4F7EA

Crystal structure of bovine cd1d with bound c16:0-alpha-galactosyl ceramide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
271
structure length
271
Chain Sequence
FSFQGLQISSFANRSWTRTDGLAWLGELQPYTWRNESDTIRFLKPWSRGTFSDQQWEQLQHTLLVYRSSFTRDIWEFVEKLHVEYPLEIQIATGCELLPRNISESFLRAAFQGRDVLSFQGMSWVSAPDAPPFIQEVIKVLNQNQGTKETVHWLLHDIWPELVRGVLQTGKSELEKQVKPEAWLSSGPSPGPGRLLLVCHVSGFYPKPVRVMWMRGEQEEPGTRQGDVMPNADSTWYLRVTLDVAAGEVAGLSCQVKHSSLGDQDIILYWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CD1D antigen, d polypeptide
publication title Crystal Structures of Bovine CD1d Reveal Altered αGalCer Presentation and a Restricted A' Pocket Unable to Bind Long-Chain Glycolipids.
pubmed doi rcsb
source organism Bos taurus
total genus 74
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f7eA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4f7eA01
5HHOE 3B5TA 2HFTA 4L4TB 1OD7A 1IC5L 3MV9A 1U8NA 4JG1L 4RGOL 1EEZB 2A1WH 4Z95L 3OR7A 4FFWC 1E4WH 4P2QA 5L2KA 5I1HL 3WD5L 5T1LD 5FDWA 2XFXA 2OQJA 4P5TC 1BP3B 5E6ZA 4Y2DC 1LEKB 4IRJA 4PTTA 2PTTB 3VWKB 4WEMB 1BIIB 2HTLC 3UXFA 1U8OA 4JFEE 5CLWA 3B5HA 1X5HA 3GIVB 3TO4D 2F54E 3C60B 1Q1JH 2A77L 3BAEH 3GI9H 4WHTA 3ROLA 4G80A 2H26B 4JZNB 2EH7L 3QDMB 3DTXA 4MVBA 4YPJA 5IIEB 2DYPB 1IKFL 1S7QA 5MP6H 1AKJA 2ADJA 3FQNA 2APTA 2FEDC 3GIZL 1C16B 3AS2A 1DQML 4Y5XB 3RWHB 15C8H 1G7PB 2FJHB 3DETD 4YDIL 4HJGA 3RY5A 3U6RA 1OTTD 1DR9A 1CFQB 6CGTA 2ED8A 4G8GA 4XP4H 3FO1A 3LKQA 4XI5C 5BMFL 4OF0A 3CNKA 3NIGF 3OX8A 3FRPA 4L8BA 5JDJA 1G6RB 1L8JA 4Z8FH 4ZSOB 1MCWW 1RULL 5DGRA 4ORZC 1RK0B 2HYMA 2E6JA 3HNTH 3QWOA 1KJ2L 2FX9L 5ID1A 1J1OH 3OAZK 3PWJB 2P5EE 4HK0B 4PJAB 3OKMB 4NQCD 1RK1B 1W2KT 1MIEL 1BQLL 4KJPC 3L3OB 4XP5H 1ZT7A 3AY4C 3VI4E 4CU7A 3MJ8B 3I6GA 3DVFA 3T3ME 2H6PB 3ULSB 2QEJA 5CHNB 5AD0A 1OAUH 1NAMH 2BNRD 2AI0L 4OGYH 5DMKA 2MCG1 5E5MB 5H94A 1YPZE 2AXFB 1MI5D 4U6HB 5FO7A 4LSSL 4XPHH 2ZOKA 1RJLA 5DJ6B 5J1AB 1XGUA 5ESQB 1IEBB 4ODXA 3T0EA 2E7HA 3DYPA 2EIBA 4NGHL 4L3EA 4UT9H 3ZLQC 2XNAA 3UTZB 1L7TH 4HKJA 5EBMB 1GGTA 4O2EB 3ARFB 3ULUL 1G9NH 4E41B 1WITA 4I0PD 4N8VB 1W8OA 3UYRH 3QQ9D 1RHFA 4GAGH 1FNFA 1HINH 1NEUA 3I3DA 2XQYG 2OMNA 5F3BB 4IIQC 2BOBA 4GW1A 2EECA 3I6LD 5I1JH 3K46A 3BSZH 4G42A 1NC4B 4GOSA 2ZUXA 1ZLWH 4X99A 4L4VA 3S35X 1MRDH 1ACYH 1IC1A 4CMHB 2YPKA 2IFFL 3PQYE 5EZJA 3K4AA 1UCBH 2C7UA 2JJTA 2VZUA 1JHLL 5E8NA 5E6IA 5J11C 4PTUB 3CFBB 1F8TL 3I9GL 1JWUB 5F7DB 5SWSB 4QRQB 3NN8A 4RNRA 3QWQB 4JFYB 3ZSTA 2B8OT 1RZJL 4JM2B 3JWDC 1CWVA 3SDXA 2F5BH 4PRID 5T33H 1NMBH 1U3JA 2X5PA 2ZKHL 3V7AG 1Y0LB 1WWAX 1N5YH 1OARH 4JG0H 1EPFA 3G6JE 1S7RB 3T4YB 1G6VK 3I6KA 1T22B 4M1CC 5AAWA 1MHHB 2J7LA 3DMMC 3HI6L 2NW3B 5HHNB 4XAKE 2GAZA 5BS0B 1PAMA 1CICA 4M6NH 4XVSH 1EFQA 2NY4D 2VXSL 2Y36H 3DO3A 3FB5A 4WUUB 4Y2OA 4Z18A 5K9KB 2XWBB 2ZCKL 4N0CA 1NSNH 2GFBB 3KYKH 5FV2A 3GZKA 4P23D 2J8UE 4J4PD 1QQDB 2Q87A 4AL8L 4MNQB 3DV6B 1WIUA 5BQ7A 2EDFA 4KVNH 1G1YA 1UH4A 2E8ZA 3KJ6L 5HPMB 5IBUB 1DQQA 3ERYA 4HIHB 3FJTA 3TEUA 3L3JA 5I76A 1ONQA 4NZRH 5GGTL 4LVNC 4GRLA 3S4SG 2JK5A 3ARBD 1AGEA 3O3DA 3KXFE 4NKQB 1R3IL 1U8IA 2XQYK 3BWAB 2BJML 4YFLF 1OQOA 3P4NA 5FB8A 1T1ZB 2AJ3A 1MLCA 1H3XA 2HWZL 1RUAL 1AP2A 3RI5F 1QA9A 3PABA 1LO4H 2VNCA 2ZSVB 1UZ8B 2GKIA 3FT4B 4QRPB 5FCSH 2PETA 3L5XH 2CKBA 4OLXL 2D31B 3QEGL 4WU5A 5IBLD 3P9LA 1F4AA 1T2QL 5L7XL 1PY9A 2DWEB 4ZFFB 2OL3A 4I2XE 1U8LA 2PXYD 2WQRA 4YHPA 1DUYB 3BN3B 1QR1A 2IBGA 3UEZA 4ZFOA 1P4BH 2XZQH 3B9KC 1Q9KB 3QHFL 5IWLA 2E9IA 3C87A 3IXTB 4X6CB 5SWZB 2PW1A 4KK8C 4IRJC 5JOPD 4M43H 2AJYL 1DANU 3T0VA 2ZP0T 2HRLA 3AREB 4EI5B 5KAQG 1KT2A 5HYSA 3EDFA 5KSAA 1UKSA 4FQ2L 1HH6A 3NFNB 4KJYA 4K7PH 2I9LA 4MVBC 3OF6D 1QNZL 3WFEL 1RJYB 2AP2A 1KELL 3MZTA 2YRZA 4AEHL 1G9MH 2A6KA 3H9YA 4FP8L 1ZA3A 4F15C 5DD1L 4W6XB 1HHGB 1CLCA 5TDOB 4LRNH 1I1AA 4LHUG 1XR8B 3RVVC 1MWAH 3MROB 3W0WD 4HUWB 3SKJH 3CSYA 1QSFA 4LKXB 4WHYG 1TJHH 1BJ1H 3CDGB 4TN9A 1BLNB 3PWLA 1DLHB 3MNZA 3WJJA 3JWDL 1OHQA 1I8IB 3TV3L 3I75B 3KPOB 3QEQA 4JE4B 1NCDH 1Q0YH 1CFTB 2W0LA 3O3BB 3ZL4L 3QIBA 3C09C 5HY9B 4ZOBA 1MELA 2OTPA 3VFUB 4U2YA 4HPYL 2NXZD 2Z8WC 4O58H 2NXYD 5DJ0A 4M93C 2JIXB 4JQIL 3E6HA 3GSOA 4LSPL 1TXKA 4OZGB 4RWYH 2D7OA 4R7DB 1MRCL 3GMQB 1I9JL 2WNGA 4JFFD 1PGRB 3T65B 2YPVH 3EYQC 1JRHI 3P40A 4DUXA 3TN0A 2WV3A 3PHQB 4FMKA 4BQCA 1BFVL 1EAPA 3EGSB 3VXPA 4HHAB 1WZ1L 4NFBA 3DVIA 4EDWH 4FZEL 1JGVL 3GO1L 1OY3B 1NCNA 4AT6B 3VMPA 3RIFK 3Q1SH 3QCVH 3T2PA 4WI5A 3B2UD 1MAMH 1A3RH 4FTVE 5FHAL 5J6HB 3LRGA 2EDTA 4W4OA 2YUXA 2YA2A 1CLZH 1PKOA 1E6OH 1FSKB 3VE0B 4YEEA 4JVWA 2PO6D 4QKXB 1A1MB 3C6SA 5E6IC 3UPRB 5E7BA 4MB4A 3BPLC 5IEHB 3TJEL 5MI0B 4P2RA 5F3HB 5ESAB 3B2VL 3VXQB 1XF3A 5IFHH 3NIDF 2EZ0C 4OAWB 1CGWA 5TE4L 3CUPA 5ID0A 3UC0L 1QFWM 2VOTA 5GS3A 5FK9A 1K4CB 2XPGA 4NO3A 1FJ1A 3WL9A 1U8KB 5C0BE 3JBG7 2DMKA 3PWPA 2J5LB 3H0TA 2F8OA 5EO9A 2FDBP 2X4UA 3LRSB 4PBVC 5H8DA 4XBEL 1HHKA 5EU6B 5L9DL 5DVKA 1H8NA 4N0CC 3RVUD 3U4BH 3UTQA 1FYTB 3RGVD 1Y18A 1HSAA 4RIRB 4MQSB 1UENA 5J3HC 5GGSB 2NY6C 5CMAB 3DSNA 4LLDA 3SJVD 3TC9A 4YIQA 5J12B 1QBLL 2NNAA 4TULL 1QOKA 3F6IA 5FKAA 4LHUD 2HKHL 5A2KH 4ZOEA 4XZUB 3MBXH 5DUML 5IKCB 