4F7CB

Crystal structure of bovine cd1d with bound c12-di-sulfatide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
b'IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD1D antigen, d polypeptide
publication title Crystal Structures of Bovine CD1d Reveal Altered αGalCer Presentation and a Restricted A' Pocket Unable to Bind Long-Chain Glycolipids.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 12
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f7cB00
1CVSC 1D5MB 1JIBA 3IKCA 1TFHA 4OZFB 3HG1E 3UTZA 4OAWB 4G8GB 2Q76A 3HC0A 2H32H 2RAMA 2J8UB 4OIIH 4YHKL 4QKXB 1RUKH 2WBJC 3HE6B 4KZEH 1M7DB 1RU9H 1R3KA 4UDUA 3DMMD 1NSNL 3WNPA 5HJ3B 4WWKB 4UDTA 5DHVA 1YEJH 4M7LH 1CE1L 3RA7L 1HK6A 4K07A 1TMCB 5DEFA 1F4WL 3RPIB 2R23A 1XZ0B 1R0AL 3MRBB 3T0BA 1FNGB 4R3SB 3TZVD 1QRKA 1S5IL 1SYVB 5BMFH 4XRCA 4RDQF 4Y5VC 5E99L 1IAII 4QXTA 1T21B 1NC2A 4CDGC 4IMLB 4V1DA 3FQRB 5FKAB 1K8IA 4RAUB 5B3JF 4YIQA 2W9DH 3T0EB 4OCSH 2B1AL 1WFUA 5F7EH 4JM2F 3O6FC 3DUUA 5E2WH 4WUUA 1B3JA 1KLGA 2D4FA 3HPJA 5FOBB 2ORBL 3L95A 4PB0H 3QDJD 3U0WL 3WIFB 5IT2L 4L4TA 4X6CB 4I5BA 5I15L 1K5NA 3FFDB 4GKNA 4WW2A 3QFJB 4NJAL 3WSQH 1LD9A 1ZLVK 1DVFB 3LCYA 1T7ZA 4D0DB 4XPGL 2ZJSL 3H8NA 4ELKA 1OAQL 3QO1A 2OZ4H 3NGBC 3PL6B 4H0GA 4AL8H 2E7LA 4HJ0C 2ZUQC 4L1HA 3BGAA 4XGZA 5D72L 4OZHB 1EAPB 2D9QB 2NY5L 3NACH 1SJEA 3IDIB 1BOGB 5HHVH 5D7JD 4P23D 4MS8D 4M8VA 4CVZB 1A1NA 4FZ8L 3EOTH 5TDOA 1CGXA 4YBLB 4F57L 1KB5L 4MHHG 3JTSB 3HC4L 1OGTA 3AM8C 1HHIA 3MCG1 2FATL 4LSTL 4NM4H 4JHAH 3LSOB 5KOMC 2EH7H 3S96B 5E6YA 2Y06H 1CDGA 1Q0YL 2MNUA 3Q6GL 5EUKA 5FV1L 3VWKD 4OM1L 3C8HA 4L4VE 3DJ9A 4QTIH 2DKUA 3GO1H 4KAQL 4KDVA 3V8OA 1J05A 4PJGF 4OZFA 1A8JH 3TBSB 4OAWA 4G8GA 4ENED 1GXEA 5CEZD 5DJZB 1NAMB 5DK2B 2J8UA 4RBPK 1TQCB 3U7WL 5D93C 4C56D 3BRDA 5F88A 4EDXB 1M7DA 5HJ3A 4WWKA 2FNBA 5CEZL 4L8CB 5AZ2L 3RPIA 1XZ0A 4ELME 4RFNC 3MRBA 5FB8B 5DD6B 1RJCA 2VXUL 5C86A 1LO5B 2O93L 1SYVA 4R97C 1F90L 2X42A 1T21A 1CZ8L 2J6EL 3P30H 4QXGL 2CK2A 4IMLA 2B4CH 1EGJL 3FQRA 5FKAA 4RAUA 2FDBP 1AE6H 4RMWA 2XZZA 3T0EA 4OFPA 5D7KD 5HDOA 4FA8A 3TT3L 3CX5J 2ZG2A 1FPTH 3UBXI 4KKAC 5FOBA 3K4ZA 1D6VL 4X99B 2EDOA 3MOAH 4F7CB 3O4OB 5JW4Q 1CDCA 1FO0B 3KXFB 4I1NB 4MDIB 3ARSA 3FFDA 3S9DB 1LO4L 4X4YB 1TENA 1JMZA 1QRNB 1DVFA 3H7LA 4LCIH 1FC2D 4D0DA 2IMNA 4FQIH 4K7PY 3ELAT 1UKTA 4TN9A 4X80L 1OTTC 4A6YH 1F97A 2R0LL 3PL6A 3QDGB 4RWHA 2ICWJ 5AYUH 3BOVA 2AQ1A 4X4MA 5GRJH 1EAPA 1S8DB 1A3RH 4CADB 3IDIA 4QRRE 4PGCA 3S37L 5BRZD 4R4ND 2HTKC 4CVZA 3BT2H 2ATPB 3ZKMC 4O4YH 1WIOA 2EIBA 5SX4H 3SQOH 5A2JH 5F6HI 3JTSA 1K6QH 3LSOA 2FB4L 5F7WC 3S96A 3MRFB 3UO1L 2XQBL 4XVUC 5ANME 6FABL 3WLBB 2R0ZL 1BBDH 1JWUA 1DUZB 4LSPL 4PY8J 4PJXB 2JB6A 3W2DH 5DJ6B 2WBJB 4N0YH 5TE7L 3TBSA 3SOBL 5DJZA 3BEVB 1NAMA 1XCTB 3LN4A 4OD3H 2X1WL 4YWGH 3S34L 4EDXA 1J8KA 3FFCB 5ALBL 1NCNA 2WP3T 4L8CA 4YHZH 2LQRA 4TUKH 3P73B 4Y5VB 4XMKH 4WNQB 3H9SB 5FB8A 4Y7MA 5K59E 1VFUA 1LO5A 4P2RB 1VEMA 4JQVC 3PXHA 3W9EB 2FO1A 3GBNL 2X89D 2BVOB 1XCQB 3V6OA 2R0KH 5L8LB 4HFUH 4MA1B 2DQFB 3EO1B 1DBBH 1MFDL 4PFEA 4HBCH 4WU5B 2HJKB 1H3WM 3VXPB 4I3SL 1RIVL 1A7QL 4GXVH 3I75A 5J1TC 4U6VL 4X99A 4L29B 4H1LB 5CJXC 5DEGB 1FO0A 3KXFA 1HCVA 1EEQA 4MDIA 4HWUA 1XH3B 4X4YA 2L4OA 1BHGA 2FECL 3NGBB 5CHNA 4YBQD 4QWWD 5CLTA 5HI3D 2GJZB 3O2WH 3D3VB 4XHQA 1AP2A 5BS0D 1F4YL 1UYWL 2JJWA 4NQXB 3QDGA 1BFTA 5EIQA 2DN7A 1EO7A 3ROOB 1S8DA 3P4NB 4CADA 1FYTE 2H8PB 1JGLH 1AFVH 2P44B 4HWNA 3RNKB 2EZ0D 3PP4H 3C08H 1JZ2A 5IFJB 4NP4H 3WS6A 3G6JE 3HFML 3VRIB 5GHWH 1CFBA 1H3TA 3MRFA 1FN4B 3WKNA 5C0IB 1MJ7H 2G75B 3IXTB 5MP6L 1DUZA 3U4EB 4PJXA 5IMOB 1BD2E 5D93B 4PJAB 5DJ6A 2WBJA 1U6AH 3NAAH 4UV7L 2NYYD 3S35L 3DO7B 5F89A 5FK9B 1QFWM 1XCTA 4NBZB 3C9NB 4MXWL 1QBAA 4JM4L 4PRBA 3FFCA 5CKAA 1KTLB 4R0LC 5KTEH 1DQLL 1CD0A 4WI3A 5KW9H 3HMXA 4IBLT 5D1XC 4EN3D 3K8KA 4R97B 4MAUH 3P73A 3G6DH 1TLKA 4WNQA 2OXHA 3VGAB 1JWMB 3F6LA 4P2RA 1GPOL 1X5FA 3CFCL 4HFWB 2B8OT 2JF1A 5HI4C 4K71C 2EDWA 5FCUH 3W9EA 4LLVB 2HVJB 3HPLB 3J7HA 1XCQA 4YPJA 4JRXB 3F7RA 5FEBA 3V5DB 1FAIL 1FCGA 2HTLD 5GGTL 4NBYB 1W72B 5CP3H 1R5IB 5DC4B 2DQFA 3EO1A 2N7BA 2VZOA 1VEOA 3VXMB 2HJKA 3TFKD 3VXPA 4Q0XH 5LXGL 1T0MA 2DTML 4U0QB 4YDIH 3B9EA 1OB1B 4EOWH 5CINH 5CBAA 3F58L 1FZKB 2G5BB 1HOCB 4L29A 1KACB 1I85A 3O4LB 5DEGA 5GJSL 4UIKH 3G6JF 2WSKA 1O7SA 2VC2H 4XHJC 4CRPA 3JXAA 3L5IA 3K7UA 4KVCL 1KEGL 2FEDC 5IBTH 2DIBA 1Z5LB 3ZL4H 5CEYB 2GJZA 3D3VA 1P5VA 4OI7A 2CD0A 4LVHC 3QDMB 5EA0L 4J8RB 4NFBA 3D87B 4X5WB 1MIEL 3ROOA 3SDCA 3RJQB 3P4NA 3VMPA 3DMMC 4P9MH 2H8PA 3AM8A 3RNKA 1MAKA 1OSPH 1UM5H 2FJGA 2VITB 2ERJC 5IFJA 4Y1AB 5A2KH 1NMAL 2X5PA 1AO7E 5IROC 3VRIA 4OT1H 4BZ2L 5T3XH 2DLGA 2P42B 4L3AA 4WI7A 5HYJA 3I2CL 3AC0A 2ZOLB 3SDYH 3N06B 4PGDB 1WZ1H 4JO2L 4YE4L 5DYOB 1UT9A 5CJOL 1RZKH 1HHHA 2VB5A 3BESR 3VMNA 3DSNA 2EEDA 4MNQB 1AXIB 4DN3L 3TF7C 3IXTA 1RURH 4XPFH 1W2KT 3FO2B 3U4EA 1H8OA 2EDEA 5IMOA 4PJAA 1LNUB 4JCMA 2WQ8A 3RBSA 2OSLA 2FD6L 2FLRT 5KVMC 3C9NA 4HEPG 2CXKA 4JY4B 4OJFH 4ZDHB 5E2VL 4BSJA 3K4AA 4UB0L 1S7WB 5DD0H 3BD4A 1KTLA 5I8KL 3LEVH 1C1EL 1U8OB 3C5ZC 5D9SB 3PF2A 3H9YA 5C2UB 