4F7HA

The crystal structure of kindlin-2 pleckstrin homology domain in free form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
ILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of kindlin-2 PH domain reveals a conformational transition for its membrane anchoring and regulation of integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Fermitin family homolog 2
total genus 30
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4f7hA00
4HDQA 1U5GA 1WI1A 3ODOA 3FM8C 4A6KA 2DFKA 1RRPB 1UNPA 1XODA 1P3RA 2AL6A 2P0HA 2R09A 2YF0A 3G9WA 1XR0B 2NMBA 1X1GA 2LOXA 4KHBB 1MIXA 1U5DA 1EAZA 3T06A 2HTHB 1OY2A 2VSZA 2L2IA 4MK0A 2QKMA 4ZRKA 3HK0A 1V89A 2AEHA 4NY0A 4WVFB 4KAXB 2YVCA 2BCJA 3V5WA 2CY4A 3N7CA 1GG3A 1XKEA 4K2PA 3AU5A 3A8PA 1KI1B 2YS5A 3MPXA 2KUPA 1FB8A 1KZGA 2OTXA 4DXAB 1NTVA 2RSGA 1M7EA 1UEFA 4XWXA 1MAIA 4Z2MB 4HB4B 2N23A 2ZPYA 3FSSA 2UZRA 4YL8A 1KZ7A 5C16A 1TXDA 1MK9B 2Y7BA 4NSWA 2I5CA 1X11A 4CHMA 2Z0PA 1EGXA 1NI2A 1DDMA 4F7GA 2Y8FA 1OMWA 3BINA 3MDBC 2UZSA 4GMXB 2V76A 1LB1A 1QC6A 2CODA 3KZ1A 2COAA 3KSYA 3DXDA 5HE0A 3ML4A 3QWMA 2LULA 1W1GA 2DYNA 5D27A 4KVGB 3SUZA 1QQGA 4ZRIA 1K5GB 5C79A 1X05A 3SNHA 1FHXA 1UPQA 1WG7A 1NTYA 3OANA 4TKNA 1U29A 3TW1A 3PEGA 4C0AA 1J19A 1IRSA 1UNQA 1Y19B 3TVVA 4DBBA 2NZ8B 3D8EA 2QKLA 4EKUA 5L81A 2Z0QA 2K00A 2DHKA 1PMSA 4MT7A 3ODWA 3TCAA 4F7HA 1MKEA 1FHWA 2YS3A 2G35A 2COFA 3ODXA 5C5BB 4CYEA 1H4RA 4A6HA 4GPTB 4HATB 3RCPA 4KHOA 5JHGA 3HQCA 4WSFA 3PZDA 2UVMA 3SYXA 3IVFA 4GN1A 4H8SA 5JP4A 1OQNA 1XCGA 2EMTA 2DX1A 3VIAA 2W2XD 4HDOA 4ZRJA 5CLLB 2DN6A 2MFQA 3KRWA 4L6EA 2DLWA 2P8VA 2HE7A 5D3WA 2KCJA 2L1CA 3O96A 2RVBB 1EF1A 2X18A 3BJIA 1TQZA 1I2HA 1U5FA 1WJ1A 4WJ7A 3ZDTA 1P5TA 1EVHA 2W2XC 4GZUA 2K2JA 2K2UA 2EJ8A 2DHIA 3TFMA 2EC1A 5CLQB 1UPRA 4GMVA 1FGYA 3ULCA 2DYQA 2H7EA 5D3VA 4HHVA 2ELAA 2GCLA 3ZVRA 2GJYA 