4F7CB

Crystal structure of bovine cd1d with bound c12-di-sulfatide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
97
structure length
97
Chain Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD1D antigen, d polypeptide
publication title Crystal Structures of Bovine CD1d Reveal Altered αGalCer Presentation and a Restricted A' Pocket Unable to Bind Long-Chain Glycolipids.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 12
structure length 97
sequence length 97
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f7cB00
1LNUB 2QQKL 4O4YL 1WFOA 1MEXL 1YEJL 4PRNB 1FO0B 4EQ3A 1FJ1A 1J1OH 5GGRB 5DJ2A 3QDMD 1FN4A 5J57B 1IEAA 1XF4B 4GAGH 3B5GA 2NW2B 4MVBC 3RWGB 3G5ZA 1T83A 4JFFD 4M8QA 1GIGH 1WWWX 4XVTL 4X7FC 5C08E 1RZFH 2QSVA 3FTGB 2FEDD 5DUMH 4F37F 2H1PH 1FO0H 1NANI 3QFJA 2Q7YB 1YEHL 1RJCA 2XI9A 3TJHD 3MV7A 4JJ5A 4OFPA 5JIPA 4FXGA 1KJVB 2HT2C 2MQCA 3WHE0 2E8ZA 2LVEA 5E99L 1WTLA 2IEPA 2ZUYA 4OLUL 2D31B 1AGDB 4MCYB 5F7LB 3BISA 2VRAA 3QXVA 2W59A 3LQAH 3MGTA 5DUBA 1NMBH 1Y0LB 1DE4A 1ZT4B 4M6AA 2JCCB 5I2IA 3IFPB 2F58L 1FNEA 1HWGB 3ZZ1A 1UKSA 3CFCH 1TJGH 3PGCB 3TBSB 3CXHJ 4TUOA 4F15B 1FG9C 1TXKA 1ZE3C 3QHZH 4LNRB 1N5YH 3BESR 3V4UH 2Q20A 4ZPTA 4L4JA 3CMOL 1CS6A 2BDNL 5C0CD 1R6VA 3JWDC 4XHQA 3IDGA 4OCWL 2IAMA 5IBUB 3DMMB 1NCAL 5KVFH 4X7DC 2CH8A 1G7LA 4HPYL 3UPRA 5KSVA 4KI5C 4MLIA 4LCCC 3VXRB 1EFXB 1O0VA 3BZEA 3UTTA 2FCBA 4ZQKB 4ZOEA 5DJ0A 3GKWH 3BQUC 1NKOA 3RWJB 5MEOB 1A1NB 3PHOA 1AJ7L 1QACA 1OB1A 1ZWIB 2DLFL 2PR4L 3OAYK 5DD0H 3GFUA 2F54E 1IQWL 1GYAA 4NQDB 3BDBA 3HZVA 5EU7E 5FYLH 2NY5L 5D7IB 1OGTA 4PRDB 4UNTA 4CVXA 5C0BB 5T33L 4UTBL 3DECA 4PY7A 5C09D 2HMIC 5TDNA 2P44B 3T0ED 3DXAE 4MA8L 3WFBH 3IJYB 3AVEA 5SWQB 1NJ9A 4YHZH 3HUJB 1HIML 1T2QL 4OD1H 3F6IA 3MACL 4JLRB 1S7XA 2DTMH 3C2SA 3S37H 3FJTA 3TBYB 5CGYC 5DK3A 5DK2B 2HA1A 1RPQA 4M61A 4PRHA 1CGSH 1DUYB 2W0FB 1WLHA 2R8SL 2CRZA 3PGDB 3FN0L 3RWCA 2V17L 2GFBB 1L0XA 1YNKH 5BRZA 3TV3H 1VFOA 3DGGB 3WNOA 1QQDA 5HYJA 5GGVY 4OM0H 4OZHB 2DQFA 1DQJA 1YEFL 3MRGB 3CLFL 5D9SA 1D5MA 1FZMA 2AJUL 3HNVL 1AR1D 1RJZB 2OJZH 1QR1B 5F6IC 1PYWA 4LAQL 3Q5OA 2YWZA 4KRNA 2C3VB 2Y07L 1S7TB 2EICA 2NY0D 2R0LL 3MRHA 4NM4H 5T3XH 4MJIE 4LHJB 3SQOH 3VXMA 2Q1EA 43C9B 4JRXE 1DN2A 3I85A 1X9QA 2YUWA 5FGRA 5I1AA 3WLBB 3JTTB 4RMSA 5TGBB 2NY6B 5IBLD 2FBOJ 2PETA 3U30C 1RUMH 1UACL 1I8KA 2DL2A 4P23C 4OKDA 5L8KB 4X6FB 4XPAL 3OZ9H 5FYKD 5LKNA 2XG4A 5EUOB 2FGWH 4L4TA 1NCBL 4PJFE 1LP9A 1DL7H 4OI7A 3RIFK 3MLYL 1PLGH 3LD8B 5EO0B 1F4AA 3BZFB 3O4LE 1NMCB 2QQNH 3IDXL 5D1XC 1AXSB 1CDYA 1I85C 4NHUB 5BJTB 3EO1B 2NW3B 4X83A 4K7PY 5EU7C 2BVOA 3BRFA 3MBXH 4AJ0A 4DZ8A 5TJWK 4HHAA 5ALCH 3MLSL 4JQVA 4JY4B 1OSPL 1EHLL 1S9VB 5IWLC 2VKWA 1MJ7L 2IFGA 5FM4A 3OR6A 3E6HB 4XNQA 2JJSA 3ARSA 1MWAL 4Z8FH 4JM2B 5C07D 5HYSG 1MLBB 5TFSH 4QY8A 2GW5A 1FNHA 1I9IH 2GCYA 3P0GB 1BQHG 1MWAA 5DZLA 3JTSB 4JM4L 4NUGL 1MCFA 3C6SB 5C0EA 4NO3A 5JOPE 3OHXB 4NQSA 2BCKB 1S9KC 4OZIB 1MFEH 2I07A 4JZJA 2AJVH 4TVPL 4BYHA 1AE6L 4G9FE 2NY3D 2BSRB 1R3KA 3WFEL 5D5MF 2XG5A 1A7OL 4M1DH 4GG6E 4Y1AB 1P1ZA 3V6OC 5C0FA 5DEFA 2QSCH 3WSQL 2E7BA 1CD8A 3CAFA 2HYMA 4NFCA 4NWTH 2PYEB 1BFVL 2WM0A 2DYPD 1EAJA 3GJEB 2RFXB 1A7RL 3ZE2F 1OP5H 2AK1L 2XOTA 5DUPH 1OCWL 3HPLA 1NANH 5I1JH 3H9HB 4Y4HB 5HDLA 1IQDB 4XAKD 4F7EB 5BQ7A 1YPZB 4JR9H 1OTTD 4LLYB 5IM7B 3DV6B 2COQA 2X89D 3OAUH 4NT6B 4D9RD 2BSTA 5HHPB 3H42L 2ICEB 4R3SA 4MD4A 5EWIH 2YA0A 1G6RL 4WV1B 1CFTB 4GJTB 3MLVL 4NJAL 5KOVC 3T3ME 4PJCE 5GS2H 5KSUB 5JR1H 1IL1A 1N5AA 3VXPA 3TT1H 1SJXA 5IP4A 5FKPA 1N6VA 1G6RA 1FFPA 4H1LG 4S0TD 1MFNA 5ISZA 3KNBA 1E28A 1S7QB 3QDJB 4G7YH 4I3GA 4AYFA 4OV5A 2GT9A 4U6YB 1LO3H 5TQ2H 4HKJA 4EIZC 1OAKL 2GEEA 4QT5A 5C0RH 4YO0B 1P69B 2ADJB 4F9LA 4Y19E 1EJOL 4ZS6C 4OI9A 4Y4FA 4OZFB 4P5KB 4PD4J 4KK8C 4XCNB 1NMAL 2WBJD 4OCSL 2Y6SD 1T3FA 5J6HB 3TA3D 2VDQH 5FA4B 3ARQA 4WU5A 3I6KA 1S5IH 3UPCA 4KKNA 1CN4A 1JNNH 3RGVD 1HKFA 1J1PH 2VABB 3RDTB 3ECBB 1UYWL 1UENA 5TQ0H 4XCCH 1II4E 4OZFH 4G6MH 3ZT7A 4RBPK 1H8OA 3D3VB 4M9PA 5JHLH 1EGJH 3SJVA 5EPMB 1UWGH 5J1TC 2O5YH 4BUHA 1ZLWH 1QLRA 4IIQA 4CU7A 5JA8B 3GMNB 3QUKB 5ESVA 4KAQL 5SV4A 3QEHB 5HI4C 5CEZL 4Z78A 4LEOA 3BH9B 3BE1L 4AM0B 5EOTB 2LQRA 2G2RB 2VDMH 4JN2A 4FFVC 3D69A 1J0JA 1DDHB 1J12A 2W9EH 3ISWA 3OGOE 2Y06H 3RZCC 3T0AA 3MLUH 3K2UH 5A3IC 5B39B 1S7UB 2VWEC 5FK9A 4NC1C 3MA9H 3ZE1F 1CVRA 2HTLD 5CJQH 4WI6A 5DRWA 1EFQA 4QTHA 3BN3B 2EDJA 4EUPB 3I75A 4YX2H 1WCBB 2HJLB 1Z5LA 4B7IA 1D6VL 5T5FL 3S98A 2IANE 3UTSE 3MODH 3PF2A 4YEEA 1IJ9A 4LRIA 3JV4B 3O9WD 4MNHB 5GRUL 5ERWB 3LIZH 1QR4A 4L8SB 4NQXA 4XTRC 3MRFB 1NKRA 4NKDA 5FYJH 4NQCB 4QO1A 4CVZB 1PX4A 1Q9KB 3TZVB 1NAKH 4EUPH 2A9ML 4PJEE 1U8JA 1KLGA 1JWSA 5KG9B 2HVKB 4D94A 2O61B 1MJ8H 3SEPA 2BNRD 4MS8D 3PP4L 5DZOA 3OJDA 1PBYA 3HI5H 4YFLI 5E5MB 4OLWL 1ZEAL 3FOLA 3MYJA 4FHBD 4QCIA 1I8MB 5D1QC 1WC7B 1IAKB 5D71H 1YN7A 2EYTA 1YECL 3I6LE 1NEZG 1GAFL 1KCVH 5JW3H 3ZKMD 3ZLQC 2PO6D 4HLJA 2H2SD 3MX0A 3QI9C 2AXGB 4ZFGL 1DCLA 3DOSA 4ELME 1AGFB 1U3HA 4HCRL 1UWXH 3QH3B 2GIYA 1LEGB 4ZUVA 4U6HB 4X4ZA 1NCCH 1MCQA 4JN1L 2MHAB 2WAHA 1FG2B 3ULUF 4HCRA 2BNQD 4PJ9B 