4F7GA

Crystal structure of talin autoinhibition complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
192
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Talin-1
publication title A novel membrane-dependent on/off switch mechanism of talin FERM domain at sites of cell adhesion.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 56
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4f7gA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4f7gA02
1P3RA 3MDBC 1W1HA 1Q67A 3PVUA 1FB8A 1U27A 5C5BB 4HAXB 1UEFA 4YL8A 1J19A 3DXCA 2YS3A 1Y5OA 3F5RA 3ML4A 1K5DB 1V5MA 3LJUX 2K00A 3F0WA 1B55A 5JLJB 1V5UA 2FDQA 1GC6A 5KQ4A 2UZSA 2LULA 3A8PA 1I7AA 4GMVA 3PVWA 3ULBA 3U7DA 2YSZA 1QQGA 1EVHA 2LKOA 1BWNA 3X23A 3NSUA 4PQ0A 2D9XA 4L6EA 2DYNA 4K2OA 1DDWA 1EF1A 1WJMA 2N0YA 4DXAB 2RSGA 1NI2A 3SNHA 2R09A 3QIJA 5J3QA 5IJMA 2YRYA 5HE3A 1Z87A 3DXDA 2NZ8B 4B6HA 4TKNA 3KZ1A 2D9YA 1BTKA 1PFJA 2CB8A 2NMBA 2X18A 3AU4A 4XWXA 2Z0PA 4WJ7A 1V61A 1MK7B 4MK0A 2KUPA 2W2XD 2EMSA 1ACAA 1U2BA 3P7ZA 3AJ4A 3BJIA 4IFSA 2N23A 3HK0A 1UNQA 5KQ1A 1AWEA 1RJ2A 2Y8GA 4HB0B 4GMXB 2J0KA 2I1KA 3P6AA 3A98B 4EKUA 1FHWA 5JHHA 2RLOA 1TQZA 1AQCA 1V89A 4DBBA 1DBHA 2CODA 2H7EA 4F7UP 3EPYA 5KCVA 1XCGA 2I5FA 1HB6A 3A8QA 4EJNA 1EAZA 1P6SA 1W1GA 2V76A 1UPQA 1WVHA 4K2PA 2I5CA 2RQ1A 3TCAA 2COCA 2JP2A 2EMTA 3VOQA 2LYDA 2WH5A 1FHOA 2YF0A 2M38A 4K17A 3AU5A 1FGYA 3M1IB 2D2QA 2GJYA 1U5EA 5L81A 1PLSA 2ROZB 1KI1B 2BCJA 2VRWB 1K5GB 2FJ9A 1DYNA 2DN6A 1FHXA 1OY2A 2P8VA 2P0HA 2DYQA 5CLQB 1W1DA 2MFQA 2CRFA 4MT7A 4PNKA 2HRJA 2QKMA 1E5WA 4DX8A 4P7IA 4C0AA 2DKPA 2KCJA 1ZC3B 3U8ZA 2ABDA 1HB8A 4KHBB 1H10A 3QBVB 2GCJA 2E2XA 2K2UA 4KHAA 5J3TA 2LOXA 2DHJA 5EFXA 4ZRKA 3PEGA 3PSCA 1FGZA 4A5KA 4HAZB 4A6FA 2YVCA 4F7GA 4HB2B 5D3XA 1MK9B 3SO6A 2CQUA 1TXDA 2OTXA 2ROVA 1ST7A 3UZTA 2RGNB 1X1GA 2KGXB 1P5TA 2XQNM 1X05A 1NTIA 4KHOA 5JHGA 1NU2A 3D8FA 3D8EA 3FM8C 4GPTB 2LOZA 2HTHB 1MIXA 4HAVB 1FAOA 4CYEA 2EC1A 4TYZA 3ODOA 2YS1A 1LB1A 4NSWA 2MKRA 2RUKB 4IOYX 4MY6A 4IAPA 2CAYA 2COPA 2J0MA 2DLWA 3TVVA 5C5BA 1ZC4B 5D3YA 3CXBB 2LG1A 1ZVRA 4CHJA 1GC7A 3TFMA 2GS0A 2Y7BA 1OQNA 2RVBB 2Z0QA 1WJ1A 4HDOA 1OMWA 2HE7A 4HHVA 4EMOA 3OANA 5DIFB 2DHKA 2L2IA 4H8SA 1XR0B 4A6HA 1M7EA 3WYFB 2ZPYA 3GYOA 2COFA 2D9WA 4D0NB 2VKIA 2YT0A 3FP5A 1RRPB 3KSYA 3ZVRA 1WI1A 1MPHA 1I2HA 2YT1A 1MAIA 1V88A 4DX90 3HQCA 4KAXB 2FJLA 1U5DA 1MKEA 1ZSQA 3SUZA 3VIAA 1LW3A 1XD4A 4Y94A 1SGHA 5HE2A 3FEHA 2PZ1A 1BTNA 1XX0A 3ULCA 2CY5A 4WVFB 1WG7A 4HB3B 3BINA 3GYPA 2MDXA 5LONB 4Z2NA 1J0WA 1V5PA 4NY0A 4WSFA 3PZDA 1HBKA 1IRSA 1TJ6A 3KRXA 3FSSA 3N7CA 1H4RA 2DHIA 2G35A 5D27A 2W2WA 2D11A 3ZDTA 1UNRA 2ADZA 1DDMA 3PP2A 2YS5A 5D3WA 1FOEA 2QKLA 5FI0A 4BBKA 3HW2B 1Y19B 2L1CA 2ELBA 1M7RA 1UNPA 4YONA 3IVFA 4K81A 4F7HA 1WGUA 1QC6A 1N3HA 3T06A 1X86A 1X1FA 1NTYA 2IYBA 5GOWB 3FLVA 2VSZA 4ZRJA 2EJ8A 3O96A 1ZM0A 5DHAB 3TW1A 5HE1A 3SYXA 5DI9B 3PG7A 4GZUA 4HATB 5C16A 3WA0A 2R0DA 3D8DA 2IFSA 1UPRA 4A6KA 1WGQA 1NTVA 2CY4A 2H7DA 4GN1A 1DDVA 1U5FA 5C79A 5CLLB 3KRWA 3MPXA 1U5GA 2D9ZA 1NVLA 5HE0A 3CIKA 4ZRIA 1ISNA 2LBBA 1X11A 2Z0OA 2MWNB 2DFKA 5FI1A 2W2XC 2ELAA 2K2JA 5LOPB 4CHMA 2AEHA 5DHFB 3SV1A 2M14A 1SHCA 1KZ7A 1KZGA 1PMSA 1BAKA 2COAA 2D9VA 1U29A 2J0JA 4A6FB 2DTCA 3DXEA 2I1JA 2RNRB 2OQBA 2DX5A 4HDQA 2P0FA 3KY9A 3TO1A 2UZRA 3G9WA 5J3YA 4HAWB 2P0DA 1XODA 2GCLA 4KVGB 5C6RA 3V5WA 2D4QA 4HAUB 1EGXA 1XKEA 1MIZB 2DA0A 4GXBA 2DX1A 2AL6A 3RCPA 3QWMA 5D3VA 4Z2MB 1DROA 5DH9B 5JP4A 3PVLA 3ODXA 2DKQA 2Y8FA 1GG3A 4HAYB 2Q13A 2J59M 4HB4B 2UVMA 3ODWA 2D10A
