFB 4OF0A 1BZ9B 2PXYC 1LQSR 3U6RA 3MLYH 3ARFD 5FO8A 1G6RH 2W60A 4ZMAT 2C4FU 3H3PL 3MV7B 5EA0H 4XNXH 5I6XC 2X4QA 1Q9KB 5I8KL 1EV2E 4MZ2A 3A0OA 2DQCH 2YD6A 1IGFH 1TJGL 5K9KA 1RUQL 3QPQC 4B0MM 1HHKB 4U3HA 4HFWA 1KT2A 4ENEC 5GISL 4KKBD 5IB4A 3IJSA 4BSVB 4ZSOB 4NPYA 5K93A 4PJ5E 3ULVH 4R3SB 3FFDA 3QUMA 2HH0H 3NABH 3F58L 1C5CL 3QH3B 2V17L 3VMNA 1PX4A 2VXUL 1A7QH 3LVEA 1N0XL 1I1AB 3CH1B 5KVMC 1JYWA 1G7PB 3B6SB 5JIIA 1IGCL 1DVFC 3R1GH 3HE7B 5FA3B 3ZKXC 5IW6B 1NCBL 2X4PA 3MV9E 2YUVA 4F58L 1VADA 1EMTH 4JFDB 4HWEH 1UCBL 3HNVL 1AGEB 4PB0L 2PW2A 2W9DH 2HWZH 2MHAA 4RZCA 1U95B 5EWIH 3H3KA 3QJFB 3VXRA 3DROB 1ORQB 2FJGB 4OD1H 2WZPD 1HIML 1CGWA 1KACB 3C5SB 3U0PB 2WBJB 5AAMA 1IM3B 1VGKB 3RY6A 4HBQA 4KRPB 5FYLH 3LEYH 1A1NB 2YD9A 1U8OA 4FZ8H 4P46A 2OR8A 4EN3A 4HCRA 1MVUA 4UIKH 2R0LH 5I1GH 5IKCA 1F4XL 4XCCL 3SGDI 2ARJA 4L1HA 2ZCLL 5H2BB 5HDBE 4YH6A 1MHCA 2CRIA 1UKSA 3SJVA 1IM9A 1YA5A 4L4VB 3LRSB 5F96H 3MLZH 3DRTA 1F58H 3V9FA 4JCMA 4UOW0 4IJ3B 4ODXB 3ZHKA 7FABL 1AXTL 3TBTB 1NFIB 3U9PH 5LVEA 2XN9B 3OB8A 4N5EC 5AZEL 5GS3A 3EDEA 4H8WC 4KROD 1G7HB 1R0AL 4UUJA 3ORJA 4NO2B 3QHTC 1UWEL 5EU6E 4XAKE 1FV1A 2DBLL 1I7UB 2ZG3A 4XPTL 5DHYB 2VKXA 3LH2L 1A9BA 3HZVA 5ESQA 3IKKA 5EC2B 5IG7B 4WWKB 4G9FA 4JHAL 3HZMA 1K85A 2DMCA 4Q9BA 4DKEH 1KB5H 3RL1A 3TYFA 2CLZB 3MGAA 1UWGL 5JORA 1I3RA 3DNKA 3CXHK 1FG2B 5F3HB 3IYLW 3WFCL 4Z0XB 4LLDA 4YR6A 5HGGS 2E6QA 3HE6C 3U30C 4BQ6A 3Q5OA 3TIDB 1F6AA 1N6QL 3N85L 3BKYL 4NWUH 2AW2A 3RNQA 4GAFB 1SEQH 5C8JA 4JO3H 5EIVA 2LTQC 1A6TB 4OLZL 3VFWA 4Y19E 2NY5L 4MWFA 1L7TH 3VXPA 1BMGA 2VDOH 2JJWA 1TXKA 3T1FB 4DN4L 3RQ3A 2EDOA 2EEBA 1SYVA 3EIFA 5I0ZA 1ZT4A 2VZOA 1S7WB 5FYKL 4OGYH 1HILB 1CZ8L 1FFNB 4XMPL 2FLRT 3S35H 3V4PH 1UQSB 4N0UA 4LASL 4J3VA 4U2YA 3VRJA 4AT6A 4ZQKB 4GKOA 4YK4B 4JO4L 2WUCL 3MODL 1N5YL 3HPJB 4IBLT 3CVHB 1U3HB 2W65B 3ARQA 3OAYK 4XPFH 4J4PA 4KMLB 2YHGA 2CUIA 3JVGA 3ZDXE 4IRJA 3P9MA 3EZJB 1KIUA 3V0AC 1J0YA 2BVOA 3DWTA 4X5XA 4ZO6A 3A6CL 3UTPE 4P59H 5CHNA 1A7PH 1HYRC 3GMRA 4EVNB 5D2LA 1D6EA 3ZHLA 1FYTB 5E99L 4LCWD 4OBSA 3WE6B 5GS1A 3O2DL 1DEEA 2QLVB 1IGJB 1R3JA 1G7JB 2FL5B 2KBGA 4ESKA 3RY6C 1GGTA 5A2JH 1S7TB 5CEYA 5DD3H 4P46C 1KBGL 3GSQA 2UVEA 4EN3C 4MDJA 1G7QA 5D2NA 1TVHB 1WZ1H 3EYFA 5FGCB 2NX5A 5SX4H 5IHZA 1YY9D 4A6YH 2EH8L 3AROA 4KAQH 1QSED 4WEUD 8FABA 2GIYA 5DJ8A 4JZJA 3UTQB 3T3PF 5ALCH 1KIQB 5CGYC 3STZA 5CSGA 3OGCA 1CL7L 5HHQA 3RGVC 4E0RB 5CILH 3NZHL 1BWWA 3ZE0E 4PJFE 4CUCA 4FXGA 2O61A 1A7NL 1PX3A 2V5YA 3F7PC 2YD1A 3H7BA 3LSOB 5CBEB 1A02N 4Z6AT 4YDKL 3MRPB 4YHZL 2D4DA 4DEPB 2V6HA 3BAEL 4ZPTA 3RVTD 5EOTA 5KTEH 2HJKA 4PS4L 3OZ9H 2P8MB 1JV5A 2YEZA 1EVUA 2VKWA 2YMXH 1PD6A 3OPZH 4CU8A 5CEXA 3DMMB 5JPNA 4DW2H 3QFJB 1KCVL 4CVXB 3GHEH 3C6LA 3MYZA 2GJ6A 1X3DA 2G2RA 5IB1A 5I15L 2NR6C 3KR3H 5DRNA 1O0VA 4D9QD 2AERT 1NFDA 2ZUTA 1W8OA 1YYLH 4QRSB 2F53A 4I9WE 1NJ9A 5CSZB 2EEAA 1I7ZA 3PGDB 4WEMB 2PO6A 3CLEL 4NZJA 2OQJB 3G04B 3QISA 2BNRE 4DGYH 3PWLB 1PZUB 4M43L 4XPAH 3MACH 1VEPA 4DN3H 4J4PC 1WZMA 1NGQL 1EZVX 3JVGC 3IAPA 5EN2A 3WL9A 1ZK9A 4IRJC 1FNHA 3ABZA 5IMKA 2FX7H 3QG7H 4HDIA 