1ETZB 4QOKB 3F58H 2CJUH 3MRCB 1RJLA 3FT2B 5D8JH 3O41B 3VRJB 4K8RC 1IKFH 2DQEL 2D4DA 4OGYL 5FGCE 4EVNA 5GRJL 3K3QA 5DO2C 4OM1H 1VACA 2D9QB 4YDIL 2NY7H 4KVCL 1C08A 2BXZA 2H3NB 4L3ED 3BEVB 3A0OA 4J12A 4Y2DC 2CD0A 4EZMA 4PJ8B 2DMCA 4H0IA 2EC9T 4XRCB 2QADD 2ZSWB 3WIIL 5F7FA 1HINH 3QA3A 1Q1JL 2Z91A 3QFJD 5D7JB 3MV7D 4KRPC 2OJEA 4LCCB 1I3VA 3VG9B 4TQEL 4KU1A 1AGEA 3QT2A 5LQBH 3BQUB 3DI2B 3R1GL 3JWDH 2ATPB 3MA7A 1IM3B 3HB3C 1YYLL 1NQBA 2A83A 2R1YA 3O4OC 1TDQA 3AU1A 4Z7NF 5JW4N 3MO1B 3UJTH 3W0WB 4EBQL 3QPQD 1WF5A 1HXYA 5MERA 4QHNA 4HIHB 5F9WC 1UM5H 5F9OL 4D0BA 3BMVA 3V4VL 3GSOA 4V1DE 3ARYA 2IFFH 5FM5M 1OARL 1ZANL 5JLZA 1MCKA 3PQYB 3SDDB 4IMLA 3AFLA 3LCYA 1IFHH 4DVRH 3QCTH 3TCXA 5I0ZA 4KVNL 2VDRL 3GIZL 4UIKH 1SYVA 4Z5RA 1ACZA 5EOCH 4PJHF 1EPFA 1Z3GL 5IIEA 3BKML 4PJAA 4UOJA 4GG8A 4WW2F 2EH7L 2IGFH 3I02A 3OKMB 5IESH 1MRCH 3CH8A 5KSAA 5F1NA 3UTTD 1U42A 3WDHA 5FDYA 1KENL 2JTDA 4LVNC 2H8PB 4NM8L 4HIEB 1MCIA 3K2MC 2GSGB 4K7PX 3VFGH 5B8CA 1NGXB 1KGCD 3CFBB 5C0AA 5GS3A 1EEZB 1Q38A 3EAKA 4Q2ZB 3L95B 4M3KB 4LLMB 4XPGH 4LSVL 3GZKA 3QXAB 5D7KD 5LXGH 1CFSA 2R4SH 4IRSA 5DJAB 1OTUD 5DK0B 1YMHA 2D7TH 2V2WB 3EDEA 5E8DL 2QKIB 3HE7B 4KQ4H 1IAOB 4MXQD 5ESAA 4ZSOB 3MBEC 1A9EB 2YKLL 4FQIH 4RNRB 5E8NB 4HW6A 3GBML 3L7FA 1HQRB 3QG6A 4XNUH 5C9KA 3PL6D 1F3RB 2F19L 2DM4A 5D6CB 5KVDH 3Q5YA 4PRHD 4PV9B 4MJIA 1I1CA 1HHIA 4TNWK 2FYYA 4HKZB 3ULSB 5IJKC 3FT3A 1MREL 4N8VG 3BW9A 1U36A 2JCCE 3MRQB 5F71A 1CF8L 3HZKA 2CGRH 1OSZB 1SJEB 3GBNH 4X6BA 4G43A 4ESKA 4BZ2L 1JTOA 4R26L 4WI9A 5D1XB 3KYNA 2ZNXA 1JHKH 3CX5K 3GSXA 2QR0B 3RWEB 4F3FB 4BK5A 2R1WA 4KJQC 1ZGLB 4UB0L 1LK3L 4QHMB 5ILTL 1CXEA 4AG4H 1DQQB 1JUFA 4WFGE 2CDFB 3AS2A 1A3RL 5IMOA 2XZCH 3EO9H 4PJXE 2ITDB 2Y7QA 3GNMH 3QHFH 5FYLE 3VXMD 5KS9E 5CGTA 3EJZC 4K94L 3QUZC 4ZAKA 5E7FA 3VXRE 5IVZB 4XB8A 3DO3A 3RUGE 2Z0BA 1BGXL 2NXYC 3LV3A 4QRTB 2NY2D 2FL5B 6FABH 1KYOK 3RX8A 1LO4H 4GMTL 3O3EA 4L4TD 1T0NB 5T3ZH 4LCUA 4G9DB 3U0TB 3I3BA 1NGZB 1UM6H 5D7IE 3CJJA 4NO0A 5GRXG 4JPIA 5IV2A 4F8QA 1K3ZA 4MNQA 2PTUA 3KPMA 2OX5A 1T5XB 3K7UA 3VFNA 1MCPH 1XF5B 1ZT7B 3OJVC 3MJGX 1M4KA 1KLUB 4JFHD 3FB5A 1G0DA 3FOMA 5DFVD 3QB7C 2GAZB 5HHXL 1X3DA 4NNPH 2MFNA 1N6UA 1BBJB 1NDMB 1BQLH 1R3JA 1UJTA 5C2UB 1N2RB 1NC4B 1QFWL 3CUPA 3MJ8A 1XFPA 5T3XE 1ZXQA 3ARBA 1MLCA 2X4QB 4LMQE 1SHMA 1XF1A 3A6CL 4RMQA 1NCTA 4RCAA 1VADA 5E00A 3PIQA 5B4MD 1NC2A 1ZVSA 5CILL 3C5ZA 4PR5A 4WI2A 4NOBA 3UPAA 1VFMA 2Q86A 3U0WH 2Y36H 1NAML 1FFRA 4Q9QH 4QYOA 5KN5B 1XIWA 1R5IB 3CU7A 1C7TA 3IETA 4V2CB 4MSWA 4UINH 2D4FA 2GY5A 3N85L 1NAMA 4Q9RL 2Z31C 1MCOH 2X7LA 2V2XA 2XA3A 1Q9WB 5F3HB 5I1GH 2HN7B 35C8L 3MOBL 3ARDC 4IOIB 5HVWA 1IGYB 2CQVA 1KTLB 1CLOL 4M7KH 2F5BL 3NCYP 5CZVH 4APQD 5E4IA 3DRQA 1QSFD 2M2DA 3FT4B 5EU4B 5EUOE 1FVEA 4F7MA 2FHFA 1BMGA 1W72B 2VISB 4N0FB 3VFSB 4M7ZC 4DN4L 1M7IB 5LGKA 1MJJB 1QSZA 3DO7B 3C08L 5F7DA 1IKNA 4H8WH 3M8OL 5AUMB 3P11L 1JPTL 4XWOD 1XGUB 4DOHB 1G7HA 4PJGB 2OP4H 4GBXD 2IBGA 4XP6L 3V5KB 1W72H 1KBGH 1VEOA 4XNXH 3KPRA 2VE6A 3MZGB 1RFDL 4OKVA 3NIFE 5ACMA 5GHWL 4JB9H 5F7NC 1YY8B 1A0QH 1ZSDA 5DURB 5D6DC 5HYFA 4KKCC 1A1MA 1HXMB 1I7RB 3PWUB 4NRXA 4Z7WF 4NO5B 5DD5H 2YMXH 4KK5C 2GJ6D 5JPNB 4PB9H 4LSRL 5I30H 2F9BT 3QDGE 5HHOB 3MGOB 1XCTB 4OFIA 3STLA 3ZO0A 2HWZL 4L5FL 3LSOA 1FSKC 4L4VB 4NKMA 3FQTB 3C5SA 3FQUA 3H3KA 4KZEH 2EYRA 4OZIE 4LRNH 3VG0L 8FABB 3D18A 3O6FC 4G5ZH 5L0QB 4FMKA 5HPOA 1JPSL 4FABL 2FJFA 1OL0A 2YN5A 4XH2B 2VH5H 3SCMA 1I3UA 4ZFFB 4NJ9H 1LO2L 1QRKA 1MFBL 4Y1AE 4JFEB 1F4WL 4Y16A 4PGZA 2DTSA 3SJVD 1GGCL 2PYEE 4CBPA 4P2QB 4W4NA 3ZDYF 3NFSL 1OAQL 3TNMA 1Z0MA 4M6NL 5HTSA 4PJ7B 1JPGA 3S36L 1MF2H 4PBXA 2UWEA 4YHLH 2VXTH 4TOYL 4NWUL 5K9KB 4UDUB 2IANA 1F2XK 1J18A 2C1OA 1YJDH 1TCRA 5DFWH 4XP5H 1IZJA 4KFZC 3RVVC 4LNVA 2KZWA 2I27N 1T7XA 2E3VA 3DX6B 4XP1L 4QRRD 2XY2A 1NBQA 1YQVH 1T03L 3H9SE 4LDEB 4G6KH 3VXUA 4H20H 4X80L 3DI3B 4HLZG 4R97C 4P4RA 1I1AB 5GGSY 4PRIB 5HGHB 3MRJA 2VL5A 5IVXB 1QRND 1H5BB 1ZHKA 2MPAH 4JFQB 2ZCLL 1BBDH 3U7AA 2YHGA 4PFEA 1YEDA 2FHBA 1DLFH 3KPSB 1AKJB 2FATL 2MOVA 5LAXA 4Z9KB 3WJJC 3V5HB 4MDIB 4HXAL 3R06B 5FCSH 3ES6B 1MHPL 3C8KB 1T21A 4D3CL 1F11B 1Z6JT 3SKNA 2NX5D 2VZTA 4RISL 5C0GB 4N0YL 2B39A 1MUJB 3F7YB 4OD3L 1W0WA 3KWWB 3TIEA 5IHZB 3LH2H 3T2PA 3P77B 3MR9A 3VWKB 3OKEB 1EUTA 3S35L 5HJ3A 4K71C 5MEPA 1DBKH 2D7QA 5HGBA 3EZ8A 1UEMA 4DEPC 3SKMB 1F4HA 1ZKAA 1XGRA 3JV0A 2LU3A 1T4KB 4LQFL 1H8NA 4KRPB 4ZNEE 2E7LA 1T1ZB 4F9PC 2HFTA 3TYFA 3KYKH 1HN1A 3ARXA 1K85A 1F4YL 2CK0L 4MD0A 3C6LB 2AJZA 3T1FA 5FUZL 3QJFA 2CKBB 1RV6X 4OF6A 1QFOA 1H3VA 4O51B 5DFTA 5GGVH 4JCMA 3FQRA 3DIFB 3HN3A 3S34H 1N64L 3RWFB 3IF1A 1NGYB 3ARZA 5F9WB 1O7VA 2WWMC 1IGCH 4GRLC 4HMEA 5FYJE 4AEHL 1K6QH 4G6AD 2ATKB 3FAWA 1WBXA 2AJYH 3BD3A 2CKBH 3BKYL 5L2KD 4X4XA 5IJVB 1S7RB 4M1CD 3OB8A 1RUPH 1BFOA 5F7YC 5HDOA 1RZIB 5KTEL 3IDNA 1EHXA 5DD3L 1MCJA 3TO4D 5JXED 3ZHLA 2XA8H 1JF5A 3VWJA 2NTFB 4NQCE 1QLEH 2DJ4A 3FO9A 3EHBD 1J1OL 3W81A 3CCHB 2A74A 3QIUC 4P2YA 2BC4A 5E2TH 5HGDB 2J8UF 4GAGL 2WBKA 3T0EC 4QRUA 3MUHL 3B6SA 1MRFH 4K23H 3TBVA 3C09B 3FRPG 3G6JB 1T7WA 1GIGL 1ZAGA 4FFZH 4LAJH 5DD6B 1RZFL 1S7SA 