2BNQB 5IMLB 1QSFE 3GSVB 5C92A 1BFVL 1CLYH 2GHWB 2NY5C 2P24B 1JWMA 2DIAA 3KPRB 5IFAL 4M6OH 4WV1A 32C2A 1ACYH 1JTOA 4HFWA 4LVOC 3BKCL 4W81A 4GRLA 2UZYB 2HVJA 4N9OB 5EN2B 4OIBA 4JRXA 3S3SA 4KTEL 3V5DA 1V3JA 2B2XH 2X7LB 4MS8C 2Y36L 4XX1E 4Q2ZB 5T1KB 1W72A 2YA0A 4HJJL 5LWYH 3VXRA 5KVFH 3VXMA 4L4VD 1FH5L 1T7XA 1OB1A 1F11B 4PJCB 1FZKA 3MRPB 3VGDA 2G5BA 4TRPL 1HOCA 3RIAF 4ALAL 2AJXL 3SE9H 3O4LA 1S9YB 1HZHH 4LEXH 5DJDB 3HC3H 4ONHA 4Y89A 3VWKC 5LKNA 1PX4A 1T04B 1M71B 4HG4K 3AVEA 3GJFH 4Y5YB 4PLKC 4AZ8A 2CRMA 4N90E 5CEYA 5B22A 1A0QL 3QDMA 4J8RA 4GQ9L 3VA6A 4UI2A 4HK0B 1G7LB 1IAIH 1MRCH 4X5WA 1J5OH 5LGHH 3HNSH 3C2SA 3MXWL 5L88L 1QPXA 2XKSA 3I02A 4ONOA 2DQHL 4NZJA 2FX8H 1N5AB 2VITA 2IPTL 4Y1AA 3RX8A 1NCBH 3FN9A 3F7VB 4MDJB 4X6DA 3SPVB 1MVUB 2WUBH 3CXDH 2ZOLA 4XNYH 4NHUB 2EDHA 1JPSH 4PGDA 1JNJA 4R8WH 5DYOA 2Y6SD 2H3NB 4HXBH 2DL9A 3GM0A 3S5LB 1X5AA 5DT1L 3OGCB 5JNYB 4WCYH 3FO2A 5SWSB 1CF8H 2QADD 1LNUA 3PGCB 2UUDH 1YEIH 5E4IA 4R0LB 5D1XB 4JY4A 4ZDHA 3P9MA 1S7WA 4X0KA 4ORGB 4S1SH 1U8OA 2FRGP 3S7GA 3STLA 1DQDL 5D9SA 5E7BA 5CZKA 2YUZA 1RIUL 3ZTJH 5IMLA 3GSVA 5C6PB 3BEWB 1U3HB 5HGAB 4K71B 4QRRD 4LPTA 2W65B 2P24A 3KPRA 4EUPH 3RKPA 1N6QH 2DD8H 4NC2B 3EBAA 5FHAL 1R3IH 5GPRA 4LLYB 4M8QA 3Q6FB 4HKJA 2X7LA 3EYFB 5T1KA 1IGCH 4QHKI 2BVYA 1MLCB 2VL4A 4PJCA 4TVPH 5JXED 2UY6A 1S9YA 5D1QD 4IHOB 5DJDA 3B9DA 2DTSA 1T04A 1M71A 4TVSa 4LVHB 2F9BT 4DVBB 3D0VA 1F6AB 5GJTH 3E6FB 4Y5YA 5C0CB 1INEH 2HRPL 1DLFH 2GSGB 5IW6B 4XH2B 3DMMB 1JZ4A 2Z91B 3FQTB 4NHCL 4M93B 5AD0A 5MI0C 3VMOA 4KKNA 4HK0A 1G7LA 1ADQA 2X4QB 4M5YH 5IWLC 1KJMB 1NAKH 1WEJH 4HX1B 2ERJB 2VL5B 5E5UB 4Z7QF 3PGFL 3TZVB 4MSWB 1N5AA 4F9LC 1DQJB 1BZ9B 2R9HD 2MTPA 3F7VA 4MDJA 2EECA 1BWWA 3RWIB 3SPVA 2DYPD 1MVUA 1JVKA 1A14H 4NHUA 3QWOB 5TQ0H 2YS4A 2H3NA 4CN1A 3S5LA 3ULUD 1Z9LA 5E8DH 3OGCA 5JNYA 4AM0B 1DDHB 4IMKC 5SWSA 2DQIH 4N1EA 1I8LA 2Q86A 3NCYS 4L8SB 4R4FL 3BISA 4CJ0A 5TF0A 4R0LA 1U2CA 3VXOB 4OGXL 3ULUL 5D2LB 4JN1L 5D1XA 1IGYB 1MUJB 4EVNB 4D9LH 4ORGA 5EUOF 2EO9A 4XCEA 5DA0B 3ARDA 3QIWA 4L3EE 2VO5A 4M1DL 2WUCH 4LVOB 1CXLA 3OAYK 3BEWA 3P9WB 1F02I 1U3HA 5EFIB 5HGAA 4YBQC 1KB5B 2W65A 4BSVA 4QWWC 1J18A 5HI3C 4G6AC 2I5YL 4XCNB 4P23B 1QKZL 4KTDL 1FP5A 4LLYA 3Q6FA 2EDTA 1NBYB 1OP5K 1ZA6B 3EYFA 4M1GH 3CVHH 2ITDA 2R2CA 4O2EB 3VXTB 1MLCA 3QEUB 3VWKB 4BK4A 4NQEB 3VFGL 4UQ3B 2DM7A 4P2OA 4UBDD 3RWGB 4IHOA 1INDL 4QGYA 2FBOJ 2FBJL 2YD8A 4DVBA 1F6AA 1MCNA 4NKIL 3RY4A 3E6FA 1EPFA 4C56B 1EO5A 1OP3H 2GSGA 2VRAA 5IW6A 2NYYC 4XH2A 2R29L 3DMMA 2OTWB 2Z91A 3FQTA 3BD5A 3CK0H 1KCRH 4K23L 2X4QA 4UOJA 5B8CC 1KJMA 4HX1A 4PJDA 3WO4C 2ZCHH 2VL5A 5IROA 5FYLH 4PLNC 1EX0A 3TZVA 4MSWA 2IPKB 4RA3A 4LLUA 4C83B 1DQJA 4EN3C 1BZ9A 2FZ3B 1ZGLB 2NY1D 3OTTA 1KTRL 1Q9OB 5GGVL 1IC5L 3RWIA 1T5WB 5JDSB 3TBVB 1J86A 2VDKH 5ISZD 4KHXL 4M7LT 3FB7A 1CDBA 1T7VA 4AM0A 1DDHA 3TYFB 3BPCB 4L8SA 1IBGL 3QDJA 1EFXB 4NBXB 1WBYA 1R3JB 1ZEAH 3TFKC 3QEGH 3VXOA 4AIOA 4HGWB 5D2LA 4O5LL 4NZUH 3AMLA 4P59H 5AG8A 5CGTA 4LCYB 5FUOH 3UEZA 1IGYA 3LY6A 1BVZA 4JVPA 1MUJA 2O5XH 1XF5B 2J88H 2ENYA 4JHWH 4LSSH 2R1XA 3T8XB 2DM3A 1CL7L 4DTGL 3MTRA 3BP7B 3UC0L 1HIMH 4L5FL 1KB5A 5EZJB 4OTXH 5FDYA 2IBGA 3T3MF 4XCNA 5D7JA 3U48A 4P23A 5BRZB 1AO7D 3RQ3A 5F7MC 5EIIB 4JKKA 1BQUA 1QBLH 1F4XH 2P5WD 3D9AH 2VABB 4LRIA 1NBYA 4XTRD 1ZA6A 1IAMA 1I9JH 1FGNH 1NGPL 4FXKB 4DGIL 2XG5A 4O2EA 1U2HA 3VXTA 2NQCA 3QEUA 3ARUA 1I3VA 1Q72H 5KVEH 4HS3A 1X44A 2A77L 3LKOA 4UQ3A 1GHFH 3HAEG 4RRPG 3RWGA 1DSFH 5FHBL 4K3EL 1YYMH 4MQXD 3LDBC 4PJBE 5JOFB 3MXVH 4ONFL 1IQWH 5TPWL 5MI0B 4L9DA 4M7KH 4I9WE 5T5NG 1JYNA 2OTWA 3D69B 1QSFD 1E4XI 3MRJB 5D5ME 3NCMA 2GUOB 3GSXB 4J23A 4JG0H 5FYLE 4WI6A 3KAAA 3O6LH 3BH9B 1V05A 1S9XA 2J6EA 2F53E 3QQ9D 2IPKA 2CMRL 3G6AB 4C83A 2ZCLL 2FZ3A 1ZGLA 1D5IL 3WFHB 3DO3A 4P5MB 2C5DC 2EXWD 2DB8A 3SGJA 4D0CB 4O51B 1UQSB 3VWJD 4Z7WE 5DGQA 5JDSA 4JR9H 2HLFD 3TBVA 3W5NA 4XP4L 3QPQD 4I2XB 2PTTB 4HKXB 3O3UN 4FQHB 1KN2L 4MLIA 4U1MB 1WTGT 2PYEE 3S4SB 1IKFH 2DLEA 4D9RE 3QHZH 1QBMH 3TYFA 3BPCA 2Z8VC 3EAKA 3O3AB 4WUKL 1M7IA 1R3JA 1UCBH 4FQLH 4U6XB 4PUBL 4HWEL 4LCYA 1V7MH 4WEBH 4N90D 1GGBL 2R1WB 5C6TL 1KIPB 3O41B 3PDDA 3FAXA 4UV4H 5EZJA 3IDJB 5EU4B 5BRZA 1ZTXL 1I3RB 3QIBC 4PJBF 5JO5B 1PJ9A 5EIIA 4H88L 4M5ZH 2XICA 5I1EH 5JZ7D 1MCKA 2VABA 1GJIA 1K8DA 1CDUA 4JY6B 4FXKA 3P9LB 5T1LD 5JW5B 1X4ZA 1RV6X 2GI7A 3KPOB 2KQNA 1LDSA 3ZZ1A 5I66B 1BPVA 1L0QA 2Y6SC 4LDLB 2BRQA 2ZNXA 3UTQB 1P5UA 5IHUL 5LBSL 2AJVL 4JEGB 1YJDH 5B8CB 1H5BB 1MHEB 4Z7WF 2QADC 4OGZA 1YEFL 3W39B 4JB9L 3DURB 4EDWH 3D69A 5HHOE 3RWJB 1WF5A 1A1OB 5EWIH 3MRJA 4F9LA 5F6IC 3GSXA 1LQSR 2JCCF 4EN3B 3HRZB 3VI3F 2F5AH 3BH9A 3OJDB 4XT1C 5F21B 3DYMA 3G6AA 4DGYL 3NCYP 3IXAB 5BXFB 3EYSL 3I9GH 1IFHL 1N7ML 2GTZB 3CPLB 4P5MA 2X89A 1DJSA 4O51A 3DSFH 4IOIB 5JHLH 2PUQT 2DQUH 4I2XA 4IMKA 4GAGL 1F45A 2PTTA 4HKXA 4MB3A 1T83A 3MCKB 1P7HL 4FQHA 1S7VB 4U1MA 1KUMA 3S4SA 1TJIL 2HH0L 4XBEL 2W07A 1TNMA 3ARBD 4PJ8A 4GMTH 3WXWL 1MJ8L 3S3PA 1CFNB 2QHRL 3BWUC 4U6XA 4RFOL 3BGMB 3VXQB 3DI2B 3NCJH 3SO3C 3V52H 1T2JA 1QFPA 1W8OA 5TF1L 5D1QC 1KIUA 3UJIH 2R1WA 3AUVA 2FHFA 5HVHC 