4RMWA 2NW2B 4L8DB 4XXCA 4RMUA 1F3DH 3MSPA 4HDIA 4GMSH 4GRLC 5C09A 5D1XB 3ILQC 4LLWA 4NQCB 2GIYA 2FJGB 3LB6C 4PJEA 4J23A 4IDJL 1EIBA 3G08A 1MFEH 2CUMA 3NFPA 5HHOB 4XHJC 4UIKL 35C8H 1QP1A 2DLIA 2XWJA 2BNRB 2PUQT 1IILE 4JVUA 4YBLC 2D2OA 1MI5B 1PSKL 5FYJE 2HVKA 3G5VA 3LDBC 3MA7A 2NY7H 4UT6H 4YDLB 1G7MB 4Y4FB 1S9YA 4LU5H 4NQED 1P4IL 1UG9A 1HILA 3RPKA 1MQKH 4JKPL 4EN3C 2Z31D 4XNMA 5MEND 4HBCH 4JFEB 5DO2C 2F54B 5C8JA 1BOGA 1KENH 1MEXH 4I0PB 1DN0B 1XCTB 5SV3A 3FQXB 3HC3L 1HQ4A 2LTQC 1UM6L 5CIPA 3S37X 5CJOL 2XZZA 5B22A 5F89A 4LKCA 4PV8B 2VLKE 1ORQB 1LEGA 2Y06L 3QDJA 1MCIA 1FLRH 1KCVH 3OKEB 5BV7H 3ZHLA 1W0WB 1D7FA 1KIQA 3GK8L 4FQXC 1P9MA 5TE6H 1A22B 3OKDA 1UXSA 2V6HA 1JV5B 3BZFA 1OAKL 1EFXD 1IAKB 2NYYC 4UAOB 1KCUL 3QNYA 4MNGA 3TO2A 1I1AC 1MH5B 3MV01 3TFKD 4MNHB 1TJIL 2P5EB 1P7QA 3PIQA 2ICWA 4U1LB 5IK3A 1Q8MA 1K5NA 2OR9L 4OZGF 2OM5A 2H32B 3P0YL 1DFBL 4XBGA 4U1SA 5C07A 3WJJC 2F19L 3VWJA 4OCYL 3BXNA 3HUJA 4XCYA 1YPZB 2WUBH 3D5OF 4P57A 3BDBA 2RCSL 1RZ8A 4NZJA 5L8JB 4KDVA 2IF7A 2NY4B 1B6UA 3KPQB 1M7DB 4LCYB 4OLVH 1WLHA 4P23B 1IGJB 1TVBB 4DKFH 1SBSH 2W9DL 1N26A 2VABA 3NZHL 1SEBA 2ARJA 1CL7I 3N85L 3QUMB 5F93C 1FC2D 2YK1H 4MCZA 2EE9A 3BO8B 3ULVC 3QUZB 4HKZA 3RAJL 4LSRH 1CLYL 5AUMB 4LVHC 4U6YA 1XGPB 1FPTH 2FX7H 1MF2H 3TN0C 4NKDB 2APVA 2Y5EA 5D7JC 1D3CA 5DRXB 4OLYH 1HXYB 4NKMB 3BIBX 1AO7D 4WTZG 4JRYA 4NRZA 5C0CD 2Q3ZA 4GSDL 4ZD3H 1HN1A 1AXIB 4MJ6A 5JPMB 4G9FD 2EDWA 1JPSL 3L3KB 2FLRT 3MLTA 1IKNA 4QHUB 4HS6B 1M1SA 1T0PB 1MCEA 1CF8L 3MFGB 3EFFB 43C9B 4G7VH 2NCMA 4HJJL 2B1AH 2PNDA 5DZNA 2IBZY 3UJIH 1E4JA 4ZYKA 4PJIF 5GRYA 3KPNB 4GUPA 1NC2B 2CKBL 1F97A 4LMQI 2OL3L 3DX8A 3ARGA 3ZYIA 1M71A 4GKZA 3FO9B 4UILH 4OKVA 3TVMD 3VFPB 5A3IC 3MRIB 1ZKAA 4ZFOL 3MRDA 3P4MB 1K8DA 1U58A 4HXAH 4KZDL 3IJSA 2UYLA 2VWEE 1IQWH 4PJDA 4HZAA 4PJ7A 3HI1A 4QGYA 5E94B 5LCVL 5CZVL 2HH0L 5A2FA 1KPVB 1B90A 3L3HA 5FA3A 5FECA 2K7QA 1UVQA 3V4UH 3MV7D 4LGPB 2NY1C 1J0IA 1XGYH 5F7YC 4J8RB 3IVKA 4L8SA 3ABZA 4IEFB 5T1KD 3VXRD 4K71B 1LEIA 3V0VB 4YDKL 3GSNB 4JRXD 5E08L 3W0WB 2W0PA 3E1F1 3GHEL 2F8VA 2EYRA 1AQDA 4XT1C 2YKLL 5GGVY 3VXNB 2QADB 5EOTA 5IJVA 4ERSL 4YE4H 1KEMH 3SKNB 1DP0A 5D2NC 3RZCC 5EUOB 2BHYA 1B4JH 3S5LG 1A6VH 3D2UB 4L3CB 1S8DB 2X6MA 2HFGH 4JO1L 3K8LA 1RIHL 5IHZB 2YPLE 3MLUH 1J8HE 2IBBA 1RZFL 3FQWA 2Y9RT 4ZAKA 3ARDB 1YY8B 5IT2H 3THMH 2RBLA 4YX2H 3V6BR 4UV4L 4E42B 2DQHH 3SKUD 3OJDA 3U4AA 4OB5H 3WSQH 5C0ND 1A6UL 2ZPKH 4Y19E 3MYJA 4PB9L 3QR2A 3K8MA 5AZEH 1JRHL 2H41A 2K9UA 3ULVL 1JGUL 1WEJL 5GJSH 4J3UA 3PGFL 5F1IB 4GS7B 3LN5B 4JFXA 1QRNA 5DK3A 5SX5H 1I8MA 2D7PA 3CFCH 5EU3A 1LE9B 3CDYA 2YN3A 5FYKL 2XICA 3VI4F 1FAKT 3T3MF 1FFOB 1H0DA 3VFSB 1XGQB 4PFEA 4X4XA 1U6AH 1YEEH 4NN5B 3ARYA 4ORGA 5KVDL 5ICZB 1DBJL 1YPZF 4YK4C 2PO6B 3MRMB 5HGHB 4RMRA 2HT4C 5HHQB 3F62A 4P5MB 3H7LA 4Q6IC 3Q48A 2EICA 3EOAA 1NBVL 3FL7A 1QFHA 5IUSA 5CBAB 3HFML 3GMLA 1IGFH 2VISA 1EEUA 1I7RB 4HAGA 5I6XC 3OB0K 1ZHLB 5D9SB 5TGBA 5D71H 3ZTNL 1N0XL 3HE6A 1ZVYA 3SPVB 5CUSL 1HIML 3NOIA 5D7LD 1GVIA 3ARQA 3PGDB 5GJTH 4OI8A 1YEFH 4WI6A 3DXAE 2DOCA 1NDGA 1DVFC 3NTCL 3VJ6B 3BEVA 5I75C 4NNYA 5CD5D 5JW4M 3SKOB 1KCLA 5GGQL 3Q6GH 4WO4D 3GMRA 4BSJA 1DEEB 5CP7B 2O5ZL 4DKEH 4HLZG 3MBEA 3O6FD 4AIZB 1QYGL 4PJXA 1BOYA 3OR6A 2CIIA 3SJVB 1OGAA 1BWMA 3V6FA 4MS8D 3GFUA 4YQXL 1WUNT 4XMLH 2XA3A 4LHUB 3TJHD 4HKXA 2X4SB 4BZ2L 3O3EA 3MLWH 4G8EA 1KN2H 2OLDA 3HZMB 2UY7A 1CDGA 3OG4B 5IHUH 2VLRA 5LWYL 2AK1L 1JHKL 3CIQA 2W0KA 4NO5A 4FTVB 2BSRA 2NZIA 1EAJA 3HPJA 1FZKB 1P7KB 3FQTA 3KPRA 3G6JF 1A6AA 4OGXH 4NHUE 4ZUVB 1B9ZA 2I5YL 4XC1H 4QT5A 3J8F7 1G7LA 1IEAB 1TNNA 4PRBA 1XMWA 4WI4A 5DHXB 5FXCH 1IGML 1OM3L 3TBSB 4BFBD 5JHLL 3ZTJH 2DQCH 4ELMA 3WKMH 3IS1X 3QIWA 4NDMB 4WJ5A 1I1FB 1F2QA 4YHNB 1T20B 4P0DA 3WN5C 2J8UF 3R06A 2X10A 4HT1L 3FN0H 4YHYC 2W65A 1BJMA 4EUPB 1FGVL 2Z31B 3RVXC 2FO1A 1MCQA 4J6RH 1UT9A 5EZOH 4YHKL 1MCOH 1AI1L 2AAVA 1FV1B 4O9HH 3VRJA 1RZGA 2MSPA 3HMWL 3QIUA 4DGVH 4EZMA 4D2NA 2XN9D 3QPQC 1PG7X 3CJJA 5EC2B 5I71B 1FG2A 5DJZA 2UVFA 2FZ3B 4AY0A 4U7KA 2GTWB 3MRKA 2D7TL 5JTWA 3LKOB 5D5MB 1QBBA 2HTKC 4KMTL 3PJSB 1HHHB 3VW3H 5DF0A 4P9HC 3CSPA 4U31A 3HE7B 1T89C 4L8CA 4CL7A 1OW0C 1VENA 5KSVA 3EKCA 3M17B 5C0JB 5F71A 5EORH 2VQ1A 2MPAL 1EFXB 2VDRL 3CPLB 3DYOA 3CFEA 2DRUA 1F4XL 2C3VA 5C71A 3QNZA 5GGRB 1BFSA 1N7MH 2Q8AL 2DTMH 4JANA 3DRQA 4LK4A 3GSRA 5SX4I 3P11H 1Q72H 3U7WL 2Z8RA 1ERNA 1RZ7L 1MJJB 3D39E 3BGFC 1NEZG 1YYMH 1A7PL 2CKNA 1P1ZA 1MCWM 3BPNB 4M5YH 5FCUH 1A9BB 2I25N 1G1CA 1JIBA 4ZNEE 4J7RA 2BOCA 3ECBA 4X6EA 3WXVL 1MFBH 3K2UL 3UROR 4KROB 5LBSH 2E9JA 4OFIA 4MAUL 5TDPA 1V8HA 4IM8A 2D9QB 4NSKB 4DGIH 1UWEH 4UOJA 5D70L 1F90H 2EKJA 3OTTA 5D7KE 4JO3L 5TF1H 1NL0L 1BVKB 2VR9A 2X4PA 3A6OA 8FABA 3ULUE 3FQRA 4BK5A 5EIIB 1YA5A 2DN7A 2P5WA 3CVHA 4NT6B 1NCBH 3A6BL 2JJUA 4LGSB 4C83A 2W60A 4WV1A 4MD5A 1MREL 1KCSL 2R4RH 1CL7L 4HW6A 3QULB 1TIUA 3VXSD 5FOJA 1I3RA 4PY7B 2BY3A 5HI5C 1CFSA 3RHWF 1RFDH 4WW1B 5IF0A 1EBAA 2OI9C 3RJDA 2VH5H 1KF9B 2VLKB 3N06B 4FZ8L 5KTEH 4DW2L 4IOFD 3O4LA 3QH3B 1Z5LB 4OI9A 4OUOA 1FDLH 3MX0A 3H9SD 4OM1L 4KKCD 5C0CB 3O6MH 3WS3A 5ACZA 3C08H 4G9FB 1ZS8B 3IDXL 3MODL 1RUQL 3P77B 2ZUQC 4J3SA 