2AJUH 5T3ZD 1J5OH 5TDPB 5KAQF 5EUOF 5B39A 3MZGB 3O6KH 2NZ9D 5GZOD 4EZMA 5D1QC 1FSKB 1KLUA 3WKML 3T1WA 5ANMB 4APQA 1QYGH 2VWEC 4KTYA 4MXVF 1VKXA 5DQJB 5GS1C 2VUYA 5C9JB 4X9HA 4ORZC 4XVJH 2B4CL 2ZUVA 4LCIH 2VXTH 3TJHC 1MNUL 3GB7B 1ZGLB 1WGOA 1LD9B 2UY7A 3FHQA 3FO0L 4K7PY 3WIHH 4W68A 5JXAH 2N1KA 3P11H 3F65A 4NKIH 1BHGA 3VFOA 1UZ8B 3WHXB 1I75A 2FLBT 1MCBA 2R2CA 4OV5B 1FQ9C 2EDDA 5D2NC 3IDNB 1W72B 1C5BH 4K3JL 3B3IB 5JQ6H 4FQLL 4JZJC 4JR9H 1DQLL 4KC3B 2K1MA 3GSVA 1A7BA 5L8LB 1AGFB 3CVIL 4PB9H 1KCSH 4NC1E 1WBXA 3TZVD 3VFPA 1X5GA 3AS0A 4M02A 1T21B 2JKXA 1DN0B 1MFBL 3FFCD 4N8VA 2OCFD 3O45A 2Q3AA 3HKFA 2YBRA 5KAQG 5EOCH 5BZDA 1T7YA 4CW1B 1X5AA 2ICEA 4KPHH 2E7HA 5JZ7C 5C09A 5T3XH 5DMIH 4KU1A 2EE2A 2VLJD 2QADC 2VLMD 3HR5B 3K2MC 4LHUA 1BIIB 3SDAD 5C0EB 3U36A 3P30H 3P4MB 2HT2C 3EO0B 5IBLC 4GMTH 4KQ4L 4OGAD 1VFBA 4R0LA 3BWAA 1Q94B 1T0MB 3C6LC 4WI4A 1D9KB 5I1HH 1TZGH 3L5IA 1LO0H 1HZHL 1J87A 4BK4A 3O81A 4MQTB 3D0LA 1N4XH 5DMGC 4HUNB 1KEML 2R0ZL 4PJ9A 1FL6B 4M7JL 4EUPB 4V1DD 3IJYB 3LN4A 4ELME 1JTPA 4WW1B 1JRHI 5SWSD 4OCYL 1X4XA 5ERWA 4X5WB 2PO6C 4G8IB 4U1HA 2YKLL 3K1DA 1PQZB 5CJQH 1HWGB 4WVRA 3O8XD 4U1LA 5DJXB 4RQQB 1YPZB 4RIRB 1F3JA 2HRPL 1YN7A 4Z0BH 4NZUH 5GS0L 4YEEA 1NLDH 2F58L 2PN5A 1OQXA 2NY1B 1MCKA 2I25N 4CU6A 4OF8A 4PJDB 4WFFE 3I6GA 1NCDL 3P77B 4S1DD 2JIXD 4YFLI 2F8XC 4UDUA 5IJVB 2AV7A 4XNMB 2Y07L 5IESL 5SWQB 3ULVE 1LNUB 5JTWA 5TFSL 2BNUA 4NM4L 4APQC 1QKZL 2YPLA 4QRQB 3WS3B 1WIOA 1NGYB 2FWOA 4NGHH 5HI3D 1XGRA 5HTSA 5I30H 1ZA3A 1Z9OA 2BP3A 5KSVB 4NRZA 3TF7C 3IFOA 3RKPA 1HYSD 1YQVH 5LGHH 3BGMA 4PJIE 5GRVK 3SDDD 3QCUL 4NJAH 5IR1B 1FPTL 4ZOCA 1RURL 3RWGA 1RZFH 2VWEE 1LP9F 1FZMA 4EDWH 1QFPA 3FJTA 4PREB 4NN7C 5TE4H 4O4YL 4DK6A 1YEGL 1P6FA 4LU5H 5FYLE 4JFXA 1WLHA 1YMMB 3MNWB 2YN5A 3I6KA 3C6SA 5FUCE 3PQYB 4GG8B 2OJZL 4NKMB 3LQAC 5MHSD 4PJCF 4FQCH 3LS4H 3Q3GA 2IANE 4WW2B 1IAIL 5J06A 5T1LB 2BCKB 4NSKA 5IIEB 5FK9A 3BGAA 3K0WA 4KVCL 1KGCE 1QSFB 1DBKH 5IEKA 2QTEA 2LABA 3EGSB 4OD3L 3NH7H 3BUYB 5CUSH 4R0LC 5FHAL 2X4SA 4NN5C 1JYXA 3UAJD 1BLNB 5CP7A 3T4YA 2KPNA 3UTSD 2J4WH 3ILQC 3DOSA 1ROWA 2BXYA 4JY6B 4PG9B 1KLFA 2IH3B 1KG0A 1PBYA 2DWEB 3AU1B 1HE7A 4GO6B 4ZFFA 5E2WH 5MI0B 5JW5A 4PJ9C 1T0PB 2CDFA 2Q6WA 1IFHH 2DQUH 2X1PA 4L4TD 4U1MB 5CCKH 3MA9L 4DGIH 3RGHA 2IQ9L 4C54A 3VGBA 4LCYA 3TPUA 2FJFB 1JGDA 1LEGA 4R90H 4OLXL 3HR6A 4IMLB 4QRPB 2Z4QB 2GJ6E 2D03H 1EJOH 3BH9B 5DRXA 5ID1A 1NC2D 2IADB 3T0EE 4OF6A 1S7SA 1U8LA 3IDIB 4LPTA 4Z77B 3FQRA 4KFZC 2YA2A 3CMOL 2OI9B 1HHJB 2J5LB 3ARBB 3QZWA 3IU3A 2Y6SC 3LQZA 4GT7A 1KTKE 5E7FA 4EI5B 4MMZC 3OHXA 5FAAA 2X89A 5HHOB 4I5BA 4HK0A 2R69L 5GZND 4KTDH 4WUUB 1Q1JH 2BSRA 3BE1H 4K2UL 4QHKJ 4QRRD 1WCBB 1GHFH 4DFIA 5AWNL 3EO9H 3MRRB 1NUGA 4GBXB 5ISZE 4KHXL 4O2EB 2IBGA 3H9HB 4JFFA 1MIML 4LSPL 2M8XA 1X7QA 3BDYH 1BFVL 4C83A 3OF6D 4ZPVA 2VXVL 1BZ7A 5C0RH 3GMPA 1K8DA 3TNMA 4HGMA 5KSBF 3EYUH 1RULL 4QYOB 1TCRA 4OLUL 5EZLA 3O4LA 4HSQA 3BIKA 4XPBL 1A4KB 3H3BC 4O51A 3QHFH 4Z7WE 4L3EA 5KVFL 3SKMB 4K9EH 1MI5B 5HHMD 4N90E 3PWPB 2RGSA 3RAJH 2QSVA 2VQUA 2BSTB 5FO9A 5GGRA 3QQ3B 2X4RB 