3PVWA 5DH9B 1FOEA 2ELBA 5HE2A 5D3YA 3D8FA 3PSCA 2LG1A 3F0WA 2D9ZA 4DX8A 2E2XA 2D9VA 5JLJB 3HW2B 2M38A 5KQ1A 2LOZA 2MWNB 1XD4A 1ZM0A 2YS1A 4HAVB 2Z0OA 1H10A 5KCVA 5LOPB 3TO1A 3NSUA 1V5MA 2RUKB 3CIKA 3LJUX 4K2OA 1TJ6A 2J0MA 4HAWB 4BBKA 2DKPA 2D9WA 1U27A 1GC7A 5J3QA 2CY5A 2LYDA 5C6RA 2DHJA 4A5KA 3DXEA 3KRXA 2IFSA 1B55A 1MPHA 2H7DA 3QBVB 4EMOA 1SGHA 3ULBA 4IOYX 3U8ZA 1FGZA 4IFSA 5JHHA 5KQ4A 3DXCA 1J0WA 2VRWB 3AJ4A 2D2QA 4HB0B 3GYOA 1N3HA 5LONB 1FAOA 1V5UA 2DTCA 2YT1A 3D8DA 3PG7A 1ZSQA 1P6SA 2PZ1A 1X1FA 4B6HA 4P7IA 5J3TA 2YSZA 3P7ZA 1NU2A 1W1HA 2DX5A 1BTNA 2MDXA 2COCA 1U5EA 4K17A 2XQNM 5HE3A 4IAPA 2RLOA 3A98B 1Y5OA 2YT0A 2GS0A 2YRYA 1BWNA 1DROA 2VKIA 3WYFB 2Q13A 3GYPA 1M7RA 2RNRB 2Y8GA 1WGUA 5HE1A 5D3XA 3M1IB 3UZTA 1SHCA 1DBHA 1MIZB 3A8QA 1PFJA 4MY6A 5GOWB 2J0KA 2I1KA 4HAXB 4Y94A 2IYBA 3SO6A 3SV1A 1ZC4B 4EJNA 1DDWA 5DI9B 1AWEA 2DKQA 2FJLA 2J59M 5FI0A 2N0YA 3CXBB 2P0FA 1PLSA 1LW3A 1DDVA 2KGXB 4F7UP 4HB3B 2DA0A 2D10A 5DIFB 1ISNA 2GCJA 5DHFB 2CAYA 3F5RA 2EMSA 1WGQA 2D9XA 3X23A 1Q67A 3VOQA 1BTKA 4A6FA 2D9YA 1FHOA 4CHJA 4GXBA 1ZC3B 1UNRA 2I1JA 2MKRA 2JP2A 4HB2B 2R0DA 4DX90 4HAYB 2RGNB 2LKOA 4D0NB 4PQ0A 1V88A 1V61A 2ROZB 2I5FA 4PNKA 1ZVRA 3FEHA 3P6AA 4K81A 4TYZA 1DYNA 2ADZA 2OQBA 1XX0A 4KHAA 4YONA 1E5WA 5DHAB 1AQCA 1BAKA 4HAZB 3U7DA 1K5DB 1MK7B 2W2WA 1X86A 1W1DA 3AU4A 4Z2NA 1I7AA 1WVHA 1RJ2A 2CRFA 4A6FB 1GC6A 2M14A 3PVUA 2D11A 1WJMA 3PP2A 5FI1A 5J3YA 1Z87A 3KY9A 3PVLA 2D4QA 1V5PA 4HAUB 2P0DA 1U2BA 2ROVA 3WA0A 5EFXA 5C5BA 3QIJA 2J0JA
chains in the Genus database with same CATH superfamily
