4F7GA

Crystal structure of talin autoinhibition complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
192
structure length
192
Chain Sequence
PVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel membrane-dependent on/off switch mechanism of talin FERM domain at sites of cell adhesion.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
molecule keywords Talin-1
total genus 56
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2012-05-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4f7gA01
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4f7gA02
5HE0A 4ZRIA 2FDQA 3ZVRA 1P5TA 3FP5A 1UNPA 3FLVA 4A6KA 3QIJA 3DXDA 2Q13A 3U7DA 1WJMA 3PP2A 1SHCA 3PEGA 4P7IA 3D8FA 1PLSA 5C5BB 1AQCA 1U2BA 2W2WA 1TJ6A 2DX5A 2FJLA 2YS1A 2CY5A 1UPQA 3HW2B 5FI1A 1OQNA 3FEHA 2ELAA 2X18A 2MFQA 5JP4A 2QKLA 3DXEA 2LOZA 4CHMA 3RCPA 1SGHA 4EKUA 5DH9B 2Y8GA 4K17A 1NI2A 5KQ1A 3ODOA 3PVUA 1EAZA 3X23A 1AWEA 2D9VA 3A8PA 3PG7A 1QQGA 2Y8FA 4EMOA 3G9WA 4GZUA 1H10A 2R0DA 2UZRA 3OANA 5FI0A 1V88A 4KHAA 1BTNA 2D9YA 1NTVA 1N3HA 3D8EA 2DA0A 1UNQA 2RLOA 2LULA 2HE7A 1X1GA 1KZGA 1V61A 2CODA 2LKOA 2AEHA 1M7EA 4DX8A 2K2JA 4F7HA 2XQNM 1Y5OA 4K2PA 3ODWA 3N7CA 2KGXB 1W1HA 2DHJA 2GS0A 4GXBA 1ST7A 5JHHA 2K2UA 3KSYA 3IVFA 5CLQB 5JHGA 3BINA 2H7DA 1UEFA 1NTYA 5LONB 1BAKA 1DDVA 4TYZA 1FHWA 4F7GA 5D3WA 2YT0A 2JP2A 1V5PA 2EMSA 3DXCA 1MAIA 1V89A 3EPYA 1FOEA 3BJIA 4BBKA 3TFMA 4MY6A 2DX1A 1OMWA 4HB2B 2DN6A 4MT7A 2D9XA 1DYNA 3V5WA 2ZPYA 1ZC4B 1E5WA 4A6FA 2I5CA 4K2OA 4KHBB 5CLLB 1B55A 2D11A 4HDOA 3MPXA 1U5EA 2CRFA 4F7UP 4A5KA 2J0MA 4HB0B 4TKNA 4H8SA 2M38A 4GN1A 1XR0B 1XCGA 4NY0A 1BTKA 2L1CA 2DTCA 2GCLA 2N23A 2Y7BA 2E2XA 2P8VA 4C0AA 5J3TA 4HAUB 2NZ8B 4HB3B 5GOWB 1HB8A 5EFXA 1TQZA 4Z2MB 5D3XA 3VIAA 2J59M 2LYDA 3AU5A 1GC6A 1LB1A 2CB8A 1FB8A 3ML4A 3VOQA 1XKEA 1MKEA 2P0HA 1EVHA 4B6HA 1WG7A 1KZ7A 1FAOA 4K81A 1NTIA 1U5FA 1I2HA 1MK7B 1NVLA 2GJYA 2WH5A 4D0NB 2MKRA 1W1GA 3KRWA 1FHOA 2P0DA 1WGUA 2ROZB 2Z0QA 2ADZA 5D3VA 1EGXA 2KCJA 1DROA 3KRXA 1K5DB 1V5MA 1ZSQA 5KCVA 1XX0A 2I1JA 1DDWA 1UNRA 1U5GA 1HBKA 3TW1A 4HAYB 1Q67A 4ZRJA 2RUKB 1ISNA 2V76A 1MPHA 2NMBA 1RRPB 4YONA 3A8QA 3NSUA 4GPTB 4IOYX 5J3QA 3SO6A 5C6RA 3WA0A 2VSZA 3F0WA 3TCAA 3FSSA 1GG3A 2W2XD 2YRYA 3CXBB 2RSGA 1FGYA 1H4RA 2YS5A 1ZVRA 3U8ZA 2R09A 4KVGB 2GCJA 3ULCA 2CQUA 4WVFB 4Z2NA 3P7ZA 4A6FB 5L81A 4IFSA 1ZC3B 1X11A 3SUZA 4CHJA 4HATB 4KAXB 5HE3A 2VRWB 4HB4B 2HRJA 2Z0OA 1K5GB 3D8DA 5KQ4A 1J0WA 5LOPB 5IJMA 1ACAA 2N0YA 1DBHA 4GMXB 2DKPA 1Y19B 2MDXA 5DHAB 1OY2A 2RQ1A 3AU4A 2LOXA 2OTXA 2FJ9A 3PVWA 4A6HA 1Z87A 1NU2A 2ABDA 2G35A 3HK0A 4EJNA 3PZDA 1BWNA 2COFA 3SNHA 2CAYA 2RNRB 2DHIA 4PNKA 3O96A 3T06A 4HAVB 3M1IB 1WJ1A 1QC6A 3KY9A 3UZTA 3GYOA 1P6SA 3SYXA 3TVVA 1XD4A 2DYNA 1J19A 1X86A 3KZ1A 5C16A 1PMSA 2UVMA 1P3RA 2Z0PA 3LJUX 2DHKA 2AL6A 2D9ZA 5DIFB 3CIKA 1WGQA 4L6EA 3AJ4A 3F5RA 2W2XC 4HAWB 1UPRA 5DHFB 4IAPA 2J0JA 2ELBA 3PSCA 5HE2A 1U27A 5D3YA 1W1DA 1TXDA 2DLWA 3ZDTA 1WVHA 2EJ8A 2H7EA 2HTHB 2OQBA 4PQ0A 2DFKA 1LW3A 3A98B 2RGNB 2PZ1A 1KI1B 2IYBA 1FHXA 2K00A 4HAZB 4DXAB 2L2IA 1MK9B 2M14A 2QKMA 2RVBB 1U5DA 5J3YA 2IFSA 2D2QA 1M7RA 5HE1A 3ODXA 3FM8C 2EC1A 4GMVA 4NSWA 3TO1A 1FGZA 4HDQA 1X1FA 2LG1A 1PFJA 4WJ7A 1MIXA 1MIZB 1U29A 1IRSA 2CY4A 2KUPA 3ULBA 1X05A 3GYPA 2D4QA 5C5BA 2BCJA 4KHOA 3HQCA 2YF0A 3WYFB 2VKIA 5DI9B 3P6AA 3SV1A 2EMTA 4MK0A 4Y94A 2YT1A 2UZSA 2I1KA 1HB6A 2D9WA 1WI1A 5C79A 4HHVA 1ZM0A 1RJ2A 1V5UA 3QBVB 3QWMA 4ZRKA 2YVCA 2YS3A 2DKQA 2P0FA 1I7AA 2COCA 2LBBA 2I5FA 2J0KA 5D27A 4HAXB 5JLJB 2YSZA 2ROVA 2MWNB 3PVLA 1GC7A 1EF1A 2D10A 4YL8A 4DX90 4WSFA 4XWXA 1XODA 2DYQA 4CYEA 1DDMA 4DBBA 2COPA 2COAA 3MDBC