chains in the Genus database with same CATH superfamily
1VBHA 1P3RA 3B77A 3MDBC 1W1HA 1Q67A 3PVUA 1FB8A 1U27A 5C5BB 4HAXB 1UEFA 4YL8A 1DIKA 1J19A 3DXCA 3NWAA 2YS3A 1Y5OA 3F5RA 3ML4A 1K5DB 1V5MA 3LJUX 3NWFA 2K00A 3F0WA 1B55A 5JLJB 1V5UA 2FDQA 1MI1A 5M4YB 1GC6A 5KQ4A 2UZSA 2LULA 3A8PA 1I7AA 4GMVA 3PVWA 3ULBA 3U7DA 3U12A 2YSZA 1QQGA 4JKAA 1EVHA 2LKOA 1BWNA 3X23A 3NSUA 4PQ0A 2D9XA 2Z4DA 4L6EA 2DYNA 4K2OA 1DDWA 1EF1A 1WJMA 2N0YA 4DXAB 2RSGA 3NWDA 1NI2A 4JKEA 4GNKB 2R09A 3SNHA 1KBLA 3QIJA 2K8EA 2X0SA 5J3QA 5IJMA 2YRYA 5HE3A 1Z87A 3DXDA 2NZ8B 4B6HA 4TKNA 3KZ1A 2D9YA 3HIEA 4HSIA 1BTKA 1PFJA 2CB8A 2NMBA 2X18A 3AU4A 5IRSA 4XWXA 2Z0PA 4WJ7A 4D6WA 1V61A 1MK7B 4MK0A 2KUPA 2W2XD 2EMSA 1ACAA 1U2BA 3P7ZA 3AJ4A 3BJIA 4IFSA 2N23A 3HK0A 1VBGA 4KHBA 4OT1A 1UNQA 5KQ1A 1AWEA 1RJ2A 2Y8GA 4HB0B 4GMXB 2J0KA 2I1KA 3P6AA 3A98B 4EKUA 1FHWA 5JHHA 2RLOA 5I2SA 2YT2A 1TQZA 1AQCA 1V89A 4DBBA 1DBHA 2CODA 5LG4B 2H7EA 4F7UP 3E66A 3EPYA 2R82A 5KCVA 1XCGA 2I5FA 1HB6A 3A8QA 4EJNA 1EAZA 2RRFA 1P6SA 1W1GA 2V76A 1UPQA 1WVHA 4K2PA 2I5CA 2RQ1A 3TCAA 3E9PA 2COCA 2JP2A 2EMTA 3VOQA 2LYDA 2WH5A 1FHOA 2YF0A 2M38A 4K17A 3AU5A 1FGYA 3M1IB 2D2QA 2GJYA 1U5EA 5L81A 1PLSA 4QJ5B 2ROZB 1KI1B 2BCJA 2VRWB 1K5GB 2FJ9A 1DYNA 2DN6A 1FHXA 1OY2A 2P8VA 2P0HA 2KUQA 2DYQA 5CLQB 1W1DA 2MFQA 3NW8A 2CRFA 4MT7A 4PNKA 2HRJA 2QKMA 1E5WA 4DX8A 4P7IA 4C0AA 2DKPA 2KCJA 2KIGA 1ZC3B 3U8ZA 2ABDA 1HB8A 4KHBB 4JKFA 1H10A 3QBVB 2GCJA 2E2XA 2K2UA 4KHAA 5J3TA 4JKCA 2DHJA 2LOXA 5EFXA 4ZRKA 3PEGA 3PSCA 1FGZA 4A5KA 2ZKMX 4HAZB 4A6FA 2YVCA 3E9OA 4F7GA 4HB2B 5D3XA 1MK9B 3SO6A 4ILHA 2CQUA 1TXDA 2OTXA 2ROVA 4JKHA 1ST7A 3UZTA 2RGNB 2KIEA 1X1GA 2KGXB 1P5TA 2XQNM 4JKGA 5I2MA 3SBGA 1X05A 1NTIA 4KHOA 4DIXA 5JHGA 1NU2A 3D8FA 3D8EA 4JKBA 3E9LA 3FM8C 4GPTB 2LOZA 2HTHB 1MIXA 4QJ3B 4HAVB 1FAOA 2Z13A 4CYEA 3SBTA 2EC1A 4TYZA 3ODOA 2YS1A 1LB1A 4NSWA 2MKRA 2RUKB 4IOYX 4MY6A 4IAPA 2CAYA 2COPA 2J0MA 2DLWA 3TVVA 5C5BA 2Z14A 1ZC4B 4OSNA 5D3YA 3CXBB 2LG1A 1ZVRA 4CHJA 1GC7A 3TFMA 2GS0A 2Y7BA 1ZYIA 1OQNA 2RVBB 2Z0QA 1WJ1A 4HDOA 1OMWA 2HE7A 4HHVA 4EMOA 3OANA 5DIFB 2DHKA 2L2IA 4H8SA 1XR0B 4A6HA 1M7EA 3WYFB 2ZPYA 3GYOA 2FJUB 2COFA 2D9WA 4D0NB 2VKIA 4GOUA 2YT0A 3FP5A 1RRPB 3KSYA 3ZVRA 1WI1A 1MPHA 1I2HA 2YT1A 1MAIA 1GGOA 1V88A 4DX90 3HQCA 4KAXB 2FJLA 1U5DA 1MKEA 1ZSQA 3SUZA 3VIAA 1LW3A 1XD4A 4Y94A 1SGHA 4JK7A 5HE2A 3FEHA 2PZ1A 2DIKA 1BTNA 1XX0A 3ULCA 2CY5A 4WVFB 1WG7A 4HB3B 3BINA 3GYPA 2MDXA 5LONB 4Z2NA 1J0WA 1V5PA 4NY0A 4WSFA 3PZDA 1HBKA 1IRSA 1TJ6A 3KRXA 3FSSA 3N7CA 3OHMB 1H4RA 2DHIA 2G35A 5D27A 2W2WA 2D11A 3ZDTA 1UNRA 2ADZA 2KR0A 1DDMA 3PP2A 2YS5A 5D3WA 1FOEA 2R2YA 2QKLA 5FI0A 5JVLA 4BBKA 3HW2B 1Y19B 2L1CA 2ELBA 1M7RA 1UNPA 4YONA 3IVFA 4K81A 4F7HA 1WGUA 1QC6A 1N3HA 3T06A 4QXAB 1X86A 4JKDA 1NTYA 1X1FA 2GUMA 2IYBA 5GOWB 4ILGB 3FLVA 2VSZA 4ZRJA 2EJ8A 3O96A 