4HDQA 1U5GA 1WI1A 3ODOA 5I2SA 3FM8C 4A6KA 2DFKA 1RRPB 1UNPA 1XODA 1P3RA 2AL6A 2P0HA 2R09A 3HIEA 2YF0A 4OT1A 3G9WA 1XR0B 2NMBA 2KUQA 1X1GA 5I2MA 2LOXA 4KHBB 3NWDA 4DIXA 1MIXA 4OSNA 1U5DA 1EAZA 3T06A 2HTHB 1OY2A 2VSZA 2L2IA 4MK0A 2QKMA 4ZRKA 3HK0A 1V89A 2AEHA 4NY0A 4WVFB 4KAXB 2YVCA 2BCJA 3V5WA 2CY4A 3N7CA 1GG3A 2NBVA 1XKEA 4K2PA 3AU5A 3A8PA 1KI1B 2Z59A 2YS5A 3MPXA 2KUPA 4D6WA 1FB8A 1KZGA 2OTXA 4DXAB 1NTVA 2RSGA 1M7EA 1UEFA 2YT2A 4CSQA 1ZYIA 4XWXA 1MAIA 4Z2MB 4HB4B 2N23A 2ZPYA 3FSSA 2UZRA 4YL8A 1KZ7A 5C16A 1TXDA 1MK9B 2Y7BA 5LG4B 4NSWA 2I5CA 1X11A 4CHMA 2Z0PA 1EGXA 1NI2A 1DDMA 4F7GA 2Y8FA 1OMWA 3BINA 3MDBC 2KIGA 2UZSA 4GMXB 2V76A 1LB1A 1QC6A 2CODA 3KZ1A 2COAA 3KSYA 3DXDA 5HE0A 3ML4A 3QWMA 2LULA 1W1GA 2DYNA 5D27A 4KVGB 3SUZA 1QQGA 4ZRIA 1K5GB 5C79A 1X05A 3SNHA 1FHXA 1UPQA 1WG7A 4GOUA 1NTYA 3OANA 4TKNA 1U29A 3TW1A 3PEGA 4C0AA 1J19A 1IRSA 1UNQA 1Y19B 3TVVA 4DBBA 2NZ8B 3D8EA 2QKLA 4EKUA 5L81A 3HSAA 2Z0QA 2K00A 2DHKA 1PMSA 4MT7A 3ODWA 3TCAA 4F7HA 1MKEA 1FHWA 2YS3A 2G35A 2ZKMX 2COFA 3ODXA 5C5BB 4CYEA 1H4RA 4A6HA 4GPTB 4HATB 3RCPA 4KHOA 5JHGA 3FVCA 4QJ4B 3HQCA 4WSFA 3PZDA 2UVMA 2KR0A 3SYXA 3IVFA 4GN1A 4H8SA 5JP4A 1OQNA 1XCGA 2EMTA 2DX1A 3VIAA 2W2XD 4HDOA 4ZRJA 5CLLB 2DN6A 2MFQA 3KRWA 4L6EA 2DLWA 2P8VA 2HE7A 5D3WA 3NWFA 2KCJA 2L1CA 3O96A 2RVBB 1EF1A 2X18A 3BJIA 4QJ5B 1TQZA 1I2HA 1U5FA 1WJ1A 4WJ7A 3ZDTA 1P5TA 1EVHA 2W2XC 4GZUA 2K2JA 2K2UA 2EJ8A 2DHIA 3TFMA 2EC1A 5CLQB 1UPRA 4GMVA 1FGYA 3ULCA 2DYQA 2H7EA 5D3VA 4HHVA 2ELAA 2GCLA 3ZVRA 2GJYA 3PVWA 5DH9B 1FOEA 2ELBA 2FJUB 5HE2A 5D3YA 3D8FA 3PSCA 2LG1A 3F0WA 2D9ZA 4DX8A 2E2XA 2D9VA 5JLJB 3HW2B 3B77A 2M38A 5KQ1A 2LOZA 2MWNB 1XD4A 1ZM0A 2YS1A 4HAVB 2Z14A 1H10A 2Z0OA 5KCVA 5LOPB 3TO1A 3NSUA 1V5MA 2RUKB 3CIKA 3LJUX 4K2OA 3U12A 1TJ6A 2J0MA 4HAWB 4BBKA 2DKPA 2D9WA 1U27A 1GC7A 5J3QA 2CY5A 2LYDA 5C6RA 2K8EA 5IRSA 2DHJA 4A5KA 2RRFA 3DXEA 3KRXA 2IFSA 1B55A 1MPHA 2H7DA 3QBVB 4EMOA 1SGHA 3ULBA 4IOYX 3U8ZA 1FGZA 4IFSA 5JHHA 1MI1A 5KQ4A 3DXCA 1J0WA 2VRWB 3AJ4A 2D2QA 4HB0B 3DCXA 3GYOA 1N3HA 5LONB 1FAOA 1V5UA 2DTCA 2YT1A 3D8DA 3PG7A 1ZSQA 1P6SA 2PZ1A 1X1FA 4HSIA 