chains in the Genus database with same CATH superfamily
4GOUA 5HE0A 4ZRIA 2FDQA 3ZVRA 1P5TA 3FP5A 1UNPA 3FLVA 4A6KA 3QIJA 3NWFA 3DXDA 2Q13A 3U7DA 1WJMA 3PP2A 1SHCA 3PEGA 4P7IA 3D8FA 2Z13A 1PLSA 5C5BB 1AQCA 1U2BA 2W2WA 1TJ6A 2DX5A 2FJLA 2YS1A 2CY5A 1UPQA 2KIEA 3HW2B 5FI1A 1OQNA 3FEHA 2ELAA 2X18A 2MFQA 5JP4A 2QKLA 3DXEA 2LOZA 4CHMA 3RCPA 1SGHA 4EKUA 5DH9B 2Y8GA 4K17A 4KHBA 1NI2A 5KQ1A 3ODOA 3PVUA 1EAZA 4DIXA 3X23A 1AWEA 3HSAA 2D9VA 3A8PA 4JK8A 3PG7A 1QQGA 2Y8FA 4EMOA 3OHMB 3G9WA 4GZUA 1H10A 2R0DA 2UZRA 3OANA 5FI0A 1V88A 4KHAA 1BTNA 3SBGA 2D9YA 1NTVA 4GNKB 1N3HA 3D8EA 3E9PA 2DA0A 1UNQA 2RLOA 2LULA 2HE7A 1X1GA 1KZGA 1V61A 2CODA 2LKOA 2AEHA 1M7EA 4DX8A 2K2JA 4F7HA 2XQNM 2X0SA 1Y5OA 4K2PA 3ODWA 3N7CA 3NWDA 2KGXB 1W1HA 2DHJA 2GS0A 3ENBA 4GXBA 1ST7A 5JHHA 2K2UA 3KSYA 3IVFA 5CLQB 5JHGA 2K49A 3BINA 2H7DA 1UEFA 1NTYA 5LONB 1BAKA 1DDVA 4TYZA 1FHWA 4JKAA 4F7GA 5D3WA 2YT0A 3B77A 2JP2A 1V5PA 2EMSA 3DXCA 1MAIA 1V89A 3EPYA 1FOEA 3BJIA 4BBKA 3TFMA 4MY6A 4JKDA 2DX1A 1OMWA 4HB2B 2DN6A 4MT7A 2D9XA 1DYNA 3V5WA 2ZPYA 1ZC4B 1MI1A 1E5WA 4A6FA 2I5CA 4K2OA 4KHBB 5CLLB 4QJ5B 1B55A 2D11A 3A58A 4HDOA 3MPXA 1U5EA 2CRFA 4F7UP 4A5KA 2J0MA 4HB0B 4TKNA 4ILHA 4H8SA 2M38A 3U12A 4GN1A 1XR0B 1XCGA 4NY0A 1BTKA 2L1CA 2DTCA 3SBTA 2GCLA 5I2SA 4JK7A 2N23A 2Y7BA 3HIEA 2E2XA 2P8VA 2RRFA 4C0AA 5J3TA 4HAUB 2NZ8B 4HB3B 5GOWB 5I2MA 1HB8A 5JVLA 5EFXA 1TQZA 4Z2MB 5D3XA 3VIAA 2J59M 2LYDA 3AU5A 3E9OA 1GC6A 1LB1A 4JKBA 2CB8A 1FB8A 2KIGA 3ML4A 3NWAA 3MDBC 3VOQA 1XKEA 1MKEA 2P0HA 1EVHA 4B6HA 4JK9A 1WG7A 2Z14A 2R82A 1KZ7A 2R2YA 4JKCA 1FAOA 4K81A 1NTIA 1U5FA 1I2HA 1MK7B 1NVLA 2GJYA 2WH5A 4D0NB 2MKRA 1W1GA 3KRWA 1FHOA 2P0DA 1WGUA 2ROZB 2Z0QA 2ADZA 5D3VA 1EGXA 2KCJA 1DROA 3KRXA 1K5DB 1V5MA 1ZSQA 2YT2A 2KUQA 5KCVA 1XX0A 2I1JA 1DDWA 1UNRA 1U5GA 1HBKA 3TW1A 4HAYB 1Q67A 4ZRJA 2RUKB 1ISNA 2V76A 1MPHA 2NMBA 1RRPB 4YONA 3A8QA 3NSUA 4GPTB 4IOYX 5J3QA 3SO6A 5C6RA 3WA0A 2VSZA 3F0WA 3TCAA 3FSSA 1GG3A 2W2XD 2YRYA 3CXBB 2RSGA 1FGYA 2FJUB 1H4RA 2YS5A 1ZVRA 3U8ZA 2R09A 4KVGB 2GCJA 3ULCA 2CQUA 4WVFB 4Z2NA 3P7ZA 4A6FB 4QJ3B 5L81A 4IFSA 1ZC3B 1X11A 3SUZA 4CHJA 1GGOA 4HATB 4KAXB 5HE3A 2VRWB 4HB4B 2HRJA 2Z0OA 2GUMA 4OSNA 1K5GB 3D8DA 5KQ4A 1J0WA 5LOPB 5IJMA 2Z4DA 1ACAA 2N0YA 1DBHA 4GMXB 3E66A 2DKPA 1Y19B 2MDXA 5LG4B 5DHAB 1OY2A 2DIKA 2RQ1A 3AU4A 4ILJA 2LOXA 2OTXA 2FJ9A 3PVWA 1VBGA 4A6HA 1Z87A 1NU2A 1DIKA 2ABDA 2G35A 3HK0A 4HSIA 4EJNA 3PZDA 1BWNA 2COFA 3SNHA 2CAYA 2RNRB 4CSQA 2DHIA 4PNKA 3O96A 3T06A 4HAVB 3M1IB 1WJ1A 1QC6A 3KY9A 3UZTA 3GYOA 1P6SA 3SYXA 3TVVA 1XD4A 2DYNA 1J19A 1X86A 3KZ1A 5C16A 1PMSA 2UVMA 1P3RA 2Z59A 2Z0PA 3LJUX 2DHKA 2AL6A 2D9ZA 5DIFB 4JKGA 1KBLA 3CIKA 1WGQA 4L6EA 3AJ4A 2K8EA 3F5RA 2W2XC 4HAWB 1UPRA 3NW8A 5DHFB 1T77A 4IAPA 