1ZM0A 5DHAB 3TW1A 5HE1A 3A58A 3SYXA 5DI9B 3PG7A 4L1RA 4GZUA 1JDEA 4HATB 5C16A 3WA0A 2R0DA 3D8DA 2IFSA 1UPRA 4A6KA 1WGQA 1NTVA 4JK9A 2CY4A 2H7DA 4GN1A 1DDVA 3ENBA 1U5FA 5C79A 5CLLB 3KRWA 3MPXA 1U5GA 2D9ZA 1NVLA 5HE0A 3HSAA 3CIKA 4ZRIA 1ISNA 2LBBA 1X11A 2Z0OA 2MWNB 2K49A 2DFKA 5FI1A 2W2XC 2ELAA 2K2JA 2NBVA 3FVCA 5LOPB 4CHMA 2AEHA 5DHFB 3SV1A 2M14A 1SHCA 1KZ7A 1KZGA 1PMSA 1T77A 1BAKA 2COAA 2D9VA 4QJ4B 1U29A 4JK8A 2J0JA 4A6FB 2DTCA 3DXEA 2I1JA 2RNRB 2Z59A 2OQBA 2DX5A 3DCXA 4HDQA 2P0FA 3KY9A 3TO1A 1KC7A 2UZRA 3G9WA 5J3YA 4JKGB 2P0DA 4HAWB 1XODA 2GCLA 4KVGB 5C6RA 3V5WA 2D4QA 4HAUB 1EGXA 1XKEA 1MIZB 4CSQA 2DA0A 4GXBA 2DX1A 2AL6A 3RCPA 3QWMA 5D3VA 4Z2MB 1DROA 5DH9B 5JP4A 3PVLA 3ODXA 2DKQA 4ILJA 2Y8FA 1GG3A 4HAYB 2Q13A 2J59M 4HB4B 2UVMA 3ODWA 2D10A
chains in the Genus database with same CATH topology
1VBHA 1P3RA 3MDBC 1W1HA 1Q67A 3PVUA 1FB8A 1U27A 5C5BB 4HAXB 1UEFA 4YL8A 1DIKA 1J19A 3DXCA 2YS3A 1Y5OA 3F5RA 3ML4A 1K5DB 1V5MA 3LJUX 2K00A 3F0WA 1B55A 5JLJB 1V5UA 2FDQA 1GC6A 5KQ4A 2UZSA 2LULA 3A8PA 1I7AA 4GMVA 3PVWA 3ULBA 3U7DA 2YSZA 1QQGA 4JKAA 1EVHA 2LKOA 1BWNA 3X23A 3NSUA 4PQ0A 2D9XA 4L6EA 2DYNA 4K2OA 1DDWA 1EF1A 1WJMA 2N0YA 4DXAB 2RSGA 1NI2A 4JKEA 3SNHA 2R09A 1KBLA 3QIJA 2X0SA 5J3QA 5IJMA 2YRYA 5HE3A 1Z87A 3DXDA 2NZ8B 4B6HA 4TKNA 3KZ1A 2D9YA 1BTKA 1PFJA 2CB8A 2NMBA 2X18A 3AU4A 4XWXA 2Z0PA 4WJ7A 1V61A 1MK7B 4MK0A 2KUPA 2W2XD 2EMSA 1ACAA 1U2BA 3P7ZA 3AJ4A 3BJIA 4IFSA 2N23A 3HK0A 1VBGA 1UNQA 5KQ1A 1AWEA 1RJ2A 2Y8GA 4HB0B 4GMXB 2J0KA 2I1KA 3P6AA 3A98B 4EKUA 1FHWA 5JHHA 2RLOA 1TQZA 1AQCA 1V89A 4DBBA 1DBHA 2CODA 2H7EA 4F7UP 3E66A 3EPYA 2R82A 5KCVA 1XCGA 2I5FA 1HB6A 3A8QA 4EJNA 1EAZA 1P6SA 1W1GA 2V76A 1UPQA 1WVHA 4K2PA 2I5CA 2RQ1A 3TCAA 3E9PA 2COCA 2JP2A 2EMTA 3VOQA 2LYDA 2WH5A 1FHOA 2YF0A 2M38A 4K17A 3AU5A 1FGYA 3M1IB 2D2QA 2GJYA 1U5EA 5L81A 1PLSA 2ROZB 1KI1B 2BCJA 2VRWB 1K5GB 2FJ9A 1DYNA 2DN6A 1FHXA 1OY2A 2P8VA 2P0HA 2DYQA 5CLQB 1W1DA 2MFQA 2CRFA 4MT7A 4PNKA 2HRJA 2QKMA 1E5WA 4DX8A 4P7IA 4C0AA 2DKPA 2KCJA 1ZC3B 3U8ZA 2ABDA 1HB8A 4KHBB 4JKFA 1H10A 3QBVB 2GCJA 2E2XA 2K2UA 4KHAA 5J3TA 4JKCA 2DHJA 2LOXA 5EFXA 4ZRKA 3PEGA 3PSCA 1FGZA 4A5KA 4HAZB 4A6FA 2YVCA 3E9OA 4F7GA 4HB2B 5D3XA 1MK9B 3SO6A 4ILHA 2CQUA 1TXDA 2OTXA 2ROVA 4JKHA 1ST7A 3UZTA 2RGNB 1X1GA 2KGXB 1P5TA 2XQNM 4JKGA 3SBGA 1X05A 1NTIA 4KHOA 5JHGA 1NU2A 3D8FA 3D8EA 4JKBA 3E9LA 3FM8C 4GPTB 2LOZA 2HTHB 1MIXA 4HAVB 1FAOA 4CYEA 3SBTA 2EC1A 4TYZA 3ODOA 2YS1A 1LB1A 4NSWA 2MKRA 2RUKB 4IOYX 4MY6A 4IAPA 2CAYA 2COPA 2J0MA 2DLWA 3TVVA 5C5BA 1ZC4B 5D3YA 3CXBB 2LG1A 1ZVRA 4CHJA 1GC7A 3TFMA 2GS0A 2Y7BA 1OQNA 2RVBB 2Z0QA 1WJ1A 4HDOA 1OMWA 2HE7A 4HHVA 4EMOA 3OANA 5DIFB 2DHKA 2L2IA 4H8SA 1XR0B 4A6HA 1M7EA 3WYFB 2ZPYA 3GYOA 2COFA 2D9WA 4D0NB 2VKIA 2YT0A 3FP5A 1RRPB 3KSYA 3ZVRA 1WI1A 1MPHA 1I2HA 2YT1A 1MAIA 1GGOA 1V88A 4DX90 3HQCA 4KAXB 2FJLA 1U5DA 1MKEA 1ZSQA 3SUZA 3VIAA 1LW3A 1XD4A 4Y94A 1SGHA 4JK7A 5HE2A 3FEHA 2PZ1A 2DIKA 1BTNA 1XX0A 3ULCA 2CY5A 4WVFB 1WG7A 4HB3B 3BINA 3GYPA 2MDXA 5LONB 4Z2NA 1J0WA 1V5PA 4NY0A 4WSFA 3PZDA 1HBKA 1IRSA 1TJ6A 3KRXA 3FSSA 3N7CA 1H4RA 2DHIA 2G35A 5D27A 2W2WA 2D11A 3ZDTA 1UNRA 2ADZA 1DDMA 3PP2A 2YS5A 5D3WA 1FOEA 