4BFEA 2XA8H 1FORH 4JPWL 5ESVA 2AJ3B 2BX5A 3DO7A 3IT8D 4LLYA 4OLWH 3T2NL 5J1AB 3MJ8A 5EZIL 2P7TA 2ICES 3GI9H 3FONA 1Q72H 2CKBH 2V2WB 3K8LA 3PGFL 1OWWA 2VE6B 4X6DB 5E5UB 5B8CB 3JWOH 5DEGA 2YUZA 4MJ5A 1XF5A 2UV3A 3C2AH 2EDYA 5IFJB 1T22A 5TDNB 2WMPA 3VXUE 2V2XA 1I1CA 4P9HH 5IBTH 1I8KB 4X99A 3CZJA 4QHUB 1ZLWK 4CMHC 4XP9L 4ORGB 4YHLH 4QTIH 1C5DA 3H7LA 1H8SA 1PKQB 5EO9B 1U8IA 3QQ9C 1UEYA 1WZLA 3S4SB 4WUKH 3ARXA 3W11D 3SDXF 4BJLA 2I9TB 1I3VA 1GZQB 1YEEH 4NJ9H 3M07A 1KFAL 2W0FB 3QI9A 5EO1B 3TYGL 5GGSA 4MNQE 5JHLH 2Q8AL 1J0HA 3S98A 5CKAA 4D9LH 5CS7A 4LVEA 5GSRA 3PWUA 2Z93A 5BS0D 2K7QA 4NYLB 3CH8A 2IPKA 4YDLC 1H8NA 3I85A 3UTTD 4LARL 3UPAA 1BWMA 4C55A 1F3RB 3FOLA 4U1KA 4FFVD 3GSWB 4MNHB 5LQBH 2DQFB 5KW9L 2X70B 1E4XH 4HHAA 2A6KB 4PJAF 5KSUA 3SDYH 3RVXD 3AS1A 4LPUA 4OCSH 2EDNA 2DLGA 4TSCH 1A6AA 3ZHDA 2FRGP 4P57A 1TVDA 4XX1E 5JIPA 3IS1X 3TIEB 1TLKA 3UTOA 1DLFL 3W81A 4PP1C 4DAGH 3ESUF 4PBWD 1RIUL 3GNML 4TTGA 2ADFH 1E28A 1HSAA 4P9ML 5HVFB 1CXIA 5HHNB 2VLRE 4XP1H 1NGZB 1KN2L 2YRLA 3ARUA 1N8ZA 2HKHH 2RCSL 5FEBA 2RFXA 1WT5A 1PJ9A 1N59B 1CD1A 4OM1H 5IK3A 4M7LH 4GAJH 2DLEA 3JTSA 4C56D 5E2UL 4FTVE 5HGAB 1NGWB 2YPVL 1KC5L 5HY9B 3LS5L 3S36H 3M8OL 4HS3B 5D1XD 1TTGA 2ITDA 3ZTNH 2O5XL 1NCAL 5C0FB 2DQHL 3X17A 4YJZL 4H1LH 4PRPD 3AS2A 4I13B 4OZFH 1M71A 1TZIA 4PPTA 4NRYA 4KVNL 4Y5XB 5BVJB 4DZBB 5T33L 1ZT7A 4LLMA 4PV8B 1N64H 5EFIB 2ESVA 4QHMB 4MAUL 1RZ7H 3B9KA 2FJHB 2ICWJ 4QF1B 5D72H 1B6DA 4JQIL 1YEDA 5T3XE 3ARDA 3BKML 3L9RB 2Y36H 2VZ3A 2DTSA 1QBLH 5EOQL 4J3XA 1PYWB 1KTLA 3Q2CA 5FM5M 2VL5B 2Z8SA 4OZIB 1I1RA 3TBVB 5C0BB 4PJEB 1AD0B 1S3KH 1I7RB 3TA3C 3GMNB 2ZPKL 2CQVA 5D5MA 4ZDHB 4QNPE 4Q6YA 4S1RH 4L29B 4CADA 1PY9A 2UWEA 1EUUA 4MQXC 4DZ8A 3PP3K 1W0VA 3QI9C 1MLCA 4HLZG 3LEVH 1MY7A 1Z3GH 3QUYC 1OT1A 1VSCA 1KPRA 4ETQB 4YQXL 2EDTA 1MCQA 1S7UA 1T3FA 1XMWA 3QDJD 2MMXA 4JN2B 5DYOA 2NY3B 3IDUA 5CJOH 5F7LB 1B4JL 4HUWA 1UACH 1A1MA 3BO8A 4PGDB 5GGQH 2V2TB 3D3VB 5IVXE 1P4IL 2IFFL 1MFEH 3SKOA 3KNBA 4LAQH 1CDYA 5E8PA 3QXAB 4NZTL 3NCJH 2MKWA 1NDMB 1DBML 3MRQA 3L7EB 5DFVD 4YDIH 5ADPH 3MXWL 4I0PD 5FGRA 3ULUC 5HYSA 3IDJB 3MROA 1BVKA 5BJTB 1P84J 2FH6A 3LZFL 3WJLA 1HNGA 4F7EA 2WANA 5B3JE 3QIUB 1QFWI 3EHBC 4OZHB 3N1PC 3BPOB 5EZOL 2X4TB 4Q97A 1WT5C 1B2WH 1FDLL 1CLOH 2VISB 4XBGA 5IB5B 5INCB 1FZOB 5IEHA 4KJQD 1KXTB 4LCUA 1JPTH 5F1NB 3G6JB 4NDMA 4P2OA 3L95A 2D7OA 2R2BA 2SEBA 5DQDH 1BAFH 3I02B 3QDMD 4GW5A 4XWOC 5JOPD 1AR1C 2JJTA 3DVNB 5J9PA 4DKFH 3NGBC 4X6EA 4YC2B 3DUUA 1TQBC 1MCEA 2BVQB 1ZSDA 3BEWB 4W4OA 4Y4FB 1DQDL 4NNYB 3FN9A 1VERA 2QQKL 5JOFA 3ZL4H 1EXUB 4GG6E 4W81A 1U8KB 2CK0L 3B9KC 4I3SH 3AREA 3MV7A 3S88L 2GSIB 3ARDC 4J12A 1IGYA 1MCDA 4X83A 4YPJA 1T03L 1Q9KA 3EYQD 3FT4B 1NDGB 5GJSL 3FN3A 3FN0H 4JDVA 5FUZL 1HHKA 5E95B 1YDPB 3D1MC 4BSVA 4K8RD 4ZSOA 3CVHH 5E8EB 4D9RD 4R3SA 4Z7NE 3KPRB 3QH3A 4F2MB 1R3KB 3TWCH 5FYKD 4MDIB 1I1AA 5FM4A 1CLZH 3BD5A 2JJSA 3CH1A 2HN7B 5HI5D 4KH2A 1GH7A 2EEDA 3B6SA 1EUTA 1DQMH 4P5KB 1HQ4A 3B2UC 3KS0H 4OGXH 5CWSB 1S5HB 3HE7A 3Q5YA 2VDPH 5FA3A 4YUEL 1FN4A 4JFDA 1AGEA 4M7ZC 4CN1A 5IV2B 3QDGA 1ZMYA 