2J0JA 2ELBA 2KR0A 3PSCA 5HE2A 1U27A 5D3YA 1W1DA 1TXDA 2DLWA 3ZDTA 4JKGB 1WVHA 2EJ8A 2H7EA 2HTHB 2OQBA 4PQ0A 2DFKA 1LW3A 3A98B 2RGNB 2PZ1A 1KI1B 2IYBA 1FHXA 2K00A 4HAZB 4OT1A 4DXAB 2L2IA 1MK9B 2M14A 2ZKMX 3DCXA 2QKMA 4QXAB 3E9LA 2RVBB 1U5DA 5J3YA 2IFSA 2D2QA 1M7RA 5HE1A 3ODXA 3FM8C 2EC1A 4GMVA 4JKFA 5IRSA 4NSWA 3TO1A 1FGZA 4QJ4B 4HDQA 1X1FA 2LG1A 1PFJA 4WJ7A 1MIXA 1MIZB 1U29A 1IRSA 2CY4A 2KUPA 1KC7A 3ULBA 1X05A 5M4YB 3GYPA 2D4QA 5C5BA 2BCJA 4KHOA 4L1RA 1VBHA 3HQCA 2YF0A 3WYFB 2VKIA 5DI9B 3P6AA 3SV1A 4D6WA 2EMTA 4MK0A 4Y94A 2YT1A 2UZSA 4JKHA 2I1KA 1HB6A 2D9WA 1WI1A 5C79A 4HHVA 1JDEA 1ZM0A 1RJ2A 1V5UA 3FVCA 3QBVB 3QWMA 1ZYIA 4ZRKA 2YVCA 2YS3A 2DKQA 2P0FA 1I7AA 2COCA 2LBBA 2I5FA 5D27A 4HAXB 4ILGB 5JLJB 2YSZA 2ROVA 2MWNB 4JKEA 3PVLA 1GC7A 1EF1A 2D10A 4YL8A 4DX90 4WSFA 4XWXA 1XODA 2DYQA 4CYEA 1DDMA 4DBBA 2NBVA 2COPA 2COAA 2J0KA
chains in the Genus database with same CATH topology
5HE0A 4ZRIA 2FDQA 3ZVRA 1P5TA 3FP5A 1UNPA 3FLVA 4A6KA 3QIJA 3DXDA 2Q13A 3U7DA 1WJMA 3PP2A 1SHCA 3PEGA 4P7IA 3D8FA 1PLSA 5C5BB 1AQCA 1U2BA 2W2WA 1TJ6A 2DX5A 2FJLA 2YS1A 2CY5A 1UPQA 3HW2B 5FI1A 1OQNA 3FEHA 2ELAA 2X18A 2MFQA 5JP4A 2QKLA 3DXEA 2LOZA 4CHMA 3RCPA 1SGHA 4EKUA 5DH9B 2Y8GA 4K17A 1NI2A 5KQ1A 3ODOA 3PVUA 1EAZA 3X23A 1AWEA 2D9VA 3A8PA 4JK8A 3PG7A 1QQGA 2Y8FA 4EMOA 3G9WA 4GZUA 1H10A 2R0DA 2UZRA 3OANA 5FI0A 1V88A 4KHAA 1BTNA 3SBGA 2D9YA 1NTVA 1N3HA 3D8EA 3E9PA 2DA0A 1UNQA 2RLOA 2LULA 2HE7A 1X1GA 1KZGA 1V61A 2CODA 2LKOA 2AEHA 1M7EA 4DX8A 2K2JA 4F7HA 2XQNM 2X0SA 1Y5OA 4K2PA 3ODWA 3N7CA 2KGXB 1W1HA 2DHJA 2GS0A 3ENBA 4GXBA 1ST7A 5JHHA 2K2UA 3KSYA 3IVFA 5CLQB 5JHGA 3BINA 2H7DA 1UEFA 1NTYA 5LONB 1BAKA 1DDVA 4TYZA 1FHWA 4JKAA 4F7GA 5D3WA 2YT0A 2JP2A 1V5PA 2EMSA 3DXCA 1MAIA 1V89A 3EPYA 1FOEA 3BJIA 4BBKA 3TFMA 4MY6A 4JKDA 2DX1A 1OMWA 4HB2B 2DN6A 4MT7A 2D9XA 1DYNA 3V5WA 2ZPYA 1ZC4B 1E5WA 4A6FA 2I5CA 4K2OA 4KHBB 5CLLB 1B55A 2D11A 4HDOA 3MPXA 1U5EA 2CRFA 4F7UP 4A5KA 2J0MA 4HB0B 4TKNA 4ILHA 4H8SA 2M38A 4GN1A 1XR0B 1XCGA 4NY0A 1BTKA 2L1CA 2DTCA 3SBTA 2GCLA 4JK7A 2N23A 2Y7BA 2E2XA 2P8VA 4C0AA 5J3TA 4HAUB 2NZ8B 4HB3B 5GOWB 1HB8A 5JVLA 5EFXA 1TQZA 4Z2MB 5D3XA 3VIAA 2J59M 2LYDA 3AU5A 3E9OA 1GC6A 1LB1A 4JKBA 2CB8A 1FB8A 3ML4A 3MDBC 3VOQA 1XKEA 1MKEA 2P0HA 1EVHA 4B6HA 4JK9A 1WG7A 2R82A 1KZ7A 4JKCA 1FAOA 4K81A 1NTIA 1U5FA 1I2HA 1MK7B 1NVLA 2GJYA 2WH5A 4D0NB 2MKRA 1W1GA 3KRWA 1FHOA 2P0DA 1WGUA 2ROZB 2Z0QA 2ADZA 5D3VA 1EGXA 2KCJA 1DROA 3KRXA 1K5DB 1V5MA 1ZSQA 5KCVA 1XX0A 2I1JA 1DDWA 1UNRA 1U5GA 1HBKA 3TW1A 4HAYB 1Q67A 4ZRJA 2RUKB 1ISNA 2V76A 1MPHA 2NMBA 1RRPB 4YONA 3A8QA 3NSUA 4GPTB 4IOYX 5J3QA 3SO6A 5C6RA 3WA0A 2VSZA 3F0WA 3TCAA 3FSSA 1GG3A 2W2XD 2YRYA 3CXBB 2RSGA 1FGYA 1H4RA 2YS5A 1ZVRA 3U8ZA 2R09A 4KVGB 2GCJA 3ULCA 2CQUA 4WVFB 4Z2NA 3P7ZA 4A6FB 5L81A 4IFSA 1ZC3B 1X11A 3SUZA 4CHJA 1GGOA 4HATB 4KAXB 5HE3A 2VRWB 4HB4B 2HRJA 2Z0OA 1K5GB 3D8DA 5KQ4A 1J0WA 5LOPB 5IJMA 1ACAA 2N0YA 1DBHA 4GMXB 3E66A 2DKPA 1Y19B 2MDXA 5DHAB 1OY2A 2DIKA 2RQ1A 3AU4A 4ILJA 2LOXA 2OTXA 2FJ9A 3PVWA 1VBGA 4A6HA 1Z87A 1NU2A 1DIKA 2ABDA 2G35A 3HK0A 4EJNA 3PZDA 1BWNA 2COFA 3SNHA 2CAYA 2RNRB 2DHIA 4PNKA 3O96A 3T06A 4HAVB 3M1IB 1WJ1A 1QC6A 3KY9A 3UZTA 3GYOA 1P6SA 