5DUML 2HAZA 4RQQB 3VI3F 2H1PL 1FO0L 4ZYKB 1DBMH 2ZKHH 3QG7H 3FO1B 1BZ9B 3L3IA 4K7PH 3BZ4B 3PWPA 3QPXH 5IEKA 4U3XA 4E41B 1J5OH 4PRNA 1FO0A 1QFUH 1UWEH 3FQXB 2HVJB 3LQAL 5GGRA 5BS0B 4MYWB 1NMBL 4OF8A 1XF4A 2NW2A 5SV3A 1QTYT 4D0DB 3H2WA 4KTEH 2P8MB 5ITFB 1ZHLB 1TJGL 4BFIB 4K3DH 4XC1L 2YPLB 5J4MA 3D25A 3RY4A 1P4BH 3QHZL 1N5YL 3V4UL 2NY0C 5IHLB 1OWRM 3OMZA 1QLFB 3DX9B 1BD2D 2EO9A 4UDTB 1HILA 1AGDA 2EEAA 4MCYA 4JQIH 3RL1B 2QQQA 1YYMH 5HGAB 1X4YA 5IBLC 2NY1B 5KVFL 1Y0LA 1NCDH 1KCLA 2HT3D 1D7FA 3QO1A 4PRPB 5D2NA 2JCCA 3BO8B 5JPMB 3TT3H 5FHAH 2QJDA 3ROOA 3GKWL 3IU3B 3PGCA 3TBSA 1INEH 2OR7A 5DD0L 4GRWF 4WI5A 5FEBA 4GW1B 1NL0H 4U1MB 5F6HI 3C8HA 3U2SB 5FYLL 4YHYC 2NXYB 4RGNB 2UYLB 3ILPB 3DMMA 4LEXH 2Z35A 2DIJA 2Y72A 1PEWA 3WFBL 4AL8H 5DHVB 2YRZA 4YHZL 3VXRA 1EFXA 1G1CA 5H94B 4ZQKA 4S2SB 4OD1L 3G5XB 5ETUA 2DTML 3RWJA 3S37L 3ARGD 2DL9A 4RRPA 5MEOA 1A1NA 4KK9C 3LDBC 1IARB 1ZWIA 3PQYE 3VD5A 1ZVYA 4NQDA 1P7QB 1BVKB 1CGSL 1I3GL 3BN9D 2DICA 3MLZH 1E6JH 1ZA3A 2VYRE 4PRDA 2X42A 5C0BA 1EO7A 5DHVH 3VCLB 1YNKL 3ZKQD 1KCSH 3D48R 1RIUH 4MQ7B 1KPVB 1KF9B 1RULH 2CR3A 4TTDD 4LCYB 4OM0L 4ZAKD 3IJYA 3OG6B 3ZTNH 2WK2A 3HUJA 1U3YA 3L7EB 2Y9RT 5FFLA 4JLRA 2EC9U 3TBYA 5T3XL 4NM4L 5A40E 3C60D 5DK2A 2DLEA 3SQOL 1DUYA 1KIPB 2W0FA 3IXTA 4MNQD 4XGZA 5C70A 3G5YB 3PGDA 4U1JA 5CLTA 2GFBA 2CO6B 3MRPB 3DGGA 3EOTH 1RUML 4RMUA 5DTFB 1UVQB 4KPHH 4OZHA 3MRGA 3OZ9L 1FRGH 1A4KB 5HYQB 4LKCA 1ZLVK 3KLDA 4HUKB 4C56B 3RTQB 2FGWL 3ARDB 3EW3B 2DLHA 1QR1A 5E6ID 3TPUB 3NPZB 1DL7L 1R5WA 1OTTC 2XKNA 2ZWLT 3BIBX 3V6FB 1PLGL 5MI0B 3LAFA 2C3VA 1S7TA 1AXIB 4P57B 3RAJH 2R2BB 2QQNL 4P3DA 2PXYC 3T4YB 2VLKB 3SY0B 43C9A 2FDBP 3ARBD 1E6OL 3WLBA 4WDIA 5TGBA 4GAJH 3O2DA 3MBXL 3UZVB 2OL3B 3DGCR 4WTWA 1CFNA 5ALCL 1IGJB 5E08H 4ONFH 2ZPKH 3HAEB 1U8IB 5FHBH 4O5LH 2VIRA 4BUGA 3GGWB 1S8DB 5EO0A 5T3ZE 4R0LB 4Z8FL 4HX1B 2DLGA 1G9ML 4GW4B 3WNLA 4X6CF 3U79A 5TFSL 4PJ5E 2OL3H 1AXSA 4C57C 1NBVH 1I9IL 2AABL 2Y6SC 2QL1A 3K8LA 3TBTB 3GSVB 3S5LG 3MROB 3HZMA 4NHUA 5BJTA 3EO1A 4H0HB 4R90H 2NW3A 2Q7NA 3B43A 3P0YH 3TN0D 5J12C 4PG2A 3QQ4B 3HAEH 1OAYH 4AH2B 1HI6B 4OCLC 3SE4A 4K9EL 3VH8A 2AJVL 1S9VA 4P46C 4XI5D 1FSKB 3FHQA 3IT8D 4JGMA 2X70B 3MRLB 4M1DL 1JPFB 4DZBA 3GUTB 3E6HA 2W07A 3QRFM 3L3HB 1FYTD 2HP4A 4JM2A 5EZLA 4GKNA 5DMIH 4R4ND 2QSCL 3O6FB 5JIIA 4HEME 4Z7OE 3UBXA 3VGEA 4NWTL 4JY6B 5IB3B 3MUJA 5FO7B 1K5NB 1P2CB 2DIAA 3QIBD 5EZIL 3NCBB 4TNVF 5J7CC 5HGGS 3JTSA 2XWBA 5DUPL 3ZE0F 3IJSB 1JGVH 4Y2OA 5I1JL 3QNYA 3OHXA 1A6ZA 2V9TA 2YXFA 4FXLA 5DJ6B 4HDIA 1IILE 2IQ9H 4LIQL 4P4KC 4JR9L 2N1KA 3V9FA 2BSRA 3VFOB 1WBZB 1NFDF 3PUCA 1WT5A 2DQIH 1A6VH 3EJJX 2A1WH 2FD6H 4PJBF 5EWIL 5DEGB 1NPUA 1UKQA 4P2OD 5JR1L 2RFXA 3TT1L 1K4DB 2GK0B 1LHZA 2DKUA 1L6XA 4UI2A 1QYGL 2CSPA 4FQXB 2V9QA 2DQGH 4C83A 5FUOL 4R97B 1IQDA 4POUB 3VXQB 1LO3L 1YPZA 5TQ2L 5EO9B 4MA7H 1PQZA 5C0RL 4JDZB 5IM7A 2D2OA 1W0VB 1TNNA 4XWGH 4MS8C 4NT6A 5I16B 4F7TA 3QDMB 3SKOB 3B2VH 2ICEA 2VB5A 3H9YA 2RJMA 5IW1B 1TETL 2VDQL 3QQ9C 1VA9A 1S5IL 4ZD3H 5KSUA 2WWKT 3ZKNC 1KJ2A 3F65A 1JNNL 3P9LB 1J1PL 2PO6C 1REIA 3QDJA 1S7QA 5TQ0L 4XCCL 4G6ML 4OBSA 1IC7H 2MWCA 4R4BB 5JHLL 1EGJL 4U6YA 1MCWW 2BVQB 1FE8H 1UWGL 3T4AB 2O5YL 4DOHE 4UT9H 2Q3AA 4YO0A 2ADJA 2HT4D 1FHGA 5GRVL 4PJGE 4JCLA 4OZFA 5JDSB 4XCNA 2F74B 1EGJA 4NHCL 5J6HA 5DRZB 2BHZA 2FLRT 4LLVB 1I9JH 4M5YH 4YAQB 3FZUD 1V8HA 3MUGB 2Y4SA 3HKFA 3TNNB 2W9EL 3UJIH 3DRTB 2Y06L 5SX5H 5DDHA 4EQ2A 2VABA 3RDTA 4JVWA 3ECBA 3MLUL 3EUUA 3JZ7A 3K2UL 3D3VA 3MA9L 2RIKA 2XKUA 5CJQL 3KS0H 5EPMA 1FNFA 3V95A 1TLKA 1CWVA 3VI4E 5C0CB 4V2BA 1VFAA 1P7KB 1P6AB 1BQSA 4WO4D 1LDSA 4YX2L 1X5JA 3WNKA 4Y4KB 4L4VE 3EYFB 3QEHA 1XF2B 1E27B 2QBWA 5FCUH 3MODL 4AM0A 5EOTA 5CSGA 3LMJH 4PP1D 2G2RA 3LIZL 1RZ8A 1TPXC 5GISH 5F8QC 5FYJL 5C0DB 1DDHA 2P24B 4JFEE 1NAKL 4AEEA 4HFWB 5B39A 4KJYA 1WITA 5F9AC 3TVMC 1MJ8L 1DVFD 5DJCA 2EYSA 1D5XB 1UA6H 3WFHB 4PJ7E 4EUPA 5C09B 1WCBA 3HI5L 2HJLA 3GJFK 1RHHB 2KPNA 4GMSH 2NXZD 2VLJD 3JV4A 5D71L 5ERWA 1KCVL 3MRFA 1J1XH 4ETQA 5JW3L 3K81A 3CDCA 3DETD 1A7QH 9CGTA 2A9NH 5JDJA 1Q9KA 3GSWB 3TZVA 1QOKA 4Q6IC 3NA9H 3HE6C 3P73B 5KG9A 3IAPA 2HVKA 1NCCL 2O61A 1A7NH 3TCLB 3S3PA 5CMAB 1BOYA 2AEQH 1NLDH 4PRIE 1MFCH 3F58L 2CJUL 5D8JL 1WC7A 1IAKA 3MUZ1 3AXLB 1IKFL 4P49A 5ENWB 1LGVA 2P43B 1BAFH 3L5XH 4NKOB 4OM1L 3MC0A 1PD6A 3GMMB 3L9RA 2NY7L 4LPCA 2AXGA 4X7SH 1PAMA 1AGFA 1OTUC 3NTCH 1EH9A 3QH3A 2IC2A 2R69H 4U6HA 5JW4M 2D7PA 3QXUA 2EH8H 2MHAA 1FG2A 4MB3A 5E2UH 3GJFH 1YUHB 2NZIA 1ETZA 3QAZC 4QOKA 1JRHI 2YD8A 5EZJB 5IMLB 2B2XH 4WHTB 3K46A 3L5HA 3FT2A 4AMKH 4HJ0C 2G60H 3O41A 3VRJA 1H3XA 4GAFB 5MEQB 5LQBL 1I3RA 3TC9A 3L3KA 1L0QA 3JWDL 3U7YH 1FP5A 5ITBH 5L8JB 2H3NA 4MXVE 3SDXB 4YR6B 2APXA 3BEVA 3QIWD 3OGCA 2PCPB 3CSBA 3UJTL 4YHYB 4YHNB 4BK4A 2P5WD 4XRCA 2IPTH 2DB8A 5FYKH 5CP7B 3UEZA 1JVKA 1CFBA 1UM5L 1F97A 5FOJA 4QWWC 2FX9H 5D7JA 2VLMD 4CJ1A 4AQOA 1EUUA 4LCCA 3MCKA 5I8EA 1Q9LA 5IB4B 3BPNC 5I66A 4D2NA 4QRQA 3ULVE 3MLPA 1IFHL 4DVRL 3OG4B 3QCTL 3BQUA 1B6DA 2EO1A 4M6OH 1J7VR 1HHGA 2ATPA 5C07B 3O3AB 5EOCL 1S9WB 2IGFL 1PSKH 5IESL 1T1YB 4NCC2 3MO1A 3W0WA 4X8JB 1VERA 