1U95A 4XAWL 2NTFB 3DROA 1ORQA 2FJGA 4QGTA 4AYFA 3C5SA 2H2SD 2WBJA 1IM3A 1VGKA 2GY5A 2EKSB 3WO4C 4RWYL 5KANG 3QXDA 3QUKB 2R23B 4OCWH 4ODVL 4S1QH 4BH8B 3LPFA 2FB4H 1MCOH 1MQKL 4ZS6D 4Y2DB 2IEPA 1RJLB 4JE4B 4N9GB 5INDB 1R24B 1T83A 5J1TC 4JQXA 1FNSH 3TT3L 2B5IC 2OL3L 3LRSA 2NQCA 3OAZK 5E5MB 4HAFA 4ODXA 4J8RB 1KSRA 1K6QL 4U2ZA 5F7NC 4POZC 3G5ZB 2XN9A 3SQOH 3EOYG 1G7HA 4IOFD 3VH8G 3MRKB 2JJUA 1T7WA 1XIWB 1I7UA 3HB3C 3GK8H 5ICXB 4AEIH 4IDLA 4R26L 1WFOA 5DHYA 5FA4B 3NFSH 4HF5H 4MVBC 5EC2A 5IG7A 4WWKA 2QJDA 3DXAB 3MRNB 2HT4C 3FQNB 5E56A 4PJHB 3C87A 1QSEE 4LVOB 1FAIH 1SEBB 1WAAF 2CLZA 4PRBB 4P2OC 4XNUH 3E2HC 3UO1L 1OB1B 5SX5H 4TPRL 2XQBH 1JNLH 1FG2A 3GKZA 3DX6A 5JW3L 2JJTC 3VW3H 4Z0XA 1RMFH 1XZ0B 5T5FL 4KJYB 4W4OC 3TIDA 4LSRL 4EKXA 3RWFB 5C0CD 5LJYH 4DKAA 1FFOB 3AY4A 3MV8D 3JWDC 3T1FA 3AREC 3WXVH 3KYKH 3TBYA 4E5XB 1FFNA 4JG1H 1UQSA 5GRJH 1C16B 5DJ6B 1ZKAA 2NY0D 1GZPB 1JGVH 3RI5K 1QFOA 4S2SB 3D48R 4ZQKA 3RA7L 4UI2A 5IVNA 1IT9H 2NW3A 5LGJB 3HPJA 1FO0A 3F62A 1V7NL 1U3HA 2EXYD 3IDYB 4OZGF 4LKCB 3NPZB 4D9QE 1I1AC 4AMKH 2JJSC 1CXHA 1EVTC 1VFAB 5F7UA 2Z91B 3VD3A 4TVPL 2F74A 5E8NA 5C08D 1KEGH 2XRAL 1OVZA 1MJUL 4KHTH 4U1GB 2FECL 1IC5H 2G60L 4YXKL 3W39B 1FYTA 4K94H 2UYLB 2NXZC 3RVVD 2Q8BL 1IGJA 3CCHB 4I3RL 2WBJC 3DTXB 2RQ8A 4KRPC 3L1OL 1S7TA 4LEOB 4FQIL 4R2GB 1I4FB 2R1XB 2E7MA 2X44D 3SE8L 1CFTA 2EDBA 1TVHA 2HJLA 2IALA 5DJYB 1ZLVK 4LLQA 5DVLA 5T3ZE 2R4SH 2WV3A 1K2DA 4JQXC 4G7VH 3I6LE 3NFPB 2D0HA 4ZO7A 1FZKA 2WWKT 5F9OH 1KIQA 2W9EH 3HI5L 4JO1H 2XIDA 4IJ3C 4X4MA 4YHML 2VDMH 4E0RA 4UV7H 1BX2B 4EOWH 4U1SB 5E00B 2QHRL 4NQCD 3O9WA 1RUPL 2J88H 4K7PX 2ZUQB 3QR2A 3LSOA 5CBEA 4LVNC 3H9SB 1EX0A 5E5RB 3MRPA 1H3GA 2VC2L 3ZYIA 4F3FB 4WWKC 2E3VA 3GBML 4WI9A 4B41A 5MERB 4R7NB 2P8MA 5DQ9B 5D70H 1EFXD 4LHQB 3PXHA 3S36X 5JHDE 2ZCHH 3BYYA 3DMMA 2DI8A 5DK2B 3QFJA 1ZE3C 2OJEB 5GQBA 2AK4E 4PRHE 5K59E 4FN0A 2X10A 3QDHA 5BRZA 5GS2H 2C3WA 3FFCE 1MFDL 3NIFE 4M93B 2JELH 1EO8H 2YD8A 1AKJB 4M3JA 1J1OL 2GK0B 3SE9H 3VXTB 1IQDB 5HYJB 3JUYA 5E4EC 4Z7UF 5IVOA 4EUPH 3U4AA 5EU3B 3HHRB 4YDVA 3KHQA 1OSPL 3AY4C 5LG1A 3RZCD 4QXGL 4QRSA 1FGNL 3KPSD 2VLME 1JI2A 5CSZA 1JGLH 3T2QA 4Y1AB 3PGDA 4MX7B 1QNZH 1G0XA 4LNRB 4IRSD 3MLRL 2OQJA 3G04A 1MHHB 4NC2B 2Z31D 1BGXL 3PWLA 4UIMB 1AHWB 1SQ2N 2YSSA 4YK4C 4LK4A 4QRTB 1MFCL 3BGFB 1A6UL 1U3HC 5B21A 5LCVH 1OAUL 4MXWH 4NQDA 1BD2B 1BQSA 2EIDA 2P44B 3JWNC 4V1DE 4WGWB 4FQXD 5SWSE 4TSBH 3NZ8B 3QQNA 2MNUA 5TDPA 2AJZB 5KS9F 4RGNC 5GS0D 1MJJA 1R3IL 1KCLA 1QRNB 2NLJB 1ZT1A 5DQJA 5DUPH 3MJ9H 4PRDA 1A21A 4YBHA 1YEHL 5C9JA 4QHNB 2VZ1A 1DUYB 3MO1B 4UT9L 5J12B 3GB7A 1ZGLA 2FATL 4IOIA 3U48A 1LD9A 1PFCA 2HKFH 4PJ8D 3UPRB 4GW1B 1EGJL 4HJGB 5H8DA 3WHXA 5F8QC 4X6CF 3RDTD 4OV5A 1CG9B 1UM5H 3IDNA 1W72A 5HYFA 1L7IL 2W07A 1OGAD 2DD8H 4CL7A 3OAUH 1MIEL 1Y0LB 1CCZA 4P23D 3PHOA 2AGJH 3EUUA 4PJBA 1AGFA 1EEZB 4NQEB 4FOMA 1LO3H 3W0WA 2CR6A 1T21A 3QWRA 4PY8J 4MHHG 2YN3A 1DN0A 3O9WC 4HKJB 4ZFOB 5GGVH 5HHXH 4CW1A 1I8IB 4HLJA 5T1KD 4CMMB 1Z2KA 1JPST 3CX5J 3KPQB 2WQ8A 4L4VE 1N3NB 2DMBA 1F2XK 1OARL 5TF1L 4DEPC 3X3FH 3HR5A 