2QKLA 5FI0A 5JVLA 4BBKA 3HW2B 1Y19B 2L1CA 2ELBA 1M7RA 1UNPA 4YONA 3IVFA 4K81A 4F7HA 1WGUA 1QC6A 1N3HA 3T06A 1X86A 4JKDA 1NTYA 1X1FA 2IYBA 5GOWB 4ILGB 3FLVA 2VSZA 4ZRJA 2EJ8A 3O96A 1ZM0A 5DHAB 3TW1A 5HE1A 3SYXA 5DI9B 3PG7A 4GZUA 1JDEA 4HATB 5C16A 3WA0A 2R0DA 3D8DA 2IFSA 1UPRA 4A6KA 1WGQA 1NTVA 4JK9A 2CY4A 2H7DA 4GN1A 1DDVA 3ENBA 1U5FA 5C79A 5CLLB 3KRWA 3MPXA 1U5GA 2D9ZA 1NVLA 5HE0A 3CIKA 4ZRIA 1ISNA 2LBBA 1X11A 2Z0OA 2MWNB 2DFKA 5FI1A 2W2XC 2ELAA 2K2JA 5LOPB 4CHMA 2AEHA 5DHFB 3SV1A 2M14A 1SHCA 1KZ7A 1KZGA 1PMSA 1BAKA 2COAA 2D9VA 1U29A 4JK8A 2J0JA 4A6FB 2DTCA 3DXEA 2I1JA 2RNRB 2OQBA 2DX5A 4HDQA 2P0FA 3KY9A 3TO1A 1KC7A 2UZRA 3G9WA 5J3YA 4JKGB 2P0DA 4HAWB 1XODA 2GCLA 4KVGB 5C6RA 3V5WA 2D4QA 4HAUB 1EGXA 1XKEA 1MIZB 2DA0A 4GXBA 2DX1A 2AL6A 3RCPA 3QWMA 5D3VA 4Z2MB 1DROA 5DH9B 5JP4A 3PVLA 3ODXA 2DKQA 4ILJA 2Y8FA 1GG3A 4HAYB 2Q13A 2J59M 4HB4B 2UVMA 3ODWA 2D10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P3R A;  3MDB C;  1W1H A;  1Q67 A;  3PVU A;  1FB8 A;  1U27 A;  5C5B B;  4HAX B;  1UEF A;  4YL8 A;  1J19 A;  3DXC A;  2YS3 A;  1Y5O A;  3F5R A;  3ML4 A;  1K5D B;  1V5M A;  3LJU X;  2K00 A;  3F0W A;  1B55 A;  5JLJ B;  1V5U A;  2FDQ A;  1GC6 A;  5KQ4 A;  2UZS A;  2LUL A;  3A8P A;  1I7A A;  4GMV A;  3PVW A;  3ULB A;  3U7D A;  2YSZ A;  1QQG A;  1EVH A;  2LKO A;  1BWN A;  3X23 A;  3NSU A;  4PQ0 A;  2D9X A;  4L6E A;  2DYN A;  4K2O A;  1DDW A;  1EF1 A;  1WJM A;  2N0Y A;  4DXA B;  2RSG A;  1NI2 A;  3SNH A;  2R09 A;  3QIJ A;  5J3Q A;  5IJM A;  2YRY A;  5HE3 A;  1Z87 A;  3DXD A;  2NZ8 B;  4B6H A;  4TKN A;  3KZ1 A;  2D9Y A;  1BTK A;  1PFJ A;  2CB8 A;  2NMB A;  2X18 A;  3AU4 A;  4XWX A;  2Z0P A;  4WJ7 A;  1V61 A;  1MK7 B;  4MK0 A;  2KUP A;  2W2X D;  2EMS A;  1ACA A;  1U2B A;  3P7Z A;  3AJ4 A;  3BJI A;  4IFS A;  2N23 A;  3HK0 A;  1UNQ A;  5KQ1 A;  1AWE A;  1RJ2 A;  2Y8G A;  4HB0 B;  4GMX B;  2J0K A;  2I1K A;  3P6A A;  3A98 B;  4EKU A;  1FHW A;  5JHH A;  2RLO A;  1TQZ A;  1AQC A;  1V89 A;  4DBB A;  1DBH A;  2COD A;  2H7E A;  4F7U P;  3EPY A;  5KCV A;  1XCG A;  2I5F A;  1HB6 A;  3A8Q A;  4EJN A;  1EAZ A;  1P6S A;  1W1G A;  2V76 A;  1UPQ A;  1WVH A;  4K2P A;  2I5C A;  2RQ1 A;  3TCA A;  2COC A;  2JP2 A;  2EMT A;  3VOQ A;  2LYD A;  2WH5 A;  1FHO A;  2YF0 A;  2M38 A;  4K17 A;  3AU5 A;  1FGY A;  3M1I B;  2D2Q A;  2GJY A;  1U5E A;  5L81 A;  1PLS A;  2ROZ B;  1KI1 B;  2BCJ A;  2VRW B;  1K5G B;  2FJ9 A;  1DYN A;  2DN6 A;  1FHX A;  1OY2 A;  2P8V A;  2P0H A;  2DYQ A;  5CLQ B;  1W1D A;  2MFQ A;  2CRF A;  4MT7 A;  4PNK A;  2HRJ A;  2QKM A;  1E5W A;  4DX8 A;  4P7I A;  4C0A A;  2DKP A;  2KCJ A;  1ZC3 B;  3U8Z A;  2ABD A;  1HB8 A;  4KHB B;  1H10 A;  3QBV B;  2GCJ A;  2E2X A;  2K2U A;  4KHA A;  5J3T A;  2LOX A;  2DHJ A;  5EFX A;  4ZRK A;  3PEG A;  3PSC A;  1FGZ A;  4A5K A;  4HAZ B;  4A6F A;  2YVC A;  4F7G A;  4HB2 B;  5D3X A;  1MK9 B;  3SO6 A;  2CQU A;  1TXD A;  2OTX A;  2ROV A;  1ST7 A;  3UZT A;  2RGN B;  1X1G A;  2KGX B;  1P5T A;  2XQN M;  1X05 A;  1NTI A;  4KHO A;  5JHG A;  1NU2 A;  3D8F A;  3D8E A;  3FM8 C;  4GPT B;  2LOZ A;  2HTH B;  1MIX A;  4HAV B;  1FAO A;  4CYE A;  2EC1 A;  4TYZ A;  3ODO