4JFDA 2X10A 5JHDE 3N1FC 4HIHA 4MZ3A 1A6WH 3EOYG 3F7RA 3VFGL 2ESVA 5KSBF 4HKBB 4BFEA 1QVOB 4CGTA 3ULUC 3FQWB 4YHPA 3MOAH 2FZ3B 3SDDA 4XPGL 1T66D 2NY3B 4UIMB 4QHKI 4YHOL 5LXGL 3HG1E 2DRUA 1B4JH 1J10A 2E8YA 3GHEH 2D7TL 2P45B 2FLBT 4WWKC 3K0WA 4CRPA 4BQ9A 1QPPA 4KQ4L 5DFVC 3OKMA 2YUXA 2DYPB 4FQIL 2H8PA 4E41E 2GSGA 1T0MA 1CU4H 3BJLA 5EORH 1NGXA 1B9ZA 5C3TA 1F4XL 4XNUL 3ZDXF 4B5EA 5BS0E 3CFBA 4FQJH 5KVDL 3S9DB 1EEZA 3L95A 3RVUD 4LSTH 4NDMB 4Z77B 3V8CA 4FQQB 5B4MC 5KVGH 4KV5E 4DKEH 3D39D 2CGRL 4NBZB 1DQLH 5DJAA 3GBNL 1IGFH 2L7JA 1MI5E 2V2WA 4RSVA 2YPVH 2QKIA 1JHKL 3HE7A 1IAOA 4X5XB 3DUSB 4ZSOA 1A9EA 1RK0A 4RNRA 5L2JA 5E8NA 2HFFB 4AG4L 1HQRA 5FKAB 3RQ3A 1F00I 1JNLL 2VTFA 2XZCL 3IDIA 3EO9L 5IGXH 4PV9A 3RVTD 5MENE 3GNML 4CAGA 1E4WH 3ULSA 4HKZA 1WZLA 4APQC 3B9AA 4PRPE 5DA0B 3RIAK 3MRQA 3QZWG 1FFOB 2N7AA 1OSZA 1LWRA 1SJEA 3ULVC 5AAWA 1MCBA 3RPIB 2XACC 5D1XA 6FABL 2WBJB 2QR0A 1I85A 1FYHB 4FXKB 1LO4L 4O2CB 3RWEA 3TA3B 5T3ZL 4F3FA 1TTUA 2IH1A 1X5LA 5DMGD 4WW2C 1ZGLA 1UM6L 2EIZB 4JREB 5BXFB 4QHMA 5FA3A 3O3BA 1JGDA 3RGVB 1DQQA 4ODSH 3WXWL 4RGNE 2CDFA 3LB6C 1KTKE 2V7HB 4URTB 1N59B 1U8PB 4P9HH 5D93B 2ITDA 2BFVH 4GW5B 5GGSB 5KAQF 3SBWA 5I71B 5DJDB 5IWLA 4X5WB 2Z93B 1CK0H 1MCPL 1P53A 2OXHA 5SWSD 3MV8E 4NZTH 5IVZA 1DBJH 1VGEH 5E1HB 4Z7UF 3HNSH 3BX7C 3QUXD 4QRTA 2FL5A 4GFTB 3T65B 4NNPL 1A21A 1BQLL 1T0NA 4LCIH 4DTGH 5KVEH 4G9DA 1VFBA 5B38B 1YA5A 1N4XH 3U0PB 2X1WL 4XAWH 3B9KD 1BF8A 2YZ8A 3HC0A 1R3LB 5EN2B 1Z9OA 5F1SA 5AG8A 1HHKB 1T5XA 4UTAH 2D3VA 4OLVH 1GGIH 3EOAA 1UFUA 4G6JL 2MMXA 1A6TB 1KLUA 3U0WL 2Y36L 3V6OA 4LHUG 2WNGA 4UT6H 5J6GB 4Q9QL 1L0YA 3VXOB 1S78D 1NDMA 4U1HB 3O9WB 3QEQD 5EOQH 1MCOL 1NC4A 2NNAB 2DBJA 2IG2H 5SWZA 3TFKC 2X05A 5I1GL 1WEJH 2EKSB 2X4QA 2V2TA 1FAKT 5LWYH 4M7KL 3JVGC 5CZVL 3HC4H 5DQJB 5LBSH 5FO9B 1BOGA 2UZIH 2BNRB 2QHLA 4C56E 4PTTB 1ZK9A 5EUKA 4EDWH 4MB5A 1DUZB 4OIBA 1BREA 1JRHH 3L1OH 4ONHB 1R5IA 1G9NH 3FQNB 1MCHA 3G08A 3M1BB 2V7NB 4H8WL 3WN5B 3C9NA 2DM2A 1XH3B 32C2A 5AD0A 2PO6B 2HN7A 1TIUA 1A6AB 4IOIA 2ZOLB 2OP4L 1IGYA 2VN7A 1KTLA 4DAGH 1CFQB 4Q6YA 1W72L 1KBGL 3BPOC 4XNXL 5E2WH 1RUAH 1EAPB 2VAAB 2W1NA 3ZHDA 4JB9L 3FT4A 4X6DF 1A0QL 1A2YB 3BWAB 5D5MB 2BNQB 3LEXB 3D85D 1MCLA 2VISA 3VFSA 4FZEH 3UDWC 4XVJH 1BWWA 1NUNB 1BHGA 1AQDA 1MJJA 3DO7A 1GOFA 5DD5L 5GZOD 2YMXL 1AH1A 3RHWK 3GI8H 1J8KA 4PB9L 5I30L 2R2HB 3KHQA 3IJHA 5IEHA 4NKIH 3V5KA 4L3EB 4NFDA 1FFQA 1IZKA 4KZEL 4LRNL 3FB7B 1XZ0B 1YY8A 2QADB 4G5ZL 4FTVE 5J3HD 5J8OA 1YMMD 3GB7B 3QFJB 1Q0XH 1T89A 5E5UB 3MV7B 4NJ9L 4FXGB 1HXMA 1I7RA 3N06B 3PWUA 4NRYA 3NPSC 5J9PA 4Y5VC 2DF3A 3QUYD 3WMSA 5JPNA 5DUBB 4I48B 3ARFC 5HHOA 1XCTA 4POYA 1MF2L 2J1KA 3FQTA 4YHLL 4BM7A 2YUZA 2X40A 1H3GA 1EBAA 8FABA 1YJDL 1DSFH 4XP5L 2C3WA 3NIGE 4IOFC 4ZFFA 1ZMYA 4ZPTB 3VGDA 4K3GA 3QDHA 1YQVL 2UUDK 4GO6B 4U7KA 1J8HA 4P2QA 4POZD 3ZDZE 4G6KL 4H20L 3IDGB 2KKQA 3TO4C 1Q9OB 4NQEE 3NN8B 1MY7A 5JXEC 3IDMB 2MPAL 4RGMC 1BBDL 3UPRB 2EDFA 5C92A 4UDUA 5K9KA 4RA0C 1DLFL 3BIAX 3UTTB 1CICC 2F58H 3G6AB 4KDTC 4KUCF 2VLLA 4W4OC 5AG9A 4OLZH 5ECJE 4WUUD 5D4QA 2FH6A 1FQ9C 4KHTH 5CEXB 4BH7B 5CJ8A 2C1PB 2E6JA 4PGDB 3LH2L 3ZTJH 4WWID 4HS3A 1I1AA 2LABA 3FFCA 3BDXA 5HGHA 1MIML 2YD9A 2YRLA 5IVXA 4XHJD 1H5BA 4AQ1B 1DBKL 4HPYH 4JFQA 4ENED 1CBVH 4XPTH 2J8OA 2OZ4H 3KPSA 3U4EA 1AKJA 3OKNB 4FQPA 3V5HA 4MDIA 3R06A 4G8EB 3ES6A 3ORJA 4NZDA 4XVUC 4GKSB 3EO0A 5E7BA 3C8KA 3PL6B 2F8XC 3GMPB 3WO4B 4M61B 4PRHB 1F11A 1KB9K 5I1DB 4TUJB 3MNWB 5HYIA 4UUJA 2VXSH 5C0GA 4QF1A 2A6DA 1SJHB 1KXVC 4XCEA 5IHZA 3KWWA 2P5ED 4OLEA 3WKNA 3P77A 1QQDB 1ED3A 1G0XA 4UOW1 4MVBD 5GGVL 4YZFE 3AREC 4Y2DA 5DVKA 2RQ8A 3S34L 5D9SB 1HE7A 1D5MB 1FZMB 1U8LB 2XTLA 2HFEA 3O6KH 3ZYJA 1IGCL 2I24N 1K6QL 4M03A 2C3HA 1T4KA 1CLYH 1KV3A 2W0KA 2CKBL 5LCVH 1T1ZA 3MOQA 3VXMB 1A9BA 4HGWA 4WRLA 5FIEA 5FO8B 2VZUA 1EMTH 2XA8L 1F45A 3DSNA 4O51A 5CS7A 1I8KB 1QLEL 4I9WE 2NY2B 3DIFA 4OZ4B 1NBZB 3CC5B 3RWFA 1TMCB 5GSVB 4CW1A 5E2TL 1BZ7A 4L4TB 1NGYA 3QDAA 1CGXA 1G7IB 1TTFA 3D6GA 3VMNA 5GIRA 1MRFL 1SY6H 1LP9B 2EDEA 4ZUTB 2ATKA 2BNUA 1CDCA 4K23L 5C09E 4FFZL 5IJVA 1S7RA 1FORH 5GSRA 1C5CH 1DBML 5GPRA 1RZIA 1MNUH 2ZKHL 3QG7L 5F88B 5C9JB 1D5BA 3SGKA 1OQOA 3OAZK 4XMKL 3QPXL 2BVOB 1D9KD 3CFDB 1J5OL 4RGOH 2NTFA 1QFUL 1UWEL 4KI5D 1Z9LA 2P42B 2BMKB 2VR4A 4NUJA 4Y89A 2AJXH 4TTDC 1YEIH 3WDIA 4PJFF 4KTEL 1WAAE 3ROLA 2XQYK 1RK1B 3G6JA 5DD6A 4RQQA 4QY8B 2WW8A 2WLZA 4K3DL 4ZYKA 3D5OF 4PJIA 4UZGA 3VW3H 1P4BL 4JFDD 3D0VB 5GGRY 2HMID 3C60C 5LGJB 3BZ4A 5MP6H 3HC3H 2OTWB 1HYSD 3T08A 4E41A 5DA4A 3MTRA 4JQIL 3FQXA 2UZYB 1KN2H 1YYML 1INQB 2FECI 5FM8A 3MBEA 4L9LB 3TP4A 1CDBA 3QXWA 1NCDL 1HH9A 4D0DA 4M43H 1GL4B 5CGYD 4OBRA 5A1AA 2P8MA 1A14H 3IAQA 1P1ZB 3BPLC 3KPQA 5ITFA 5DEFB 5E1AB 3TT3L 4BQBA 4PS4L 1DJSA 5FHAL 1AHWC 4Y5YB 4LDLB 1OGAE 4APQB 2YPLA 1INEL 5FYKE 1KSRA 1QSFB 1NL0L 3E0GA 4JM4H 3DX9A 3O3UN 4UDTA 3HPLB 3RL1A 4LEXL 2F53A 3PJSA 5J13C 3BH8B 4WW2B 1JI2A 5J11C 4AL8L 3DYOA 4FNLL 3LPGA 3BRDA 4KTYA 4KUCD 4R3SB 4GG6F 3DVFA 1MHHB 4GBXB 1OF2A 3WKMH 3IU3A 4JG0H 2DDQL 4XXCC 4A6YB 1KT2B 2VUYA 1IL1B 4OCRH 4U1MA 2AK1H 3U2SA 5FKPB 1FFPB 