4R4NC 2P5WD 4WEBH 3FO1B 2L4OA 3QNXB 4FQ1H 4HPYL 4ZTPH 5C0EA 4IHOB 3P4MA 1FIEA 3MRBB 3Q0HA 3EZ8A 5KVGL 1S9VA 1H5BB 1YUHA 3DMMC 3BKCH 3KPMB 4X7FC 4MJ2A 2DQGH 2X40A 2W1NA 1BBDH 4L8SB 5I73C 3VD9A 2FCBA 5FV1L 1J8HB 3VD5A 1D9KA 4OSUH 1NBQA 1QP1A 3GRWH 5MHSE 1CE1L 4K23H 2XTJD 2A9MH 2ADGB 4MNGB 3IDXL 3HNTL 1CICB 2YXFA 1FL6A 1MLBB 3IJYA 4D3CL 4QOKD 3T3ME 1D5IL 4WW1A 5DS8B 1DDHB 2XPGB 4U05A 4X5WA 1GGCL 3OXSB 4G8IA 3ARZA 3M45A 4EJ1C 4NC0B 1PQZA 1CFVL 4NFCA 4MA3B 4K8RH 2LFGA 4HWBH 3BZEA 2VNCA 3HMXH 4Z7OE 4ZFGL 4JM2F 4NKOB 5KBNC 1U93B 2YWYA 5DJXA 4HJJH 4RQQA 1YPZA 4RIRA 1REIA 1DBBH 2R0WH 4JRYD 5EUKB 1DBAL 3D85B 4JQVA 3UTSE 1P7HL 4BZ2L 3TVMB 2EH7L 5MENB 2CRZA 15C8H 1P6AB 4JJHA 3FOMB 4Z95L 1UJ3B 4L4TE 3O2VL 1L0QA 3P77A 4WJ5B 4HIHB 2FX8H 1RZ8B 5IJVA 4XNMA 4ZXBB 5DI8B 5SWQA 1LNUA 1IC7H 4PY7B 3QEUA 2O5YH 1A0QH 4H26B 3WS3A 1OAKH 2DLIA 2J6EL 2G9HA 4HEPG 1EHAA 4LVHC 3FT2B 1P4LA 2A77H 1A8JH 1YEKH 3C5ZA 4HS6B 4JRXD 1XF4A 5IR1A 2NYYC 1CGSL 4Y0GA 3RWJB 3LQMA 3SCMD 4JG0L 5MEOB 5HSFA 4PREA 3TT1L 4M61B 4XPGH 2CMRL 1MJ8H 3HC4L 4OFIA 4J6RH 5DVMA 3L6FB 4QRRE 2D7PA 3IETB 1OTUC 4NCC1 1YMMA 4GRLB 3MNWA 4WI6A 4L4JA 1RZKH 2D3VA 2APTA 4GG8A 4NKMA 3GGWB 4L9LB 4WW2A 5EC1B 3ZDXF 4WFGE 1SVCP 2BCKA 4PJGB 5BCAA 5IIEA 2DJ4A 2A0LD 2D31B 1FH5H 2A6DA 1QSFA 3V8OA 2F5AH 3EGSA 4U6HB 2D0GA 3I3DA 2IGFH 4R4FL 5DTFB 1FL3B 1UG9A 2FD6H 4GQ9L 3PV7A 1NUNB 1HH6B 4HKXB 4MB4A 2IAMD 4J1UB 4XP4H 1CL7I 1D9KC 2Y4SA 5ACZB 4PGEB 5HHME 4JY6A 3GRWA 4S0TD 4M1DH 3AU1A 1U41A 4RDQF 5HPMB 1IAIM 1EPFA 4FFWD 1LILA 4XC1L 4LLVB 4UNTA 1UA6L 5FHBL 1LVEA 5L6YH 3LMJH 5TH2B 1ACYL 3QFJE 2AXFA 1JK8A 3VXSB 2FJFA 2YPKB 3BPCA 4UMGA 1QZ1A 4IMLA 4QRPA 4MLSA 1DLHB 3BH9A 2IADA 4HWBA 5TDOA 3HMXA 3IDIA 4ALAH 4OI8A 1OF2B 2HFGH 2BOCB 1HHJA 1S5IH 4QRUB 2NY1C 3ARBA 3GJFA 4YBLC 1T2XA 3MREA 1IEHA 4HZLB 3FRPA 4EI5A 4NO5B 1EHLL 5HHOA 4NHCL 3WN5B 1FVDB 2DQTH 1OT2A 3QEQD 4WUUA 5C6TL 1B0RA 2XG5A 4OUUB 4RDQG 4GOSA 1OAZH 4WGVB 5GGTL 4EIZC 3MRRA 3B83A 3RWDB 4GBXA 2ZSWB 1JTTA 2IPUK 4O2EA 3V6BR 1EBPA 4Y4KD 3T65B 3H9HA 3C5ZC 3RPIA 2QSQA 3RU8L 4DJMA 5I76B 3SOBH 4LOUC 1CQYA 1LDPL 1LWRA 5BS0E 3MLYL 5ANME 4G6JH 5KSAC 1G6RL 4MJID 4KI5E 5EA0L 2WINB 4XNXL 4P3WA 3QSKB 4QYOA 1N0LA 2P8PA 4ZNEE 1A4KA 3WJJA 2YC1B 2DQCL 1IGFL 1KUMA 2VSDA 3HZKA 4RX4A 4IDJH 3MLTB 4LMQE 5HD8C 1F4YH 3SKMA 4OFKA 1RK0B 3D87B 3ULVL 1YNLH 3PWPA 5C70A 2HH0L 3NABL 3BT2H 4OFDA 5E6ID 1CD0A 4WW2C 5C0IB 3QRGH 2BSTA 3KYOA 4RFNB 3QQ3A 1A7QL 4G6AC 4JHBA 5BV7B 2EZ0D 2AJ3A 5I1JH 3GSRB 4YNYB 1OLLA 3R1GL 5CSBA 4M7KH 2MCPH 1EMTL 2V2WA 2W9DL 1AO7B 1QLFB 4X6DA 2HWZL 2VE6A 1C1EH 2Y23A 4OF5A 5EWIL 5D1ZD 3SDCB 3O2WH 4OD1L 1SY6A 4K3EH 1IQWL 5B4MD 4JLRB 2D7QA 3KLHD 2AXHA 1NMBH 5FYLL 3LEYL 2CO7B 5IFJA 1AGDB 4G8EB 5TDNA 2OK0H 1YYMH 1I8KA 4QHUA 4HEME 4UIKL 2R0LL 5I1GL 2HVJB 1HI6B 1KN4H 1V5JA 4G9DB 4PRPE 2NXYC 1XF2B 2BNQB 3FKUS 1EAPB 3DV6B 3IGAA 3E3QC 5EO9A 4OCXH 2FEDC 3IJHB 3S4SA 1NBZB 3MJ7B 4FFYH 5F96L 3MLZL 3LKNB 3EO1A 1F58L 3RTQD 3PWJB 3WYRA 3P3YA 3BDXA 3OJDB 1GZQA 2W0FA 3MRMB 5EO1A 3U9PL 5K9OB 4HUUB 1IAOB 1MCRA 2OTUB 3HLAB 5DRZB 