3O41A 3T65B 1E6JL 3U79A 5BS0A 1FIEA 5IQ7L 3QNZB 3H9HB 3IDJA 5EU4A 4QRPE 1I3RA 5E2UL 1N64L 3MUGB 5JO5A 3MV9E 3MA9L 1CQKA 3B6SB 2DQTH 2EDFA 4RZCB 4X6BB 1BGXL 1HHJB 4JY6A 2R9HC 3P9LA 3JVGC 1Y6NR 4XPAL 1QACA 2X10A 3KPOA 5DFWH 3SGKC 5I66A 1HDMB 3B2VH 4ZUWB 2YD1A 1MSPA 4LASH 2IQ9L 5CIPH 3DV4B 2YPVL 3UTQA 4LNVA 1O0VA 1ITBB 1WWCA 4E41E 2D31A 5B8CA 1H5BA 1MHEA 3MLVL 4PJFF 1IE5A 3W39A 5EO1B 4O9HH 1WFTA 2A73B 4L3ED 3DURA 4AH2B 1CD1A 3RWJA 4LHUD 4FNLL 2NX5D 4EN3A 4BJLA 3HRZA 2IBBA 4XBGB 5I1AB 3OJDA 5IGXL 2E8YA 2LU7A 4GJTB 3EDFA 5FOJA 2K9UA 3IXAA 3L7EB 4PRNB 3L1OH 4OBSA 5BXFA 1A64A 5GGTA 1RVFH 3CPLA 2GTZA 9CGTA 1CICD 1J9CT 3KPMB 1QP1A 4IOIA 4LCCB 3P4LA 2QJDA 2VXQH 5J4MA 4UT6L 4RGNC 3UJTL 1CGYA 1YY8B 1S7VA 2YA2A 5IBLC 4KZDH 5ADPL 4MA8H 4L4VB 1M4KA 1KLUB 1MCIA 4N0UE 2E6QA 5A3ID 5EZLB 1CFNA 2F19H 3BGMA 3VXQA 4OCYL 5E00B 3VD4A 1GAFL 5LG1A 4GG8A 5EB9A 2YXMA 1VGKB 3QO0B 5DQDH 2D9CA 1A6WH 4UBDC 1OAKL 1BEYL 3VU2A 2C1PB 2GYSA 5FKPB 5GRVL 3T65A 3EDEA 4X8XA 2VDLH 3L5JA 5KVGH 4ELMB 3PWNB 3VFWB 1BFSA 1CXKA 3QNZA 4GAFB 4N8PA 4PGEB 3BPLC 4G7YL 5IESL 3H9HA 1FLRH 4S1DD 5C0GB 2NY2C 4ODTH 1EBPA 1IC1A 2C3VB 3ARED 5C0BA 1CXFA 3MUGA 2ESVE 4DK3A 4HG4J 3B6SA 4KY1H 3NCCB 1LVEA 2IF7A 5F7UA 3MLRH 2RCSL 4RZCA 4X6BA 4OUUB 3HZYB 2EE9A 1HHJA 2BVUA 2FH8A 3GIZL 3ZE2F 3BKMH 1BMGA 3NFPA 4D9QD 3K81A 5C08D 3SKJH 1I1AD 1DBKL 1MHPL 3DV6B 1HDMA 2ARJQ 3RIFK 4ZUWA 2QADB 4PJ7A 3GSUA 1ZXQA 4HKBA 3DV4A 3ZYOA 3FTGB 4ZNCD 2V9TA 2OP4L 1CGSL 1L6ZA 5EOCL 3N1FC 4UOW0 2HKFL 1TIUA 5DQJB 2IBZY 1ULVA 2JLLA 4LLWB 3STBA 5J6GB 2IMMA 4M9PA 3MGAA 4PYHA 4YO0A 5HHXL 5I1HH 5I1KH 3CSYB 5EO1A 5HY9A 1T66D 3AB0C 2A73A 1UGNA 2MPAH 4AH2A 4PJHB 1LO0L 4WHTB 4X9HA 5JPMA 1ED3B 4HH8A 4XBGA 4OLEA 5I1AA 2AKRB 4QRRB 5F9OH 1ERNA 5DC9B 3L7EA 1C7SA 4PRNA 1A6UH 4G6JH 3KS0J 5K9JH 4LCCA 3JZ7A 25C8H 1FGVH 2NLJB 1BJ8A 3QCVL 2BJMH 5F3HA 1FG2B 5ANMB 1EDQA 1YY8A 1NDMA 3VGBA 3ZDZE 4K7PX 4XTRC 2X4NB 4L4VA 5IFHL 5B4MD 3ZSTA 5FECA 1MY5A 4IRZH 2ADFL 3SO3B 3WUWG 4HS8H 5EZLA 3GSNB 1KLFA 5D1QB 4H0IA 5F7FA 3RWFB 5E00A 4NWUH 5E08H 5HVHB 2K1MA 3WEXB 5I75B 1VGKA 3QO0A 3WNNA 1U58A 3VE0B 5BV7H 2R0WH 2VDNL 4O2FB 2C1PA 5FKPA 4M48L 5I9QC 4LSVH 3BKJL 4KUCD 3F7PC 4FMFA 2Q8AL 4ELMA 2GKIA 3MLUL 1JK8B 3PWNA 3VFWA 4JAMB 4AEHH 4PGEA 1UA6H 3FL7A 1YEHL 1A9EA 1OAUH 1WK0A 3WFCH 1KELH 3LB6D 4XNUL 1KENH 1U8KB 3D25B 2C3VA 2VSDA 2FH6A 3MCLH 2EDKA 3MRIA 1Y6MR 3NOIA 4OM0L 3DBXB 2IWGA 1P1ZB 3IU4L 1F3DH 2AV7B 4XMLL 1YEGL 4WHCA 2YN3A 4OLXL 4OUUA 2BVQA 3HZYA 2I60L 4HCRL 5KSAC 2KZ1B 3CFBB 1TTFA 2PYED 4P4RA 3JV4B 4TYUA 2YXFA 4GAJL 2GK2A 2HLFC 1CFSB 2JK5B 3DV6A 2EDRA 4ZO6A 4LLAA 1R6VA 1WBZB 4UILH 1KV3A 2D7QA 3OMZA 1JGEB 2W60A 5JXAH 2XI9A 3FTGA 1MCHA 3WIHL 4HHAB 4WFHE 1MY7A 3RUGE 4LLWA 2CKBL 4DQOL 3NZHH 1VPOL 4I3RH 3RVWC 3JWDC 1VHPA 1JPST 2OTUB 2I26N 4PJHA 1B90A 2EYRB 1SEQH 5ALCL 4WHTA 1ED3A 3ZKSD 3BMWA 5KG9B 2X44D 2AAVA 3FRPA 2AKRA 2X1XR 4QRRA 1Q0XL 1UWXK 5J3HC 3OKLB 2AJSL 3G6JB 1KYOK 1H3UA 3WV0A 5FF6B 1A2YB 4OZIE 3CVIH 2Y7QB 4XP1H 4P49A 5F8RC 5FYJH 3X14A 1DBMH 1BJMA 5ANMA 1KN4L 4R90H 1IGJB 5JZ7C 2WINB 2X4NA 4LSQH 5HPMB 1BD2B 5JXEA 1YEEL 3GKWL 1KFAL 1J0IA 1BVLA 3KPQA 1A6ZB 1U93B 1E4XH 2N4IA 3WEXA 2JB5L 1F2XK 2HA1A 5ADOL 4NNYB 4OGAD 3V4VH 5FUZL 1NPUA 3BPLB 2E7CA 5IW1B 2ZG1A 4O2FA 1NEZG 2NY2B 1VFBB 1JK8A 4JAMA 3EZ8A 1J1PL 5IB5A 5I71B 1MI5E 1QA9B 1U8KA 3D25A 4EKXA 1TVBB 2J8HA 3OAUH 1G7HB 2GJJA 3LRSB 4FFYL 3RNQB 5T3ZE 1YPZE 3CXHK 2NY1B 3RUGF 4DKDC 4TTDD 3JVGA 5I8OH 5B39B 3DBXA 4KJPD 2AV7A 2XN9E 1FNLA 2DYPA 3PIQB 4HC1H 4LSDA 3SGKA 1IC7H 1NCTA 3IJSA 4Z7UE 1WWWX 4HPOL 3JV4A 4TUOB 3FT4B 3HUJF 3K80A 5I1IL 1CFSA 2JK5A 3QI9D 2R2EB 2ILLA 1WBZA 5L2KD 1CIDA 4ETYA 5E03A 4HHAA 3AB0B 4XPBH 3IU3A 3LQAL 1J0HA 3ARBC 3ET9F 2OTUA 3B3IB 3EJZC 3PDGA 4UT7H 2EYRA 2R8SH 4TOYH 5HYSG 5KG9A 5B38G 1NCWH 3HS0B 2EDLA 1XGRB 2YK1L 3G08B 5FYKU 2YD3A 3MV9D 3OKLA 4ZTPL 2AK4E 4FHBD 4ZUUB 1AO7B 4OKVB 3G6JA 2F5BH 3DECA 4AEFA 5C7XL 3RGVD 4KROD 5FF6A 1A2YA 4H8WL 4N8CL 2Y7QA 2DQEL 3MOBL 1I9IH 2YKLH 4BUHA 3EO0B 2XG4A 4P57B 1A6AB 1IGJA 3F7YB 2WINA 4WTXA 3MUZ1 5DTFB 2AEPL 5HPMA 3MRMB 2DBLL 3LEYH 2AJUL 4IDLA 4TSBH 5GRVK 5D7LD 1A6ZA 1U93A 4Y0GA 5L6YH 4E41D 5I9QB 2DL2A 3DRTB 2WNGA 1FFRA 4NNYA 4OB5L 3WNLA 3OF6D 1ZOXA 2JIXD 1IARB 5IW1A 4QT5B 4XPHL 2FX7L 3CAFA 1LDPH 5F3BB 4KVNH 2VDPL 1QSFB 4Z7UF 5KSVB 2A74B 2EEAA 1N0LA 2OM5A 1OCWL 3L3JB 2BERA 2WWMC 5E2TL 5DHVH 43CAB 3LKNB 1TVBA 1BIIB 3RNQA 3LRSA 1PFCA 5DRZA 1HINH 4HEME 3ZYIA 4S1RL 3R0MA 1KC5H 1Q38A 5B39A 5GIRB 1SMOA 3HB3D 1RFDH 4WTWA 5E6ID 3BUTA 3PIQA 3MJ7B 5GZND 5ISZA 4Y2OA 2VZUA 1AIFB 4AEIH 2XRAL 1CICC 4YLQT 1FORH 1AQDA 3ZTJG 4TUOA 3FT4A 1M05B 2R2EA 3FMGL 4GKZB 4EUPG 1U91B 2RGSA 1EK3A 5SX5K 5HPOA 1JF6A 1I7RB 1DL7H 3WFDH 5I30H 5CJ5A 5IHLB 4OZGE 1QFWI 2H1PL 3VD7A 3B3IA 4GKSB 4P3CH 1FNSL 2Q8BH 4U1LB 1IVLA 2VDQL 2AXJA 2E9WA 3HS0A 4PGZA 1JPFB 1T6WA 3ARWA 1ONQB 4ZUUA 3ARFC 1AO7A 2OR9L 4FQJL 5F9AC 1B6DA 2Y25A 3LN5B 4S1DC 3V7AG 2P5WA 3R0NA 3AREC 3SKUD 2VLJE 1FZMB 3O81A 1AXSB 1XF3B 2CDEB 1MQKH 2PF6A 1JZ5A 3EO0A 4P57A 2VUYA 5DD1L 1A6AA 1E4KC 4Z77B 5T1LB 3F7YA 4XCCH 