3SYXA 3TVVA 1XD4A 2DYNA 1J19A 1X86A 3KZ1A 5C16A 1PMSA 2UVMA 1P3RA 2Z0PA 3LJUX 2DHKA 2AL6A 2D9ZA 5DIFB 4JKGA 1KBLA 3CIKA 1WGQA 4L6EA 3AJ4A 3F5RA 2W2XC 4HAWB 1UPRA 5DHFB 4IAPA 2J0JA 2ELBA 3PSCA 5HE2A 1U27A 5D3YA 1W1DA 1TXDA 2DLWA 3ZDTA 4JKGB 1WVHA 2EJ8A 2H7EA 2HTHB 2OQBA 4PQ0A 2DFKA 1LW3A 3A98B 2RGNB 2PZ1A 1KI1B 2IYBA 1FHXA 2K00A 4HAZB 4DXAB 2L2IA 1MK9B 2M14A 2QKMA 3E9LA 2RVBB 1U5DA 5J3YA 2IFSA 2D2QA 1M7RA 5HE1A 3ODXA 3FM8C 2EC1A 4GMVA 4JKFA 4NSWA 3TO1A 1FGZA 4HDQA 1X1FA 2LG1A 1PFJA 4WJ7A 1MIXA 1MIZB 1U29A 1IRSA 2CY4A 2KUPA 1KC7A 3ULBA 1X05A 3GYPA 2D4QA 5C5BA 2BCJA 4KHOA 1VBHA 3HQCA 2YF0A 3WYFB 2VKIA 5DI9B 3P6AA 3SV1A 2EMTA 4MK0A 4Y94A 2YT1A 2UZSA 4JKHA 2I1KA 1HB6A 2D9WA 1WI1A 5C79A 4HHVA 1JDEA 1ZM0A 1RJ2A 1V5UA 3QBVB 3QWMA 4ZRKA 2YVCA 2YS3A 2DKQA 2P0FA 1I7AA 2COCA 2LBBA 2I5FA 5D27A 4HAXB 4ILGB 5JLJB 2YSZA 2ROVA 2MWNB 4JKEA 3PVLA 1GC7A 1EF1A 2D10A 4YL8A 4DX90 4WSFA 4XWXA 1XODA 2DYQA 4CYEA 1DDMA 4DBBA 2COPA 2COAA 2J0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE0 A;  4ZRI A;  2FDQ A;  3ZVR A;  1P5T A;  3FP5 A;  1UNP A;  3FLV A;  4A6K A;  3QIJ A;  3DXD A;  2Q13 A;  3U7D A;  1WJM A;  3PP2 A;  1SHC A;  3PEG A;  4P7I A;  3D8F A;  1PLS A;  5C5B B;  1AQC A;  1U2B A;  2W2W A;  1TJ6 A;  2DX5 A;  2FJL A;  2YS1 A;  2CY5 A;  1UPQ A;  3HW2 B;  5FI1 A;  1OQN A;  3FEH A;  2ELA A;  2X18 A;  2MFQ A;  5JP4 A;  2QKL A;  3DXE A;  2LOZ A;  4CHM A;  3RCP A;  1SGH A;  4EKU A;  5DH9 B;  2Y8G A;  4K17 A;  1NI2 A;  5KQ1 A;  3ODO A;  3PVU A;  1EAZ A;  3X23 A;  1AWE A;  2D9V A;  3A8P A;  3PG7 A;  1QQG A;  2Y8F A;  4EMO A;  3G9W A;  4GZU A;  1H10 A;  2R0D A;  2UZR A;  3OAN A;  5FI0 A;  1V88 A;  4KHA A;  1BTN A;  2D9Y A;  1NTV A;  1N3H A;  3D8E A;  2DA0 A;  1UNQ A;  2RLO A;  2LUL A;  2HE7 A;  1X1G A;  1KZG A;  1V61 A;  2COD A;  2LKO A;  2AEH A;  1M7E A;  4DX8 A;  2K2J A;  4F7H A;  2XQN M;  1Y5O A;  4K2P A;  3ODW A;  3N7C A;  2KGX B;  1W1H A;  2DHJ A;  2GS0 A;  4GXB A;  1ST7 A;  5JHH A;  2K2U A;  3KSY A;  3IVF A;  5CLQ B;  5JHG A;  3BIN A;  2H7D A;  1UEF A;  1NTY A;  5LON B;  1BAK A;  1DDV A;  4TYZ A;  1FHW A;  4F7G A;  5D3W A;  2YT0 A;  2JP2 A;  1V5P A;  2EMS A;  3DXC A;  1MAI A;  1V89 A;  3EPY A;  1FOE A;  3BJI A;  4BBK A;  3TFM A;  4MY6 A;  2DX1 A;  1OMW A;  4HB2 B;  2DN6 A;  4MT7 A;  2D9X A;  1DYN A;  3V5W A;  2ZPY A;  1ZC4 B;  1E5W A;  4A6F A;  2I5C A;  4K2O A;  4KHB B;  5CLL B;  1B55 A;  2D11 A;  4HDO A;  3MPX A;  1U5E A;  2CRF A;  4F7U P;  4A5K A;  2J0M A;  4HB0 B;  4TKN A;  4H8S A;  2M38 A;  4GN1 A;  1XR0 B;  1XCG A;  4NY0 A;  1BTK A;  2L1C A;  2DTC A;  2GCL A;  2N23 A;  2Y7B A;  2E2X A;  2P8V A;  4C0A A;  5J3T A;  4HAU B;  2NZ8 B;  4HB3 B;  5GOW B;  1HB8 A;  5EFX A;  1TQZ A;  4Z2M B;  5D3X A;  3VIA A;  2J59 M;  2LYD A;  3AU5 A;  1GC6 A;  1LB1 A;  2CB8 A;  1FB8 A;  3ML4 A;  3VOQ A;  1XKE A;  1MKE A;  2P0H A;  1EVH A;  4B6H A;  1WG7 A;  1KZ7 A;  1FAO A;  4K81 A;  1NTI A;  1U5F A;  1I2H A;  1MK7 B;  1NVL A;  2GJY A;  2WH5 A;  4D0N B;  2MKR A;  1W1G A;  3KRW A;  1FHO A;  2P0D A;  1WGU A;  2ROZ B;  2Z0Q A;  2ADZ A;  5D3V A;  1EGX A;  2KCJ A;  1DRO A;  3KRX A;  1K5D B;  1V5M A;  1ZSQ A;  5KCV