3MLZL 3DX7A 4P23D 3RVWD 5ISZB 4UBDC 4M4RA 1E28B 5C07E 3ILPA 1KCSL 5T1MB 1DQMH 1RIUL 2GT9B 3TN0C 1RULL 2WWKO 2IPKB 4QT5B 4A6YH 2GJ6B 3ZTNL 3SO3B 5DHVA 1LE9B 2X4NB 5DMJB 4S2SA 4XI5C 4X0KB 2F54D 5D7LD 3T3MF 3CK0H 1AIFA 4PJCF 4R4NC 4PLJC 4MDJA 2IH3B 1FGNL 5L8LB 2X09A 2CDEB 3FL7A 4YDJB 3VCLA 2XQBH 3TJEH 3DXAD 3D0LB 3VFMA 4MQ7A 1KPVA 5T1LA 3SJVB 4LCYA 2R23B 1ONQB 3FO0H 4K3EH 1FRGL 3LEYH 4IIQB 3R8QA 5TH2B 5ESVB 3MXWH 4Z78B 3OF6A 4CADB 4U2ZA 1IBGH 4LFHG 5JXAH 5EBGA 4DUWA 5EH1A 2R39A 3GRWA 4JN2B 4EJ1C 3RAJL 3VMPA 3D69B 1KIPA 4P5MA 4P2OC 4D9RE 5DQDH 4QRRB 3MRPA 1NEZA 5FK9B 5SX4I 4GAJL 4U1GB 2Z31A 4OD2B 5DRWB 5DTFA 4MMXC 1UVQA 1AD0A 4YDLB 1ULVA 4WFHD 4ONFL 3I75B 3ARDA 1XR8A 2ZPKL 5CEZH 5FHBL 4O5LL 3G04B 3QNXB 5F89B 3V6FA 3LS4H 1QRNB 4RMRA 3DYPA 2ICES 2R2BA 4LASH 3UAJC 2OL3L 2VLKA 3SY0A 1NBVL 5SWZD 2UZXB 4G6FD 4R90L 4K2UH 3P0YL 3OL2A 1U8JB 1OAYL 3VFUB 2V6HA 4XPHH 1C8PA 5GS0D 5INDB 1RURH 3OJDB 2BJMH 4QHKJ 3EBAA 4NOFA 3HAEA 1U8IA 1NCUA 3S36X 5DVNA 4LGRB 3RL2B 1S8DA 2X4UB 3V6ZB 4RA3A 3KJ4C 3O4LD 1KYOJ 1BPVA 1YN7B 4GW4A 4FA8A 1SM3H 5DHYA 3VA6A 3F62A 4XNMA 4NP4H 5D6DA 3TBTA 5EFIB 3GSVA 3MROA 4WEMB 1UC6A 1JGVL 4M8VA 4PJEF 4ZUVB 5I1HH 4Y5VB 2CLZB 1DLHA 4AH2A 3SDCD 4WW1A 5BW7C 2HTKC 1WGOA 5FGBC 2IQ9L 2VZ3A 4KK8D 1FH5H 4OSUH 2HJFB 4JPKL 2XT1B 1WZ1L 1P7HL 2X70A 3MRLA 3GUTA 4TSAH 2DQIL 1A6VL 1T22A 2JB6B 3ZTJG 2A1WL 2FD6L 3WXVH 3GKZA 3O6FA 1G1YA 5TDPA 4JY6A 4EVNB 5IB3A 2X4RB 1V3LA 1K5NA 1P2CA 4KMLB 3ZT6A 2H26B 2C7UB 4PP1C 4F7PA 4ELMF 3MV9A 5L2KB 3IJSA 3NVQA 5C6TH 5JOPD 2RGSA 1LEKB 3TPKA 5IBTH 5EBLB 4G9FD 5DJ6A 1I8LC 2OSLB 3TO4B 4ODHL 4GQ9H 4KMQA 5HI4D 3T0DA 2H45A 2MQ3A 3QA3B 2Z91B 4MA7L 3OKOA 2OJEB 3FFDA 4XWGL 1E0OB 4RZCB 3S3SA 3S35X 3W11D 3B2VL 2LE9A 1G7JA 2DQEH 4Q0XH 1AGEB 1XF3B 4RFOH 5DEGA 5K59E 4R2GB 2OTPA 3MLXH 5F1OB 3RZCD 5FXCH 2O93L 4ZD3L 5A3ID 3GSNB 3ZKXB 1KFAH 2GK0A 2BP3A 1OOAA 4FQXA 5E6YA 3DETC 4JRYA 4NCDA 5MERB 2GK2A 4UNUA 3SE3C 3T0WA 5DSCA 1IC7L 4CJ0A 3GSOB 1FE8L 5EO9A 4QRPD 2W9LA 4JDZA 4UT9L 5JLZB 3NABH 1W0VA 1MH5B 5I16A 2ZUVA 3QDMA 4XXDA 4IMLB 2XZAH 1J8HD 1JE6A 3WS3A 2B4CC 2H32B 4EIGB 5MHSD 5IW1A 3EDKA 2NR6D 3RBGA 4JFFA 5E70A 4M5YL 1SEQH 3N1PC 2BNQE 3W2DH 3BGAA 1QUNA 3K8KA 3UJIL 5F1NB 1X5FA 2WINB 2OR9H 1T1WB 3HS0B 4PJDE 2ID5A 2EDXA 1AP2B 3BJ91 1JWMB 4R4BA 1BD2B 2H32H 3T4AA 1CD9B 1UB6A 1CDGA 2J7LA 4WGWB 5D1QD 3ZE2E 2VZSA 5JW5B 1A4JB 3FONB 4L3EE 5JDSA 4A2LA 2F74A 3I50H 1PG7W 3NA4A 5FCUL 5GGTH 4HXBH 3QI9D 4IRSB 3LMJL 1RVFH 3CNKA 4U7SA 4LLVA 2JELH 2B5IC 5F7WC 2BZDA 1YMHB 3FFCD 5GISL 4F9PA 3MUGA 4KKAC 3QFJE 2ZCKH 5ESAB 3DRTA 3MV7E 1IAIH 1GC1C 4HKXB 2YZ1A 2OTUA 2QV2A 3QIWC 3QG6B 5C0CA 1P7KA 1UA6L 3BSZH 3F5WB 5BV7B 4K8RD 3REVB 2H9GB 3O6ML 4GMSL 3O45B 2PKDA 1JHTB 3NGBB 4U0QB 4G43B 3RI5F 4Y2DD 3C5JA 1J1XL 3B9EA 1DBBH 2P24A 3ARGB 2A9NL 2R1WB 5F7MC 4BZYA 2ARJA 5BV7H 4UAOC 3NA9L 3ALWA 1A7NL 1YZZA 5K93A 5IB2A 1RZKC 1D5XA 5DJ8A 2MCPH 4MAYD 3O8XD 1CL7I 4HGMA 4HMCA 3WFHA 1NBYB 3I84A 1NLDL 4TVSa 5H8DA 1N3NB 3U4BH 3T0EA 3UTSD 1MFCL 1UJ3C 1MCRA 3IXAB 4ZAKB 3WIHL 3LN5A 1QO3B 3UTTE 1EEYB 1HDMB 2OXGA 1BAFL 3L5XL 1T66C 3HRZA 5I1CH 5FV1L 2XQYG 3WIHA 4X7SL 3GSWA 4LCUB 3C60B 3OXSB 5D96B 3P73A 1MPAH 2R69L 5IV2B 4MNQB 2EH8L 4OFDA 4U3HA 1RIHH 5CMAA 4R8WL 5E2UL 4PJXF 2LAGB 5KS9F 2EDHA 2P8PB 2B2XL 2KQMA 1FL6B 4AMKL 2G60L 3BPLB 3WCYA 4ZOBA 3RUGF 1GZQB 1CXLA 1T83C 4HGKC 5EULV 1OW0C 5E6IB 4NKOA 4L3CA 3GMMA 3U7YL 3FO2B 4YFDB 1BLNA 3S37X 5ITBL 3U9UB 1UCTA 2Q76B 2P46B 4PRHE 3E1F1 5D7IF 4FQ2H 4I0PD 2IPTL 1OWWA 3ARBB 1MLCB 5FYKL 2DLTA 5E6ZA 5BRZE 4CN1A 5HYJE 1HWHB 1YUHA 5E00B 2FX9L 1ZVSB 5EZJA 5IMLA 4PR5B 3S7GA 2WV3A 3W9EA 2J8UB 3GM8A 3LVEA 5CWSB 3GMLA 2AQ1A 3B3IB 3O3DB 1RU9H 5F9JA 4ACPA 4AIXA 4M6OL 1F2QA 3C2AH 3IETB 4MSWB 2C3XA 1PG7H 3VXME 2X7LB 3SDXA 4YR6A 5F21B 1PSKL 1AY1H 3AB0C 2PCPA 4U3CA 1I7TA 5HYEA 2LV4A 5J56B 3TN0B 1K2DB 4PRBA 3L5JA 2VR9A 3DRQB 2Q8AH 1Y6MR 4L4TE 3MOAL 1NAMH 3QULB 5IB4A 1RD6A 1LP9E 1A7PH 2AI0H 4QGYA 1KG0B 1KPRA 3CDGB 1QZ1A 4U33A 1WWAX 1B4JL 2F53D 1LILA 1FYTB 3GHEL 4HF5H 3BFOA 3O3AA 4OLYH 1S9WA 3WUWB 1T1YA 5F3BA 4HJJH 3RFZC 4JFHE 4LHQB 4X8JA 3SHSA 4HUUB 3QIBB 1DBAH 4V1DD 3EJZD 1CU4L 4BQ6A 3O2WH 5EORL 1CGYA 2VE6B 3ET9F 3MV11 3B9KC 3QUZD 3ETBF 4GXVH 1QVOA 4FQJL 1SMOA 4U1KB 4PIRF 3FQWA 5EUOF 2VERN 2NY5C 4FRWA 1CFVH 4LSTL 3N1GC 1JV5A 5CP3H 4EDXB 5KVGL 1P4LB 4DKEL 4UIMA 1PY4A 1A1MB 1DQLL 1IGFL 1D6EB 2YPVL 3HI1B 3P2TA 4AZ8A 4U6TA 2DYPA 2FSEA 4P2OB 1SVZA 2HRLA 1IM9D 4NKMB 4K3HA 3C5SB 3FQUB 3ZSTA 4IJ3C 2BVUA 4HK0B 5BOZG 3D18B 3NIFF 4LKXA 1QD0A 3RZWA 5BCAA 5IGXL 4N0UA 1E4WL 2XZZA 3NBNA 4HIIA 4NDMA 2FJFB 4Z77A 5INCB 3SCMB 4B50A 2P8LA 2YRPA 3OXRA 5HBBA 1LD9A 3VRLE 2NZ9C 5T1LD 1U91B 4QNPF 2G5BB 3DYMA 4RFNC 3STZB 4WHYG 5DS8A 3RIFF 4X5XA 4I18C 3DUSA 4LSRH 2HWZH 5CBAB 2VC2H 2IBBA 4XPBL 4ODSL 1MCEA 5FKAA 2VZ1A 4OZIF 1YDPB 1MQ8A 3ARUA 3DUUB 4P9HL 5CEYB 4ODXB 3ILQD 1CK0L 2HKFH 4M93C 3WO3B 1TVHB 1FFOA 1K4CB 4NZTL 1DBJL 1VGEL 3HNSL 2Z31D 2EDDA 3K4AA 2XRAH 5DJZB 1TZIB 3TA3A 2ADFH 2FBJH 4LCIL 5KVEL 2EIZA 5HVGB 5BXFA 1N4XL 3MRJB 4MQTB 4XAWL 1ZHKB 4TOYH 4WFGD 5ISZE 4LSUH 