5DTFA 3BJ91 3MRMA 2AABH 4RISL 2X4UB 3BE1L 4UOW1 1F58L 3EOBB 5CS7A 1RD6A 3MV8D 4QEGA 1I1AC 3DRTA 4LOUD 4OIIL 1CU4H 4YHYC 5DVOA 5GS3A 4KZEL 1MNUH 3CMOH 3UBXG 1EBAA 3TV3L 3OKKB 4OZFH 1YEJL 4M7LL 2DQGH 1QSFA 5KSVA 2A74A 1ND0B 2PCPB 4PJ5E 4ZPTB 1T66C 4NO3B 4WY7H 3L3JA 3CX2A 5J7CC 43CAA 1B2WH 3LKNA 3RVTC 15C8H 1LE5B 1ZGLP 4OZGF 4HH9B 2X1PA 1Q1JH 1SJVA 5GIRA 1Q9KB 3RZWA 3ARTA 3VWJA 4OQ1A 3MJ7A 2W9DL 1HILB 4V1DE 2VN7A 5JW4R 1A9BB 2AP2A 1YNLH 4BQ8A 1FDLH 4Z5RB 1M05A 1U91A 5IVNA 3Q1SH 5KVDH 3MLSH 1OAZL 3ARBB 4PRPE 5T1MB 2FGZA 4UT9H 5IB2B 4OCRH 3C2AH 1M7XA 3O3EB 3WSQL 4XP9H 4L4TE 4JFDA 2YPKB 3N9GH 5GS0H 4GKSA 5EBGA 5I1CH 1MIMH 2QSVA 4TNVF 1EH9A 1I1YB 3ARQA 4U1LA 4AL8L 5IF0B 2P8PB 4U05A 2XFXB 2YRPA 1JPFA 4NUGH 5I2IB 5IB3B 1FJ1B 4OFKA 3EOTL 1MJJB 3QSKB 2VLME 3FB5B 4G3YH 3LN5A 2V9QA 3MLWH 1KBGH 3MO1A 5FUCE 4GO6B 1FZMA 1AXSA 1XF3A 2EH7L 2CDEA 2E8ZA 2KL6A 2YC1A 4Z77A 5F1KC 5T1LA 5I0ZA 2VDOL 1L4IA 5D8JH 2VOTA 1G9NH 1IGTA 4YHPB 3O6KH 4HKZB 2XV6B 3OKOB 4NYLB 3GO1L 4M43H 3TLRA 1VFAB 4LPVA 2GJ6E 2LV4A 1EVTC 4G8GE 2NY7H 3BP5B 3QWQB 3GM8A 3P0YH 3OKKA 3WLWD 2BOBB 4L3EB 1N5YH 1FNEB 4LHUB 2DOCA 1NAMH 2Z31D 3ZHLA 1F2QA 5TFSH 3EJYD 1ND0A 2CR3A 5ITFA 3BGFC 4ZPTA 3K8LA 4NO3A 4M1CD 3JV6B 5D6DC 3IDMB 4I13B 2O5ZL 2EC8A 3LMJH 1LE5A 3BRFA 2B1HH 4HH9A 4JFHE 1CICB 2HYMA 4BFGA 3TT1H 1G7QB 4WW2F 5J6HA 2RB8A 3FHQA 4XPTL 2R4SL 3QUML 2ICEB 4WFFE 3IFPB 1A9BA 1UZ8B 3IAGC 2LABA 4Z5RA 4ZFZB 5HYQB 3QXUA 4P0DA 4PV8B 3MOAL 3U30B 4JY5L 2QSCL 3ARBA 2G60H 2GFBB 43C9B 3LHPH 3O3EA 1F13A 5FA4B 1WFNA 1MLBA 2YPKA 5TQ2H 4JDVB 4TSCH 5FYKE 1N8ZB 1QR1B 1FO0H 3P40A 4A6YL 1I1YA 1PY4A 5IF0A 4OGAC 3ARFB 4K9EH 2XFXA 3S88H 1TCRA 1LGVA 5I2IA 4U4BA 5IB3A 4JPWH 3AREB 4X4ME 3U4AA 3VA2C 1MJJA 3BT2L 4O4YL 2EEBA 2R56H 1R3HB 1EHLH 1SHMA 3FB5A 4RGMC 2XN9D 4P4KD 2GK0B 2D7TL 3FO9B 4KMQA 3QH3A 3C5JB 1P4BL 3HE7C 4NNPL 1AI1L 2J8UF 2ATKB 3D2UD 5L7XH 3NBNA 3DX9A 2W1NA 1IGFH 4KJPC 4Z9KB 4U0RC 2IG2H 4HKZA 1BQLL 3OKOA 4K8RH 4NYLA 1I1AB 4F37K 4YHYB 3W2DL 3QULB 1VFAA 3IDUA 3MRDA 3TIEB 4KI5F 3HI1A 3LQAC 3QI9C 4OD3L 4ODSL 2H2PD 3HR5A 4YWGL 3PNWB 5MENE 1IKNC 4HIEB 2ZCKH 5D70L 3BP5A 3N1MC 1DANT 2BOBA 3WXVH 4L3EA 1FNEA 4LHUA 1T89C 5DHXB 2QQLH 1X5GA 4TUKL 5JLZB 2NX5A 2O5YL 4Y4KD 3JV6A 3MACH 3IDMA 5I1GL 4JFEE 2AK4D 1XMWA 4LARL 3HMXH 2VR9A 5J1AB 1L7TL 5ILTH 1WLHA 4PP2B 1CICA 1RUMH 3IFNH 2I24N 1HSBB 2R0KL 3G9VA 4H8WC 4NO5B 1G7QA 4BFEA 5DD3L 1FC1A 3WD5L 2ICEA 1DBBL 3AMKA 3QUYD 3V6OE 4AQ1B 3RGVC 4U1NB 1CBVL 3IFPA 1UZ8A 4FG6D 1RJLB 1T4KB 1JHTA 4KROC 2JJVA 1ITCA 2YHGA 3ULVH 5ACMA 4ZFZA 5HYQA 3N1PC 1S3KH 4PV8A 4PIRF 5K9QI 1TPXC 1MEXL 1MQ8A 4LKCA 1KXTB 2GFBA 2A0LD 2V7HB 3QXDA 1OGAE 5FA4A 5CUSH 5F9DC 2CRZA 4OFVA 1U3JA 1JGDB 4H1LH 4IM8A 3U0TA 4JDVA 4WEMB 1QR1A 1FE8L 1N8ZA 3V4UH 5D5MB 2XKUA 4FTVE 1BZQK 1WIUA 2BZDA 5EOTB 3VI4E 4KQ3L 4MJ2A 4PLJD 1WCQA 3I3EA 2F53B 1IT9H 3GK8H 1MCBA 2ZSVA 3VDBA 3QHFH 5HGBB 3AREA 3PP4L 4MX7A 3C08L 5A2LH 4E5XB 3SGEI 4PJEA 2OMNA 3BX7C 4NP4L 2QQQA 5DF0A 1FVDA 2GK0A 3FO9A 5GHWL 4H25B 4Z7WB 3C5JA 5IJKA 2ATKA 3KVQA 2AV1B 3MOQA 2XTJD 2PYEB 12E8H 3HB3C 4TSAH 5IR1B 5GZNC 5C08A 1I1AA 2CKBB 1ZA3B 1L7IH 1YYLL 1A47A 3HNVH 1N26A 5IP4A 1NKRA 3BKYL 4NFDA 3TIEA 1N0XH 3CH1B 1BBJB 1MREL 3RI5K 3U36B 1G6VK 1BX2A 1ZHKB 3PNWA 5DQ9A 4HIEA 4P5KB 1MFEH 2ZPKL 2FJFA 3FT3B 4JG1H 4E9LA 5KTEL 5I74C 1KTDB 3TBWA 3AXLB 4ERSH 3WKML 2X6MA 5JLZA 1CR9L 1YEKL 3G6DL 2J2ZA 5IBUG 1DUYB 1X4YA 4GRWE 5ID1B 4NRXB 4JKLA 2JJTA 5J1AA 2PR4H 3TWCH 5I19H 1U8IB 1SM3L 4PP2A 4JKPL 4JHZA 1HSBA 1BM3H 2Q3ZA 1EAJA 2LAAA 2L7JA 3VXSE 3ULVE 2WLYA 1RJLA 2BRRL 1T4KA 4EI5C 4YDIL 1JI2A 5CINL 5FDWB 4KK6D 1ZLUH 1PDKA 2YN5A 4F58L 1II4E 1JZ7A 1PD6A 4UIKL 3F8UB 1KYOJ 4GS7C 4POZC 3ECBB 4RGOL 1JGDA 3BH8B 3JV0A 3ZL4L 2P47B 1GRWA 1UADC 4LNRB 5D5MA 3QUKB 3U1SL 4LOUC 4NC0B 1VACB 2KUTA 5EOTA 4PJ5D 1ZSDB 2AI0H 3D3VE 4ZD3L 1U42A 3BSZL 3O45B 2FECI 1T03H 5DZOA 5T3XD 2H41A 1JRHL 1E4WL 4P9ML 1GGYA 4RBPH 3ARYA 1K9TA 2UZXB 3QJFB 3HE7B 4JN2A 4E5XA 4HCRA 4ETQB 4PJXF 3LKRB 2FIRT 4YXKH 1YQVL 2VAJA 5T3XL 4H25A 1S9VB 5IVXE 1QYGL 1CDJA 4LLMA 3SE3A 1WZ1L 2EKSB 2AV1A 5HYJE 1DFBL 4PTUA 1F8TH 1RZKL 3RKDD 2PYEA 2QQNL 3WIHA 3D0LB 1A7NH 4KHTL 3D18B 1QFWH 1RURL 4GW4B 3PP3H 4LDOB 5IR1A 4MVBC 4GRWF 3QI9B 2CKBA 2NTFA 2W0KA 3FO1B 3NPZB 4PRPD 1FBIH 1ZA3A 4U3HA 4DZ8B 3RTQD 1B4RA 3R8QA 4HLJA 5L2KB 5ICYB 4R4BB 4ZNEA 3CH1A 3CXHJ 4A2MA 1BBJA 5ACZB 5C3LD 2Q7NA 3U36A 2V2TB 1GCFA 1ZHKA 3SQBA 3BZ4B 4RWYH 3JTTB 1A6TA 2Z93B 3FT3A 4FFVD 3LEVL 1KTDA 3AXLA 3MLZH 3MRNB 4Q6IC 3ULVF 4DKFH 1X5JA 1UWEH 4G9DB 4LAQL 1RZIB 1CLYL 1D9KD 3KJ6H 4L1DA 1DUYA 5ID1A 2IH3B 2VLMD 1I4FA 4OFIA 4QRPB 4NRXA 3LQMA 2QHLA 3MV9B 1EEZB 3UPRB 5L0QB 3RGVB 2B2XL 4FFWD 4KROB 2VISB 4YDKH 4MXQD 2N1KA 3CDGB 1NCDH 4AMKH 5LWYL 5KVFL 1E0OB 3T08A 4PJ9C 1TPXB 4J12A 1XR8A 4UINH 3QA3B 5FDWA 3VXRE 3VXME 2DLFH 2GJ6D 1KCVL 1NC4D 4LEXL 3QQNA 3BMVA 5D7LB 4MD4B 3GMMB 2PW1B 3P4MB 3G9AB 4E41B 1WT5A 2Z8SA 2YA1A 3OJ2C 4Q7DA 3HZKB 4OLYL 5LJYH 1N4XL 1P53A 3BPNC 3UPAA 2JIXB 1NCAH 5IVOA 3BP6B 4UTAH 3QUKA 3GI9H 2DQDH 1MRCL 1VACA 3GMQB 3O3DB 4AEEA 5LGHL 3VFTB 