4K9EH 5GGVH 5I1DA 3LKNA 2VDML 2KKQA 4NZUH 4EIGB 2BVPA 4XPGH 1S5HA 2FHCA 3ARZA 2YUZA 4F7EB 3RVTC 3U30C 3HAEA 4UV7L 4P2OD 1GSMA 3D0VB 4J3VA 4ZOAA 3LN9A 3KYNB 3L7FB 5I30H 5HSFA 1LK3L 2DB8A 4ZTPL 4PBXA 4WWKC 4JHBA 2YEZB 4DUWA 2DDQH 3MLVL 1HHIB 5I8OL 4G6KL 3DI2B 1A8JH 5GSRB 1MCRA 4RFNC 5F6IC 2AGJH 1BVLA 4WFED 2H2SD 5C7XL 1R24B 5JIPA 2AABL 3QI9D 4D3CL 4U1NA 1N4XH 4O4YH 1SYSA 4CJ0A 3OQ3B 4PJHA 3S36X 4JREC 4G5ZH 4Z7NE 3W9EB 4KQ4L 2R23A 1A7QL 3VFVA 1OGTA 3MV7B 3WUZA 2X1XR 2DM2A 4KI1A 5T1DH 2V5RA 2QQLH 4HFUL 3TWCH 4HK3N 4X6FA 1FLTX 2R2BB 2AK4E 1ZANH 4JM4H 5H2BA 5DJAB 4JRXB 4XBPB 3CXHK 3IJYA 4BQBA 4M62H 4Y5VB 3WFDL 2EH8H 5TDNA 1ZE3C 2NY3C 5C0GB 4ONGL 3OAYK 4HCRA 3TIEB 2MKWA 1KTRL 3F58L 1G7QA 1QSED 2CLZB 1I3GL 1MHEA 3S7GA 3TM6A 1FZMA 1FE8L 1DBAL 2VDKL 4R7NA 3UZQA 1HHJA 4FQCL 1T1WB 2X1PA 4OCSL 1LP9E 1RUKL 2IH3A 3T8XA 1SEQL 1KJMB 1QFWI 4PGDB 3VGAC 4QXGL 4PRHA 2CLVA 5DQ9B 5ERWA 1R5WA 2AJZB 1KLGA 4R0LC 4XP9L 2DAVA 2VDLH 3P73A 4DVRH 2BK8A 5GS1A 4N9GA 2ORBL 5IHLB 4GLRH 5IM7B 3TLRA 5DLMH 2CRYA 4RGNC 1MRFL 4NOFA 2XTJD 4TUJB 4LSVL 3TNNA 5IMOB 5ACLA 3C5ZD 2HT2D 2AQ2A 3X3FL 2X4TB 4MDJB 3N9GL 1BZ9B 3QXDA 4F37K 1UQSA 3VFWA 1WZLA 3KPLB 3B43A 5E1AA 4Q2ZA 1A7NH 5CEYA 4CVZA 1IC5H 2IAMC 3BKJL 3GUTB 3KLDA 4AM0A 4R4BA 2QQNL 2KH2B 4NWUH 1MCKA 3VFRA 4NJAL 3OKLB 2A6JB 3QAZC 1YDPB 1U8PA 3I85A 1K2DA 2AJUH 4OZHE 3CU7A 2R8SH 4NUGH 3NA4A 1EMTL 4KDWA 1NBQA 4JRWA 2GUOA 4EOWH 4TQEL 2DQUL 3BMVA 4X9IA 4RAUA 1KTKE 3H9HB 4CBPA 4PLKD 1F11B 5AG8A 3GB7B 4APQA 2YPLB 3M45A 5DC0A 1J8HB 5C86A 3R8BB 5KZCD 1QHOA 2EDKA 5CBEA 4LNRA 4N0FA 5IP4A 3EJYC 1HZHL 4A6YB 3IDJA 4EBQL 3LEYL 5D8JL 1ORSA 3BZEB 3EYSH 4Y19B 3MFFB 3O6FB 3BWUC 1EV2E 4PLJC 3INUL 2A6IB 1Z0MA 2ZUSA 5KVEH 5KSBA 3VXTB 4P3DA 4DTGH 2AJVH 1UM4L 4LCUB 5L8LB 1JNNH 3MNWB 4FQLH 1PQZB 3B9VA 2ADFH 4X5XB 4KJWC 2J8HA 4PP1D 3U7YL 4BH7A 1ZHNA 2DBLL 5CSZB 2BMKA 3FRPG 1T83A 3S5LB 4C56A 2IANA 2Z4QA 4M03A 1MJ7L 2BSSB 3CXDH 4ZO9A 5FIEA 1XF4A 1K8IB 1XF5B 3OJVC 4JFDA 1KTLB 5I1AB 4HQQL 1XIWD 1ZVSB 4KK6C 1VFUA 4U2ZA 5E03A 1NCTA 3QRFM 4UTBH 3QCTL 5EC1A 4POUB 3KPMA 1B0GB 2GSGA 5C9JA 4LCWE 2UWEB 2SEBB 5DEZA 1IGIH 1JN6A 4LHJB 4KI5C 4POZC 4F7PA 3KDMB 4R4FL 1HQRB 1D9KD 1E27B 5DFVC 2AV7A 1F3JB 2DQDH 1GHFL 3SQOL 4NZDA 3LS5L 1NCWH 5BZDA 2D0HA 2AS5M 2I9TA 4R2GC 2A9NL 3VFMB 4H26B 2XN9B 1KN4L 4JLRB 4F57H 3JV0A 3DOSA 1L7IL 3BT2H 1MCCA 1WBZA 4Y1AE 3U36B 1XGRB 4AH2A 3QO0B 4FABL 2Y07L 5EUKA 1IMHC 3DUHA 3DURB 2F9BT 3NVQA 4WWID 2MCPH 1P69B 5IB2A 3IU3B 5F21B 3PP4L 2KZ1B 1A6ZB 1FZOA 3MLXL 3VXMA 4HIXH 4XMPL 1CTOA 4F2MB 3QPXL 1TENA 4PJGB 1P2CB 4ZS6C 1ZHBA 2R0WL 5IEKB 4Z0XB 4YBHA 3E3QA 3VFGL 4R90H 3V0WL 3G5YB 2HG5B 3WKNA 5IG7B 4MWFB 4OZIB 2NX5A 2BSED 1QLFB 3MV9D 1UH3A 4NHUB 3GMNA 3L3GB 5F7EH 2AJSL 4P2QD 2WW8A 5L2KD 3TP4A 3CLFH 4AMKH 3IRZA 4LLQA 4AQOA 3LHPH 5I0ZA 1CE6B 2ZCKH 3PQYD 1PYWA 5E1HB 1IBGL 3CDFA 3VFOB 1FNEA 1JMXA 1BM3H 5DRZB 3BDXA 4NO2A 4L3EE 4D9LL 5IB1B 4TSBL 4JFQA 5HGAA 4BZ1H 1XFPA 5JR1H 2BNQE 1AY1H 1SJEA 1L6XA 3G5XB 1ZV5A 1S7VB 4X5LA 1FORH 2QL1A 4MVBD 1IM3A 3CVHL 3VXSB 4GAYB 1AKJD 4X83A 2VN7A 1UXWA 1JYVA 1IGTA 3CAFA 4GW5A 3EOBA 4PLNC 1PLGH 4MX7B 3VWKC 2VN4A 1RIVL 1CGYA 3T0DA 1IT9H 4U05A 4AYFA 3RGHA 3QXAB 4PV9A 4G8GD 4NWTH 5TFSH 1KCKA 1YEKL 1TMCA 2HT3C 4TSAH 4BJLA 1MSPA 4IMKA 3TBTB 1DDHB 1KJ2B 3DX9A 4FQHB 5DTFB 3MR9B 2FO4B 4KJQD 2XZAH 1SJXA 3VD9A 1A7OL 3V9FA 3TESA 1RZIB 4PR5A 5JOFA 1AGDB 1AFVL 1NANH 4H1LH 2EIZB 1R3JA 3FT2B 3G5ZA 3OL2A 5DJ2A 1MFDH 1YNKL 3SDXE 5CEZL 2AXJA 1INDH 3HC4L 4KY1L 1NBZA 2ESVD 1CGSL 1VCAA 3DX6B 2B1HL 5IVXE 1X4XA 4RBPH 1RMFL 2BRQA 4UIMA 2ADIA 2R2EB 1ED3A 3HI5H 1R0AL 1D5IH 1NFIA 2Y7QB 1JPFB 2CD0A 3S9DB 3V5KB 4M48H 1A9EA 3T0ED 4U0QB 3MCKB 2R56L 4GRMB 5JO5A 5I1EL 3RWGB 5CGTA 2J88L 4HS3A 5IMLA 4F7MA 3L3DB 4P4RA 1WK0A 3L5WB 4ONFH 1FO0A 5KVFH 1GYAA 5HYSG 3D0LA 5E70A 3DIFA 4UOW0 5CEXB 2GQHA 1KYOJ 4J3XA 1KIRB 4L4VD 4ZPTB 1JTOA 2BZDA 4ZDHB 3AM8A 3MRGB 4Y4HA 3WLBB 3MCLL 4KTDH 1NEZB 1BFOA 2YD7A 5ICXB 4LPXA 4ACPA 3WIIH 4QLRA 1EA9C 4MA1C 2OP4H 5ISZA 2IQ9H 3MRNB 4P5TB 4HCRL 1JPTH 3CZFA 4Z7WA 1ZHKB 3RWFB 3MZGB 2E7LA 3BKML 3EDDA 1CFNB 4F3FB 4M1GL 5I1CL 5I15L 4GAJL 4L4JA 3DRTA 3P0VH 1DSFL 1OP3K 4FFYL 3HNSL 2OK0H 5H37H 5DMIL 1T66C 1RPQA 4F8QA 1QFWL 2X1WL 4M61B 3WEXB 4WEBH 1F6AA 2Z93B 3KNBB 3BX7C 5CINH 1CICD 3LMJH 4HIEA 1A1NA 4WW2C 3L9RB 5CP3A 4GQ9H 5D7SL 3NPZB 3SGJA 4NUJB 3EOYG 3N0PB 4TVPE 1X4YA 5J3HD 1BF2A 1NLBH 3I3EA 3C5ZB 1PZ5B 3IFOB 5IFJA 25C8L 3DVNB 2CIKB 3LEVL 3GGWB 2F53E 4N0YH 5KJRH 4TVSa 1T1YB 1MJ8H 4OD1H 5EU5A 4IHOB 4NKOA 4LF3B 5D2LE 3FN9A 5EA0H 3UTTE 4NM4L 1UC6A 4PJFE 5DVMA 4ZFZB 4GRLD 2IQAB 2AK4B 3ILQD 3B3IB 4DVBA 2V7HB 3HHRB 4ZUWA 2BDNL 4UTAH 3FQUB 2G2RB 1WWWX 4I13B 4M7ZB 4UNVA 4EDXA 3GBLA 3NCYP 2NZ9C 2UZYB 3E3QC 1E4XH 1Z0NA 3WDJA 1JF1A 2ATPA 5J1SC 1YZZA 5B4MD 2M1KA 4Q9QL 3F5WA 2GJ6B 4D0BA 3PGCB 3CCHA 2BC4A 3QZWA 2EC9T 3C5JA 4U7SA 4XP6L 5KN5A 3RL1A 4YPGA 3UTPD 5E2JA 3S96B 5KZCB 5HYJE 4Q97A 3RKDD 1QFPA 5EZIL 1OTSC 2R69H 3NCBB 4HUUB 4J1UB 1N2RB 1HOCB 4QTIL 3HN3A 4LFHG 3VDBA 3GJFH 3CVIH 2MNUA 3IT8D 3OKNA 3ULVE 2WWMD 5C2BH 4OV5A 2BNUB 3WO3B 2ZSWB 4IIQB 1TVHA 1JWMA 5SX5K 1URLA 