A;  2YS1 A;  1LB1 A;  4NSW A;  2MKR A;  2RUK B;  4IOY X;  4MY6 A;  4IAP A;  2CAY A;  2COP A;  2J0M A;  2DLW A;  3TVV A;  5C5B A;  1ZC4 B;  5D3Y A;  3CXB B;  2LG1 A;  1ZVR A;  4CHJ A;  1GC7 A;  3TFM A;  2GS0 A;  2Y7B A;  1OQN A;  2RVB B;  2Z0Q A;  1WJ1 A;  4HDO A;  1OMW A;  2HE7 A;  4HHV A;  4EMO A;  3OAN A;  5DIF B;  2DHK A;  2L2I A;  4H8S A;  1XR0 B;  4A6H A;  1M7E A;  3WYF B;  2ZPY A;  3GYO A;  2COF A;  2D9W A;  4D0N B;  2VKI A;  2YT0 A;  3FP5 A;  1RRP B;  3KSY A;  3ZVR A;  1WI1 A;  1MPH A;  1I2H A;  2YT1 A;  1MAI A;  1V88 A;  4DX9 0;  3HQC A;  4KAX B;  2FJL A;  1U5D A;  1MKE A;  1ZSQ A;  3SUZ A;  3VIA A;  1LW3 A;  1XD4 A;  4Y94 A;  1SGH A;  5HE2 A;  3FEH A;  2PZ1 A;  1BTN A;  1XX0 A;  3ULC A;  2CY5 A;  4WVF B;  1WG7 A;  4HB3 B;  3BIN A;  3GYP A;  2MDX A;  5LON B;  4Z2N A;  1J0W A;  1V5P A;  4NY0 A;  4WSF A;  3PZD A;  1HBK A;  1IRS A;  1TJ6 A;  3KRX A;  3FSS A;  3N7C A;  1H4R A;  2DHI A;  2G35 A;  5D27 A;  2W2W A;  2D11 A;  3ZDT A;  1UNR A;  2ADZ A;  1DDM A;  3PP2 A;  2YS5 A;  5D3W A;  1FOE A;  2QKL A;  5FI0 A;  4BBK A;  3HW2 B;  1Y19 B;  2L1C A;  2ELB A;  1M7R A;  1UNP A;  4YON A;  3IVF A;  4K81 A;  4F7H A;  1WGU A;  1QC6 A;  1N3H A;  3T06 A;  1X86 A;  1X1F A;  1NTY A;  2IYB A;  5GOW B;  3FLV A;  2VSZ A;  4ZRJ A;  2EJ8 A;  3O96 A;  1ZM0 A;  5DHA B;  3TW1 A;  5HE1 A;  3SYX A;  5DI9 B;  3PG7 A;  4GZU A;  4HAT B;  5C16 A;  3WA0 A;  2R0D A;  3D8D A;  2IFS A;  1UPR A;  4A6K A;  1WGQ A;  1NTV A;  2CY4 A;  2H7D A;  4GN1 A;  1DDV A;  1U5F A;  5C79 A;  5CLL B;  3KRW A;  3MPX A;  1U5G A;  2D9Z A;  1NVL A;  5HE0 A;  3CIK A;  4ZRI A;  1ISN A;  2LBB A;  1X11 A;  2Z0O A;  2MWN B;  2DFK A;  5FI1 A;  2W2X C;  2ELA A;  2K2J A;  5LOP B;  4CHM A;  2AEH A;  5DHF B;  3SV1 A;  2M14 A;  1SHC A;  1KZ7 A;  1KZG A;  1PMS A;  1BAK A;  2COA A;  2D9V A;  1U29 A;  2J0J A;  4A6F B;  2DTC A;  3DXE A;  2I1J A;  2RNR B;  2OQB A;  2DX5 A;  4HDQ A;  2P0F A;  3KY9 A;  3TO1 A;  2UZR A;  3G9W A;  5J3Y A;  4HAW B;  2P0D A;  1XOD A;  2GCL A;  4KVG B;  5C6R A;  3V5W A;  2D4Q A;  4HAU B;  1EGX A;  1XKE A;  1MIZ B;  2DA0 A;  4GXB A;  2DX1 A;  2AL6 A;  3RCP A;  3QWM A;  5D3V A;  4Z2M B;  1DRO A;  5DH9 B;  5JP4 A;  3PVL A;  3ODX A;  2DKQ A;  2Y8F A;  1GG3 A;  4HAY B;  2Q13 A;  2J59 M;  4HB4 B;  2UVM A;  3ODW A;  2D10 A; 
#chains in the Genus database with same CATH topology
 1VBH A;  1P3R A;  3B77 A;  3MDB C;  1W1H A;  1Q67 A;  3PVU A;  1FB8 A;  1U27 A;  5C5B B;  4HAX B;  1UEF A;  4YL8 A;  1DIK A;  1J19 A;  3DXC A;  3NWA A;  2YS3 A;  1Y5O A;  3F5R A;  3ML4 A;  1K5D B;  1V5M A;  3LJU X;  3NWF A;  2K00 A;  3F0W A;  1B55 A;  5JLJ B;  1V5U A;  2FDQ A;  1MI1 A;  5M4Y B;  1GC6 A;  5KQ4 A;  2UZS A;  2LUL A;  3A8P A;  1I7A A;  4GMV A;  3PVW A;  3ULB A;  3U7D A;  3U12 A;  2YSZ A;  1QQG A;  4JKA A;  1EVH A;  2LKO A;  1BWN A;  3X23 A;  3NSU A;  4PQ0 A;  2D9X A;  2Z4D A;  4L6E A;  2DYN A;  4K2O A;  1DDW A;  1EF1 A;  1WJM A;  2N0Y A;  4DXA B;  2RSG A;  3NWD A;  1NI2 A;  4JKE A;  4GNK B;  2R09 A;  3SNH A;  1KBL A;  3QIJ A;  2K8E A;  2X0S A;  5J3Q A;  5IJM A;  2YRY A;  5HE3 A;  1Z87 A;  3DXD A;  2NZ8 B;  4B6H A;  4TKN A;  