3O45A 3HNSL 3QDME 3WLWC 4M7JL 5DO2D 4KKCD 3QJFA 3HA0A 4ETQA 1ADQH 3EJYC 4OCWH 3LKRA 5GS1A 4JFHD 1Z9MA 4M1CC 5F7LB 4Y1AE 5E6IB 4XNYL 3L3KB 2EKSA 4G8EB 4X6DE 4WFFD 3QIUD 1T7YA 2WM0A 4OZ4B 3QZWG 4HXBL 1D7FA 2EDDA 5C8JA 5E1HB 1I8IB 3HNTL 2XNAB 1IEAB 3D18A 4YHMH 4GW4A 4KH2A 3QI9A 1CF8L 4N0UB 3RBGA 1YNKL 4DZ8A 4UNVA 5JORB 4LIQH 3H3KA 1NMCC 1GC1C 5L2KA 5ICYA 4R4BA 1UG9A 1YEIL 1L0YA 4D94A 1U8LB 5ACZA 5I74B 4S0TD 1T1XB 4W4OC 2DMCA 4KRLB 1T89A 3BZ4A 5FYKD 2Z93A 3AS1A 4S1SL 4ODHH 1RI8A 2HLAB 5GXBB 4RX4D 5EOCJ 3MRNA 1HXMB 3ESUF 4G9DA 1OSZA 5FYKL 1NFKA 1WTLA 4P2YA 2ITCB 1BECA 1OP9A 2OCFD 2R1YB 2FHCA 2IH3A 2DD8L 4APQD 2ADIB 3MV9A 1R3IL 5IOPB 1EEZA 3UPRA 1AQKH 3K3QA 3RGVA 2CUIA 5SWQA 4HUWB 3MX0A 5I18L 4QNPF 5CWSB 2FEEI 1NFDE 5T33H 1JGVH 1JF5A 4P4KC 3LPFA 3PQYE 4KJYB 5FYJU 3QXVA 5K9OB 2NR6D 3QA3A 4JJHA 3U2SB 3WDJA 1Z3GH 2OTPA 5D7LA 4MD4A 3GMMA 3U4BH 2PW1A 2YZ8A 3LN9A 5T1DH 4FABH 3P4MA 3MV8B 4E41A 5MEND 5GJTL 1A3LH 2XWTB 3HZKA 3V6ZB 2XA8L 4MYWB 3OF6A 2JIXA 3HAEA 4X6DF 3ZKXC 3BP6A 1NSNH 3L3DB 5DJ2B 3RIAK 1CE1H 2HJFB 3GKZA 3GMQA 1NAKL 2I9LB 3VFMB 1WEJL 1F4WH 3VFTA 2L0DA 2DI7A 5DURD 4JFED 4X9GA 4AIZB 2DQJH 3VH8G 3JWOC 2EO1A 1DBJH 2P43B 4RMSA 2P8MB 1UM4L 3IFLH 3KYNB 2F8VA 5E99H 4DWHA 3TVMC 3C6SB 3QXTA 3WNKA 4GSDL 4GG6E 5E6IA 1A14L 3L3KA 5TQ0L 4G8EA 1OOAA 3DROB 5CFHA 4Z7OE 1ES0B 2IBZX 4OZ4A 2B1AH 1U3YA 3L9RB 1I8IA 2ZUUA 2XNAA 1IEAA 3GNML 1SVZA 2DQIL 1RY7B 4N0UA 4S1QL 4K3HA 4OF8A 4AENB 3QUYC 1OGAD 2VQ1B 4FG6C 3B9AA 5I15H 5E7FA 1T1XA 4BFIB 3DIFA 4LSUL 4D9LL 3TA3D 1QZ1A 1WIPA 3QUXD 4XPGH 3WJJC 4WRLA 2ZJSH 4ZOEA 2HLAA 4FTVD 3WL9B 2A0LC 1GIGL 1NFDF 2ICES 1HXMA 2WUCL 1RUAH 1KEML 5D72H 2X4OA 2ITCA 2NY5H 2R1YA 5FGCE 3CMGA 4FZ8H 2ADIA 1AJ7H 4PJCF 5IOPA 3RVXD 4PLJC 5CILL 4W6WB 3HC4H 4N1CA 1BREA 4PJ9B 1QD0A 1BQHG 2FATH 3DX8B 5TE6L 4HUWA 3NMEA 4I48B 4M1GL 4MCZA 5LQBL 4JRYD 5CWSA 1UEMA 4MNGA 4PG9B 1Q0YH 1GOGA 1AGCB 1NLBH 3FN3A 3IDGB 3Q6GH 4KJYA 3ZKQD 3PABB 1ROWA 3ORJA 4LLQB 4G6FB 5EZOH 5E8NB 4KAQH 1IEHA 3BPNB 2WW8A 1IAKB 3C09C 3CDFA 3MV8A 3UP1A 1XGTB 2XWTA 3V6ZA 3U7WH 1NBVH 3FQWB 4PRHD 4UNUA 5C0FB 1UH2A 1AXTL 4MA7H 3L3DA 5BZWB 4Z7OF 5DJ2A 3RZCD 3CK0L 1PKQE 5CEZH 1MHHA 2Z31B 1RZGB 2I9LA 5AZ2H 3PWVB 3VFMA 1OM3L 3MNWB 4AIZA 5FIEA 2PETA 4WDIB 2OX5A 4PJDE 3NA9L 2P8MA 1IILE 3KYNA 3QQ4B 3QUMB 1F90H 5CCKH 1MCOH 3C6SA 3ESVF 1CZ8H 1WGOA 4QXGH 2KDGA 4OZIB 4BA8A 2VDKL 3VXSD 4LQFH 3DROA 3E2HC 5C9KA 1ES0A 4E42B 3L9RA 1NMCB 3TT3H 1QHPA 3DHJA 1LILA 1A7BA 3O8XD 2IEPA 1SJXA 3RWEB 4YHIB 3DX6B 2XPGB 1D6VH 5DMJB 1A7OH 4AENA 3TPKA 1HHGB 2I25N 2VQ1A 3ZE1F 1LO4H 3QDJE 5FUOL 4BFIA 2O5XL 1MF2H 2WMPA 3UYOD 4Q58C 2CKNA 1IAOB 3WL9A 4LSSL 5D1ZD 4FRWA 5DRXA 3T4YB 1GGCL 1HEZA 4ZOBA 1TDQA 2NZ9D 1J88A 1UXSB 4OTXL 1UWGL 3SDCD 1YN6B 1YPZB 4N0CD 3WIIH 1QBLL 1JBJA 1D6EA 2XN9B 3D9AL 4P4KB 2Q7YB 1NGWB 1S5HA 5HYJD 3LZFL 4I48A 2FB4H 3D2UB 2HFFA 5A43C 3FQUB 1WVZA 4PG9A 5CZXD 5A16B 1AGCA 3IDGA 1J12A 3KYKH 1Q72L 3PABA 6FABH 3EFFB 1R24B 1MCRA 4LLQA 2YD2A 1GHFL 5J11C 4LSPH 4PJDF 5E8NA 3UAJD 3RKDC 1O7VA 3S98A 4F8TA 1KG0B 1YYML 1IAKA 5INCB 3ZKXB 2C4XA 3SOBH 2A6DB 4UIMB 4I0PD 1XGTA 4H26B 3O0RL 3FQWA 2OL3L 3VGEA 4KRMB 3RTQC 5C0FA 2R39A 5BZWA 1UZ6E 3ZSSA 2Z31A 1RZGA 1WICA 4KKLD 3VRLE 3H3BC 3O6LL 1L0XA 4Y4KB 3MNWA 4FFVC 4YJZL 5JQ6L 4WDIA 2X40A 4PLOB 3A6CL 2AK4B 3I85A 4ZXBD 3U9UB 8FABB 4YX2H 3QQ4A 3QUMA 4GRLD 1UXWB 3GBNH 5KSBE 4YFEA 3GMLB 4OZIA 5D2LF 2UUDK 3GSOB 3T3PE 2D7PA 4E42A 3P11L 1U8PB 3QUYB 3MBXH 3NIFE 5FUCC 2VLLA 4FFWC 1OY3B 5D7KE 3RWEA 1QBML 1RHHB 1RIVH 2XPGA 1A7QH 5H37H 5C70A 4U6VH 2FO4B 1EZVX 1HHGA 2I07B 3UTPD 2HVKB 1UCBL 3BZDA 4A6YA 1V7ML 4WEBL 3ULSA 3TEUA 3S36L 1GGTA 1IAOA 3MR9B 1JNHB 1UKQA 2CLZB 3VD3A 3A6OA 3RL2B 3T4YA 3TIDB 4YR6B 1MCQA 5FM5O 4WEUD 4B41A 3ZTNL 5C0ND 1UXSA 2WBWB 5HHME 1U8MB 2FYYB 1YN6A 1IM3B 4G8IB 2HT2D 1YPZA 3SE4A 4XVJH 1RIHL 1CYGA 2XN9A 3DGCR 4P4KA 5I1EL 1C5DB 3RPKA 2Q7YA 4J4PD 4KKCC 4U7SA 3WO3B 1NGWA 3D2UA 2RBLA 4WI9A 4OZFG 3FQUA 2XTJB 5A16A 1RMFL 5H35B 4MZ3A 3EFFA 3C09B 1TETH 2ICWB 1MHCB 2J3SA 2OYPA 4AY0A 1KG0A 3S35H 5INCA 2VXTL 4N0RA 2A6DA 4G42B 4UIMA 4H26A 5IUSA 4DK6A 4MXWH 4Y19D 5MEQB 5DGRA 4M61B 1MFBL 2PO6D 1XR9B 3E0GA 3N85H 4XC1H 1HQRB 1PBYA 4HUNB 3I6KB 4Y4KA 2GTWB 1T3FB 1DVFC 2DICA 1M1SA 5HYFA 1MWAL 1FRGL 2AK4A 5H94B 3CFCH 4C59B 8FABA 3MRRA 3QG7H 4PRID 3E2HB 3UROR 5BVJB 1UXWA 3KNBA 3GMLA 3DSFL 1A22B 2DQUL 1FAIH 5E6ZA 2Z92B 3GSOA 4JKWA 5GGTH 5E94B 3PQYD 1P69B 1U8PA 3QUYA 5E8EB 1VKXB 1FSKB 4YBLC 4XMPL 2IAMD 4KTYA 3CJJA 5LXGH 2DTMH 1K4CB 5E56A 1RHHA 5IMMB 5ABDE 2FO4A 4GMTL 2B5IC 2I07A 2HVKA 3CC5A 1QLEH 4J3OC 2NR6C 1V3LA 1HH6B 2Y07L 3NCJL 3T0WA 2Q76B 2D3VA 3HC0B 4KVCH 1KEGH 1X6LA 35C8L 3MR9A 1JNHA 3BFOA 2CLZA 4M3KB 1MAJA 4NM8L 3WUWA 1F42A 2A1WL 5EA0H 4YR6A 3TIDA 4CKVX 5DLML 1NCCL 3HKFA 4JFFD 4PJ5B 3K0WA 1JNNL 5I6XB 3NIGE 5DEFB 1GH7A 3PXJA 5BS0E 5KAQF 1U8MA 2FYYA 1IM3A 3CZFB 3MMEB 5DZNA 3K4DA 4X4XB 2X9WA 1Q94B 3QDAA 4BZ2H 1C5DA 3RX7A 4QXTB 2XTLA 2Y5TB 5J11B 4OQTH 2VDRH 1J87A 2WAHA 4YE4H 4O58L 4BQCA 4NCDA 2C9AA 5H35A 1OP3K 3GSRB 3V6OC 3KHOA 1ZT7B 1LO2L 4DKAA 3B2VL 3DUUB 