4LQ1A 5KSAD 4QY8B 1J0YA 3EO0B 1XT5A 5T3ZL 1FNSL 3GBNH 4CJ1A 5FYKE 5IQ9B 4GKSA 1JVKA 1KGCD 1QSZA 4OD3H 3HS0A 1YMME 4KRPC 3UTSA 3NA9L 2JCCA 4XNUL 1JZ5A 3JTCA 4S11A 4NKIL 5J11B 3DARA 4JHZA 2ZJSH 3ZKNC 4FN0A 3AREC 2Q86B 4EI5C 5D1ZA 4HC1L 3V52L 5BW7A 1I1AD 5DWUH 3L6FA 1LWRA 3TF7A 4XNYH 1QSFD 4G3YL 3BPCB 2Q7YB 2I60L 4PRPA 2AXGA 3MXVH 4XGZB 1NFDB 3MJ9H 4DCQA 4HWEL 1FAIL 5KS9B 3ULUF 2GT9A 3QEQD 1Z3GH 3OJ2C 2EKSA 4KPHL 3REVA 3WNMA 4NJ9H 3LQAC 4NQVB 2VL4A 3QIBD 4KRMB 3QQ4B 4WFFE 1D9KB 2DQGH 1YEGH 4PG2A 3IETB 2V7NB 1GGCL 4PRIA 5GRUL 4XCNA 2J6EH 2NLJA 5IB3A 4Z9KB 2DQEL 1M05B 4LCCB 1FFNB 2A73A 3MREB 2AEPL 2R1XA 1KG0A 4QOKE 4PB0H 4JFOA 3O2VH 4CU6A 1FYHB 1FGNH 2WM0A 3TN0D 4L1DA 1X9QA 1GIGH 2R1WA 1RZKH 4LVNB 4HMEA 4R4NC 2ID5A 3RY6A 4RWHA 1CDUA 4YXHH 1FL3A 5FGCB 5L88L 4R26L 5CILL 3PL6A 4NQDA 3BHBA 4JB9H 4OCWL 4BELD 5C0EA 3LSOA 4LBEA 1D5XB 4LIQE 4ODWB 2R29L 5D2NE 5JMOC 4HS8H 1I1YA 5JLZB 1WFTA 2VDPH 4JZJA 5L6YL 2P8MB 2WUCL 4HK3J 2V5TA 4Y4HC 3JSSA 4XC3H 4KUCD 3ARBA 3MV9B 1U8NB 3MXWL 4ODTL 3D3VA 2D0GA 3N1MC 3S35H 4P2QB 4ZTOL 5L2KB 4H8WC 5D1QA 3VGDA 3BEWA 3FO2A 4P2RD 3B9KB 2XFXB 1YY9D 4IRJB 3U9PL 5HJ3A 5C0RL 4LFHD 1U8OB 3QA3B 2XRAH 3R4DA 4IJ3C 1RVFL 4Z7NF 2KBGA 5EO0A 5EULV 3HG1E 1A3LH 1UCTA 1BEYL 2QQKL 4AEIL 3ROLB 4MAYA 4O02H 3AC0A 4JPVH 3PWPD 3DTXB 5MI0C 5JNYB 5K9QI 5FUZL 4NPYB 1Y6MR 2ADJB 3A6CL 5GPRA 2OZ4A 4ONHA 5IBTL 1VACA 3JTTA 4G7YL 1NGWB 2NY1D 4Y1AB 4ODVL 2YOCA 4HJGB 3HRZA 2DWDA 3QFJA 3E2HA 3OPZH 1JTTA 2G75A 3FO1B 4M1DL 3TO4C 4GJTB 1LO3L 4PJCA 2JELL 5IMMA 3OX8B 4P5KA 2NTFA 1Q9LB 3ARVA 4URTB 1U91A 5A43C 4MNGE 1JGDA 4YAQA 2ZCHL 4DKDC 5ITBL 5KW9H 2X70A 3QWOB 5ID1B 1LP9F 5C09D 1E6JL 3M8OL 4ETQA 1OTTC 4M6ML 5F96H 1HH9A 5J12C 3MOBH 3FONB 3P4LA 1RY7B 4P4KA 5DRWB 2CRZA 5AD0B 1CK0H 3LQAL 3VD4A 2OYPA 2FJFA 1KSRA 3SN6N 5C0IA 3FFDA 2VYRE 2ZCLL 5FO7B 4M93B 4KZDH 4DN4H 1MY5A 2Q6WA 2ZOKB 1RJLB 5A16A 4L5FL 1JTPA 1QVOA 1XGUB 1U93B 3F12A 3TA3A 2X9XA 1PKQE 4QHMA 3T0EB 4KTEL 3FCTA 4L3EB 2E27H 2C3HA 4HKJB 4LEXH 4TVPH 5M95B 4D9RD 1DBMH 3VD3A 4TUKH 2I26N 3LEXA 3SOBL 4QHLB 1D5ZA 2MMXA 2PW2A 4YDLC 3L5IA 1HCVA 2QR0A 2BOBB 4GW1B 3SO3C 1BAFH 2NY5H 1FO0L 4G42B 2DIJA 3QDJD 1SM3L 4X99B 1CBVH 3WFHA 1KOAA 2XWTA 2JJVA 1IQDA 2YPKB 3ARXA 4OZHF 3EUUA 4LCIL 1S3KL 5E8EA 3KPSE 1EJOH 5EZJB 2C4FT 4I0PC 3LAFA 4ODHL 3QQ9C 5E6IB 5IQ7L 3AB0C 3H7BA 3ORJA 3SGDH 3UJTL 4ALAH 4JZOB 3NN8B 4DN3H 4DOHE 1WVZA 2VB5A 5C08A 1IGCH 1CXHA 1WCBA 3IKCB 4G43B 4BYHA 1P7QD 3EAKA 4N0UA 2AQ3A 3TF7C 3F7RA 4H8WL 2L0DA 1CI5A 3SDXB 5EOCH 3U7AA 2KDGA 2C1PA 5C0AE 1TQCC 5I18H 3DSFL 5C07D 3VWJD 3B4NA 5DEGA 5CWSA 5D7IE 4Y4KD 2IWGA 5IMKA 3O2WH 4UAOC 1FVEB 4E5XA 1BZQK 4ZODA 1H15A 1CE1L 2IPUG 1HKLH 1I7ZA 4S0SD 4BSWA 3V5HB 1F2XK 1DQLH 3MQIA 4U1KA 1IAOA 4FQPA 4Y8DC 4ZO6A 1CLOH 5DFWH 2YA1A 3PNWB 4G8FB 1FIGH 1MHCA 3ME0A 1IM9A 3V6OA 2H1PH 1D5BB 1HXMB 1DQQB 2VLMD 4JJ5A 3TYFA 1YEJH 3BKYL 3FOLA 4G9DA 5EPMB 4OLWL 2PCPA 1ONQB 2NY4C 32C2A 1MQ8A 1MCJA 5JUEL 4IRZL 1CD1B 3PDDA 4MXQA 2P43B 2VZVA 4GRLB 4P23C 5F9AC 1NQBA 2JK5B 2R0KH 4OQ1A 5EWIL 3SDAA 1AGEB 4NHCL 4TNWF 1A14H 3O3DB 5HGBB 4AJ0A 4JRYD 3LKSA 4OQTH 5E2TH 5TQ0H 2AJ3B 1MLCB 4E9LA 4LPYA 3IF1A 5FYLL 1T0NA 1AP2B 4LARL 4JN1L 5GRJH 1T7YA 5CP3H 3LDBB 3ZTNH 4JFZH 2KQNA 2CKBB 3QDGA 3EIFA 4WU5B 3P9LB 3ARBC 1OD9A 4M6OH 1ZLVH 2OL3B 1VERA 4EN3B 3BDYH 4YHPB 4KFZC 1QR1B 5AWNL 4R96A 2VXQH 2PYEE 1FQ9C 2WP3T 4ZFOB 1IGYA 3MLYH 5JIHA 3ARGD 4YNYA 3CFDA 5DJ8B 3H3PL 1DLFH 1UWGH 1FCCA 4FXKA 1PEWA 4XPTH 3UMTA 1KLFA 4FQIL 4NQEA 3MRQA 5IBLC 5FO9A 5I17A 3FT3A 4PS4H 1QBMH 1KT2B 2HTKD 2R4SH 4UT7L 2PXYC 5KSAB 3L7EA 1HH6B 2I9LB 4N8CH 1JNHA 3SE9L 3PWUB 4F58L 3UBXA 3E8UH 3MRCA 5DHYA 1KJVA 1CVRA 4KZEL 2A6KB 1N6QH 1TPXB 1ZA3B 4I77L 5B21A 4CRPA 4LIQH 3E2HC 3VRLE 4M5ZH 1J0HA 4U6XA 1I1AB 1DCLA 1KB5L 5HI3D 1SYVA 4RISL 3VD5A 5DK0A 1YEHH 3VFNA 1J18A 1QSFB 3CSYB 1UYWH 3ZDZE 4OCRL 2Q3AA 3CFKB 3PWLB 4OGZA 3FFCE 4DAGH 4PJ8A 2VXUH 5DD6B 3MNZB 3ZT6A 3QEQB 5HGDA 3FB6B 4KUZH 4X6DE 3VG0L 3KWWA 2G9HA 3QIBB 4WU7A 4JAMA 3V4VL 4DQOL 4JQXC 1W72A 4QNPE 1YMHA 4OLZH 3RU8H 4ZAKD 2BRRH 1AR2A 2WK2A 5DJ0B 1JZ7A 4UMGA 3E6HB 3GSOB 3MTRA 5MERB 4OUUA 1NPUA 4LSDA 5TE7H 2HFEA 5D6CA 4XWGL 4KQ3H 1Z9SA 4G8IA 5DHVB 3O41A 4MJ5B 2UVEA 4LVHB 1OGAE 3TN0B 1EAPB 2NXZC 3VXPB 3JWOH 2WBKA 5DR5L 2G5RA 5D7JB 2NXYC 3EYFB 1S5IH 1CIDA 1JBJA 4JPWH 1CS6A 2FB4H 1CTNA 1QRND 1YMMB 2ICES 3MOQA 5T5NF 3WFBH 1KXVC 3SDXF 3OHXA 2CMRH 1IEHA 2NY2C 3S37H 4QYOA 3NABH 1U92A 4OFVA 5IVXF 1EDQA 1T04A 2ATKA 3RVTD 2DD8H 5C3LD 3B83A 4HWUA 2FYYB 3C6SB 2VZ1A 4XPBL 3ZZ1A 3T04D 3MRHB 4JCMA 1C8PA 1KTDA 3O4OC 4P2RB 3FZUD 5IROA 4JFPB 4ZXBA 3B2UC 5LAXA 1XF3B 3AFLA 3MLRL 3Q3GA 5EO1A 1CVSC 3L3IB 1AHWA 3CUPB 4K2UH 1ZTXL 2X44D 2GK0A 4FXGA 1GZQA 3O0RL 5FK9B 4NO3B 2XPGB 5JQHC 3HE6D 3FB7B 1FJ1B 2PO6C 4HXBH 4RGNE 4Y5YA 3NCFB 1K3IA 1OAXH 4Z5RA 3CU1A 2A6DB 3PWPB 2R0ZH 3IRPX 5EO9B 1MIML 1DE4A 4C54A 1CZ8L 2EDBA 2X4UB 4KK5D 1LHZA 1HHKB 3DGGA 3F7YA 5CFHA 3WNLA 3O45A 2VUYA 1Y18B 4WCYH 2NY1B 1HSAB 5EFIA 3MA9H 3MBED 2PKDA 2XA8L 1NGQL 2W59A 4X4ME 5EIQA 3SCMD 1DQDH 2BVYA 1OAQL 4LQFH 3HZVA 1UB5B 1JGLL 6FABH 2J2ZA 3B9AA 4BSVA 3R1GL 3O6LL 4I3SL 