3KZ1 A;  2D9Y A;  3HIE A;  4HSI A;  1BTK A;  1PFJ A;  2CB8 A;  2NMB A;  2X18 A;  3AU4 A;  5IRS A;  4XWX A;  2Z0P A;  4WJ7 A;  4D6W A;  1V61 A;  1MK7 B;  4MK0 A;  2KUP A;  2W2X D;  2EMS A;  1ACA A;  1U2B A;  3P7Z A;  3AJ4 A;  3BJI A;  4IFS A;  2N23 A;  3HK0 A;  1VBG A;  4KHB A;  4OT1 A;  1UNQ A;  5KQ1 A;  1AWE A;  1RJ2 A;  2Y8G A;  4HB0 B;  4GMX B;  2J0K A;  2I1K A;  3P6A A;  3A98 B;  4EKU A;  1FHW A;  5JHH A;  2RLO A;  5I2S A;  2YT2 A;  1TQZ A;  1AQC A;  1V89 A;  4DBB A;  1DBH A;  2COD A;  5LG4 B;  2H7E A;  4F7U P;  3E66 A;  3EPY A;  2R82 A;  5KCV A;  1XCG A;  2I5F A;  1HB6 A;  3A8Q A;  4EJN A;  1EAZ A;  2RRF A;  1P6S A;  1W1G A;  2V76 A;  1UPQ A;  1WVH A;  4K2P A;  2I5C A;  2RQ1 A;  3TCA A;  3E9P A;  2COC A;  2JP2 A;  2EMT A;  3VOQ A;  2LYD A;  2WH5 A;  1FHO A;  2YF0 A;  2M38 A;  4K17 A;  3AU5 A;  1FGY A;  3M1I B;  2D2Q A;  2GJY A;  1U5E A;  5L81 A;  1PLS A;  4QJ5 B;  2ROZ B;  1KI1 B;  2BCJ A;  2VRW B;  1K5G B;  2FJ9 A;  1DYN A;  2DN6 A;  1FHX A;  1OY2 A;  2P8V A;  2P0H A;  2KUQ A;  2DYQ A;  5CLQ B;  1W1D A;  2MFQ A;  3NW8 A;  2CRF A;  4MT7 A;  4PNK A;  2HRJ A;  2QKM A;  1E5W A;  4DX8 A;  4P7I A;  4C0A A;  2DKP A;  2KCJ A;  2KIG A;  1ZC3 B;  3U8Z A;  2ABD A;  1HB8 A;  4KHB B;  4JKF A;  1H10 A;  3QBV B;  2GCJ A;  2E2X A;  2K2U A;  4KHA A;  5J3T A;  4JKC A;  2DHJ A;  2LOX A;  5EFX A;  4ZRK A;  3PEG A;  3PSC A;  1FGZ A;  4A5K A;  2ZKM X;  4HAZ B;  4A6F A;  2YVC A;  3E9O A;  4F7G A;  4HB2 B;  5D3X A;  1MK9 B;  3SO6 A;  4ILH A;  2CQU A;  1TXD A;  2OTX A;  2ROV A;  4JKH A;  1ST7 A;  3UZT A;  2RGN B;  2KIE A;  1X1G A;  2KGX B;  1P5T A;  2XQN M;  4JKG A;  5I2M A;  3SBG A;  1X05 A;  1NTI A;  4KHO A;  4DIX A;  5JHG A;  1NU2 A;  3D8F A;  3D8E A;  4JKB A;  3E9L A;  3FM8 C;  4GPT B;  2LOZ A;  2HTH B;  1MIX A;  4QJ3 B;  4HAV B;  1FAO A;  2Z13 A;  4CYE A;  3SBT A;  2EC1 A;  4TYZ A;  3ODO A;  2YS1 A;  1LB1 A;  4NSW A;  2MKR A;  2RUK B;  4IOY X;  4MY6 A;  4IAP A;  2CAY A;  2COP A;  2J0M A;  2DLW A;  3TVV A;  5C5B A;  2Z14 A;  1ZC4 B;  4OSN A;  5D3Y A;  3CXB B;  2LG1 A;  1ZVR A;  4CHJ A;  1GC7 A;  3TFM A;  2GS0 A;  2Y7B A;  1ZYI A;  1OQN A;  2RVB B;  2Z0Q A;  1WJ1 A;  4HDO A;  1OMW A;  2HE7 A;  4HHV A;  4EMO A;  3OAN A;  5DIF B;  2DHK A;  2L2I A;  4H8S A;  1XR0 B;  4A6H A;  1M7E A;  3WYF B;  2ZPY A;  3GYO A;  2FJU B;  2COF A;  2D9W A;  4D0N B;  2VKI A;  4GOU A;  2YT0 A;  3FP5 A;  1RRP B;  3KSY A;  3ZVR A;  1WI1 A;  1MPH A;  1I2H A;  2YT1 A;  1MAI A;  1GGO A;  1V88 A;  4DX9 0;  3HQC A;  4KAX B;  2FJL A;  1U5D A;  1MKE A;  1ZSQ A;  3SUZ A;  3VIA A;  1LW3 A;  1XD4 A;  4Y94 A;  1SGH A;  4JK7 A;  5HE2 A;  3FEH A;  2PZ1 A;  2DIK A;  1BTN A;  1XX0 A;  3ULC A;  2CY5 A;  4WVF B;  1WG7 A;  4HB3 B;  3BIN A;  3GYP A;  2MDX A;  5LON B;  4Z2N A;  1J0W A;  1V5P A;  4NY0 A;  4WSF A;  3PZD A;  1HBK A;  1IRS A;  1TJ6 A;  3KRX A;  3FSS A;  3N7C A;  3OHM B;  1H4R A;  2DHI A;  2G35 A;  5D27 A;  2W2W A;  2D11 A;  3ZDT A;  1UNR A;  2ADZ A;  2KR0 A;  1DDM A;  3PP2 A;  2YS5 A;  5D3W A;  1FOE A;  2R2Y A;  2QKL A;  5FI0 A;  5JVL A;  4BBK A;  3HW2 B;  1Y19 B;  2L1C A;  2ELB A;  1M7R A;  1UNP A;  4YON A;  