3CIQA 2V7HA 3AS1A 3LS5H 4P5TD 1U8PA 4UU9B 4GW5A 5EIIB 4Q7DA 4P46A 5DJDA 4UTAL 4OLVL 1BQUA 1A6PA 1GGIL 2GKIA 4PRAB 3OTTA 1CL7H 1T21B 1WJ3A 4J8RB 4OQTH 4WO4B 3SKNB 2WQ8A 5J3HC 4XBEH 3Q2CA 4UT6L 4UV7L 1HKLH 3RNKB 2ITCA 2B20A 3OJMB 5EOQL 5B38A 3VXNB 5ICZB 1FZKB 6CGTA 3QWQB 3QUYC 1JFQH 4Y8DC 3OKKB 4JVPA 1WEJL 2DI8A 5EN2A 5LWYL 3AS3A 3ZMRA 3SJVE 2AAVA 5FECB 1JTTA 2CLRB 1B2WH 1HCVA 3EDDA 4KKCD 5LBSL 1DVFB 5K9QG 1A6TA 2UZIL 3VFVB 5GXBB 4EDWL 3TYFB 4DVBB 4KK5D 4NIKB 5J6GA 1JRHL 4J6RH 3L1OL 1IC5H 1QBMH 2CUHA 1FLTX 4MD0B 4I77H 1NLBH 3T1FB 3VXOA 4U1HA 2NXZB 5IMMB 2VLJB 3O9WA 5CEZE 5A2KH 1S5HB 4TULH 2NNAA 3FQRB 2Q3ZA 4P0DA 1OP9A 2ZUQC 3WDJA 2OI9C 3MJ7B 3IF1B 2EKSA 3VJ6A 3B9DA 4DAGL 3FB6A 4KDWA 3MJ6A 4NRZB 3QR2A 1RUAL 1NFKA 5DQJA 2CK2A 5FO9A 4R96B 4I3SH 1TJHH 4HD9A 2BNRA 1I9RH 3WUZA 3MV9D 4PTTA 1PY9A 4MJ6B 2BY1A 3FB8B 3GMOA 1DUZA 1ACYH 1BFOB 5B22A 1S3KH 3QISA 4FZEL 4XVJL 4ONHA 1AR2A 2CK0H 3FQNA 3KYAA 1JPST 4NZRH 3M1BA 4CVUA 2V7NA 1EZVX 2VITB 3LZFH 3GI8L 3WN5A 3H6JA 3UO1L 3CDYA 4KC3B 2PO6A 2A74B 1A6AA 2ERJC 2ZOLA 1YNLH 1CFQA 5CD3B 3KAAA 5L7XH 1EAPA 2VAAA 1JHLH 3QP3A 4LVOC 5K9JL 4O02H 1OD7A 1A2YA 3MMEB 3BWAA 1ZTXH 5D5MA 2BNQA 4RAVA 5E8OB 4JG1H 5EC1A 1NFDB 4HZAA 1Q0XL 4Y4FC 3OX8B 4M6MH 3L3IB 4PJBB 5CJXC 4WNQA 1CD1A 5IEKB 3UBXI 5KVMC 3DVNB 4HC1L 4LLDB 3BP7B 2O26U 2R2HA 3VXSD 3D87B 4PPTA 4NYLB 4L3EA 4HC1A 3JV5A 3QIWB 4JKLA 2ENSA 3W5MA 1MCDA 2FR4B 3KG5A 2A2QT 3FB7A 2P5WB 1XZ0A 2EDWA 1FVDB 1RZJH 2H6PB 4HBQA 4YJZL 1DSFL 1DANT 2I25N 3GB7A 3R4DA 1D5ZA 3D25B 2CUIA 1A02N 3I2CH 2OMBA 4LSSH 1HILB 3HMXH 4U6XB 3QDGD 4JKPL 1PGRB 3I6GB 3MRBB 4I48A 5TE7H 4UAOB 2D9CA 2A6KA 2EDKA 4L3AA 3QO1B 5D2NB 2HJKB 5GZNC 1N8ZA 5A2JH 5DMKB 3ROOB 1CG9B 2AEPL 4M7JH 1UJ3B 4XC1H 3IDJA 4KJWD 2ZG3A 4OLZL 1LO5B 4KHTL 4ETYA 4UQ2A 2IMNA 4YLQT 2ORBH 4L1HA 3M45A 1Q9OA 1N6QH 2Z35B 3NN8A 2WWMD 4Q6IA 4GRLD 3X3FH 1D9KC 3HE6A 2BERA 3IDMA 1MRDH 1WK0A 5GS2D 4Y4HD 2VDLH 4AEIH 1CBVL 4XPTL 1BJ8A 2OZ4L 4YBLC 1X5KA 1URLA 3G6AA 5ETUB 3IGAB 4EN3D 1GCFA 1CGTA 1UH3A 3H7BA 4QXTB 2OZ4A 4NNYA 3H9SD 2YA2A 5CEXA 1ZA3B 7CGTA 3EOBB 2VXSL 3D39B 3QIUD 4BH7A 2C1PA 4PGDA 4MHHI 3CSGA 4PJAE 1HYSC 1ES0A 4PP2B 4YH6A 2FJHA 1U3HC 2AQ3A 1CTOA 1W2KT 3N1MC 2P47B 2AV7B 3O6KL 3OKNA 2AQ2A 4O2FA 3ZDYE 1TQBB 4G8EA 4JZNB 1IMHC 5C0AE 3T77B 1ZHNB 2K7PA 4GKSA 1CLYL 2NYYC 3PL6A 5LCVL 3GMPA 4P48A 3IXTB 5H37H 1I3GH 1ROWA 2OMNA 3KPOB 1CGVA 1GOGA 3JWOH 5I1DA 4TUJA 1TTGA 1OY3B 3AS0A 3MNWA 4FS0A 4PYGA 4XGZB 1JZ6A 2R9HC 4U1JB 1EMTL 1SJHA 4IMKA 4KHXH 4LVHC 5BOPA 2ZP0T 4Z7QE 1YN6B 1KXTB 4HUVB 4KRMB 1R5VB 4LKCB 1U8LA 4OGXH 5J1SC 4I8DA 1SY6L 1R5WB 2XKNB 4OCNC 1OD9A 1NUFA 4CL7A 3EIFA 4HZLA 2A0LC 1FORL 4P3DB 3OJ2C 4N8CH 1SY6A 1C5CL 1MNUL 1ZLUK 4JE4B 5FO8A 2IPUK 1JYNA 3PGFH 5SWSB 4WDIB 4JHBA 1DEDA 4KGLA 1FNAA 4JRWA 4RGOL 5GRYA 1INDH 1ITBB 3NFNB 3QUXB 1WBYA 3RVWC 1TVBB 1CFNB 4OZ4A 1NBZA 3CC5A 5CIPB 5GSVA 5HXMA 2AJXL 4L8CB 2PN5A 1G7IA 1YEIL 4JEGB 2VIRB 4ZUTA 5CFHA 3B9KB 3NH7H 1MFDH 1JNJA 1Y6KR 5IROA 1GGUA 3O2DH 4PB0H 3U46A 3VW3L 5D1ZC 4QHLB 5F88A 1E6OH 5C9JA 3HZMB 5CIPH 5DC0A 5MP6L 3RGHA 2P7TA 3HC3L 5DYOB 1OP5K 3JXAA 1JF6A 1C1EH 3CFDA 4WWKA 3X17A 2R0WH 1VDGA 4U49A 3UTQB 1JWUA 1EX0A 5IK3B 1KN2L 3VH8B 2BMKA 1CYGA 3QEQB 1UZ8A 4O00A 3DSFH 3V0WH 1I75A 4M43L 4MNQE 2APWA 4KK9D 3VFRA 4DZBB 2W9DL 1A14L 5J89A 5EZLB 5JOFB 4GKNB 1RK1A 5B8CC 1G9MH 3UBXB 4RFEB 4M48H 2AABH 1ZLUH 3D0VA 4BFGA 2FJGA 4WUKH 5LGJA 1UCBH 2XWBB 4TNWF 2OTWA 4Y8AA 5E95B 3M17B 3QNYB 3QUMB 4U0RC 1A6ZB 2DM7A 3CPLB 4K9EH 5CUSH 1F90H 4IRJD 4HDIB 4MJ5B 1INQA 4L9LA 1OVZA 4Z95H 2NLJB 3X11B 4NGHH 3BGFB 3RWDA 4PJ9D 2UY7A 5DC9B 5E1AA 4C54A 4Z7OF 3WKML 4Y5YA 4NN5C 3QUMH 4JG0L 4APQA 1A1OA 3D9AH 1QSFA 3HFMH 5EZIH 4OCRL 3RWIB 5FOBB 2WLYA 3D85B 2DQDH 5F72S 4JY5H 2NY4C 3VD9A 5DD1L 4C83B 4PJHA 4WTZA 1DQML 4ZUWB 4LIQH 3BH8A 5ALBH 4WW2A 4LLUB 3V4PL 4L1DA 2DQCH 1PQZB 4A6YL 2BXYA 1ZLWK 5GS0C 3LN9A 5GRVK 1GRWA 5EU3A 4F7TB 5HY9A 3BKCH 1MHHA 4S1RH 4XX1G 5ANMB 4C55A 2PXYD 4GBXA 1R0AH 3KR3H 4OIIH 4A6YA 1CDIA 3MRDA 1KT2A 3CK0L 1N7MH 2YXMA 4ELKB 5BO1H 2EDBA 1KJ2B 3J8F7 2I9TA 5IFJA 1YMMB 1QYGH 1F6AB 1NDGB 3DNKA 2C9AA 2XQBL 3HNTH 5FUOH 5T1MA 1NGPL 3TJEL 1MHCB 3FO0L 2IPKA 3WNNA 4JDTH 3SDCC 4K3EL 5JQ6H 3LEYL 2GJ6A 3QUYB 2X2YA 1LE9A 4ZUUB 2X4NA 1HNFA 2NQCA 3MXWL 1KJ2H 3VGAC 3KPRE 1OP3K 1IBGL 5JXAL 4J3WA 1TETH 2R56H 1PKQB 3PQYD 2XTJE 4LGSB 4X0KA 2DMKA 3P4NA 4YE4H 4GUPB 2IH3A 1G9EA 2CDEA 4KROC 1JI1A 5DDHB 4KKLC 4YDJA 1WIOA 2CDGA 3QRGH 2X4TB 5DQDL 3PWLB 4ODBD 2K1MA 4P46D 5DGQA 3D0LA 3SQBA 1G7QB 2R23A 1ONQA 1VFAB 3EGSB 3QXDA 2OI9B 1RZ7H 5TH2A 3DX8A 3PHSA 4PJGF 1Q94B 2DQHH 3JVGA 1CIUA 4CADA 3LS4L 4NHCH 3G9VA 3IFLH 5DT1H 3W11C 3PNWB 1RZ8B 4N90D 3CH1A 4LASL 2K7QA 3O2VH 3C5ZC 4X9BA 5GRZA 4HG4K 5DI8B 4K2UL 4QRRA 4P4KD 1UWXK 4KJYB 4WUUB 1XIWC 3KGRA 4XPHL 4Z76B 4OD2A 4DK3A 1WTGT 2AXHA 5DJCB 2EYSB 4K3JH 5C2BH 2WUCH 1PFCA 4XBGB 5CZXC 1F3DJ 1RURL 2BJML 2UWEE 1EO5A 4WJ5A 5CINH 1HHJB 1OP3H 5I1LB 3G04A 3QNXA 5IFAH 5F89A 1QRNA 1RY7B 3WEXB 1KB5A 2R29L 1SM3L 4ETQB 4MMZC 4U4BA 4NP4L 3BEWB 2NR6C 3BP4B 3UDWA 4J3OC 1T2JA 3VFUA 5EU6A 1A8JH 