4HDIB 1PVHA 2VLRD 4PRNA 3RVUC 4PJBE 3RGVC 4JDTH 3GMPA 5D2NB 5ETUA 4PPTA 1QLRB 2YD9A 4X5WA 5ANMA 5I66A 4LLWB 1ZSDA 5GSVA 2EDLA 3B9EA 1R5VA 4MJIA 3KPRD 1EHLL 2NR6D 5HD8D 4XXDA 2IBZX 43CAA 2XWJB 2FX8L 4GBXA 2E5EA 1KLUA 1NGYA 4K94H 1Q9WA 3MGAA 1C7TA 2OZ4H 3QIWD 3G5VB 2FNBA 3DWTA 3MV8D 3MA7B 4XMKL 1YN7A 1S9YB 3TCXA 1VFOA 3HAEG 3BP5A 1C12A 4X7FC 4F7CA 5C0FA 1QSVA 1HILB 5K9OA 2I07A 4V2BA 4XNMB 4PJ9A 5E2WL 3RL2A 4YR6A 2C9AA 3HC0A 4ZUTB 5HHPA 1DBBH 4P9HH 3KYOA 4KVCH 4OZFH 5C8JB 3QIUD 1BOGB 1V3KA 5D2LF 2QKIA 4ODUA 5SV4A 5F7HA 4PJFF 4OIAA 1G9EA 1I4FA 5CJ8A 5CIPB 2H9GB 3B9DA 3SE3C 5F97E 5F89B 4K3EL 4LKCB 3ZKSD 1JFQH 4RMQA 3K0WA 2Z31C 1I3VA 3QDJB 5AAMA 3RUGE 3MMEA 5A1AA 3T0XA 4NNPH 4YK4B 4BA8A 4ZPVB 5IR1B 3BZFB 4OIBA 4CDGC 2F15A 4M7LL 5I71C 3HMXA 2XT1B 2ICCA 3QNYB 4MNGB 3DV4A 4Q6IB 3TO2B 2H26A 1AJ7L 3QDMA 4XNXH 3MACL 5F1NA 1GRWA 4RBPK 1P7QB 1DZBA 5IIEA 3PIQB 1F4WL 4MQXC 5IK3B 4KI5E 4GQPH 5I6XB 1K5NB 4Y5XA 1FC1A 2FJHA 4DGYL 4XP9H 4XBGB 5C07B 3CH1B 1NCCH 3QWRA 5AYUH 1R5IA 3ULVF 3VWJB 2YMXL 2P24A 4AEFA 1DVFB 3BXNB 3HUJB 5HHMD 3PWNA 5MHSE 1BD2E 4RFOH 1RZ8B 2C3WA 1WT5A 4OZ4A 1ZLSH 3TFKC 4F9PA 4ZSOA 1YQ2A 1BQHG 1PKQB 1FZJA 4H88L 4UQ2A 1TETH 5E2VL 1FVCB 4OIIL 5F7KC 2WSKA 2VABB 2P5WD 2Q20A 1IFHH 1SEBB 2ARJB 2M26A 2R2HA 4JGUA 5D7LA 4XCCL 4P3CL 5LXGH 4MCZB 1E4KA 1XGTB 4HKZB 2CJUL 4U6YB 3DYMA 1YECL 2AXFA 4ODBD 2DJ4A 4YC2C 2WY3A 4YBQC 1SJHA 3I2CH 1CGTA 3FRUA 5I74C 3ROOA 3X3GH 1P4LB 3O4LD 3OKKB 5J1AA 1RD6A 4HF5L 4DZBA 1QD0A 4X80H 1YQVH 3H8NA 4MJ6B 4C59B 2B4CH 1YNTB 5DT1L 3MLTB 5EBMA 3BH9B 5CEZD 4DOHB 5E24E 1UGNA 2VLJE 4WIQA 3WN5B 2DQTH 3QHZL 4YHYB 2JJWA 2GITB 5DSCB 1VESA 2LU7A 3WXWL 4GUPB 1B0WA 4LRIC 2FR4A 1CFVL 2YRLA 4PRHE 5C0AB 3E0GA 1NC4A 1G7JB 5DRNA 1AC6A 1CR9H 4GKZB 1YEIL 3TYGH 3IFLL 4OKVB 3WCYA 3RWCB 1C5CH 1B3JA 1D5MA 3GKWL 2XZCH 5HBBA 1K8DB 1U58B 3IJSB 2A83A 1R3KA 1MFCL 2UYLB 3CFBA 4PTUA 5E9DA 1JWUA 4RGMC 5F7DA 4Y5YC 4IS6A 4JFYA 4N8PA 3TT1L 5HI4D 2DF3A 3MNVA 4NN7B 3BKCL 3BOVA 3IU4L 3L3HB 1QLEH 4LSTL 3IGAB 1UVQB 2VSCA 5HGGS 2VERN 5EBLA 3TVMC 1Y0LA 3TT3L 2EDDA 1VGEH 1CD0A 1S7RA 3T4YA 4PY8I 2F5AL 1UFUA 4L8SB 2VDOH 4Z7VE 1T22A 1VEOA 4X98A 3MOAH 1ZWIA 2NW3A 4XP1H 4NNXA 5K9KA 2XWBA 1AQDB 1JYNA 3L5HA 5F70A 2O5XH 5EOTB 2EE6A 4XAWH 4EKXA 5BXFA 5IESH 1K6QL 1QQDA 4XNQB 3S98A 1CXEA 3ZYOA 3SO5A 2L7JA 4PP2B 5FGSA 4NBXB 4TRPH 4PJAE 4NP4L 1C08A 1JI1A 4HIHA 4PGEA 4GBXC 3FQWB 4WI9A 1LE5A 4Y5VC 1OVZA 2KUTA 3VCLA 1KXTB 1W72L 4JPKL 3S8WA 2PYEB 2DLFH 1BHGA 4NZTL 1ND0A 2CXKA 2YZ1A 4NO0B 5I1KL 1M6OA 1TTGA 1K3ZA 5FUOL 4J3TA 4ENEC 3X14A 2VL5A 4EXPX 2VXTL 2ZG3A 1C1EH 2GK2A 4YXKL 4WDIB 2WBJA 2OI9B 1I9RL 2R9HD 1J5OH 5DQDH 4NC0B 4YHIA 2VC2L 4JY5L 5E99L 4JFXB 3JZ7A 4CN1A 1GAFL 1YNLL 2Y5TA 4E41E 1QRNB 3V0AC 4DUVA 3HNVL 5EU3B 3LV3A 1C5BH 2XACC 5C0NC 3VFTA 4LPUA 1I75A 3GSXA 1PG7H 1H0DB 2L7UA 1BJ8A 1FBIL 4ORGB 1F4YH 4PJ5A 2G5BA 3MCG1 3PHOB 4V1DE 1ZA6A 4GXVL 2VUOA 3MRPA 1R3LA 2GCYB 2FCBA 1CCZA 5DD0L 4FMFA 3EOAB 2ILLA 2FWOA 3G6AA 3GMLB 2D4FA 4ODSH 4X6DB 1RJYA 2VISB 5SWSE 4X7SL 5ENWA 4LL9A 1TJGH 4Z7UA 2V2TA 3HE6B 4APQD 1P84K 1ZT4B 4RFNB 5F6IB 5CJBA 1MNUL 3MYZA 3OJMB 4YDVA 4XB7A 1NDGB 2D4DA 3GMOB 2LAAA 4GG6E 1AQKL 3BEVB 1XR8A 3SDCA 4NNYB 4JREB 3QEUB 4HUWA 4LEOB 1L4IA 4HUXA 3TBYB 2EXYD 1ODAA 4QXUL 4WI2A 5EU4A 3GMRB 4JO4H 4XHQA 5C0DA 5BS0E 5T3ZD 2UUDH 4ZS7L 3MBEB 2H2PD 4WUUE 4AG4L 4JQVA 5JQ6L 3TIDA 3OR6B 4L9LA 3QG7H 1OGAB 1DBKH 3O3BA 3HR5B 4X8JA 4P3WA 4MNQE 5HY9A 1E4KC 4QRRA 3O3EB 1AFVH 1S7TB 5CD5C 2NY3B 5DJXB 3QXUA 3EYUL 1KEGH 3E3QE 4WO4C 4A2LA 4HIJB 4NO5B 5E8PA 1JF5A 5ILTL 3X11A 2BSRB 3MJ6A 3HPJB 3O6FC 4OZGA 4R7DA 3FQTB 3GMQA 4C56D 2IAND 1II4E 5JXAL 5D7IF 1T3FA 1AE6H 1XZ0A 1A6AB 5E8DL 3WJLA 1NDMA 4MS8C 4JFDD 1H8OA 1MFAL 4QT5B 2CDFA 3TJHC 3WUWB 1O5DT 3EW3B 4PRBB 7FABL 3EGSA 1VPOH 4ELMB 4R8WL 3S88H 1RIUH 5ESVA 4WJ5B 2OR7A 2FIKA 2PTVA 3U1SH 2W65B 3BMWA 5EU7C 5IGXL 5LG1A 1JF6A 3D6GA 2JB5H 4QRPE 2CSPA 1NAKH 3PDGA 4LSQH 4PGBA 3VRJB 4RGNB 3O3AA 1QFUH 3QIUB 2AV1A 5DS8A 3RTQD 3NFSH 1UZ6E 1CIUA 4X6CE 1F58H 1KC5L 3HCVA 5SWZE 1FG2B 3R0MA 3WFZA 2KL6A 1A1MA 3T2NH 3MRKB 4U49A 3C6LA 2FHFA 2Q76B 2EIDA 4JHAL 4WRLA 1SHMA 4MYWB 2FSEB 5ESAA 3LPWA 2IAMB 5JW4N 4MXWL 1NMAL 4N5UA 1GGYA 3AXLA 4FQJH 1GGIL 2P49B 3V4PH 1YYLH 3VXMD 1IC4L 3O3UN 2VQ1B 1CDCA 1OAYL 2GEEA 1U8KA 1H3WM 3S36H 3QAZB 2YSSB 2IC2A 3FB8B 2C3VB 2DKUA 3QNZB 4JANB 3DRQB 3GSRB 3REWB 3HMXL 4PJIA 4CW1B 4LASH 2W07A 2IPKB 5EU6A 3RNKB 3N50A 1P1ZB 2UV3A 2NX5D 3D85B 4FG6D 3RP1A 5JHDA 1FYTA 3BJ91 4XVJL 3WIHH 2EC8A 2BOCB 3ECBB 3VXUA 4RIRA 3ZE2E 4TNVF 4ZMAT 3A0OA 1D6EB 5TDPB 2ZUUA 2AERT 3SGEH 1TCRA 2JJSC 3JWNC 3G04A 3NAAH 4RMTA 4S1SH 2BXZA 2Z9TA 5CCKL 5F9OL 4K3DH 3OKYA 1BF8A 2X4QB 4XZUA 1M4KA 5IKCA 3U0TB 2P7TA 2NW2A 4L8DA 8FABB 1KPUA 2XKNA 4U6VH 2VDNH 4YHLL 3CVHB 4QRSA 5C6TH 1WAAE 1WIOA 3FKUS 1FN4A 4GMTL 5F6HI 2P8PB 4C83B 2W60B 4YUEL 4MD5B 4WY7H 3O11A 5BRZD 1MWAA 5ADOH 4W81A 3VRLF 5HHOA 3EO9L 4GRWE 2HKFL 1I3RB 1J1PH 5IF0B 4YHMH 2WBJC 4ZFGH 1ZEAH 2ENYA 2R0LH 5TPWL 3ZDZF 4DFHA 2PYFA 2JB6B 4TYUA 1RUML 5I9QC 4FQ1L 1G7MA 4Y4FA 1JZ3A 1DL7H 1X7QA 3O2DH 4HG4K 2DQJL 3P30H 1MCPH 5HYQB 5JIIA 3RUGB 4RDQG 