3IVF A;  4K81 A;  4F7H A;  1WGU A;  1QC6 A;  1N3H A;  3T06 A;  4QXA B;  1X86 A;  4JKD A;  1NTY A;  1X1F A;  2GUM A;  2IYB A;  5GOW B;  4ILG B;  3FLV A;  2VSZ A;  4ZRJ A;  2EJ8 A;  3O96 A;  1ZM0 A;  5DHA B;  3TW1 A;  5HE1 A;  3A58 A;  3SYX A;  5DI9 B;  3PG7 A;  4L1R A;  4GZU A;  1JDE A;  4HAT B;  5C16 A;  3WA0 A;  2R0D A;  3D8D A;  2IFS A;  1UPR A;  4A6K A;  1WGQ A;  1NTV A;  4JK9 A;  2CY4 A;  2H7D A;  4GN1 A;  1DDV A;  3ENB A;  1U5F A;  5C79 A;  5CLL B;  3KRW A;  3MPX A;  1U5G A;  2D9Z A;  1NVL A;  5HE0 A;  3HSA A;  3CIK A;  4ZRI A;  1ISN A;  2LBB A;  1X11 A;  2Z0O A;  2MWN B;  2K49 A;  2DFK A;  5FI1 A;  2W2X C;  2ELA A;  2K2J A;  2NBV A;  3FVC A;  5LOP B;  4CHM A;  2AEH A;  5DHF B;  3SV1 A;  2M14 A;  1SHC A;  1KZ7 A;  1KZG A;  1PMS A;  1T77 A;  1BAK A;  2COA A;  2D9V A;  4QJ4 B;  1U29 A;  4JK8 A;  2J0J A;  4A6F B;  2DTC A;  3DXE A;  2I1J A;  2RNR B;  2Z59 A;  2OQB A;  2DX5 A;  3DCX A;  4HDQ A;  2P0F A;  3KY9 A;  3TO1 A;  1KC7 A;  2UZR A;  3G9W A;  5J3Y A;  4JKG B;  2P0D A;  4HAW B;  1XOD A;  2GCL A;  4KVG B;  5C6R A;  3V5W A;  2D4Q A;  4HAU B;  1EGX A;  1XKE A;  1MIZ B;  4CSQ A;  2DA0 A;  4GXB A;  2DX1 A;  2AL6 A;  3RCP A;  3QWM A;  5D3V A;  4Z2M B;  1DRO A;  5DH9 B;  5JP4 A;  3PVL A;  3ODX A;  2DKQ A;  4ILJ A;  2Y8F A;  1GG3 A;  4HAY B;  2Q13 A;  2J59 M;  4HB4 B;  2UVM A;  3ODW A;  2D10 A; 
#chains in the Genus database with same CATH homology
 1VBH A;  1P3R A;  3MDB C;  1W1H A;  1Q67 A;  3PVU A;  1FB8 A;  1U27 A;  5C5B B;  4HAX B;  1UEF A;  4YL8 A;  1DIK A;  1J19 A;  3DXC A;  2YS3 A;  1Y5O A;  3F5R A;  3ML4 A;  1K5D B;  1V5M A;  3LJU X;  2K00 A;  3F0W A;  1B55 A;  5JLJ B;  1V5U A;  2FDQ A;  1GC6 A;  5KQ4 A;  2UZS A;  2LUL A;  3A8P A;  1I7A A;  4GMV A;  3PVW A;  3ULB A;  3U7D A;  2YSZ A;  1QQG A;  4JKA A;  1EVH A;  2LKO A;  1BWN A;  3X23 A;  3NSU A;  4PQ0 A;  2D9X A;  4L6E A;  2DYN A;  4K2O A;  1DDW A;  1EF1 A;  1WJM A;  2N0Y A;  4DXA B;  2RSG A;  1NI2 A;  4JKE A;  3SNH A;  2R09 A;  1KBL A;  3QIJ A;  2X0S A;  5J3Q A;  5IJM A;  2YRY A;  5HE3 A;  1Z87 A;  3DXD A;  2NZ8 B;  4B6H A;  4TKN A;  3KZ1 A;  2D9Y A;  1BTK A;  1PFJ A;  2CB8 A;  2NMB A;  2X18 A;  3AU4 A;  4XWX A;  2Z0P A;  4WJ7 A;  1V61 A;  1MK7 B;  4MK0 A;  2KUP A;  2W2X D;  2EMS A;  1ACA A;  1U2B A;  3P7Z A;  3AJ4 A;  3BJI A;  4IFS A;  2N23 A;  3HK0 A;  1VBG A;  1UNQ A;  5KQ1 A;  1AWE A;  1RJ2 A;  2Y8G A;  4HB0 B;  4GMX B;  2J0K A;  2I1K A;  3P6A A;  3A98 B;  4EKU A;  1FHW A;  5JHH A;  2RLO A;  1TQZ A;  1AQC A;  1V89 A;  4DBB A;  1DBH A;  2COD A;  2H7E A;  4F7U P;  3E66 A;  3EPY A;  2R82 A;  5KCV A;  1XCG A;  2I5F A;  1HB6 A;  3A8Q A;  4EJN A;  1EAZ A;  1P6S A;  1W1G A;  2V76 A;  1UPQ A;  1WVH A;  4K2P A;  2I5C A;  2RQ1 A;  3TCA A;  3E9P A;  2COC A;  2JP2 A;  2EMT A;  3VOQ A;  2LYD A;  2WH5 A;  1FHO A;  2YF0 A;  2M38 A;  4K17 A;  3AU5 A;  1FGY A;  3M1I B;  2D2Q A;  2GJY A;  1U5E A;  5L81 A;  1PLS A;  2ROZ B;  1KI1 B;  2BCJ A;  2VRW B;  1K5G B;  2FJ9 A;  1DYN A;  2DN6 A;  1FHX A;  1OY2 A;  2P8V A;  2P0H A;  2DYQ A;  5CLQ B;  1W1D A;  2MFQ A;  2CRF A;  4MT7 A;  4PNK A;  2HRJ A;  2QKM A;  1E5W A;  4DX8 A;  4P7I