2J5LC 3KJ6H 3ARBC 3BRGC 4HIEA 4W4NA 4EI5C 1CGYA 3L3KB 4NYLA 3AB0B 2HLAB 3OAYH 3MUHL 3CC5B 4DKEL 1KB5L 1T66C 1G0DA 2EE3A 3GSWA 4MNHA 2DQFA 2X70A 4HPOH 2A6KA 4UAOB 4BM7A 3U4EA 3BZFB 4MS8C 4RRPA 3OBAA 1GPOL 4GBXC 4PJDE 5HYQB 3G5XB 1WFUA 3TIEA 4JDTH 1XH3B 4NBZB 4NWUL 4NHUB 2RAMA 1SEQL 3EYVB 4JO3L 4ELMF 1RZJC 1L7TL 1PGRB 2R8SH 5C1MB 2VDOL 4OGZA 3QDJE 4FABH 4OGYL 5HGDB 2BVEA 3U7WH 1NGZA 3V4PL 3HTLX 5LGKA 2PXYB 3WJJC 1IKFH 2V5MA 2IG2H 4UTBH 5C07D 3UDWA 1NL0H 1BVZA 1N6VA 5I6XB 1OHQA 5HVWA 4XPFL 3VFNB 2Z0BA 3QNZB 3T3PE 3JZ7A 1A64A 5HY9A 3RL2B 1OP3K 4HS3A 4PG2C 1J9CT 5C0FA 4JVPA 4W6YB 3PQYE 3OB0K 2HT3C 1A7PL 4U0RC 4Y5XA 5BVJA 1TPXC 4DZBA 3ULVF 4AJ0A 2XY2A 3VWJD 5DJAA 3QO0A 3D25B 4QHMA 1V05A 3G6AB 2W91A 2FJHA 1EBAA 3L9RA 1K3ZA 4NNXB 3ZKXB 2P5EB 4QXWA 1YNTB 5I1KH 4FXLA 3DSNA 1IAII 3O6MH 5DD3L 4K55A 1PYWA 5JOPE 5D2LF 2ERJB 3TBVA 1T5XB 5C0BA 4PJEA 1I7RA 4RFOL 2A6JB 4A6YL 4KAQL 2A6IB 5EOCJ 4ZDHA 2WLYA 4YHNB 4L29A 5JDSB 5ALCL 4TTDD 5JR1H 5DJDB 3OGOE 2X42A 1VENA 1YJDH 2BVYA 4AENB 3TBWB 1MPAH 5CIPB 3K2UH 2NY4B 4ETQA 1JPSL 4X8XA 5AZ2H 1XGTB 4KKBC 1HKFA 3U46B 2CIKA 3N1GC 4ZUTB 4D9RE 3UJTH 2H32B 1A6WH 2G5RA 3HRZA 4X6BB 4JN2A 1BOGA 2WP3T 4L5FH 4NNPH 3ECBA 2V2TA 4LPXA 3OPZL 4X80H 4NOFA 1W0WB 2N7BA 2EDKA 4PGZA 1I1FB 4JFYB 1MHEA 1TDQA 2EXWC 2BHUA 2AEWA 4LCWA 3LY6A 1N7MH 3GJEB 3KR3L 4MXVE 1KJVA 1MCFA 2V7NB 1YYLL 4OAWA 4XXCA 3HE6B 3IDJA 4M8VA 4TNWK 4OZ4B 3U30B 3L3HA 5J56B 3KXFD 5DZLA 1S9KC 2LTQB 4OZHA 4DGYL 2X7LB 3W5NA 1NFDF 1A1OA 2X4TA 3UDWC 4XCEB 2W60B 1DTUA 2VISA 4XPAL 5DK3A 3MACL 4JPIA 2X4QB 4E9LA 3FL7A 1D5ZB 2IBBA 4DN3L 2HTLD 5B22A 2W0LA 5AD0B 4M7LT 5F1NA 1BM3H 3G6JA 2I5YH 2Y1VA 4XP5H 4N9OB 3DVNA 3WLBA 4UT7L 1CF8H 2FX7L 3PUCA 3QG7L 1T80A 2BVQA 4HD9A 5D71H 4Y4FA 1QBMH 3BW9B 2AJUL 5A16B 4NNYA 4JGJA 2DTMH 1J5OL 1P84K 1MI5E 1EXUA 3EFDL 4PYHA 4Y16D 1OTTD 3H6JA 4PTUB 3O6KL 5F72S 1A2YB 3W9DB 2JCCB 3IAGC 1T04B 4U6VH 4ZODA 1QYGL 1A22B 3EYOA 1U58B 2AJYH 1QA9B 3DUSB 1ZA6B 4XVJL 4LCIL 3SKUD 3FT4A 2VXTL 4LLWB 4JB9H 1VADB 3PWNB 3V5KB 3WIHL 2GFBB 2PW2B 5JXAL 1XCTA 3P11L 3UBXI 1ZLSH 4NKIL 1YDPA 5E7BA 4X6DE 3RKDD 3KPRA 4Y4HD 5F6HJ 3VWKD 3D9AH 1R3KA 2E6PA 4NFBA 1C5BL 5EB9A 5C0CE 1U8OB 5JQ6L 3HCVA 3KDMB 3QUZB 4P46B 5D7LD 4JR9L 2HN7A 5ECJE 5SWZB 1KJ2H 1JPFB 4P5KA 4MB3A 1MVUB 2VDKH 2EDQA 3MV8E 1XR9B 1S5HA 1KCSL 2ZOKA 3GDBA 4Z7WF 4YFDB 1MHCB 5L7XH 2HLFD 3SJVB 5I19H 4KMQA 4Q2ZA 5A3ID 1FAKT 1PKQE 5EOCL 4TRPH 5IV2A 4KPHL 5A2KH 2NTFA 4WO4D 5CD5D 3RGVB 5T3XL 2FO1A 2CGRH 3IRPX 1AC0A 5DMIL 2GCYA 2NY3C 3NCYP 2EKSA 3P30L 2OTPA 3D39D 1F8TH 3QUKA 4OFYA 2DI9A 2VSCA 4NO0B 4BH8A 3KGRA 3TFKD 2X4UB 3QXUA 5C08E 4KRLB 2P46B 4G9FB 3HZMB 4P5TD 1R24A 4LGRB 5I1HL 4GAYB 1TZGL 4PGCA 1L4IA 1HK6A 1LO0L 5JORB 1N4XL 5E5MA 4J8RA 1V8HA 4Z78B 1H9VA 4P4KB 3G5ZA 4RMSA 2EDXA 4PJ5D 4YR6B 4XXCC 4ZUSA 2NPLX 1NUDA 3V6OA 3STLB 1XIWA 5CJQL 1QFWH 1GSMA 4KXZI 5FA4A 1OP5K 1FVCB 5I8OL 5EBLA 4X7TA 3DXAA 3MRNA 1LP9E 3FQNA 4YXLH 4Z0BL 4CVZB 1YY9C 4NZUL 4PJHA 4DKDC 2I9LA 5CJ8A 1NLDL 1SEBA 2N7AA 3OKMA 4PRBA 4N0UB 4LRIA 4QHKI 1OB1A 3DSFH 1UFUA 4YC2C 1XZ0A 