1TVDA 5T3XL 3IFPB 1UB6A 1A21A 4X6DF 3W81A 1MAKA 4X4ZA 4F9LA 2EDQA 1MCBA 3HZKB 1G6RH 1T2JA 2F54A 3LKNB 4QNPF 3VDCA 4JHWL 5IJKA 4JR9H 2BVPB 1S5HB 1DN0A 1XCTA 3ZE1E 3FQXA 5D96B 4ZOCA 1TZGL 4IOFC 1F6FB 3L1OL 3HAEB 1FRGL 5GISL 1H3GA 4YH6A 4HZLA 5GIRA 3IDNA 4PGZA 5DJCA 5DQJA 2QSVA 2AQ1A 2AEQL 4I9WD 1W0WA 4Y16A 1VEMA 4UDTB 3QZWG 3GEWB 1B2WH 4MD4B 2EDHA 1BVLB 3D87B 4P2OC 1YC7A 3NH7H 3OB8A 1SYSB 1WBXB 5DXWA 1A6TA 4G6ML 4R4ND 2R23B 1OGTB 3U0WH 4XB8A 5DUPH 2UZIH 3GM0A 4X6FB 4M7KH 3KJ4C 1FNLA 1JWSA 4K55A 5GGSY 1ROWA 4U1JB 2LAGB 4NBYB 5H2BB 2A1WL 2H2SC 1E4WL 4MXVE 3QI9C 3IJYB 4NQSB 4Y4HD 5TDNB 2OTWB 3VG9C 4RA3A 3FO0H 5JZ7D 2ZUYA 2G60H 1TVBA 1GOGA 1ZLVK 3CX2A 1G7QB 1L0YA 4YHOH 5ISZD 1QEWB 2HJKA 3UJJH 1MHEB 1FZMB 1X5GA 4R7NB 1Q1JL 3BAEL 1HHJB 3GI9L 3QEHA 4NQCE 3SQBA 4ZO7A 4XH2A 3QUZA 3T8XB 5DZLA 4UNUA 3L5JA 2IPKA 5MP6L 1AD0A 3RNQA 2CK0H 4PRHB 15C8L 2CLVB 5ERWB 1R5WB 2BNRE 2IH1A 1KLGB 1ES0A 3Q6FA 5DRXA 1NGPH 1RZJC 2QSQA 5FF6A 1MI5E 3P73B 1HXYA 3SGKA 1T7ZA 4MSWA 1J88A 3KVQA 2DIBA 3PQYA 4XP4L 5GS1B 1QR4A 5ITFB 4LVEA 3L3KA 4RCAA 4Z8FL 3BRGC 3K7UA 3HKFA 3DJ9A 3EFFA 43C9A 4D0CA 4K8RH 3HNTL 5KSUB 4PJBF 12E8H 4D9QD 3NCJH 1MHPH 1UQSB 3VFWB 4QRUA 1NC2A 4XP5L 4Q2ZB 4Z78A 5CEYB 5IW1A 1HI6A 3G6JA 2Z8SA 3I6LE 1OAUL 1LNUA 1NAML 1U8HB 4Z7VB 3O6KH 1IJ9A 4OGYL 4R97C 3SBWC 3MRIA 4AM0B 4R4BB 2XTJC 1VSCA 2BX5A 2J3SA 5FYLD 1WFNA 3C5ZC 2HT2C 5H35A 5GS2D 4XPHL 3SKMA 3VFRB 5JDSB 4Q0XH 4DEPC 3IFNH 1S7XA 1EHNA 2J8UA 1K2DB 1NH6A 1X6LA 1KPVA 2VXVH 2Z92B 4UT9L 4E0RA 4MLSA 2GUOB 2OSLA 2R1YA 3DHJA 3DI3B 1GZPB 1L7TL 4RAUB 4BKLA 1IARB 4HIIA 1BEYH 1SVZA 3UP1A 1G9NL 5K93A 4APQB 3UYRL 2ZWLT 4OLUH 4PRIE 3TZVA 2D03L 1U0QA 4GAGL 4J8RA 4P46A 1HINL 4LAJH 5KOVC 5CBEB 2ESVA 4N0FB 3HA0A 4M7ZC 1A02N 4LDEB 4Q9BA 3GSNA 5I1JL 3RQ3A 1P5VA 2FATH 3OSKA 3BSZL 4MHHI 3KXFA 1ORSB 1G9MC 1DN2A 4OM0H 1MRDL 1ACYL 1ZLUH 3RUGF 3KR3H 2P44B 5J7CC 4PLKC 4PGCA 4OFDA 5K9QG 1TQBB 1UCBL 5J1TC 3D2UA 4L3CA 5KSBB 1S8DA 2YRPA 3GSWA 4S1RH 4OGAC 4P3DB 3UTSD 3OGOE 4I2XA 3DUSA 1RUPH 2F8XC 4KI5F 5IHBA 1LGVA 2F5BL 1N6UA 5T33L 1NMBL 5HYFA 4MA1B 4BH7B 5D1ZD 1N5YL 1OARL 1MCNA 2BMKB 1NCAH 3O9WA 3X13A 2AEWA 2VRAA 4JG0L 5F88A 3WHE1 2Z4QB 3F7VA 1XF4B 4X4YB 1J1XH 4K23H 4JFDB 3SE4C 3VD7A 4PRPD 3VGGA 2B0SH 4M6NL 4XVSL 4V1DB 3WO4B 2Y36L 1NSNL 3KYKL 3KPMB 3PDOB 2GSGB 5C9JB 1OF2A 2CXGA 4PP1C 4JDZB 3AU1B 1NUGA 1LE9A 4F7PB 4KVNL 4HGWB 4WW2B 5JXEA 2AV7B 2GY7B 4NOBA 1YJDH 5JW3H 3VFSA 5BZDB 4G6FD 1KFAH 1XIWC 2JLLA 4Q6YA 4M8VA 4GG6B 1P84J 4NZRL 4ZG1A 2B2XL 3EJJX 2HVJA 5JOPE 3CSBA 1WBZB 5ADPH 4KHXH 5HHQA 4AH2B 4P5MA 3RRQA 4HWNA 5EUKB 1D9KC 1BBDH 3M1BB 5IB2B 1I7RA 2MJWA 5D6DA 2IG2H 3GJEB 1FZOB 1LO4L 1OTUD 2DM7A 3VXMB 3PL6D 1BQUA 4NQDD 1CG9A 4LCCC 3QRGH 2BVUA 1HDMA 4N1EA 3SPVA 3L5XL 3PGDA 5E2UL 1ZHBB 5F8QC 1I85C 2BSTB 1NLDH 1OCWH 2MWCA 2BVOA 3SKOA 1ADQA 1J12A 1P4BL 2XZQL 3ZHKA 1GJIA 2NX5B 1I3UA 3RWIA 1EGJH 1DEEA 5DGQA 5CP7A 4I0CC 3W0WE 4M43L 3GMNB 4QTHA 3D3VD 1UACH 3BVNA 1JYXA 4OSUH 3W82A 1WFUA 5D1QD 2FH6A 3V7AE 2HP4A 5EUOE 1A4KA 1FNEB 4AZ8A 3LN4A 4P59H 4XNZC 4K7PL 4NO2B 5DJDA 3HZMA 2X9YA 4JFQB 5HGAB 1TTUA 2EDYA 1J0ZA 1S9WA 3H9ZA 1G9ML 2FBJH 4PGJA 4MAYD 1IM3B 3SGKC 5J13C 1REIA 5GS0H 4Z7VF 4LRNL 4KRPB 1UXWB 2CPCA 4ZUVA 1IGTB 5LGJB 4GW5B 2EE3A 4QXTA 2CR3A 1MWAL 3OZ9H 5E6YA 4JFFE 1EO7A 1ZK9A 3SKJL 1U3HA 1TJHL 3QFJD 1QG3A 4PV9B 5JA8B 4KK9D 4J2XA 1KPRA 5DVLA 2ED9A 4EUPA 1NCDL 1KIPA 1Q0YL 3OAUH 3AAZA 3H42H 3I02B 1Z9MA 4N90D 4RMVA 4PJAF 3BIKB 5C0BA 5JOFB 5E5UB 2APXA 4WTXA 4WENB 1R3JB 4O58L 5DJ2B 4HMDA 4MQ7A 2YXFA 1AXSA 5L0QC 2JF1A 4OTXH 2FZ3A 5GQBA 4ISVA 1NBZB 2GTWA 4P4KD 4RWYL 1DQTA 3VXOB 1HHHA 1QUNA 1RU9H 2BVQA 2YPVL 4KJQC 4X7CC 4UIMB 1RSFA 1EH9A 1ED3B 5FM4A 3X17A 1NFIB 2ZNWA 5C0JA 1OOAA 3JTSB 3TA3D 4EDWL 5BO1H 1A9EB 3LS4H 1DQJB 1VKXA 4Q9RH 4WTWA 2N1KA 5JO5B 4XPAH 5GGRA 3WS6A 3QUXD 1JZ4A 3Q1SL 3QCVL 4HS3B 4OJFH 4IOIA 1J0KA 1MAML 1A3RL 5DFTA 4F7MB 1X5JA 4P4RB 4ESKA 1FO0B 4GRWB 2YD8A 1HYRC 1JUFA 1CLZL 3D0LB 1E6OL 1N3NA 1AIFB 3T77B 2KZWA 3TPKA 3T0EC 3JUYA 3UBXG 2OTUA 1EXUB 2NY2D 2YUWA 3QG6B 4FXLA 3SJVE 5L2JA 3X12A 1XEDA 4Y4HB 5CD3B 1I9IH 3MRBA 1BFOB 5EIIA 5IFHL 3EDKA 2WLZA 4ONOA 5I1LB 4WW2F 5ISZB 4JM2F 5I19H 2BP3A 5C08D 1G0YR 4OI7A 1KJ3H 2VAAB 3QULA 3CZFB 4Z7WB 4GG6F 5HYIA 3CGTA 3DRTB 4WW1A 3VGFA 4IJ3B 5HDLA 4NC2B 2VLKA 1AGBB 4N5EA 5BVPH 5INDA 3U4BL 3QH3A 2H32H 2JJTC 2HN7B 1FH5H 4M9OA 3MGTB 1KB9K 1CDHA 5T1LB 1F6AB 2ED7A 5E8OA 4HIEB 1A1NB 3CX5K 4JGMA 5JXEC 3P77A 4IOSD 3TNMB 3IDUA 5MENE 1GH7A 1T03H 3ILPB 5IFJB 2RFXB 4GMSL 4F7EA 2IEPA 3TO4B 1IM9D 3QUMH 3RIAK 2LV4A 3KYNA 4NKOB 1MFEL 1CICC 4W68A 35C8L 1U3YA 5I2IB 3MLSH 5D5ME 3GI8H 4MXQD 2YEZA 2MHAA 4DVBB 1BGXH 5D6DC 1HHIA 3SDAD 5GXBB 4BFGA 4TUOB 1RJZA 1U95A 2EC9U 4WFGD 3BH8A 1AR1D 5GSRA 2NY7L 4BQ6A 4UT6L 4LU5L 4U3HA 4K3JH 1MQKL 1LQVA 1V05A 1JF1B 3LZFH 4PLOB 2VDQH 2ATPB 1HWHB 5GGRY 4HBCL 3BPOC 1XAUA 3F5WB 3MO1A 3QDGD 2HMID 4S1QH 5IB5B 3CCHB 2BC4B 4EQ2A 3ALPA 1KENL 1MEXL 5SWQA 1UZ6F 3QUYA 5KN5B 4YPGB 4HJ0D 4X6CF 5CJQH 1I8LA 5F9WC 5GZND 1PG7W 2DQIH 1A6WH 4XBPA 1CDBA 2MKLC 4J3WA 5ALBH 4XX1G 3GHBH 1FLRL 3OKNB 1KCVL 5BV7L 5B4MC 4XVTH 4OV5B 