5I1HL 3MRRB 2NX5A 3VXUE 3H0TB 5INDA 3QQNA 3RNQB 1IKNC 3OR7B 4PJ7F 1X5ZA 4OSUL 1FH5L 2EE9A 2P5EB 2E27H 5T3ZD 1G7PB 3QQ9D 2W91A 4LGPB 3RL2A 4TSAL 3KVQA 4EI5D 2E9JA 2X4UA 2G75A 3FHAA 3V6ZA 5JQHC 2R0ZL 3WXVL 1F8TH 3ZKND 4PJ5D 3ZT5A 2CMRH 1FNLA 3U1SH 3AGVA 3L9RB 5M7QA 1WFUA 5EFIA 5D72L 5C6TL 4YWGH 2BSED 2VUOA 4Y5VA 2CLZA 4HUNB 5IBTL 1QEWB 5IBUG 4Q9CA 1EDQA 3BD5A 3ARFA 4GQ9L 2HJFA 4I2XB 5DMYA 5I1EH 1WISA 2W0PA 4WU7A 2FECL 2JB6A 4Q0XL 3NIDE 4XX1E 3QQ3B 3RWHA 4RFOL 2X4RA 4RRPG 1I3RB 3MLXL 3L3KB 4X6DB 3VU2A 4RDQG 2H26A 3MXVH 2C7UA 5JO5A 1UZ6E 1KFAL 5L2KA 3WV0A 4JANA 3OGCB 3GM0A 1LEKA 4ZXBC 2FX7H 5EBLA 4Y16C 4LPTA 1I1YA 5EC2B 2OSLA 1HYRC 5JXEA 3TO4A 3L3GB 4Z0XA 3TEUA 1D9KB 1PW3A 1QSEA 4N0CC 2VLRA 3NABL 4MAYC 3O8XC 4RZCA 2XZQH 1UB5A 2R4RH 3MCKB 4YBLB 5I8EB 1Q9LB 1CICA 3GSNL 2XZAL 3KJ6H 3GMRA 5I66B 4QRQB 1XF3A 3HPJB 4W4OA 1OTSC 2FH8A 1HHGB 2IMMA 2XIDA 1F58H 1SEQL 3W2DL 3GSNA 5EBMA 4MXVF 4NSKA 3TVMD 4YBQC 5HI3C 2OR9L 2AXFA 4JFDB 3BUYB 3PXHA 4Z7WA 2ESVB 1A22B 3S96A 2OK0H 1BJMA 1MH5A 4G80A 1XGPA 4YHPB 5E24E 1FNSH 2LTQC 3RY6A 4BZ1H 5I73C 4PGCB 3ULVF 1C5BH 2H32A 3I50L 1SJVA 4X9IA 5GGTL 4HXBL 1VEMA 3MFFA 1RVFL 4G8GD 3VXTB 1MJUH 2JELL 3HE6D 1NFIB 1JYVA 3K74B 4WI7A 2G9HA 1X7QB 2ZCKL 5GGTA 1Q0YH 4RMVA 5ICXB 1IAIL 2WINA 1T1WA 3HS0A 3PWPE 1AP2A 1JWMA 1T0MB 4JZOB 1BD2A 3BWUC 1CE1H 3AREA 4I0PC 3JSSA 4K07A 4CMMB 5DRXB 3BSZL 5I18H 2EC8A 4HSQA 5JW5A 1A4JA 1I7ZB 3FONA 4PG9A 5F6IB 4YHOH 5AZ2H 4TUKH 2P5WE 1WWBX 4M00A 5I8KH 1FC1A 2XXMB 1DBBL 2E7LC 4LPVA 2NPLX 4QXWA 4J1UB 5F1KC 1RK0B 5BV7L 4HKXA 4RMWA 4WIQA 5L2JB 5B3NA 5C86A 4M62H 2GTZB 1JZ2A 2WUBH 2KBGA 3U30B 4P23B 2IPUG 1F4XH 2MCPL 3VH8G 4HJ0D 2CO7B 3ALPA 4YQXH 4AIZB 3F5WA 3IDIB 5C0JB 3REVA 2H9GA 3U4BL 4JJHA 2RB8A 5D2NE 3O45A 4KV5F 3NCCB 1A47A 1JHTA 3UBXG 1AC0A 5AZEH 4GH7B 3B2UD 1JK8A 4N68A 3IDYC 5I1CL 3ARGA 2F54B 2IH1B 1WQVT 3PABB 3Q5TA 5D7LB 2MKLC 1MPAL 1VHPA 5FA3B 4QWWD 3O3BB 1JGDB 1JNLH 3TYGH 1RIHL 1A64A 1NBYA 3MZTA 4O9HH 3VWJC 2EDOA 1TFHA 3DXAB 1N3NA 3WS6A 3IXAA 1QO3A 1EEYA 1HDMA 1JYXA 2WP3T 1KC5H 1E4KC 4JFYA 4JO4H 4U6VH 3WYRA 3EYQC 4NQDE 1XT5A 3C60A 1VFBB 1FAIH 3OXSA 4FQ2L 4U0RB 5C0BE 3HC0B 3WXWH 4ZFOB 3ULUD 3EJYD 5T1KD 2QHRL 2XWJB 4JKKA 3EOAB 3WD5H 4FN0A 2P8PA 2BX5A 1FL6A 2R2EA 3HUJE 4ZOCA 1OLZA 2BK8A 4WWKD 1GZQA 2O5ZH 1AHWA 3PWJB 3OB0H 4DCQA 5E6IA 1RU9L 4J4PC 4HUWB 3KXFA 3C2AL 3Q48A 3FO2A 3U9UA 2Q76A 2OR8A 1PG7L 1AY1L 4P59H 5F7HA 1MAJA 5SWZB 2R1XA 3OKDB 4G6FB 2V2TB 4WFEE 3H8NA 4F58H 1KTDA 1TQCC 1JNHB 4OZHE 1LMKA 2Q8AL 4G6JH 3B5HA 1BOGB 4G8FB 1ZLSH 2J8UA 4OZFG 5EUKB 5CWSA 3VDAA 4M02A 1KNOB 3B3IA 4PJFB 1A7PL 2AI0L 3O3DA 3RY5A 3ILQC 2Z9TA 4XXCA 4TSBH 5E03A 2X6MA 4HF5L 3G08B 3O4LB 2E7HA 2FRGP 4OLYL 1AGCB 4F15C 1SYSB 4M4PA 4KZDH 3C9NB 5AD0B 32C2B 4MX7A 1CDUA 4HJJL 3UTZB 4OF0A 1RIVH 5GS0H 3P0VH 4HH9B 1UXSB 1DBAL 3TN0A 3O2WL 1K2DA 4HH8A 5F7EH 3VE0A 1F13A 3Q0HA 4GXVL 3SDCB 3DMMC 2EXYD 4FG6D 4KJPC 2EE6A 1XEDA 3ULVD 4P5TC 3QULA 4ZTPL 1CFVL 5IQ7H 3VGAB 4CMHC 1KG0A 5DJXA 2CXKA 4WGVB 5E8EA 3CDGA 1ZT1A 3MREB 1AQDB 1SQ2N 4FFWC 1FYTA 1F6FB 3WE6B 5CP3A 1LQSR 3WUWA 5JHDD 3LB6D 3IJHB 4HUUA 5B39G 3QIBA 3G9AB 5IEHB 1EV2E 2RR3A 1ADQH 4U1KA 4EUPG 5BVPH 4G9FB 2Q87A 5M94B 3P30L 2BOCA 4NC0B 2YSSB 4HK3N 3HG1D 4EDXA 1P4LA 1FL3A 3MNZB 1CLCA 2XXCB 3OBAA 2BHYA 4NRYB 5J9PB 1D6EA 3EFDL 3HI1A 5T5NG 3RZCB 2N56A 1IGTB 1B0RB 3K80A 4IHOA 3MRMB 2NCMA 4PY8J 4P2OA 4X7TB 5F93C 5T1DH 2VC2L 4JAMA 4MA3B 3CVIH 1R3HB 2OS7A 2GITB 4XNYH 4HK0A 4KXZI 1UGNA 3O11A 4Y88A 4MQXC 3U36B 1FBIH 4FQ1H 4DK6A 2DM3A 2EZ0D 2HKFL 5INCA 4QRPB 3WLWC 4WHDA 4LIQE 3FMGH 1MI5D 3HCVB 2WSKA 1U91A 2E5EA 2XRAL 2G5BA 2I9LB 3NCYS 1J8HB 1X44A 4N5ED 3STZA 3TFKD 2ADFL 2FBJL 4Z7VB 3MLTB 1HNGA 1WIPA 1Z0NA 5EA0H 3T8XA 5CBAA 4LSUL 1LVEA 1O5DT 2DI7A 2JKXA 2NY6C 2NY1D 5MEND 1YDPA 3LS5L 3DUUA 2Z4QB 1YPZE 3LKOB 3QSKB 3Q3GB 5DQ9A 4PRPD 2VLLB 5CEYA 4ODXA 3BUTA 4R6UA 2DAVA 3NIGF 5L6YH 2VQUA 5D1QB 3DVGB 1CL7L 4IDJH 1TVHA 1K4CA 1BVLB 4OQTL 4D0CB 1S9XB 3L3JA 4XBEL 4ZMAT 1RAMA 3PDOB 1C7SA 4NNXA 5IT2H 5DJZA 4YHIB 1BJ1J 1HKLL 1TZIA 3QI9B 3NMEA 3WJLA 1NMCC 4OQTA 2IBZY 4HS3B 3FFCB 4LQ1A 2KQNA 3HZYA 2WBWB 2ZOKA 1JFQL 4U1SB 1FDLH 3T2QA 3QDJE 2YN3A 5JMOC 1JGEA 3U4EB 3MRKB 1EK3A 3CFJA 5FGBA 4UU9A 3IDUA 3GIVB 3SE4C 1AFVH 5EIIA 1IEBA 1B2WL 3MV8D 4EKXA 5DRNB 4PRAA 3EO0B 4CDHA 5HPMB 4J8RA 1DN0A 4WO4A 4HWZB 5EU6D 3VD7A 4I13B 3DURA 4J6RL 4I4WA 4UUJB 5EO1B 4JM2C 1IC5L 3UYOD 1QBML 4QF1B 4I77L 1NLBL 2A6DB 4GQPH 4XCEB 3RNKA 1HSAB 1ED3B 3VXNA 1BIIB 4TULL 1MIMH 4Y2DB 5ICZA 1FZKA 2FIKB 2GJZA 3OKKA 4WCYH 1BX2B 3U6RB 4MGXA 1I8LA 2HFEB 3REWB 4K8RH 3D3VE 2B7DT 5FECA 2CLRA 1QSVA 1DVFA 4I3SL 1TJHL 5KBNC 4MAYB 1I9RL 3VFVA 4DVBA 1A9BB 4HGWB 1ACYL 1WT5C 1S3KL 1CIDA 3UTSB 2FHCA 4KJWC 2Y5TB 3ARFD 3S6CA 4JO1H 4LP5A 2VLJA 4X6CA 5HYSB 5I76B 5IMMA 4NZRL 4GRMB 4PGEB 1S5HA 3LZFL 5IB1B 3O4OB 4YZFF 4ZO7A 1BQHB 2YPKB 4CW1B 3MJ7A 1BZ7B 3PWNA 1YNLL 4LOUD 5GIRB 4NRZA 2BNUB 1B3JA 4IOFD 4XBPB 5L7XL 4Y4HC 1JHLL 4EXPX 4R96A 4O02L 4MB4A 5EG6C 2APFA 4HMDA 1ZTXL 4MJ6A 5GSRB 3FB8A 5I73B 1MFAH 4RX4D 4JG1L 4EN3C 4RIRB 4M6ML 2BVPB 1D5BB 3ZL4H 