5HHPB 5I73B 4PRPB 1MHCA 1RK1B 3RTQB 2GY7B 1G84A 4G42A 3RAJL 4Z18A 4I5BB 5DUMH 3OKNB 5E2VH 4UB0H 3EHBC 1FVEB 1LD9B 1MFAL 1HWGB 1XR9A 4OF7A 1HQRA 1NGYB 3TPUB 3QIWD 1I9RH 1HQ4B 3I6KA 2GTWA 4ELKB 3G5YB 3QUXC 5IM7B 3OZ9H 2A38A 3SCMD 3RVUD 3HR6A 3FO0H 2XA3A 1KPUB 3DWTA 1X5LA 1HYSD 5DDHB 1CQYA 4MJ5B 5BVJA 1AY1H 4HMCA 3ZE0E 5DXWA 1OGTB 2Y36H 2Z92A 5DHYB 3WFEH 4ODXB 4OLUH 1D5BB 3RVXC 5E94A 5E8EA 4L9LC 1VKXA 1RULL 3KLHC 4KZDL 4MA8L 5GGSY 1K4CA 4XP6L 4JPKL 5IMMA 4X7SH 4TRPH 2AJXH 2AERT 1LO3L 2GJ6B 1JN6B 1RK0B 2WWKO 1TZIB 4XB8A 1NC4B 2AVGA 4U7MA 1J8HD 1HH6A 5F97E 2Y9RT 1SJHB 2VQUA 4WO4D 4M6ML 3IFOB 5F88B 1A0QH 2XZCL 2VDLL 3V0WH 2C7UB 3ALXA 5KVGL 4GQ9H 3T2NH 2DMBA 2X9YA 1FZOA 4PJ5A 3TC9A 2XQYG 3SKMB 5T5FH 3MXWH 5GGRB 5L88H 3CZFA 2DQHH 1UH4A 3HZVA 4NIKB 3MMEA 5F1NB 3OAZH 4X4XA 1Q94A 5GS2D 5FO8B 4KY1L 5C0BE 4JQIH 1OT2A 4PG2A 1LK3L 4FQCL 5EO0B 5HGGS 3ZHKA 5CGMA 2Y5TA 1EHNA 4OLZL 4PD4K 3JSSA 1TJHL 3BKML 1G9ML 4M00A 4BK5A 4YZFE 1NQBA 1DEEB 3MRQB 1MJUH 3GSRA 1ZT7A 3N1QC 5HHPA 4TUJB 3KYOB 3ULVC 2ICCA 4PRPA 1RK1A 4MA1C 3RTQA 2AK1L 2CK0H 4JZNB 4KUZH 3GI8L 3VFOB 3O8XC 4PJ7E 3CLFH 3ZE0F 3OKNA 3IJYB 5F7HA 1PEZA 1FVEA 4EUPB 1I85C 4QRSA 1DQDH 1NCUA 1NGYA 3TPUA 4LP5A 1T20B 1HQ4A 3BI9X 3G5YA 5IM7A 1D9KA 2H6PB 5F9OL 5D1ZC 4BZYA 3QNYA 5KANI 4KJQD 5B3NA 1DZBA 4Z0XB 1KPUA 5CGYD 5FHAH 4PGCB 2NZ9C 3ILQD 5DDHA 4YXHL 1A6UL 4MJ5A 5F96H 5B38A 3SDCC 3EDKA 2F58H 5K9JL 3IJHB 1HWHB 2FJHB 1FGVL 4H1LG 5DHYA 4N0CC 4ODXA 1OWWA 1D5BA 1NH6A 1GYAA 2BJML 4PRDB 1WUNT 2B5IB 2YSSB 5IW3A 3DOSA 4KRPD 3KHQA 2EDQA 2V5RA 4EI6B 4ZFFB 5DJYB 1JWUB 1PVHA 3BUYA 2GJ6A 1EEUA 3BN9D 1JN6A 1ZE3C 1RK0A 4QXWA 1TZIA 5CZXC 1NC4A 2JB6B 5KBNC 1HE7A 2V7NA 1H15B 1CT8B 5E08L 3VCLB 4WI8A 1SJHA 5MENB 3QCUL 1YUHB 3UAJC 2HRPH 2VZSA 3LN4B 3IFOA 2BSSB 1CTOA 2R0WL 3FT2B 3GSNH 4LSVL 2NCMA 2C7UA 4I0PC 5C2BL 4YZFF 4CU6A 1CFVL 4AEHL 1UA6L 3WFCL 3T1WA 3SKMA 3TGXA 5DURB 1P9MC 4JFEB 5GGRA 4F8QA 5F1NA 3I84A 2DF3A 2Q20A 4WVRA 4KKLC 2NTSP 4JDTH 1BIHA 4K2UH 5CD3B 5FO8A 4PJ7F 4U2ZA 3BAEL 3VGAC 5EO0A 5IHBA 2R15A 1CIUA 4ZXBC 4WV1C 1QBBA 4Z7NE 2PTUA 1VADB 2APXA 3K8MA 3QIUA 4N5EC 4GRLC 2B39A 4KC3B 3RL1B 1DEEA 3MRQA 1PQZB 3ZDXE 4TUJA 3KYOA 5C07E 2VTFA 5BVPH 4UILL 4QO1A 5A2IH 3KLDA 3I75B 5EC2B 5JXAL 4JZNA 1URLA 3PE9A 1OGAB 3VFOA 3ULUH 3OKDB 2J5LC 1PY9A 1K2DB 2YPLD 1CXIA 2BNRD 3IJYA 3NZHL 4I3RL 3Q5YA 3TA3B 3GMOB 3QUXB 4EUPA 1JL8A 5FV2A 1JWSB 4J6RH 5CJ8A 3UZQA 5CHNB 4FTVB 4RX4A 1YDPA 1AP2B 1T20A 4PJHE 5CMAA 1QSEE 5HHMD 3LS4H 1UEYA 3V4PL 2H6PA 3UTTE 1KCLA 3MSPA 4Z0XA 4APQA 4TULH 1QKZH 4KTDH 4OCXH 5BO1L 5DJ0B 4LFHG 4L9LB 4PGJA 3IJHA 2HT2C 2JJSA 3CVIL 2FJHA 4YDVB 4XP1L 3LAFA 1B0RB 3NPSC 4PRDA 2W92A 5A40E 2HT4C 2YSSA 4J4PC 4ELMF 4EI6A 4ZFFA 5DJYA 1CD8A 1CTNA 4W6YB 5EORH 5JIKA 5DK0B 2BX5A 3OL2A 5DI8B 5DUPH 1H15A 3MC0A 1CT8A 3VCLA 5CSZB 2IALB 1HN1A 2FBJH 5MENA 5F89B 1YUHA 5AAWA 4C4KT 4FZEL 4Z6AT 4PRHB 4Z7NF 2BSSA 3FT2A 2XIDA 4PRBB 4EBQH 1B88A 3E8UL 1HKFA 4Y16D 5JOEA 4NWTL 4GRWB 4JFEA 4HUXB 2DDQH 2PO6C 3MUHL 2VXSL 3OAUL 4Y8DC 1UB5B 2HG5A 3RWHA 4JFQB 3F12B 5CD3A 4KPHL 5I8OL 4OCMC 5GGVH 5HDLA 1NL0H 2RR3A 3VXSB 1VADA 4JCLA 3CUPB 2K7PA 4KHXH 1LP9B 1IC7L 2CRIA 3GIVB 3VGHA 2Y5EA 3EO9H 1UENA 4PJHF 2QBWA 3NIDE 3RL1A 3NCBB 5DA4A 2QSTA 1PQZA 3O8XB 1YA5A 1T0MB 3ULUE 1CD9B 1IBGH 5D7IE 5CBAB 5EC2A 3QEHB 3ZMRA 4PJ8D 2R69L 1OGAA 2DJSA 2IAMC 5CSBA 2CQVA 3OKDA 1K2DA 1OL0A 1ZV5A 1G6RL 3TA3A 3GMOA 3QUXA 4UT7L 5C71A 1JWSA 2YUXA 3EYUL 1CN4A 3JV5A 4FTVA 5D1ZB 2R8SL 3QCTH 4TOYL 3EYOB 5AZEH 4DTGH 1NCWL 3LRHA 1I1RA 4L5FH 3W0WE 4Y5YC 4C58B 1FIGH 3SDCB 4QHNB 3TYGH 2VLKD 4NSKB 2D03L 2HT3D 2F5BL 4HXAL 5DJ0A 4L9LA 2FJGB 5IVXB 1CLOL 4NKQB 2FLBT 4YDVA 3VFSB 5HYJB 2GAZB 2V17L 2YKLL 4J7RA 1TITA 1B0RA 4PBXA 4HSQA 4JRYA 1H3VA 2VKXA 1OTSD 3ZHDA 2ARJB 1HHHB 3LEYL 3MBED 3M1BB 2OL3B 1QQDB 1W0WA 5DK0A 5K59F 4K3EH 5DI8A 2ARWA 4M62L 3MYJB 4HQQL 5CSZA 2IALA 2OSLB 4ONFH 4I0PB 5TPWH 5IB1B 2X4SB 4PRHA 1XGPB 1I8LC 1U95B 4KVNL 2VERN 3ES6B 1G7JB 3RZCA 1A6PA 4IIQB 2NW3A 3NIDF 3OR7A 4JFOB 2MQ0A 4ZSOE 2ZUXA 4HUXA 3ULUF 2CMRH 4K94C 5D7IF 1DBAL 3SBWA 1S9WB 4ZXBB 1UB5A 3MRLA 3ARDC 32C2B 3QIWC 4WV1B 4OV5B 4JFQA 3F12A 1CE6B 3O11A 4LCUA 3FOLB 1KC5L 4GRLB 1U3HC 3SCMC 3RVUC 4LVNB 4MMZC 3H3PH 4UMGA 1OVZA 2W9LA 3VXSA 1I9EA 3CUPA 1MCPH 1GZPB 1LP9A 4AEIL 3GIVA 1KCUL 4GAYB 1AR1D 3VDAA 5ISZE 3VXRB 3O8XA 2Z8RA 4LMQE 2J5LB 2CR6A 1TVDA 1JMXA 4POUB 4WUKH 5K93A 3RFZC 3WFDL 3X3FL 3QEHA 1PG7X 3VXUD 4PUBH 4MXVE 4ONHB 2Z4QB 2ADJA 4OSUH 2HAZA 4P2OC 3JWDH 5D1ZA 1GGBH 3D1MC 2G2RB 2BP3A 2WP3O 3EYOA 3JUYA 4F9PA 1S9KC 5I1LB 3GHEL 4WO4C 3LKPB 3EDDA 4YHLL 4BQ9A 4QHNA 2I9TB 3TH3T 2XZAL 4NSKA 3U7AA 3I02B 3CSBA 1M6OB 4M93C 5C0BD 1I7UB 4H88H 3X13A 3NPSB 5IVXA 3VFSA 3TZVC 4X6DB 4Z0BH 2GAZA 3MRGB 2P5WE 1G9MC 1JHKL 5EU6E 4QLRA 4U1JB 3LKQB 3KLSA 3U83A 3L3OB 5KSUB 2GQHA 2ARJA 3M1BA 1A6VH 1QQDA 2OL3A 3H0TB 4UU9B 2IH1B 4HAFA 5MEPA 3MYJA 3PWLA 2AJVH 1EV2E 1CU4L 4I0PA 5IB1A 2X4SA 1MNUL 1HI6B 4D8PB 5J8OA 1XGPA 1YEFH 5EG6C 4L8SC 4KK9D 1U95A 4JB9H 1DQMH 1P9MA 3P9MB 4X0KB 4XXCA 3NCEB 4EIZC 3ES6A 4XAWH 1G7JA 1MWAB 2PO6B 4LDEB 