A;  4C0A A;  2DKP A;  2KCJ A;  1ZC3 B;  3U8Z A;  2ABD A;  1HB8 A;  4KHB B;  4JKF A;  1H10 A;  3QBV B;  2GCJ A;  2E2X A;  2K2U A;  4KHA A;  5J3T A;  4JKC A;  2DHJ A;  2LOX A;  5EFX A;  4ZRK A;  3PEG A;  3PSC A;  1FGZ A;  4A5K A;  4HAZ B;  4A6F A;  2YVC A;  3E9O A;  4F7G A;  4HB2 B;  5D3X A;  1MK9 B;  3SO6 A;  4ILH A;  2CQU A;  1TXD A;  2OTX A;  2ROV A;  4JKH A;  1ST7 A;  3UZT A;  2RGN B;  1X1G A;  2KGX B;  1P5T A;  2XQN M;  4JKG A;  3SBG A;  1X05 A;  1NTI A;  4KHO A;  5JHG A;  1NU2 A;  3D8F A;  3D8E A;  4JKB A;  3E9L A;  3FM8 C;  4GPT B;  2LOZ A;  2HTH B;  1MIX A;  4HAV B;  1FAO A;  4CYE A;  3SBT A;  2EC1 A;  4TYZ A;  3ODO A;  2YS1 A;  1LB1 A;  4NSW A;  2MKR A;  2RUK B;  4IOY X;  4MY6 A;  4IAP A;  2CAY A;  2COP A;  2J0M A;  2DLW A;  3TVV A;  5C5B A;  1ZC4 B;  5D3Y A;  3CXB B;  2LG1 A;  1ZVR A;  4CHJ A;  1GC7 A;  3TFM A;  2GS0 A;  2Y7B A;  1OQN A;  2RVB B;  2Z0Q A;  1WJ1 A;  4HDO A;  1OMW A;  2HE7 A;  4HHV A;  4EMO A;  3OAN A;  5DIF B;  2DHK A;  2L2I A;  4H8S A;  1XR0 B;  4A6H A;  1M7E A;  3WYF B;  2ZPY A;  3GYO A;  2COF A;  2D9W A;  4D0N B;  2VKI A;  2YT0 A;  3FP5 A;  1RRP B;  3KSY A;  3ZVR A;  1WI1 A;  1MPH A;  1I2H A;  2YT1 A;  1MAI A;  1GGO A;  1V88 A;  4DX9 0;  3HQC A;  4KAX B;  2FJL A;  1U5D A;  1MKE A;  1ZSQ A;  3SUZ A;  3VIA A;  1LW3 A;  1XD4 A;  4Y94 A;  1SGH A;  4JK7 A;  5HE2 A;  3FEH A;  2PZ1 A;  2DIK A;  1BTN A;  1XX0 A;  3ULC A;  2CY5 A;  4WVF B;  1WG7 A;  4HB3 B;  3BIN A;  3GYP A;  2MDX A;  5LON B;  4Z2N A;  1J0W A;  1V5P A;  4NY0 A;  4WSF A;  3PZD A;  1HBK A;  1IRS A;  1TJ6 A;  3KRX A;  3FSS A;  3N7C A;  1H4R A;  2DHI A;  2G35 A;  5D27 A;  2W2W A;  2D11 A;  3ZDT A;  1UNR A;  2ADZ A;  1DDM A;  3PP2 A;  2YS5 A;  5D3W A;  1FOE A;  2QKL A;  5FI0 A;  5JVL A;  4BBK A;  3HW2 B;  1Y19 B;  2L1C A;  2ELB A;  1M7R A;  1UNP A;  4YON A;  3IVF A;  4K81 A;  4F7H A;  1WGU A;  1QC6 A;  1N3H A;  3T06 A;  1X86 A;  4JKD A;  1NTY A;  1X1F A;  2IYB A;  5GOW B;  4ILG B;  3FLV A;  2VSZ A;  4ZRJ A;  2EJ8 A;  3O96 A;  1ZM0 A;  5DHA B;  3TW1 A;  5HE1 A;  3SYX A;  5DI9 B;  3PG7 A;  4GZU A;  1JDE A;  4HAT B;  5C16 A;  3WA0 A;  2R0D A;  3D8D A;  2IFS A;  1UPR A;  4A6K A;  1WGQ A;  1NTV A;  4JK9 A;  2CY4 A;  2H7D A;  4GN1 A;  1DDV A;  3ENB A;  1U5F A;  5C79 A;  5CLL B;  3KRW A;  3MPX A;  1U5G A;  2D9Z A;  1NVL A;  5HE0 A;  3CIK A;  4ZRI A;  1ISN A;  2LBB A;  1X11 A;  2Z0O A;  2MWN B;  2DFK A;  5FI1 A;  2W2X C;  2ELA A;  2K2J A;  5LOP B;  4CHM A;  2AEH A;  5DHF B;  3SV1 A;  2M14 A;  1SHC A;  1KZ7 A;  1KZG A;  1PMS A;  1BAK A;  2COA A;  2D9V A;  1U29 A;  4JK8 A;  2J0J A;  4A6F B;  2DTC A;  3DXE A;  2I1J A;  2RNR B;  2OQB A;  2DX5 A;  4HDQ A;  2P0F A;  3KY9 A;  3TO1 A;  1KC7 A;  2UZR A;  3G9W A;  5J3Y A;  4JKG B;  2P0D A;  4HAW B;  1XOD A;  2GCL A;  4KVG B;  5C6R A;  3V5W A;  2D4Q A;  4HAU B;  1EGX A;  1XKE A;  1MIZ B;  2DA0 A;  4GXB A;  2DX1 A;  2AL6 A;  3RCP A;  3QWM A;  5D3V A;  4Z2M B;  1DRO A;  5DH9 B;  5JP4 A;  3PVL A;  3ODX A;  2DKQ A;  4ILJ A;  2Y8F A;  1GG3 A;  4HAY B;  2Q13 A;  2J59 M;  4HB4 B;  2UVM A;  3ODW A;  2D10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...