3TN0D 4PJCE 4KJYA 4NQCE 3KYAA 4Y4FC 4DOHB 3PABB 4JDZB 5HPOA 3DETC 2XZAH 2ZUSA 3NFNB 1FFOA 5HVHB 2I24N 3RVTC 4KKAC 4X5XB 2HVKA 5HDOA 4E5XA 2YD2A 4N0YH 3WLWD 5CHNB 4HUMB 4JEGB 4NGHL 4P2RB 3HI6H 5I30L 1C16A 4NT6A 5DJ6A 5D1QB 1GZPA 4JM2D 1YQVL 5LGHL 4S2SA 3TO2B 1CWVA 5GS1B 4NJAL 3WKNA 4IOSD 3K4DA 1Y6KR 1KULA 5LGJA 1DEEB 1QTYT 5KANI 4LKCA 1RZFL 4YHPB 4EDWL 5TE4L 2IC2A 3MUGA 1VFAA 3VXMD 1IARB 4LU5L 2Z91A 4G8GB 4LPYA 4O5LH 1QEWB 1HN1A 4OZIE 3W39A 3R0MA 4FQCL 4RFEB 1MRCH 1P5UA 3SDXB 3V4UH 2UYLA 3DYOA 3OGCB 5HHQB 4HWNA 3PG2A 4UU9B 2F5BH 3GI8H 3CCHA 1A3RH 2OMBA 2CJUH 4XVTH 5DGRA 4FXGB 1NAKH 1K3IA 3U9UB 1UB6B 1NANH 2R1YB 3UYRH 4LEOA 3H7BB 3EYSH 3NH7L 4XX1G 2R1XA 4H20H 5CUSL 4Y19D 2I60L 3FMGH 2OZ4H 5D8JL 3DI2B 4YX2H 4ZPTB 2JK5A 5DJYA 2QADB 2VLKB 2HJKB 2NNAA 2J4WL 3WNKA 1NPUA 2NZ9C 5GZOC 2ZWLT 1OWRM 3ARGD 1QACA 1EEYB 5E2WL 1IGTA 4XI5C 1HHHA 5DXWA 3HG1B 1ND0B 1BX2A 4JFQA 1IFHL 1WBYA 3D3VE 2DQUL 3C6LB 5E00A 32C2B 4R8WH 5CCKL 4DGIL 3V6OC 3K7UA 2OMNA 5IB1B 1XIWC 5DHVA 5E08H 4XH2B 3SDDA 4HUVB 35C8L 3MXVH 2W0PA 4RAHA 2D03L 3BI9X 3VI4F 1EJOL 3V4VL 3LKOA 4F3FA 1ITCA 1FG9C 3QPQD 2AJVH 3MLVH 5MERA 2F53B 4R7NA 3DX8B 5DQ9A 4ENED 5BW7A 2PF6A 5C0AD 2PO6B 4JCLA 4LVOC 5KSBE 1OGAE 4ZOBA 4LRIC 5DK2A 4Q9RH 2J8UA 4A2MA 3ZT6A 1DQQA 3QIWB 4XVSH 2DL9A 1PKOA 1JZ4A 1AKJA 4GLRI 1U92A 4KTDL 2VIRB 1IQDA 5EN2B 1EJ6A 1G9MH 1DVFD 1Q1JL 3VXTA 3WL9B 5HYJA 1H3VA 3BE1L 5EU3A 4MMXC 3G6JE 5IMKB 1GHFL 4MQ7B 1A5FH 5AYQA 3SDAC 3EO9L 5HVGB 4HKZA 4Y1AA 4MX7A 4X7DC 3MFFA 4LNRA 4F57H 4KY1H 4FZEH 1MHHA 4HC1A 4XCFH 1GGBH 4NFDA 1AHWA 3VD7A 3CSBA 3UBXB 5I1AB 4CN6A 3BDYL 3HAEH 2ZZUT 3IDYC 4Q58C 5C0RL 1BD2A 5CP3A 4LHJB 1PLGH 3VFRA 3FZUD 5B3JF 3EYUL 4OTXH 5DSCA 2AK1H 4QOKE 2QSCH 1ZLWH 1GC1H 4NWTH 1FZJA 3ZYZA 3NZ8A 3QHFL 2AJZA 4K9EL 2P43B 3RAJL 3GSVB 4OJFH 4MCZA 1QRNA 2NLJA 1Q8MA 1ONQB 1ERNA 2UZIH 2VB5A 1FORL 1GGYA 4NO3B 4JRYE 4QHNA 4XNZC 2LU7A 4N8VB 5DA4A 1M1SA 4NN6C 3VG0H 4OLWL 1S8DB 4R2GC 4HJGA 5DEZA 1UADC 5E1AB 1CG9A 3GI9L 1Q72L 2CKBL 1NH6A 9CGTA 3WSQH 4LHUB 3JWOL 5FCUH 4M8QB 3FB6B 2WIMA 1VFBB 1AFVH 2Q20A 2B2XH 3BWAB 3C2AL 4XNQB 1EEZA 4X9BA 4NQEA 2DYPD 4PJAE 4PJXB 1UH4A 4P9HL 5IBTL 3LKPB 3V7AE 2CLRB 4Z7NF 4YHLL 1G9NC 2ZUQC 4QTIL 4ZFOA 3D0LB 3SDDC 1RV6X 4IM8A 1T0NB 1N3NA 3OF6A 4OLVH 4TNVF 4WUKL 5IMLA 1H8OA 3FO1A 1TJIH 4IHOA 3ALXA 5BW7C 1YEEL 2WM0A 4NJ9L 4DVBB 1PW3A 4BZ1H 3MRBA 5F3BB 5F9WB 4OQTA 4LCCA 5JHLL 4U3XA 4U1LB 2A74A 1H5BA 2ZUUA 5D7IB 3KPMA 4PBVC 4UQ3B 4ELKB 2CDEB 2HJFB 4D9LL 5T3ZL 1J8HA 4KJWC 2E9IA 1UZ6E 4M93C 1PVHA 1MFAL 5B38G 3TO4D 2ADGA 1Q9WA 2C1PB 2DKSA 1MLBA 2H8PB 5DDHB 3CX5K 5LQBL 3NN8B 5DS8A 3TBSB 1DDHA 1E4XL 1XGUB 2XPGA 3SDYL 4YDJA 3HI1B 3VXRD 4OCSL 3OXSA 4G6KH 4RWHA 1KTRL 4MA3A 4UBDD 2DRUA 3UAJC 2BNUB 1AHWC 1U93A 4N1HB 4NKOA 4CDHA 2COQA 4DAGL 1HHIB 2B8OT 1RHFA 4YIQA 4EN3D 3BGFC 2I07B 2ADFL 3D85A 4AL8L 3S7GA 3JSSA 2R4RH 3SGKA 1V3JA 5MENA 3IFOB 5BQ7B 3RVWD 1G1CA 4K7PL 3BGMB 4XP1L 5IUSA 1Q0YH 3W5MA 3FOMA 4DVRH 1IM9D 3QFDB 1UJ3A 4NQVA 3DVFA 5HXMA 2HKHL 2VR4A 4WJ5A 5CGYD 2V7HA 3RWGB 5IT2H 1RZ8A 3SE4A 4ZXBA 4GRMB 