5TE6L 3CC5B 2YXMA 1JWMB 1UWXH 3SO3B 1S7WA 2EO1A 3EO1A 2CLZA 4RAVA 1AD9B 2J4WH 3RKDC 3QP3A 3IYLW 3GRWA 5IWLC 1W8NA 4JDVA 4NRYB 4BFEA 4KKBD 3UTSB 2JCCB 2X41A 1KJMA 1T7VA 1IAIH 1KB5B 1VFMA 1NUFA 1OSPH 3UO1H 1CT8A 2WWMC 3AB0B 1MCDA 2YWYA 3FTGA 2K7PA 3ZE2F 1IL1A 3L95A 5KSAC 3VH8A 1G0XA 4MQXD 2WUBL 5AZ2H 3WLWD 4QRTA 4WI7A 2QLVB 4QHNB 5IM7A 4KAQH 3GSNH 2FECI 2AXGB 4PRPB 5LGHH 3WE6B 1AO7E 1Q0XH 1EO8H 1TQCB 4PJ8D 5C0CE 4OKDA 2XXMB 4G9FE 5GHWH 5IMOA 5EB9A 4OLVL 1PZUB 1TPXC 3REVB 4DKFL 1SBSL 3BE1H 3LD8C 1T21A 5DD5H 4NYLA 1WAAF 5IB4B 1CU4H 3FOMB 5IFAH 4NCDA 3KPLA 2FL5B 1ACZA 2ICWI 4GRWF 4PRIB 1MY7A 1WCQA 4XCNB 4G6FB 4D8PA 2UUDK 2NLJB 2GJZA 4LSRL 2GJJA 1FPTL 2FX7L 4K3EH 1MF2L 5BJTA 4HH8A 3T4AA 2BERA 2A9MH 4Y4KA 1A1OA 2R1XB 3KYMB 4M7JH 2Y6SD 4JFOB 3QIBC 2A6JA 4OLYL 3CH8A 5BZWB 3U46A 3WS6C 4ZD3L 3ARPA 4YBQD 1FL3B 1V3MA 2OJZH 4QCIB 3GB7A 4NQDB 3BHBB 4IMLA 2YPLA 1J8HA 4G7VL 3MV7E 3ZE1F 2X4RB 3BP6A 2B1AL 5C0EB 3LSOB 4LBEB 4MZ3A 1F4WH 3UJIL 1VFAA 1I1YB 4A6YA 1LD9A 4WVRA 4JZJB 3LIZH 2APFA 2WANA 2AXHA 3VXRE 3ZYJA 1ITBB 1IC7H 4JRXE 2QSCH 3ARBB 4UILL 1NUDA 1T4KA 1WC7B 4Y19A 5E00A 3D3VB 4O00A 3ETBF 5D1QB 4HXAL 5FA4A 1CDJA 2Z91A 4MA8H 3ESVF 4ZXBD 1IQWL 2HRPH 1CQYA 2GTZB 4W4OC 4YO0B 1PQZA 3HZYA 2EDXA 4X5XA 4I3GA 5EO0B 3V4UL 1C5DA 1VHPA 4Q7DA 5GRXG 2PXYB 1XGYL 4LSUH 4ELKA 2BSSA 1MPAH 1K8IA 3KLAA 4P9MH 1YY9C 5I1AA 4ONHB 3QISA 3JTTB 4MXVF 4CVXB 1ADQH 2P46B 1WTGT 1AXTH 5D72H 3GBMH 1WGOA 2FLBT 3E2HB 4M4RA 2G75B 3BQUD 2LU4A 4M00A 4YE4L 2DKSA 4IRSA 5IMMB 1NKRA 2ZOLA 1VFBB 1B4JL 4HPOH 2H45A 1Y6NR 3KDMA 1A6VL 4GKNA 1F3JA 3OXSA 2UY6A 2HFGL 2CLRB 1JGDB 3C9NA 3DXAA 2X4NB 3MLUL 2VLLA 4WHYH 4H26A 1LO5A 4NM8H 4JO2H 2DS4A 4U1IA 3TH2T 3U9UA 4ETQB 2B39A 4MJID 5IT2L 3THML 1JMZA 1N5AA 3B8SA 4YX2L 1HH9B 2DQHL 3U36A 1XGRA 4GBXD 1LDPH 4OB5L 5BVJA 3WSQL 4GLRI 1ZGLM 2V17H 2ZPKL 2W9EH 2XI9A 3QNXB 1GPOH 1WBYA 3DURA 3FFDB 5JW5A 2XXCB 4XXCC 3IU3A 1FFPA 2Q6WB 5AZEL 1A6ZA 1T5XB 5A16B 3RI5K 4MDIA 5GJSL 4ENED 3F12B 1RAMA 1T1XA 3QUYC 2BFVH 4QHMB 3MJ7A 4U1HA 3FCTB 3H6JA 1XCQA 4PJ9D 3TH3T 4EUPH 3IDIB 5D7LE 3CFCL 2NXZB 4F33B 4LPCA 3WFCH 2HG5A 3C2AH 2C4FU 2NXYB 4F7TB 4MWFA 3LEXB 4ZQKA 1ZXQA 4L4TD 4PREA 1A0QH 1D5ZB 2PW2B 1U6AL 1QLFA 2VR4A 5TQ2H 3GNMH 4NHUA 2R2CA 4EEEA 4O5LH 1IVLA 2QR0B 2ICEB 1EUTA 2XG4A 4Z76A 2D7MA 4JFFB 2NY2B 3VFOA 4KXZH 1IQDB 5J9PB 4Z77A 5T5FH 1U9KA 3QBTB 4KC3B 5LQBH 2GSIB 1IGFL 5HDQH 2OS7A 3S4SB 4GFTB 3PE9A 3G5XA 3K2MC 3O4OB 5D71L 5I8KH 5C08B 1JNLH 1XR9B 3QDMD 1JL8A 1WCBB 5GJTL 2DYPD 1YEFL 4N0UB 1HSBA 5DZOA 2C1PB 4MGXA 1P9MC 4OFYA 3LQMA 3QWRD 1UEMA 5C2UB 1HKFA 2IADA 3Q6GL 5B38A 5CWSB 1V5JA 4GXUN 2RR3A 4DKEL 4NRXA 5IBUG 5DMJB 5IMKB 4BQ9A 2CGRH 1H15B 3TBTA 5FYJH 1TLKA 5DTFA 4WUKH 1QKZH 4BH8A 2UWEE 3QJHA 2NQCA 4XMLL 1I7ZB 4RQQB 5I16B 4BSWB 4RFEA 3MLWL 5GRWA 1AGDA 3BIAX 4U1KB 1KN2L 4I5BA 3MLZH 3FT2A 4XCEA 1S9XB 4K7FA 5IHUL 1MHCB 3VWJC 3QUKA 4UB0H 1IM9B 1NBYA 3D39A 3NGBC 4Y4KC 2XN9E 3TBVA 3TYFB 3U4EB 4ZNEA 4G9DB 3GSQA 1V7MH 1T7WA 4OGXL 32C2B 1OP5K 1R3HB 5T3XD 3I50H 3RGVB 3CFJB 4XC1L 1BREA 1C7SA 2R2EA 3SDAB 1FL6A 4BUHA 2DQCL 1JPFA 3W39A 4GXVH 3WKML 3MUY1 3SCMA 4RZCB 3LKSB 4JJHA 3FN0L 4GRMA 3BJLA 3S34H 3IF1B 3HLAB 4HH9B 3RWGA 1I8KB 4PJGE 4J6RL 5EZOL 1S9VA 1MCOL 2N56A 3L3DA 4O9HL 3LY6A 1LO0H 4DGVL 3DX7A 4Z0BH 1OLLA 4I18A 4OZIE 2V2WB 4S2SA 1NC4D 1IGYB 4UBDD 4YNYB 3CFDB 4QWWD 3GMMB 4FXKB 3VW3L 3WLBA 2Y23A 1EHXA 1IKNC 3B6SB 3MV8A 1D6VH 1V7NH 2QHRH 4MJ4A 2WAHA 2J1KA 3NACH 4NQEB 5FO9B 1F5WA 3STLA 5E9DD 3IS0X 1KB9J 3L7EB 2AJXH 5MENB 4Y2DA 3B5GA 3IAGC 1JNHB 1CYGA 4NQUA 5KVGH 3RWFA 4UINH 1ETZA 3ARGC 3MRCB 2RGSA 2O5YH 1N7ML 4KHTH 4KH2A 5ABDE 1KJVB 2DTML 2K1MA 3LPGA 3C2SA 3P11L 3EYVA 1Q72L 3VXSE 2YA0A 5J57B 1YYML 1HYSD 4M5YL 5FCUL 4PUBH 1SMOA 3KHOA 2Q8BH 1QPXA 2IFGA 4U6XB 1MFBL 3BUTA 3KPTA 5LBSL 2J12B 1SYVB 2A2QT 3KNBA 5DK0B 2VE6A 4DGIL 3L9RA 4NN7C 1UWEL 1KBGH 4K3GA 4HUVB 5EUOF 3H9SE 4K8RD 4PJ8B 1F90L 4WI3A 3MRLA 2FECL 5IVZA 5TF1L 2N7AA 1RHHB 5HGDB 4EVNA 5HHXH 3IFOA 3WYRA 1N64L 3KWWB 2G9HB 2A0LD 4HWZA 4WU7B 4L8SC 1NCBL 3QO1B 4TSCH 1T1YA 4Z7UE 5GGTA 3WDHA 5HI3C 2OCFD 1W72B 4ZUUB 3KGRA 2R4RL 5K9JH 3GRWH 1MCSA 1ZLUK 3A67H 5DMGD 1RFDL 1A3QA 2BY2A 2YZ8A 2VH5L 2EYTA 5KTEL 3O8XA 5HHMA 3W2DH 3GSUA 5ALCH 4G8IB 3CK0H 3ZKMC 3O41B 1HWGB 2WBJD 5DJYA 1FDLL 1LK2A 1WICA 3O6ML 5HVFB 4HWBH 1KIUA 3C08L 3LH2H 4WFEE 4H1LA 4YC2B 4FFZH 3EFDH 4ZAKC 5I74B 2EIEA 3NCYS 4YHZH 1NANI 3DGCR 4OT1H 5GGVL 4K9EL 2IJ0C 2YC1A 3K4DA 4NZUL 1I7UB 3K8KA 3K80A 3BD3A 4XPGL 4UQ3A 5FHBH 1ZLWK 1LP9A 3OHXB 1A7RH 4H20L 3BESR 1ZMYA 3MUJA 3JV6B 5DK2B 1UA6H 1KV3A 4KKNA 4H0HB 2DLHA 4FFEX 1F3RB 1UM5L 4QYOB 5I30L 1VGKB 1U92B 3W5NA 1SY6H 1TZHA 4PJ5D 2ATKB 3DROA 3BGMA 2ZSWA 2DDQL 5KBNC 4KKAD 1P6FA 3EDEA 3NIFE 3HR6A 1AO7B 4QY8A 3EO0A 5KG9A 2AGJL 5IQ9A 4KTYA 3OGCA 5LAXB 1QSEE 3Q3GB 5EO1B 1N4XL 4O4YL 3CMOH 2GK0B 4FXGB 1X6NA 3NBNA 5KAQF 1GZQB 4G5ZL 2WINB 3RIFF 3RA7H 5E95B 4DZ8A 1OT2A 4RGMB 4M4PA 5T1DL 2Q86A 4Y5YB 1CFBA 2QQLL 4Z5RB 3SDCD 3TWCL 4FNLH 3EYOA 1WF5A 1DE4B 5J6GA 3FZUC 3QDHA 1JJUA 2B7DT 1OAZH 1ZANL 2ERJC 4JM4L 3T1FB 4A6YH 3O45B 2ITDB 3TVMB 4ETYA 2EE2A 4PRDA 4M9PA 4M62L 