1CDJA 2EIBA 4WV1C 3JUZA 1QSED 4UT7H 2VITA 2VLRD 2JB5H 43CAB 5E9DD 3V8OA 2YR3A 1Y6NR 4NUJB 1CICD 4LVNB 2XNAB 1LE5A 2HG5B 3PWVA 5CD3A 5I17B 1QHPA 2ZUUA 5CHNB 4I0PB 3ROLB 4BSWA 1UH4A 1RZJL 3MMEA 5H2BB 2GQHA 5E8OA 1NFDA 5HDBE 4PJIB 3OKLB 2A6JB 3OX8A 4HEPG 4LMQI 2A77H 3WNMA 4UV4H 4L8DB 4PJBA 3I2CL 4GXUM 4XMKH 4LSSL 1YQ2A 4ALAH 3HMXL 3DVNA 5CCKH 4LLDA 3BP7A 2WANA 4OLXH 1JF1B 4QHUB 5TE7L 1X5AA 3MBEB 4MZ2A 1WZMA 5GRWA 4ISVB 4NYLA 4RWYH 3WHE1 3HMXA 3SGJC 1HH9B 3QIWA 1JL8A 3RA7H 4AT6B 1HOCB 4XVUD 1X5XA 1WAAF 1V3JA 2FR4A 3W9DA 4FTVD 3KPQB 2P5WA 2H6PA 1FVDA 5C6WH 4QOKE 2YD5A 4I2XE 4YDKH 4M7JL 3FRUA 5FM5O 1S9YB 4QXGH 4A2MA 3PV6A 1KEGH 4FQLH 1VKXB 3MRIB 2BOBB 4PGBA 5ID1A 4XVSH 1GGBH 3ARED 1LO0H 4KQ3L 4U6XA 3IDYB 1RZKL 2YOCA 2ORBL 3I6GA 3MRBA 1N6QL 4BFBD 2F53B 3PJSB 3JV6B 1VGKA 5C1MB 3X3FL 5IVOA 1MRDL 1A7BA 1AO7D 2VDLL 3A6OA 5E8PB 4AEIL 5IKCB 2HJKA 4WFFE 4TN9A 3KPNA 4PS4H 1OF2B 5DMKA 4V1DB 1CG9A 4WI8A 1UJ3A 3DBXB 3QUZB 4KI5E 3H7LA 2N4IA 4HT1H 1LO5A 3DX7B 4PBVC 2FO4B 3GBLA 1O7SA 4NQED 3BVNB 1IAIM 3PG2A 2J4WH 3VRIA 4L8SC 1QBLH 5D2LB 1J86A 1U93A 3W0WE 4OCXH 4ZOAA 4FNLH 5F96H 4JFDE 4XP9H 2ZG1A 2X5PA 2AK4D 2V9RA 1XGTA 5I8CA 2ESVE 1IM9B 1XCQA 2VXVH 3IGAA 3D2UD 2F8OA 2FX8H 5ID0B 2DDQH 3QWRD 1K9TA 4LHUD 4QXTA 1AIFB 4UILH 1M7XA 4MDJB 4GT7A 4YPGB 5M95B 5CSBA 3JWOL 5I1IL 1OW0A 4EOWH 3EOBA 5B3JE 5BMFH 3D39A 4KHXL 3CDFA 1W8OA 5DXWA 4I3RH 4NQVB 3VFMB 5T1LB 5TPWH 4PP2A 1GHFH 5EZOH 1KIRB 4DFIA 4IRJC 1JN6B 4OGXL 4Y0GA 2AV7A 1KCRH 2WIMA 1L7IH 3IKKA 1TQCB 5F9DC 3GO1H 3SN6N 4JZNA 1XGQA 3T77A 1ZHNA 1BEYH 4PJ9C 2HRPH 4JGUA 4HAFA 4P5MB 4N8CL 1FGNH 3TLRA 2Y5EA 3K4ZA 3KPOA 5J06A 4P99A 3KLAB 3PGFL 1OAZL 5TDOB 2Y1VA 5EU5B 1NEZB 5AAMA 4X9FA 5C0NC 2YC1B 2IWGA 4BQ8A 2Z31B 1YN6A 1INDL 3DPBA 4WEUD 4D9QE 4OI8A 4HUVA 4ZSOE 1R5VA 1AD0B 3NAAH 3GRWH 1XR8B 1FIEA 4M1GH 4PJ8C 3U7WH 3GSQB 3KXFD 3NH7L 1FV1B 3IRPX 4Y4KD 1MFDL 4PJXB 5KS9B 4GOSA 2DKSA 4P5TB 3O2DL 5FYJU 5I75C 5D7JC 2L4OA 3SPVA 4PB0L 3L5WB 4CMHB 4M7ZB 2ICWJ 3VG9C 3L3DB 4B53A 3E8UH 5SWSA 3RUGB 4LCWA 1OAXH 4G42B 1KCUL 2VZOA 4I9WD 1C1EL 3ARTA 2R0WL 3NFNA 2AJSH 3QUXA 2Z8VC 1U8OB 1TVBA 1P9MC 5CIPA 5D7LE 3RVXD 3QXTA 4L8CA 4GS7C 3THMH 3DSFL 3V0WL 3B9KA 3LQMA 4NO2A 1IC4L 2HLFC 2J3SA 3UYRH 4MJ4A 4NZJA 4JQXA 4CU6A 1OAUH 1RQ5A 5A16B 5IW6A 4M48L 1FL5B 5DHYB 4XNMB 4LARH 4BKLB 4UBDD 1RUQL 4QHLA 1QBBA 3SDDC 4WUKL 1UCBL 3MYZA 5DYOA 4JFOB 1U58B 1DLHB 1QFWM 1CXIA 2E7CA 4OT1H 1AXTH 3UTQA 4WW1B 5CUSL 5IK3A 5BZDB 1F90L 2PF6A 1MELA 2BVTA 3QEQA 2J12B 2IBZX 4KK6C 4Z95L 3RRQA 4R9HA 3P4MA 4OZGF 4NGHL 2X1XR 1T22B 1K8IB 3NCEB 4HWNA 5JOFA 1Y18A 4PLJD 3MJ9L 2JK5A 3DLQR 4RFEA 5TDPB 3T1WA 4W6YB 3QUML 4H5SB 3D9AL 4YGVB 3HFML 4WFHE 3V6OE 4F7PB 1QHOA 3MJ9A 5IHBA 3MV9B 4X98A 1F42A 2EXWC 3M17A 3QUMA 2DQDL 3OAYH 4JY5L 3RIAF 3CPLA 1HH6B 4I18A 4KDVA 4MJ5A 4YC2C 2FWOA 5ALBL 3HE7C 4P2RD 1PZ5B 4GAYA 1WZ1H 4JPKH 4TRPH 3OKOB 2DQCL 5SWZE 2NLJA 3FFDB 3X11A 3BKCL 1KJMB 1G7JB 3FAXA 3HMWH 4J23A 4S1RL 5HDQH 5HHVH 1R0AL 3KR3L 5KSBA 1OGAD 2X41A 3L6FB 3F12B 1SEBB 4OFYD 4OIIL 4E5XA 1A3QA 1JCKA 1N7ML 5BO1L 3RWIA 5FOBA 4S11A 1MHEB 3D85A 4JRYB 5SX5K 2AP2A 1L9MA 3HNTL 1HHHA 5DSCB 1WCQA 4ODHH 3DUHA 4ZUWA 4LLUA 3LHPH 4JDTL 5JQ6L 3VXSB 4YHKH 4XXDB 2MCG1 1KJ2L 1CE6A 1U8MB 1HQ4A 5ANMA 5JIHA 3WS3B 2D0HA 2ICCA 2D7OA 3UAJD 5K59F 4IOSD 4FQCH 2R56L 4JFFB 4EI5C 1FFNA 3UXFA 3SBWC 1FIGH 4YE4L 4ELKA 3QO0B 4N8VB 1YMMA 1F6AA 1NDGA 1JZ7A 1GZPB 3QRGL 5J1AB 5ACZA 4J3SA 5A43C 4TPRH 1MHCA 1UB6B 1WV7T 4KMTH 1YEGH 3IFNL 4K71B 1RZ7L 2P1YA 3QDGB 3QUYA 1MCSA 2B1HH 4UNVA 4WI4A 1HZHH 5GS1C 3I3DA 1L4IA 2DQHL 3BPCB 4ZUUA 2JIXD 4DEPB 4HJGA 2FEEI 3EYVB 2ADGB 3IFLL 1PKQA 1B0GB 5DT1L 1NGWA 5F1IB 2C5DC 5CJOH 3B8SA 4HQQH 2UY6A 1RZGB 2W60A 4FOMA 4GUPA 3O2VL 1J05B 5IQ9B 5JA9A 3TO2B 2HTKD 2X4TA 4PJDF 3QYCA 3PWLA 2OTUB 1NUGA 1G7QA 1V3MA 2ARJQ 3DV4B 4HWBL 4K3JL 4ERSH 2WUCL 5C2BL 3EGSA 5HHOE 3RKDC 1Q94A 1GOHA 2VWEE 2YD2A 5CINL 4PJDA 4NC1E 4GRLB 5F44A 5IFAL 3FN3A 4HWBA 4OCMC 1KN4H 4FMFA 3PNWA 3UTPE 5CZKA 2HFGH 3C5JB 3G5VB 1TITA 4QRPE 4EN3B 4S1DC 5DI8A 2ARJB 4Z7UA 3ESVF 4RAUB 4WUUA 1J8HE 4P2QE 4Z76A 3H9SB 2XN9A 5MHSE 4E0RB 3HHRB 5IB2B 3CSYB 5DJ8B 1LEIB 4Z7VE 4AENB 5I8OH 4XBGA 3QIUB 3LQZB 4IBLT 3O6MH 1HHJA 3T0EB 5I1LA 4NPYB 3RHWF 2E27L 2VQ1B 3WEXA 3LN5B 1YEKH 4HWUA 1AGBB 4H8WC 1F8TL 2KH2B 2CMRL 3U1SL 1T80A 3HRZB 5HHNB 3BEWA 3BP4A 5HHMD 1U8HB 1V7ML 4Y5XC 1TZGH 2CKNA 5CJXA 4YWGL 2CRYA 2E9WA 2WP3O 3MRRA 3H0TA 2IQAB 1G6VK 4MNGA 3RNQA 3OR7A 4ZUSB 3FFCE 2P5EA 5KZCD 5IVXE 5I1EL 5JZ7D 3BGMB 1G7PA 5FDWA 3WIHH 3KPSE 4LLQB 3HR6A 1X6NA 1M7DA 2PW2A 4JO2L 3WHXA 4L3CB 3E3QE 1BLNB 1DEEA 2D0FA 3BDYH 2NY0B 3MXVL 1CVSC 3T3PE 3EFFA 3B83A 2XFXB 5DLMH 1CZ8H 4IDLA 2ED9A 1T89C 4MA1C 2FX7L 2XWTA 1QEWA 2BRQA 4R8WH 3AY4C 4I2XA 3HI6H 1MVUB 1X5YA 4OFVA 3WNPA 3W9EB 2XZQL 2R4RL 3IB4A 3KJ6L 2W92A 3GMLB 3QQ3A 4F37K 4KKAD 4C59B 1KPUB 4I1NB 4LF3B 5F9JB 4ZDHB 4X6DA 5L0QC 3IS0X 2VDNH 3L3OB 1UM4H 3SDYL 1F58L 2OCFD 4HULB 2DMBA 2PW1B 2JE8A 3B2UC 1SBSH 2Z92A 3Q6FB 1NGQH 1I7TB 1YJDC 3MLRH 4PYHA 3C87A 3N0PB 5EC2A 2FNBA 1NH6A 3L3GA 5F7KC 2YS4A 4PRBB 3S88H 1JBJA