3H9YA 4P2QB 4OM1L 4M7LL 4OLEA 3BEVA 4GAJL 4AH2A 3ULUF 3H2WA 1CDUA 1CLYH 3FQXB 4I0CC 4H26A 1MCIA 3S36L 1OOAA 2XQYG 3C6SB 5KZCD 5GSVA 3ZTNL 2PETA 1AY1H 2PR4H 3FT2A 5J12C 3Q6FB 3EBAA 1R5VB 5MP6H 3Q3GB 4HS6A 4L3AA 5ALBH 1ZLUK 1WJ3A 5CD3B 2VITB 3DX9B 5BMFH 4NSKB 5FK9B 1N64L 3R8BB 5D6CB 1RZ7L 4IEFB 5MEOA 5J6GB 3LN5B 5IEKB 3QEQE 2FECI 5D72L 3DARA 2Y06H 4L8CB 3WIIH 2Y36L 1GAFH 3L6FA 1QBLL 3IETA 4GRLA 4TVSa 5CP7B 5CZVH 3KS0J 3QIBD 5EIIB 3GGWA 1S3KL 2DJSA 4L9LA 3KPLA 5EC1A 2R15A 5DD5H 4PJGA 5BV7H 2ED9A 3JXAA 2APXA 2Q6WB 2H6PB 2OR9H 4S1RL 4J3OC 3O0RH 4CMHB 4M00A 4MJIE 3JTTA 4I4WB 4U6HA 2BERA 2B39A 3UPCA 5DTFA 3IRZA 4LCCC 1FL3A 4J4PD 1H5BC 5DRXB 1HH6A 1Z3GL 3QJHB 3H9SE 4IRJD 4J1UA 5D5MF 3L7FB 4XPHH 3FQRB 5ACZA 1AQDB 4PGEA 5A2IH 3V0WH 4F7PB 5HPMA 3LRGA 1JNHA 2O5ZH 1IGMH 5CJOL 1MCHA 3QZWB 5E2VH 8CGTA 1UACL 1NCTA 3O6FB 3ROLA 4LLVA 4Z8FL 5F7MC 5GGQL 3V6FB 2KKQA 4I5BB 4YDLB 1AGCB 4HK0B 4LAQL 3VXSA 3LOWA 2YPKA 1F90H 1MJ7H 4NCDA 4LBEB 3TJHD 1DLHA 4PLKC 3BD3A 5FYLD 1RQ5A 3NCJL 4OM0H 3ZDZF 3NA9H 1OF2A 3D2UB 1FLRH 1X6LA 2P1YA 4YDIL 1P7QD 5ADPL 3ISWA 2XICA 4O58H 5JW4N 4QRUA 4Z7VB 2EDHA 1BFOB 2NX5D 3ZMRA 4Y1AE 2EC8A 4GUPB 3SEPA 1KXVC 2GY7B 3J8F7 1T1XB 5DFWH 4F37F 1X7QB 1DN2A 1UJ3C 4HZLA 3WEXB 4FXKB 5C2UB 4NO5A 2C3VA 4OZGB 4QWWD 4ZPVB 5IROA 3LKRB 3RWCB 4MAYB 4ZXBC 3SE4C 1B2WL 3TNMB 2OP4H 3UP1A 1TCRB 3O4LB 1JPTL 3BIKB 3W11C 3QXVA 4UOW1 5DQDL 1BAFL 1JHTB 5JZ7D 5TGBB 4DKFL 5H37H 2V9QA 4YGAB 5F1KC 5C0JB 3T65A 1QFHA 1A47A 1MAMH 4KZDH 5I76A 3ZL4L 2HT2D 5IBLD 1RUMH 1CGTA 4O02L 3DO7B 4I3SL 4LLYB 1WFTA 2WINA 4FMFA 3QUXD 3QEGH 2GJ6D 1QLRB 2P7TB 4N0CD 3FN0L 3U4BH 3RHWF 1B4RA 2CUHA 5DWUL 3T0ED 2YC1A 3Q1SL 1ZANH 4GRLC 5F70A 5DMGD 2IF7A 3MLTA 3C09B 3BRFA 5KG9A 3CVHL 3RP1A 1RK0A 3K4ZA 1U8JB 1V7MH 1PG7H 4L9LC 1J11A 3QEHB 3WNNA 1JUFA 5C0IA 3TWCL 2VMFA 3K8MA 3OAZH 5HYSG 1CLZL 1C12A 1HDMB 3BPNB 1MWAH 1M7IB 1SJVA 4OGXL 5KVDH 1C5DB 2VJXA 3CLFH 3GSRA 4HMEA 1GJIA 4YNYA 2BVUA 3TA3B 2VDPL 3OKLA 1UGNA 1U8IB 3MX0A 1WICA 3HNSL 2Q7YB 1AO7A 3S37H 3BSZH 4PD4J 3SDCA 1H3UA 3UJJH 3CFDA 4JLRA 3QI9B 2KUTA 1DUZB 5I8CB 1A7NH 4QKXB 4JFEB 2V9TA 4HUXA 3EW3B 1AGDA 4G8EA 2DQIH 3QUYB 3C60D 4H1LG 4OZFG 3CMGA 3NPSB 5GSRB 4OCWL 4S1QL 2FB4L 3N0PB 4APQD 2HVJA 1MCOL 2DL2A 1HWHB 25C8H 2VQTA 4G9DA 4PS4H 12E8H 1XF2A 5EZJB 1EAPA 3DV6A 1YECH 1ED3B 3UZQA 2CD0A 3E6FA 1FNSL 3FOLB 5F1IB 1NBZA 4MNGE 3AUVA 3PWJA 4HHAB 5BO1H 1JHKH 2P8LB 1KELL 3OJDA 1YEFH 1CU4H 3MRMA 4HUUA 1IAOA 2DM2A 1A6AB 4G6FD 4N90D 2OTUA 3HLAA 4NQUA 3SQOL 5CIPH 5DRZA 3SY0A 1D5MA 3MCG1 1AIFB 1UENA 3HC0B 1ZV5A 3GK8L 4AEIL 3L3KA 3SKJH 1N2RB 4HF5L 4Q9QH 1K4DB 2HLAA 1RFDH 5DJ2B 5IROC 1F42A 3V6ZB 3BQUB 5K9JL 4H8WH 3LCYA 4GMSH 3CC5A 4E41B 4CDGC 2BSED 2JF1A 4JFOB 1D5XA 2J1KA 1FAIL 2FR4B 2R2EB 4XNUL 1JNLL 2YK1H 4YE4H 3L3JB 5C09D 3VW3L 5HYQA 5EUOA 5KS9B 4Q9CA 1RMFL 3VGFA 3OTTA 1CD1B 5IK3B 1NEZG 6CGTA 3JTSB 5JPMB 1XH3A 2A73B 2YD4A 4NHUA 3WO3B 3X11B 2UZYB 3EYVA 3RUGB 5EBMA 2ITDB 2VDQH 3NGBB 2PTVA 3WXVL 5IQ7H 3KYKL 1TQBB 4WFHD 3V7MA 3SGEI 5HGDA 4NQXB 3ILQD 1NKOA 1JFQH 4JG1L 4H0IA 2IJ0C 4XBEH