3DVGA 5EFIB 2EH8L 4OZHA 3HE6C 4JPIA 2BVTA 4TTGA 1Y6KR 4YWGL 3DMMA 1W0VA 1MJUH 3HZVB 3RBSA 4QRRD 2PR4H 4U1GB 4BSVB 3VMNA 4KK5C 2WLYA 5TF0A 3ZT7A 2RIKA 4PRNB 1KCRL 1EEYB 5ETUB 5ANMB 3D9AH 4MA3A 5I66B 1TZIB 3MBEC 5GSVB 3AMLA 5EOQH 1R5VB 3SCMC 5T1KB 1QHPA 3VXRB 4XXDB 2GYSA 43CAB 3UAJD 2VDLL 4DVRL 1F02I 4GBXB 4MZ2A 3EJZC 1KLUB 1NGYB 1LO2H 2ITCA 2IGFH 2ZUWA 1A5FH 2E6QA 3QCUH 3RVWD 4LLYA 1J0JA 1YN7B 5E4IA 5DLML 3AUVA 3IXAA 3BP5B 1C12B 5C0FB 4ZUSA 2HFFA 3RKPA 1OPGL 1Q94A 2GJ6E 1N8ZA 4KWUA 1WISA 2NR6C 3RL2B 4YR6B 3CLEH 1FNHA 5HD8C 3HC0B 5HHPB 4OLEA 5DD3H 5JLZA 3STBA 4B5EA 4Y0GA 2LU3A 4TPRH 4QHKI 4CNIA 2QKIB 1A7NL 1BQHA 4ODUB 3SE8H 2DQFB 3QIWC 2WIIA 4TOYH 1I4FB 5D5MF 1RURH 3EOTH 2XQBL 3D69B 3C6LD 3H3BC 3DLQR 4OCXH 4YXLH 4NWUL 3B9KA 4U1MA 3S3SA 1E4XI 3VRIA 3MRRA 4XCFH 1T5WA 2FGWH 4XPFH 3W9DA 3U2SB 3FAXA 2AJUL 3MMEB 4LCWA 2PTUA 2R8SL 3QA3A 3QIUC 4NUGL 3SDYH 1G0DA 3CZJA 3RZWA 4EOWL 3G6DH 4I3RH 5GS0D 3DV4B 2XY2A 4KRLB 5F1NB 5JNYA 4NPYA 3GJFA 5EU6D 3OKOB 5JHDD 5FM5M 4JG1H 1FYTD 1NGWA 3RWEA 4EQ3A 4RGOH 1OSZA 4Y1AA 4R3SA 4Z95H 3VXUD 2BCKA 5I1HH 3WD5H 1R5IB 5F7NC 4YDJA 3EYSL 2P24B 1NFDE 4FA8A 3BW9A 3PWNB 4JFHD 5KS9E 1Q9LA 5I1GL 4OZ4B 5JPNB 5KVEL 4HV8A 1FZJB 4UQ2B 4DTGL 2AJVL 2A77H 2HA1A 2FD6L 4WFHD 5D1XD 4MD0A 1JNNL 2EH7H 4FQLL 3LRHA 1PX3A 2R2HB 4FFVD 2ADFL 5D7LB 1XH3A 2WP3O 4LLMA 4HLZH 1IKFH 5CGMA 3O8XC 3GIZH 4NFCA 4OGAD 5HHOD 3FONA 4LVOB 1DQMH 5DRWA 2IMMA 1EJ6A 3MJ9A 4YDIH 3CXDL 4NCC1 4WO4B 5DEFA 1SJHB 5I0DA 3FRUB 3ROOB 4Y4FD 5BMFH 1BQSA 3Q5YA 4MB5A 4DZBB 1U93A 2Y72A 4UTBL 4WV1C 1AC0A 1RULH 5FGCE 4JFED 1IGIL 1JFMA 1KJ2H 4GG8A 5MEPA 2FX9H 2J6EA 2BNQA 2F54D 2C5DC 2DQDL 2VITB 1MIEH 1BQLH 5IV2A 1NCWL 2D03H 4QHLA 3ALXA 1EVTC 1YUHA 4OCLC 5M94B 4F57L 2AI0H 1FFQA 2FR4B 3ZKXB 3BT2L 3MV9E 5DA4A 5DRNB 4LHQB 2H8PA 3VA2C 4LLUB 4LSSH 4P2QE 5L2KE 4Y16D 5HVGB 4OF3A 1D5MB 1U2CA 2MCPL 4NGHH 1UADC 3QJFA 5T1MB 5D96C 2A83B 1R3KB 5E9DB 3CSGA 4JZOA 4HIXL 4IS6B 4MHHG 4NC1C 1V3JA 1UJTA 3ULUH 3IKCA 4G43A 3MNVB 2P5ED 1JYWA 4NN6B 4X9GA 4MLIA 2P1YA 1MAJA 2CUHA 3QYCA 3RTQA 5HPOA 1I1CA 4R90L 5EBLB 5B39A 1JZ8A 1PJ9A 3WV0A 2E7BA 3ES6A 1QPPA 5IVXA 4QF1A 4OF5A 4X98B 1U42A 3KPPA 1FVEA 5F7EL 2X4OA 2H3NB 1ZWIB 4PG9B 4G8GE 3CLFL 4AMKL 2IFFH 1G7IA 3LHPL 4NNXB 5HI4C 4W70A 4UU9A 1JHLH 5BXFB 3V5HA 1F8TH 3I9GH 1BM3L 2C3XA 3PNWA 4G8FA 1LILA 1RZJH 4BZ1L 5JR1L 1AY1L 4KDTA 4BFIA 1D5BA 1HXMA 3ZSSA 2ADGB 1C08B 2CDGA 3KAAA 2YBRB 2ZKHH 3QUZD 4PGEB 1FORL 5EPMA 5AEAA 1LE5B 3OXRA 2ESVE 2B2XH 3VCLB 1CD1A 3PG2A 1PLGL 1UWXK 4PY8J 3N1GC 4HLJA 5TH2A 3SEPA 1ND0B 2IALA 5HGBA 5INCA 1M6OB 1NJ9A 3HI6H 1IT9L 2VXSH 5TFSL 4NWTL 3X14B 5FO8A 2VL5B 4LLVA 4EI6A 2W38A 4TSAL 2WBJB 4O2FA 5I8CA 1NCUA 3T0EE 4ZNCD 5C6WH 2X40A 4AL8H 3VGHA 1I7TA 2XZAL 2X09A 5I9QB 1SJVA 3MUHL 3KJ6H 5E2UH 4LNVA 4D94A 4YHIB 1E28B 3DUUA 3OAYH 5F1OB 2Y5TB 4EN3A 5BRZA 2QV2A 1NAMB 3LV3B 1NC2D 1MFDL 4UUJA 1RV6X 3VFTB 1INDL 4C57C 2YWZA 4GT7A 5GGTH 5GS1C 3GSXB 3V95A 5DJ8A 1WFOA 2R9HC 4PJ5B 1R3IH 4L4VE 2BJMH 4XAKD 2G5BB 3HI5L 1D5IL 1ZA6B 2HWZH 1ZGLA 3ZO0A 3MRPB 1R3LB 1OWRM 3H9SB 1RUAH 1SQ2N 5DYOA 4M48L 2X89A 3G6AB 2FWOB 3PWUA 4FQXA 4OLXH 3QEGH 5B3NA 1T2QH 5ENWB 1F42A 2F53A 3S6CA 5L7XH 3F8UB 4Z7UB 2V2TB 2AEIT 4B7IA 5D2LA 4JKWA 3TZVD 4P46D 4ONFL 4YDVB 3QHFH 3UTTA 4P2OB 4PJFA 1QFOA 5KVFL 1A4JA 4OD2A 3SDCB 3MPCA 2HJFB 2AJYH 4H5SA 1UEYA 3BUYB 4HUXB 3KXFD 4P49A 5EU4B 3CFKA 2QADD 3BD5A 5DD6A 3BD4A 1I9EA 5C0DB 4XTRD 3TIDB 3KJ4B 4FQ2H 1MVUB 4OF8A 3FB6A 4KTDL 5A2LH 3V6ZA 4L9LB 3SGDI 4APQC 3WIIL 1M7IA 1QNZH 2EEBA 3D2UD 3WFEH 1G7HA 4X8JB 5J89A 3QI9B 1KELH 2OP4L 2IQ9L 4X0KA 4QRRB 4AEHH 3VG9B 4PBWD 1HNFA 1JPTL 4FP8H 2V2XA 1PBYA 3ARDD 5DD1H 2EXYC 1CGVA 4RX4A 5HYJA 1CQKA 3RHWK 4M6AA 3BRFA 5E8PB 3P0VL 5B8CA 1S7SA 3X11B 2W0FB 1W0YT 2H2PC 4YGVB 3UPAA 4EUPG 5MERA 1K9TA 2OK0L 3K4ZA 3O9WD 1TQBC 3D25A 2GY5A 5DHVA 1T3FB 1XZ0B 2EYSB 1NDMB 1SMAA 4WEBL 4MJ5A 2CDFB 4YFEA 3JWDH 5CINL 3TV3H 4JN2B 3LMJL 2V5YA 1EUUA 4WEUD 2UWEF 5ESVB 2VTFA 4GQ9L 3RBGA 4O2CA 2FIKB 2GW5A 5D7JA 3EYFA 3ZL4H 1GCFA 4NBZB 1QSEB 1J05A 1NLBL 4HUNB 2YD2A 1YMMA 2R39A 4HPYH 1T83C 2D7QA 5JXED 4N0YL 5KJRL 3EHBD 1MJ8L 3VU2A 2QBWA 4OD1L 4PGBB 3UTPE 1RZKC 4JQIH 3O3AB 2AV1B 4QEGA 5DS8B 4LSPH 5EA0L 3WO4C 3QQ3A 1MRCH 1I9JH 3HCVB 4OQTA 2FYYA 2AVGA 4JY4A 1Z6JT 3C6LB 3E6FA 3SY0A 3MRHA 2CRMA 4UTAL 4DKAA 4AENA 1BFVH 1DEDA 4JFPA 3RDTA 1WZ1H 4PYGA 1U41A 4FZEH 1AGFA 1CGXA 3L3IA 1JGVH 4R97B 1ZT1B 3HPLB 3AXLB 1KNOA 3GO1H 1E4XL 4CADB 4PJGF 2XTJB 3RTQC 1KGCE 2P8LB 3FB7A 4DEPB 2C1OA 2X05A 5FHAH 1DUZA 2A6DA 4Y88A 4OZIF 1BZ7A 4PJIB 2R69L 5JHDB 3KLHD 2WWKT 4QOKA 2BY0A 4S1DD 3VXUB 2MFNA 1QSFE 3CVIL 1Z9LA 3QDAA 3RX8A 3TJEH 1ZAGA 5C2BL 2YN5A 4OV6F 1T0MA 3ZMRA 3B2VH 5ICYB 1TCRB 3G04B 2CUIA 4KDTC 5TE4H 3CXHJ 3QEQE 1GOHA 3UC0H 1UB5A 4Q9CA 1PFCA 4I48B 3GBNL 1N59B 2P7TB 5EZLA 3ZYZA 4OBRA 1KPUB 3IDYC 2KPNA 2XKNB 1CDIA 4FG6C 3MGOA 2P45B 4OD3L 3DNKA 5D2NA 4QRSB 3RZCA 1QLRA 1FN4B 3JUZA 4FHBD 1MVFA 4FTVD 5DDHA 3O11B 1MWAB 4JY6A 2W92A 4X6BA 2ZJSL 4XBEH 5L9DH 3JV4A 5DWUL 4XNYL 2VSDA 1U3HD 3ARTA 2PYFB 3MXVL 1QBLH 3MJ9L 1X7QB 4TULH 2R15A 2HKHH 3SHSA 4N1CA 1Z3GL 1UB6B 5C1MB 5DUMH 1CDYA