4IIQA 3PHSA 4RMTA 4XP5H 3STLB 4JFOA 5EBMB 4Q9RL 4LK4A 4WY7L 1B2WL 4JRWA 1S9WA 3V6BR 4ZXBA 15C8L 4OV5A 1I3GH 1TVHA 1CE6A 2CUHA 4PRIB 1VERA 3FOLA 4MXVF 4DKEH 5IBUB 3WBDA 5IKCB 4M8QB 4KJQC 3LPGA 3L3IB 4HKJB 5CGYC 5D7JC 1GZPA 4GAGH 4P23C 1NFDB 3ILQC 2Q6WA 3PQYB 2V2WA 4XAKD 3RY5A 2FSEB 4GAYA 1V3KA 2IAMB 1FDLL 4YAQB 1S7XB 1TJIH 4LRIC 2HH0H 1PW3A 3EUUA 3Q1SL 3WE6B 4UT9L 3WXWH 1MJ8H 3DVNB 4KRPC 4PP1D 4Y5XB 3QFJD 4K7PL 4N68A 2Z4QA 4XP9L 4CJ1A 4GXUN 2F54D 3D0VB 4CMHC 3BN9C 5TF1H 4DVRL 3LIZL 2G2RA 3Q3GB 2XXCB 4JFDE 1E6JH 3FZUD 2HMID 4ENEC 5HD8D 4NC1E 5AD0B 5IQ7H 5I1LA 1AD9B 4PBWD 1AD0B 3LKPA 5EIVA 1J0KA 4NUGL 5JA8B 2I9TA 3OQ3B 4PB9L 2AEQL 3SN6N 1M6OA 5E2UH 3J8F7 1N64H 5F6HJ 1I7UA 1KPVB 3MA9H 4GG6B 3RIFF 4J4PA 1X9QA 4MJ6B 1BGXH 3MRGA 1V7NH 4XVTL 2V2XB 4DGVL 5EBLB 2E9BA 4U1JA 3LKQA 3WHXB 5GGQL 5IK3B 1G9NL 1X4XA 3SGJC 3L3OA 5KSUA 5C07D 3O6KL 1QLFA 1I7TA 3VGGA 3H0TA 1ORQB 2YR3A 2V5MA 3I3BA 4UU9A 2IQ9H 2IH1A 3UDWA 2Q86B 5C0JB 3MGOA 1XIWD 3C5SB 2YPVH 1B4JL 4G9FD 1HI6A 4D8PA 3P0YL 4JZJA 4Y19A 2H26B 3LD8B 1MWAA 2PO6A 1NAML 5K9QG 5TFSL 4XCEB 1QSED 1S7SB 4FNLH 5KJRL 2XZQL 1HHKA 3ARDB 3INUL 3QIWB 5EBMA 3UTTD 3FN0L 4HV8B 4UTBL 3RGHA 5FGCB 2YD4A 4ZFOL 3E1F1 3SCMB 4BSVB 3LMJL 4HUMB 2AXFB 4BH7B 4X9FA 2B1HL 5HBBA 4PRIA 3HRPA 3O6ML 5IKCA 1KIRB 3L3IA 4OFYD 4WHDA 5E70A 5BQ7B 4UT6H 1NFDA 3RVVD 4R4NC 1F5WA 5F1OB 3PQYA 3M17B 2FSEA 3UJTH 3QEQD 2CGRH 2ITDB 4XC3L 2IAMA 4YAQA 5ADPH 1S7XA 4DW2L 4DZBA 1XF2B 3WE6A 4NFCA 2G60L 3T2QA 3N50A 3LHPL 4P2OB 3DVNA 4Y5XA 2MCPL 1RZ7H 4Q9BA 4LSRH 1QSVA 1GAFH 1QRND 4WTZA 5A2FA 5F9JB 1T80A 5TQ2L 1FNFA 4WO4B 4GQPH 3B43A 1OAKH 1BEYH 1NBQA 5J13C 1PKQB 3T0DA 3Q3GA 1N2RA 4PRAB 1GOFA 4MAYA 1AD9A 5IESH 1AD0A 4JFFA 5IG7B 4G7YH 4JVWA 4PJDB 2ADGA 3DYPA 5BZDA 1EHAA 1EHLL 2FX9L 4TNVK 3GMPA 5KAQG 1KPVA 4LLUB 3DHMA 5DD5L 2NNAB 1I7ZB 1RUQL 2X4PA 4GG6A 2OI9C 1ACZA 4K8RD 2APWA 5L7XL 2RCSH 3SEPA 4MJ6A 1PSKH 2EE6A 1SYSA 2V2XA 5TE4H 3ETBF 5EBLA 1IC4L 4OLWL 3WHXA 5IK3A 1AGBB 4OFDA 3FB7B 1A3QA 4K8RL 4IS6B 1DBKH 1MHPH 2VJXA 1ORQA 3U82B 1SY6L 3BO8A 4HIXH 5J89A 1ZGLM 1T83C 1WJ3A 5C0JA 3PHQA 2FWOB 1ZANH 3C5SA 3QDJB 3QZWB 2OP4H 1CGSH 1WBYB 2HKFH 1PAMA 1BJ1H 1UFUA 5J0BA 4K3JH 3V6FA 4JO1H 4ZUSB 3WXVL 4PJ8C 2ZUYA 2H26A 2BNUA 2FCBA 4PD4J 1S7SA 2QQLL 2R1XB 3WNMA 3CIQA 3W0WD 3RP1A 1QUNA 2BHYA 3H9SD 4TPRL 1VGEL 4HV8A 1CG9B 1FL5A 3MACL 1SVCP 3SCMA 2NX5E 4O2CB 5H37G 4LL9A 2QTEA 3EOAB 2AXFA 4BH7A 4PBVC 5CBEB 4DAGL 1LE9B 3T0VA 5D7JB 4MNHA 2MCG1 3S4SG 1RUML 2H9GB 3O6FD 3QQ3B 1KIRA 1BP3B 5I1DB 5BQ7A 2DBJA 4P46D 1KCSL 3IETB 2EZ0C 3QCVH 1KIQA 3M17A 3C60D 4MJ4A 1P2CB 4NQDE 1NDGB 3MJ6A 5JUEL 4UAOB 3GSQA 4EJ1C 5AAMA 3DXAE 4KRPB 1Y0LA 1S3KL 4U6YB 1XF2A 2ADFH 4HS3B 3VG0H 3MJGX 3LKOB 4CMHB 1OTSC 3I6LD 1JHLH 5F9JA 1J8HA 1SBSL 5E95B 1Z9OA 3QJHB 4WO4A 3AS3A 1UM6H 1PKQA 2VDNH 1XGQB 4M48H 4PRAA 2GIYA 3BKJH 3SDXB 4J3TA 3MLUH 3ARVA 5IG7A 3FONB 2E7BA 1IT9L 1H5BC 3NZ8B 4XNUH 1OT1A 1HKLL 3I3DA 4YHOL 1S9XB 2UWEA 3MODH 5LCVH 3AY4C 1Q8MA 5KSBB 4HIHB 2NNAA 3LV3A 1I7ZA 4PJEE 4OM0H 4YEFA 1KTKE 2P5ED 1YMHB 3IDYC 2I60H 4HCRH 4RDQG 3MLPA 2ZKHH 5DEZA 5ETUB 12E8L 5A1AA 1AGBA 4TSAL 3CU1A 4GAJH 4IS6A 1I75A 3P2TA 1L7IL 3QWRD 4D9QE 3HNVL 2MSPA 2HTLC 1AKJD 1WV7T 5C08E 4DCQB 1AR1C 2FWOA 3QZWA 3WIHH 1M7IB 1U41A 2CKBH 1P6AB 2YPLB 2BNRB 4RAHA 1VPOH 1QFUH 4NGHH 5AYQA 4HIIB 4ZUSA 4KKBD 1QNZL 4NZRH 5ALCH 1SMAA 1PG7H 3RRQA 2P48B 2D4DA 3C8KB 5HHMB 1CG9A 1OARL 1Q0XH 1P7QD 4U1HB 4O2CA 3EOAA 4P9HL 5CBEA 2PR4L 1LE9A 5I19L 3O2DH 1PLGH 2H9GA 1BM3L 3QQ3A 2FHBA 2MKLC 5I1DA 3IETA 2KKQA 5EU6D 1HNFA 1NANI 1X5ZA 5CSGA 1MRFH 3ROLB 4Z8FH 1K8DB 4CN6A 1P2CA 1RJZB 1NDGA 4F3FB 2VZTA 3QRGH 1J0ZA 1UVQB 4U6YA 4QF1B 3GKWH 1KFAH 4DUVA 5IV2B 3IS1X 3CSGA 5J13B 1OTTD 2YMXH 1BVKB 4PJEF 4W4NA 3QJHA 5ADOH 4JDZB 3ABZA 4OCNC 3BWAB 5FUZH 3LS5H 2DS4A 1NUNB 5CJBA 1XGQA 3IB4A 3IT8D 3T0AA 1J0JA 3SDXA 1DQQB 3FONA 2BY3A 4JPVH 3MV7E 4HUUB 4KK9C 3NZ8A 1U8QB 1NUFA 2OI9B 2APVA 4JQXC 5D71L 3RY6C 1AH1A 4NRZB 1EGJA 4R26L 4M7ZC 5KSBA 1UB6B 2QLVB 4HIHA 4WHYH 4YXKL 4QRTB 4XVUD 3VRJB 1ZLSL 4YGAB 1YMHA 4PJIE 4MZ2A 1TTUA 2QR0B 5ETUA 4HPOH 4NZTH 1A7NL 5EU5B 1QFWL 1FFPB 5I1IH 4LCCC 2BVTA 1JF1A 1G6RB 2CO6B 4XWOD 4DCQA 3O2VL 2BC4B 3UTOA 4PJ8B 3TO2B 2B20A 2EYTB 5FFLA 3W82A 3LQAH 4RWYL 4ZNEE 1G7PB 2YPLA 1FFQA 4JKMA 5DVKA 2BNRA 1N6VA 4HIIA 4JFDD 2VNCA 3S3JA 4S0SD 1V8HA 4NN5C 4PP1C 4OLVH 3EFDL 4DKFL 1FV1B 1UWEL 3HHRB 1J1XH 3C8KA 3KJ6L 4QRQB 5BS0B 2ICWI 1JNLH 4ESKA 3T09A 4U1HA 3H42H 2EYSB 2YK1H 2VLKB 2HMIC 3D85D 4M6NH 5LAXB 1ZT1B 5TDNA 4KDWA 4IDJH 4X83A 3L5WA 1BF2A 4H8WH 4G6MH 4YDKL 3ZDYE 1NCDL 2DQEH 3ROLA 4QHKJ 4O02L 4GFTB 4XCFL 2E27L 4F7PB 1RJZA 3DVIA 3EKCA 5D5MF 5EPMA 2E6JA 4F3FA 4KUCF 2DLFL 4J2XA 1UVQA 3DX7B 1JTTA 4QF1A 5IV2A 4LF3B 4PY8I 4WW1B 1WWAX 4KU1A 1B0WA 1BVKA 5FM5M 4JDZA 5F7DB 4OB5H 2LU3A 3BWAA 1NCAL 1JYXA 2D31B 1V5JA 3MLYH 4UTAL 3GI9L 2VDPH 1CD1B 1DQQA 1QO3B 4Y16A 1OCWH 1MCLA 2XWBB 3VD5A 4HUUA 5ESQB 2BDNL 1U8QA 1MCDA 3B5GA 4P48A 3KGRA 4N8VB 1J7VR 2UY7A 5E2TH 3IAQA 5JHDE 2VXVH 1FZJA 2XQYK 4NRZA 4OCWL 3IDYB 1KJ2L 1UB6A 4S1RH 4JGMA 1WCBB 4QRTA 