A;  1XX0 A;  2I1J A;  1DDW A;  1UNR A;  1U5G A;  1HBK A;  3TW1 A;  4HAY B;  1Q67 A;  4ZRJ A;  2RUK B;  1ISN A;  2V76 A;  1MPH A;  2NMB A;  1RRP B;  4YON A;  3A8Q A;  3NSU A;  4GPT B;  4IOY X;  5J3Q A;  3SO6 A;  5C6R A;  3WA0 A;  2VSZ A;  3F0W A;  3TCA A;  3FSS A;  1GG3 A;  2W2X D;  2YRY A;  3CXB B;  2RSG A;  1FGY A;  1H4R A;  2YS5 A;  1ZVR A;  3U8Z A;  2R09 A;  4KVG B;  2GCJ A;  3ULC A;  2CQU A;  4WVF B;  4Z2N A;  3P7Z A;  4A6F B;  5L81 A;  4IFS A;  1ZC3 B;  1X11 A;  3SUZ A;  4CHJ A;  4HAT B;  4KAX B;  5HE3 A;  2VRW B;  4HB4 B;  2HRJ A;  2Z0O A;  1K5G B;  3D8D A;  5KQ4 A;  1J0W A;  5LOP B;  5IJM A;  1ACA A;  2N0Y A;  1DBH A;  4GMX B;  2DKP A;  1Y19 B;  2MDX A;  5DHA B;  1OY2 A;  2RQ1 A;  3AU4 A;  2LOX A;  2OTX A;  2FJ9 A;  3PVW A;  4A6H A;  1Z87 A;  1NU2 A;  2ABD A;  2G35 A;  3HK0 A;  4EJN A;  3PZD A;  1BWN A;  2COF A;  3SNH A;  2CAY A;  2RNR B;  2DHI A;  4PNK A;  3O96 A;  3T06 A;  4HAV B;  3M1I B;  1WJ1 A;  1QC6 A;  3KY9 A;  3UZT A;  3GYO A;  1P6S A;  3SYX A;  3TVV A;  1XD4 A;  2DYN A;  1J19 A;  1X86 A;  3KZ1 A;  5C16 A;  1PMS A;  2UVM A;  1P3R A;  2Z0P A;  3LJU X;  2DHK A;  2AL6 A;  2D9Z A;  5DIF B;  3CIK A;  1WGQ A;  4L6E A;  3AJ4 A;  3F5R A;  2W2X C;  4HAW B;  1UPR A;  5DHF B;  4IAP A;  2J0J A;  2ELB A;  3PSC A;  5HE2 A;  1U27 A;  5D3Y A;  1W1D A;  1TXD A;  2DLW A;  3ZDT A;  1WVH A;  2EJ8 A;  2H7E A;  2HTH B;  2OQB A;  4PQ0 A;  2DFK A;  1LW3 A;  3A98 B;  2RGN B;  2PZ1 A;  1KI1 B;  2IYB A;  1FHX A;  2K00 A;  4HAZ B;  4DXA B;  2L2I A;  1MK9 B;  2M14 A;  2QKM A;  2RVB B;  1U5D A;  5J3Y A;  2IFS A;  2D2Q A;  1M7R A;  5HE1 A;  3ODX A;  3FM8 C;  2EC1 A;  4GMV A;  4NSW A;  3TO1 A;  1FGZ A;  4HDQ A;  1X1F A;  2LG1 A;  1PFJ A;  4WJ7 A;  1MIX A;  1MIZ B;  1U29 A;  1IRS A;  2CY4 A;  2KUP A;  3ULB A;  1X05 A;  3GYP A;  2D4Q A;  5C5B A;  2BCJ A;  4KHO A;  3HQC A;  2YF0 A;  3WYF B;  2VKI A;  5DI9 B;  3P6A A;  3SV1 A;  2EMT A;  4MK0 A;  4Y94 A;  2YT1 A;  2UZS A;  2I1K A;  1HB6 A;  2D9W A;  1WI1 A;  5C79 A;  4HHV A;  1ZM0 A;  1RJ2 A;  1V5U A;  3QBV B;  3QWM A;  4ZRK A;  2YVC A;  2YS3 A;  2DKQ A;  2P0F A;  1I7A A;  2COC A;  2LBB A;  2I5F A;  2J0K A;  5D27 A;  4HAX B;  5JLJ B;  2YSZ A;  2ROV A;  2MWN B;  3PVL A;  1GC7 A;  1EF1 A;  2D10 A;  4YL8 A;  4DX9 0;  4WSF A;  4XWX A;  1XOD A;  2DYQ A;  4CYE A;  1DDM A;  4DBB A;  2COP A;  2COA A;  3MDB C; 
#chains in the Genus database with same CATH topology
 4GOU A;  5HE0 A;  4ZRI A;  2FDQ A;  3ZVR A;  1P5T A;  3FP5 A;  1UNP A;  3FLV A;  4A6K A;  3QIJ A;  3NWF A;  3DXD A;  2Q13 A;  3U7D A;  1WJM A;  3PP2 A;  1SHC A;  3PEG A;  4P7I A;  3D8F A;  2Z13 A;  1PLS A;  5C5B B;  1AQC A;  1U2B A;  2W2W A;  1TJ6 A;  2DX5 A;  2FJL A;  2YS1 A;  2CY5 A;  1UPQ A;  2KIE A;  3HW2 B;  5FI1 A;  1OQN A;  3FEH A;  2ELA A;  2X18 A;  2MFQ A;  5JP4 A;  2QKL A;  3DXE A;  2LOZ A;  4CHM A;  3RCP A;  1SGH A;  4EKU A;  5DH9 B;  2Y8G A;  4K17 A;  4KHB A;  1NI2 A;  5KQ1 A;  3ODO A;  3PVU A;  1EAZ A;  4DIX A;  3X23 A;  1AWE A;  3HSA A;  2D9V A;  3A8P A;  4JK8 A;  3PG7 A;  1QQG A;  2Y8F A;  4EMO A;  3OHM B;  3G9W A;  4GZU A;  1H10 A;  2R0D A;  2UZR A;  3OAN A;  5FI0 A;  1V88 A;  4KHA