3VRJA 1CFQB 2DQCL 4NZDA 4N5UA 1KJ3L 2QR0A 2VDML 5EU5A 4B0MM 4YHML 1FFPA 2MMXA 2Z9TA 3FMGH 5E8OB 4LIQL 3RVVC 1G6RA 4KRNA 4LPXA 3B8SA 2BC4A 3TO2A 2KH2B 3VXUB 2EYTA 3E6HB 5I76B 1MCWM 5L2KE 4U6TA 4ZTOL 1KF9B 1G7PA 5E5MB 3ZDYF 4GG8B 3DRQB 3MNZB 3DETD 4ODHL 5JXEC 5C0RL 1FV1A 3THMH 1P7KB 5HI4D 4P2QE 5I75C 4QRQA 4KXZH 1PKOA 2EYSA 2B7DT 2VLKA 1L9NA 5LAXA 1ZT1A 1MVFA 1P6FA 4I77L 5C0BB 4ZODA 1AQKL 4TQEH 4E0RA 4HK3J 5CZVL 3MJ8B 4HF5H 4X7CC 3TNMB 5T33L 4F7PA 2X4RB 4H20H 5JIPA 3FKUS 2NY3D 3NFPB 3GGWB 3MJ9L 3MBEA 3DX7A 4RISH 1TQBC 3BE1H 1EA9C 2FEDD 1Z3GL 5D7SH 4ZG1A 4LF3A 4GXUM 3U4BL 4WW1A 5T1DL 4FABL 1F58H 5E2JA 3PWPE 4PJ7B 3GSUB 4KK8D 1A3LL 4HKBB 5E5RB 3ULUC 1T6VN 5C0CD 3UXFA 3HMWH 5D7LE 5F7DA 1J10A 4QHUB 3MA7B 4N9GA 3TV3H 2UV3A 4C55A 4YO0B 1GVIA 2VR5A 5HY9B 2BFVH 2OJZL 5TGBB 1QO3A 2XWBA 5JPMB 3AY4A 4M7ZB 2DQJL 5ESQA 4NNXB 1IMHC 4N8VA 2AXGB 3QBTB 4CVWA 1DBJL 4RAVB 4PJGE 3IFLL 3K1KC 1NMBH 5CP7B 1IZJA 1WCBA 3TBTB 3WCYA 2EKJA 5TJWK 5C9JB 2OLDA 1CFQA 2MOVA 4PS4H 5DJAA 1N3NA 3U7YL 3ARPA 3OB0H 2Z8WC 3T2PA 4NQDD 5J9PB 1YECL 3DXAD 1WITA 1PYWB 2UZIH 1F3DJ 5F3HB 1NDMB 3QRFM 1F3RB 4P46C 5E8OA 5FECB 4U7KA 3C60C 1OAZH 3QUZD 2E9JA 3C5ZD 3KLAB 3VXUA 3E6HA 5I76A 2X1QA 4NN5B 4X9BA 2ZSWB 3BDXA 5E5MA 1X5YA 1C8PA 2P8LB 3DRQA 3MNZA 2F54B 4XZUB 4KGLA 1EIBA 1E28B 1U58B 2B0SH 1RUAL 3IAPA 1P7KA 5JDJA 3MGTB 2CSPA 3ZLQC 2AJYH 4M03A 1A9EB 1W0YT 2VMFA 2HJLB 2OQJA 1AJ7L 3A6BH 4MCYB 3GJEB 1H3PL 1RUPL 5DWUL 1MRDL 1ZLUK 1T2QL 4F37F 3GRWL 1MFCH 2CUMA 3MRIB 3AU1B 5I71C 3QXAB 2AGJH 2APBA 4TNWK 5CJQH 3MJ8A 2X4TB 3TNMA 1LEKB 2BVQB 2NY1C 2X4RA 1NLBL 2VDOH 4B7LA 3UZEA 4P4RB 4XWGL 4NQED 5C07B 4MNGE 3GGWA 3FAWA 5EZOL 2VKWA 4X7DC 5JR1L 1MPAL 1EMTH 3OSKA 4PLKD 3X3GH 2MFNA 1D5MA 5F70A 5T5NF 5IIEB 1XIWB 2W60B 1NBVL 4Y4FD 5JOPE 4G9FB 4X5XB 3HE6A 4QHUA 3MA7A 3MV8E 4MA7L 4ZFOB 3HI5H 5TGBA 1QSEB 3KPPB 4JQXA 3RY6A 2CRYA 3UPCA 5B39G 3UTTB 1FNGA 4R3SA 4NNXA 2AXGA 2PKDA 4GRMB 4KKBC 2AXHA 1OD7A 4N0FB 4RAVA 4P9HC 1A21A 4BYHA 5CD5D 4K3DH 2O5ZH 2EDNA 4FQ2L 1MAMH 3FCTB 3MUJA 5CCKL 1MCOL 5CP7A 3PP3K 4JHBA 1KOAA 3TBTA 4Y8AA 5C9JA 1JGUL 4LQFL 5SV4A 5HSFA 4LU5L 4ODVL 1KPRB 1BAFH 4XPTH 1Q9LB 2R4SH 3QUMH 5J9PA 4BQ6A 3GFUA 2O26U 2FL5B 1PYWA 3X14B 3QEQB 2CLRB 1A7OL 4U1GC 2HP4A 2VZVA 1EFXD 5F9WC 5ITBH 3WIFA 4JY5H 2QSCH 1GC1H 4X6CA 4ZOAA 1MELA 3KLAA 4QRUB 1BVLB 1XAUA 3KPQB 1JPTH 3QFJA 3B4NA 1MF2L 2ZSWA 4U6HB 2CJUL 2P8LA 1IJ9A 2F54A 4XZUA 2DRUA 4I0CC 1E28A 4JANB 4MQXC 3W81A 1A5FH 3RU8H 3MV7D 3MGTA 3VW3H 4LBEB 1XGUB 2AQ2A 4OZHA 4WI4A 5IB5B 2YBRB 3HI6L 1BOGA 3CLEL 4U1IB 2HJLA 4V2BA 3ZT6A 4MCYA 5DMYA 3GJEA 4U49A 3WIIL 2LVCA 5LGJB 3V8CA 3LKSB 3OKYA 2D7TH 3AU1A 1P4BH 5T3ZH 3QQ9C 3QXAA 4JZOB 4NNPH 5DRWB 1AI1H 1GGUA 2X4TA 3UYRL 2DYPB 4HIJB 1LEKA 1TQBB 3MNVB 3RI5F 4X6EB 1G0DA 3KYKL 1JZ6A 2EXWC 3IJSB 2J4WL 5C07A 1BQLH 2RIKA 4YXLH 3VWJC 5I1JH 5D7IB 5DS8B 3QPQC 2EH8H 4WENB 5MEOB 5IIEA 1XIWA 5DK2A 4M02A 2LE9A 4OF5A 4ODSH 3IU3B 4G9FA 4X5XA 3MROB 4XNXH 4HGMA 4XWOC 5D70H 4PTTB 3M45A 4ZFOA 1CLZL 1K85A 2X1OA 1EO8H 1QSEA 3KPPA 3M8OL 3W0WB 2O5YH 3HZMB 3UTTA 2PTVA 4GLRI 4XX1G 3ZDZF 1NGXB 5DD6A 4GRMA 3JWOH 5I1GH 3L5XL 4N0FA 4NC1C 1MCSA 4IJ3C 1OPGH 2A6JB 4S10A 1NANH 4LARH 4YX2L 3FCTA 1L7TH 4ONGH 3O6FB 4WWID 1NGQL 1KPRA 1P4IL 2UYLB 4OFYA 5DD3H 1Q9LA 5BJTB 3V9FA 4P46B 3WD5H 3MBXL 1MFNA 4HULB 2FL5A 3GBML 3C60B 1CBVH 3QEQA 1DTUA 1T2XA 3B83A 1G0XA 2CLRA 3U9PH 5HTSA 3CNKA 4F7CA 1KB9K 4NN6C 4BKLB 1MEXH 3NH7L 4QRUA 4NKMB 3VJ6B 1QRNA 4K7FB 4U6HA 4XNZC 5KZCD 2ZUQB 1WBXB 4JO3L 2J8OA 3I50L 1FE8H 4G6AD 2A9NH 3PWJB 4AT6B 4JANA 3MZTA 3G04B 2CIIB 4ZSOB 3IDXH 4KQ3H 5CKGA 4YBHA 1QSZA 1XGUA 4KFZC 4LBEA 2A6KB 5DK3A 2YBRA 5JHDD 4G7VL 4DOHE 4U1IA 5F93C 4XVJL 2ATPA 4Z76B 1C08B 5LGJA 2YOCA 5JW4N 3E3QE 5DRZB 4W70A 3LKSA 2FGWL 4RGNE 1JV5B 4FQ1H 1EJ6A 4HWBL 4JZOA 5KS9B 5DRWA 2P5EB 3QPXL 3KYMB 5L9DL 2LU4A 4L3CB 4HIJA 1AGDB 1SY6A 3MNVA 5ISZB 4X6EA 5H8DA 4Q6YA 3WNOA 2M1KA 3WLBA 1RZJL 1AQDB 4XNQB 5D7IA 3TESA 1TETL 5DS8A 4LPCA 1YYLH 5MEOA 1AKJB 3BKYH 2V5TA 5INDB 3BEVA 3SHSA 1MREH 3CFIC 4U31A 1XGYH 4XCYB 3MROA 6CGTA 1EJOL 2ZPKH 4RFNB 5BOPA 4PTTA 4OZIF 4JM2D 3N85L 4XC1L 4P2QD 1F3JB 2KPNA 3WKMH 1CR9H 3W0WA 4Y5VA 1YEKH 3HZMA 3H9SA 3R8BB 1EZVY 3DETC 1RPQA 1NGXA 1C7TA 3SDAD 4ZOCA 1P7QB 1IGMH 2A6JA 3MUY1 4HLZH 4I0KA 3QG7L 2HWZH 2BVOA 1SM3H 5EZIH 5HDQL 2VH5L 5EDXA 4JKPH 4QXUL 3O6FA 2W0LA 1MCJA 2UYLA 2ZP0T 5BJTA 2P5WB 2EC9T 4CMMB 4P46A 5EU6B 4U1GB 5F9WB 4WU5A 3C60A 4PY7B 5EU3B 4DN4H 2BRRH 4H0HB 2IGFH 3ARRA 3T2OA 5GRUH 3BZEB 1GGIH 2GEEA 5EOQH 4F58H 4H1LA 3TJHD 3HG1D 5DVMA 3PWPD 4BKLA 2DKSA 1QLEL 4NKMA 1XH3A 1YPZF 1G1CA 2NY3C 3VJ6A 4K7FA 3ZYJA 1S7QB 1WBXA 4RGOH 3R1GH 3PWJA 4AT6A 4QTHB 2NZIA 1NUGA 4NQXA 4KK8C 4Q9QL 3U1SH 3G04A 2CIIA 4ZSOA 4ZD3H 2C26A 3BSZH 3EOYG 2A6KA 3MLXL 1JRHH 1E4WH 2VLRE 3DVGB 2APTA 5FGRA 4Z76A 1C08A 4WGWB 1YQVH 4ODBD 1EEYB 1JV5A 1YC7A 1QYGH 5KS9A 1IEBB 2P5EA 3KYMA 4OQTL 2VDRL 4L3CA 3VWJB 3EIFA 1FN4A 1UACL 1AGDA 1DFBH 1T1YB 3DVFA 5GGVY 5KANG 5C0IA 2QQNH 1Z9SA 2IADB 2G75A 4XVSH 4KHTH 1MOEA 2XTJE 4XNQA 3EYQD 4YQXH 2ENSA 3QWRA 4EQ3A 3RX5A 5JW3H