A;  1BTN A;  3SBG A;  2D9Y A;  1NTV A;  4GNK B;  1N3H A;  3D8E A;  3E9P A;  2DA0 A;  1UNQ A;  2RLO A;  2LUL A;  2HE7 A;  1X1G A;  1KZG A;  1V61 A;  2COD A;  2LKO A;  2AEH A;  1M7E A;  4DX8 A;  2K2J A;  4F7H A;  2XQN M;  2X0S A;  1Y5O A;  4K2P A;  3ODW A;  3N7C A;  3NWD A;  2KGX B;  1W1H A;  2DHJ A;  2GS0 A;  3ENB A;  4GXB A;  1ST7 A;  5JHH A;  2K2U A;  3KSY A;  3IVF A;  5CLQ B;  5JHG A;  2K49 A;  3BIN A;  2H7D A;  1UEF A;  1NTY A;  5LON B;  1BAK A;  1DDV A;  4TYZ A;  1FHW A;  4JKA A;  4F7G A;  5D3W A;  2YT0 A;  3B77 A;  2JP2 A;  1V5P A;  2EMS A;  3DXC A;  1MAI A;  1V89 A;  3EPY A;  1FOE A;  3BJI A;  4BBK A;  3TFM A;  4MY6 A;  4JKD A;  2DX1 A;  1OMW A;  4HB2 B;  2DN6 A;  4MT7 A;  2D9X A;  1DYN A;  3V5W A;  2ZPY A;  1ZC4 B;  1MI1 A;  1E5W A;  4A6F A;  2I5C A;  4K2O A;  4KHB B;  5CLL B;  4QJ5 B;  1B55 A;  2D11 A;  3A58 A;  4HDO A;  3MPX A;  1U5E A;  2CRF A;  4F7U P;  4A5K A;  2J0M A;  4HB0 B;  4TKN A;  4ILH A;  4H8S A;  2M38 A;  3U12 A;  4GN1 A;  1XR0 B;  1XCG A;  4NY0 A;  1BTK A;  2L1C A;  2DTC A;  3SBT A;  2GCL A;  5I2S A;  4JK7 A;  2N23 A;  2Y7B A;  3HIE A;  2E2X A;  2P8V A;  2RRF A;  4C0A A;  5J3T A;  4HAU B;  2NZ8 B;  4HB3 B;  5GOW B;  5I2M A;  1HB8 A;  5JVL A;  5EFX A;  1TQZ A;  4Z2M B;  5D3X A;  3VIA A;  2J59 M;  2LYD A;  3AU5 A;  3E9O A;  1GC6 A;  1LB1 A;  4JKB A;  2CB8 A;  1FB8 A;  2KIG A;  3ML4 A;  3NWA A;  3MDB C;  3VOQ A;  1XKE A;  1MKE A;  2P0H A;  1EVH A;  4B6H A;  4JK9 A;  1WG7 A;  2Z14 A;  2R82 A;  1KZ7 A;  2R2Y A;  4JKC A;  1FAO A;  4K81 A;  1NTI A;  1U5F A;  1I2H A;  1MK7 B;  1NVL A;  2GJY A;  2WH5 A;  4D0N B;  2MKR A;  1W1G A;  3KRW A;  1FHO A;  2P0D A;  1WGU A;  2ROZ B;  2Z0Q A;  2ADZ A;  5D3V A;  1EGX A;  2KCJ A;  1DRO A;  3KRX A;  1K5D B;  1V5M A;  1ZSQ A;  2YT2 A;  2KUQ A;  5KCV A;  1XX0 A;  2I1J A;  1DDW A;  1UNR A;  1U5G A;  1HBK A;  3TW1 A;  4HAY B;  1Q67 A;  4ZRJ A;  2RUK B;  1ISN A;  2V76 A;  1MPH A;  2NMB A;  1RRP B;  4YON A;  3A8Q A;  3NSU A;  4GPT B;  4IOY X;  5J3Q A;  3SO6 A;  5C6R A;  3WA0 A;  2VSZ A;  3F0W A;  3TCA A;  3FSS A;  1GG3 A;  2W2X D;  2YRY A;  3CXB B;  2RSG A;  1FGY A;  2FJU B;  1H4R A;  2YS5 A;  1ZVR A;  3U8Z A;  2R09 A;  4KVG B;  2GCJ A;  3ULC A;  2CQU A;  4WVF B;  4Z2N A;  3P7Z A;  4A6F B;  4QJ3 B;  5L81 A;  4IFS A;  1ZC3 B;  1X11 A;  3SUZ A;  4CHJ A;  1GGO A;  4HAT B;  4KAX B;  5HE3 A;  2VRW B;  4HB4 B;  2HRJ A;  2Z0O A;  2GUM A;  4OSN A;  1K5G B;  3D8D A;  5KQ4 A;  1J0W A;  5LOP B;  5IJM A;  2Z4D A;  1ACA A;  2N0Y A;  1DBH A;  4GMX B;  3E66 A;  2DKP A;  1Y19 B;  2MDX A;  5LG4 B;  5DHA B;  1OY2 A;  2DIK A;  2RQ1 A;  3AU4 A;  4ILJ A;  2LOX A;  2OTX A;  2FJ9 A;  3PVW A;  1VBG A;  4A6H A;  1Z87 A;  1NU2 A;  1DIK A;  2ABD A;  2G35 A;  3HK0 A;  4HSI A;  4EJN A;  3PZD A;  1BWN A;  2COF A;  3SNH A;  2CAY A;  2RNR B;  4CSQ A;  2DHI A;  4PNK A;  3O96 A;  3T06 A;  4HAV B;  3M1I B;  1WJ1 A;  1QC6 A;  3KY9 A;  3UZT A;  3GYO A;  1P6S A;  3SYX A;  3TVV A;  1XD4 A;  2DYN A;  1J19 A;  1X86 A;  3KZ1 A;  5C16 A;  1PMS A;  2UVM A;  1P3R A;  2Z59 A;  2Z0P A;  3LJU X;  2DHK A;  2AL6 A;  2D9Z A;  5DIF B;  4JKG A;  1KBL A;  3CIK A;  1WGQ A;  4L6E A;  3AJ4 A;  2K8E A;  3F5R A;  2W2X C;  4HAW B;  1UPR A;  3NW8 A;  5DHF B;  1T77 A;  4IAP A;  2J0J A;  2ELB A;  2KR0 A;  3PSC A;  5HE2 A;  1U27 A;  5D3Y A;  1W1D A;  1TXD A;  2DLW A;  3ZDT A;  4JKG B;  1WVH A;  2EJ8 A;  2H7E A;  2HTH B;  2OQB A;  4PQ0 A;  2DFK A;  1LW3 A;  3A98 B;  2RGN B;  2PZ1 A;  1KI1 B;  2IYB A;  1FHX A;  2K00 A;  4HAZ B;  4OT1 A;  4DXA B;  2L2I A;  1MK9 B;  2M14 A;  2ZKM X;  3DCX A;  2QKM A;  4QXA B;  3E9L A;  2RVB B;  1U5D A;  5J3Y A;  2IFS A;  2D2Q A;  1M7R A;  5HE1 A;  3ODX A;  3FM8 C;  2EC1 A;  4GMV A;  4JKF A;  5IRS A;  4NSW A;  3TO1 A;  1FGZ A;  4QJ4 B;  4HDQ A;  1X1F A;  2LG1 A;  1PFJ A;  4WJ7 A;  1MIX A;  1MIZ B;  1U29 A;  1IRS A;  2CY4 A;  2KUP A;  1KC7 A;  3ULB A;  1X05 A;  5M4Y B;  3GYP A;  2D4Q A;  5C5B A;  2BCJ A;  4KHO A;  4L1R A;  1VBH A;  3HQC A;  2YF0 A;  3WYF B;  2VKI A;  5DI9 B;  3P6A A;  3SV1 A;  4D6W A;  2EMT A;  4MK0 A;  4Y94 A;  2YT1 A;  2UZS A;  4JKH A;  2I1K A;  1HB6 A;  2D9W A;  1WI1 A;  5C79 A;  4HHV A;  1JDE A;  1ZM0 A;  1RJ2 A;  1V5U A;  3FVC A;  3QBV B;  3QWM A;  1ZYI A;  4ZRK A;  2YVC A;  2YS3 A;  2DKQ A;  2P0F A;  1I7A A;  2COC A;  2LBB A;  2I5F A;  5D27 A;  4HAX B;  4ILG B;  5JLJ B;  2YSZ A;  2ROV A;  2MWN B;  4JKE A;  3PVL A;  1GC7 A;  1EF1 A;  2D10 A;  4YL8 A;  4DX9 0;  4WSF A;  4XWX A;  1XOD A;  2DYQ A;  4CYE A;  1DDM A;  4DBB A;  2NBV A;  2COP A;  2COA A;  2J0K A; 
#chains in the Genus database with same CATH homology
 5HE0 A;  4ZRI A;  2FDQ A;  3ZVR A;  1P5T A;  3FP5 A;  1UNP A;  3FLV A;  4A6K A;  3QIJ A;  3DXD A;  2Q13 A;  3U7D A;  1WJM A;  3PP2 A;  1SHC A;  3PEG A;  4P7I A;  3D8F A;  1PLS A;  5C5B B;  1AQC A;  1U2B A;  2W2W A;  1TJ6 A;  2DX5 A;  2FJL A;  2YS1 A;  2CY5 A;  1UPQ A;  3HW2 B;  5FI1 A;  1OQN A;  3FEH A;  2ELA A;  2X18 A;  2MFQ A;  5JP4 A;  2QKL A;  3DXE A;  2LOZ A;  4CHM A;  3RCP A;  1SGH A;  4EKU A;  5DH9 B;  2Y8G A;  4K17 A;  1NI2 A;  5KQ1 A;  3ODO A;  3PVU A;  1EAZ A;  3X23 A;  1AWE A;  2D9V A;  3A8P A;  4JK8 A;  3PG7 A;  1QQG A;  2Y8F A;  4EMO A;  3G9W A;  4GZU A;  1H10 A;  2R0D A;  2UZR A;  3OAN A;  5FI0 A;  1V88 A;  4KHA A;  1BTN A;  3SBG A;  2D9Y A;  1NTV A;  1N3H A;  3D8E A;  3E9P A;  2DA0 A;  1UNQ A;  2RLO A;  2LUL A;  2HE7 A;  1X1G A;  1KZG A;  1V61 A;  2COD A;  2LKO A;  2AEH A;  1M7E A;  4DX8 A;  2K2J A;  4F7H A;  2XQN M;  2X0S A;  1Y5O A;  4K2P A;  3ODW A;  3N7C A;  2KGX B;  1W1H A;  2DHJ A;  2GS0 A;  3ENB A;  4GXB A;  1ST7 A;  5JHH A;  2K2U A;  3KSY A;  3IVF A;  5CLQ B;  5JHG A;  3BIN A;  2H7D A;  1UEF A;  1NTY A;  5LON B;  1BAK A;  1DDV A;  4TYZ A;  1FHW A;  4JKA A;  4F7G A;  5D3W A;  2YT0 A;  2JP2 A;  1V5P A;  2EMS A;  3DXC A;  1MAI A;  1V89 A;  3EPY A;  1FOE A;  3BJI A;  4BBK A;  3TFM A;  4MY6 A;  4JKD A;  2DX1 A;  1OMW A;  4HB2 B;  2DN6 A;  4MT7 A;  2D9X A;  1DYN A;  3V5W A;  2ZPY A;  1ZC4 B;  1E5W A;  4A6F A;  2I5C A;  4K2O A;  4KHB B;  5CLL B;  1B55 A;  2D11 A;  4HDO A;  3MPX A;  1U5E A;  2CRF A;  4F7U P;  4A5K A;  2J0M A;  4HB0 B;  4TKN A;  4ILH A;  4H8S A;  2M38 A;  4GN1 A;  1XR0 B;  1XCG A;  4NY0 A;  1BTK A;  2L1C A;  2DTC A;  3SBT A;  2GCL A;  4JK7 A;  2N23 A;  2Y7B A;  2E2X A;  2P8V A;  4C0A A;  5J3T A;  4HAU B;  2NZ8 B;  4HB3 B;  5GOW B;  1HB8 A;  5JVL A;  5EFX A;  1TQZ A;  4Z2M B;  5D3X A;  3VIA A;  2J59 M;  2LYD A;  3AU5 A;  3E9O A;  1GC6 A;  1LB1 A;  4JKB A;  2CB8 A;  1FB8 A;  3ML4 A;  3MDB C;  3VOQ A;  1XKE A;  1MKE A;  2P0H A;  1EVH A;  4B6H A;  4JK9 A;  1WG7 A;  2R82 A;  1KZ7 A;  4JKC A;  1FAO A;  4K81 A;  1NTI A;  1U5F A;  1I2H A;  1MK7 B;  1NVL A;  2GJY A;  2WH5 A;  4D0N B;  2MKR A;  1W1G A;  3KRW A;  1FHO A;  2P0D A;  1WGU A;  2ROZ B;  2Z0Q A;  2ADZ A;  5D3V A;  1EGX A;  2KCJ A;  1DRO A;  3KRX A;  1K5D B;  1V5M A;  1ZSQ A;  5KCV A;  1XX0 A;  2I1J A;  1DDW A;  1UNR A;  1U5G A;  1HBK A;  3TW1 A;  4HAY B;  1Q67 A;  4ZRJ A;  2RUK B;  1ISN A;  2V76 A;  1MPH A;  2NMB A;  1RRP B;  4YON A;  3A8Q A;  3NSU A;  4GPT B;  4IOY X;  5J3Q A;  3SO6 A;  5C6R A;  3WA0 A;  2VSZ A;  3F0W A;  3TCA A;  3FSS A;  1GG3 A;  2W2X D;  2YRY A;  3CXB B;  2RSG A;  1FGY A;  1H4R A;  2YS5 A;  1ZVR A;  3U8Z A;  2R09 A;  4KVG B;  2GCJ A;  3ULC A;  2CQU A;  4WVF B;  4Z2N A;  3P7Z A;  4A6F B;  5L81 A;  4IFS A;  1ZC3 B;  1X11 A;  3SUZ A;  4CHJ A;  1GGO A;  4HAT B;  4KAX B;  5HE3 A;  2VRW B;  4HB4 B;  2HRJ A;  2Z0O A;  1K5G B;  3D8D A;  5KQ4 A;  1J0W A;  5LOP B;  5IJM A;  1ACA A;  2N0Y A;  1DBH A;  4GMX B;  3E66 A;  2DKP A;  1Y19 B;  2MDX A;  5DHA B;  1OY2 A;  2DIK A;  2RQ1 A;  3AU4 A;  4ILJ A;  2LOX A;  2OTX A;  2FJ9 A;  3PVW A;  1VBG A;  4A6H A;  1Z87 A;  1NU2 A;  1DIK A;  2ABD A;  2G35 A;  3HK0 A;  4EJN A;  3PZD A;  1BWN A;  2COF A;  3SNH A;  2CAY A;  2RNR B;  2DHI A;  4PNK A;  3O96 A;  3T06 A;  4HAV B;  3M1I B;  1WJ1 A;  1QC6 A;  3KY9 A;  3UZT A;  3GYO A;  1P6S A;  3SYX A;  3TVV A;  1XD4 A;  2DYN A;  1J19 A;  1X86 A;  3KZ1 A;  5C16 A;  1PMS A;  2UVM A;  1P3R A;  2Z0P A;  3LJU X;  2DHK A;  2AL6 A;  2D9Z A;  5DIF B;  4JKG A;  1KBL A;  3CIK A;  1WGQ A;  4L6E A;  3AJ4 A;  3F5R A;  2W2X C;  4HAW B;  1UPR A;  5DHF B;  4IAP A;  2J0J A;  2ELB A;  3PSC A;  5HE2 A;  1U27 A;  5D3Y A;  1W1D A;  1TXD A;  2DLW A;  3ZDT A;  4JKG B;  1WVH A;  2EJ8 A;  2H7E A;  2HTH B;  2OQB A;  4PQ0 A;  2DFK A;  1LW3 A;  3A98 B;  2RGN B;  2PZ1 A;  1KI1 B;  2IYB A;  1FHX A;  2K00 A;  4HAZ B;  4DXA B;  2L2I A;  1MK9 B;  2M14 A;  2QKM A;  3E9L A;  2RVB B;  1U5D A;  5J3Y A;  2IFS A;  2D2Q A;  1M7R A;  5HE1 A;  3ODX A;  3FM8 C;  2EC1 A;  4GMV A;  4JKF A;  4NSW A;  3TO1 A;  1FGZ A;  4HDQ A;  1X1F A;  2LG1 A;  1PFJ A;  4WJ7 A;  1MIX A;  1MIZ B;  1U29 A;  1IRS A;  2CY4 A;  2KUP A;  1KC7 A;  3ULB A;  1X05 A;  3GYP A;  2D4Q A;  5C5B A;  2BCJ A;  4KHO A;  1VBH A;  3HQC A;  2YF0 A;  3WYF B;  2VKI A;  5DI9 B;  3P6A A;  3SV1 A;  2EMT A;  4MK0 A;  4Y94 A;  2YT1 A;  2UZS A;  4JKH A;  2I1K A;  1HB6 A;  2D9W A;  1WI1 A;  5C79 A;  4HHV A;  1JDE A;  1ZM0 A;  1RJ2 A;  1V5U A;  3QBV B;  3QWM A;  4ZRK A;  2YVC A;  2YS3 A;  2DKQ A;  2P0F A;  1I7A A;  2COC A;  2LBB A;  2I5F A;  5D27 A;  4HAX B;  4ILG B;  5JLJ B;  2YSZ A;  2ROV A;  2MWN B;  4JKE A;  3PVL A;  1GC7 A;  1EF1 A;  2D10 A;  4YL8 A;  4DX9 0;  4WSF A;  4XWX A;  1XOD A;  2DYQ A;  4CYE A;  1DDM A;  4DBB A;  2COP A;  2COA A;  2J0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...