4B6HA 4P7IA 4GNKB 5J3TA 2YSZA 3P7ZA 1NU2A 1W1HA 2DX5A 1BTNA 2MDXA 2COCA 4QXAB 1U5EA 4K17A 2XQNM 5HE3A 4IAPA 2RLOA 3A98B 1Y5OA 2YT0A 2GS0A 2YRYA 1BWNA 1DROA 2VKIA 3WYFB 2Q13A 3GYPA 1M7RA 2RNRB 2Y8GA 5M4YB 1WGUA 5HE1A 5D3XA 3M1IB 3UZTA 1SHCA 1DBHA 1MIZB 3A8QA 3OHMB 1PFJA 3NWAA 4MY6A 5GOWB 2J0KA 2I1KA 4KHBA 4HAXB 4Y94A 2IYBA 3SO6A 3SV1A 1ZC4B 4EJNA 1DDWA 5DI9B 1AWEA 2DKQA 2FJLA 2J59M 5FI0A 2N0YA 3CXBB 2P0FA 3NW8A 1PLSA 2Z13A 2Z4DA 1LW3A 1DDVA 2KGXB 4F7UP 2KIEA 4HB3B 2DA0A 2K49A 2D10A 3A58A 5DIFB 1T77A 1ISNA 2GCJA 5DHFB 2CAYA 3F5RA 2EMSA 1WGQA 2D9XA 3X23A 1Q67A 3VOQA 1BTKA 4A6FA 2D9YA 1FHOA 4CHJA 4GXBA 1ZC3B 1UNRA 2GUMA 2I1JA 2MKRA 2JP2A 4HB2B 2R0DA 4DX90 4HAYB 2RGNB 2LKOA 4D0NB 4PQ0A 1V88A 1V61A 2ROZB 2I5FA 4PNKA 1ZVRA 3FEHA 3P6AA 4K81A 4TYZA 1DYNA 2ADZA 4L1RA 2OQBA 1XX0A 4KHAA 4YONA 1E5WA 5DHAB 1AQCA 1BAKA 4HAZB 3U7DA 1K5DB 1MK7B 4QJ3B 2W2WA 1X86A 1W1DA 2R2YA 3AU4A 4Z2NA 1I7AA 1WVHA 1RJ2A 2CRFA 4A6FB 1GC6A 2M14A 3PVUA 2D11A 1WJMA 3PP2A 5FI1A 5J3YA 1Z87A 3KY9A 3PVLA 2D4QA 1V5PA 4HAUB 2P0DA 1U2BA 2ROVA 3WA0A 5EFXA 5C5BA 3QIJA 2J0JA
chains in the Genus database with same CATH topology
4HDQA 1U5GA 1WI1A 3ODOA 3FM8C 4A6KA 2DFKA 1RRPB 1UNPA 1XODA 1P3RA 2AL6A 2P0HA 2R09A 2YF0A 3G9WA 1XR0B 2NMBA 1X1GA 2LOXA 4KHBB 1MIXA 1U5DA 1EAZA 3T06A 2HTHB 1OY2A 2VSZA 2L2IA 4MK0A 2QKMA 4ZRKA 3HK0A 1V89A 2AEHA 4NY0A 4WVFB 4KAXB 2YVCA 2BCJA 3V5WA 2CY4A 3N7CA 1GG3A 1XKEA 4K2PA 3AU5A 3A8PA 1KI1B 2YS5A 3MPXA 2KUPA 1FB8A 1KZGA 2OTXA 4DXAB 1NTVA 2RSGA 1M7EA 1UEFA 4XWXA 1MAIA 4Z2MB 4HB4B 2N23A 2ZPYA 3FSSA 2UZRA 4YL8A 1KZ7A 5C16A 1TXDA 1MK9B 2Y7BA 4NSWA 2I5CA 1X11A 4CHMA 2Z0PA 1EGXA 1NI2A 1DDMA 4F7GA 2Y8FA 1OMWA 3BINA 3MDBC 2UZSA 4GMXB 2V76A 1LB1A 1QC6A 2CODA 3KZ1A 2COAA 3KSYA 3DXDA 5HE0A 3ML4A 3QWMA 2LULA 1W1GA 2DYNA 5D27A 4KVGB 3SUZA 1QQGA 4ZRIA 1K5GB 5C79A 1X05A 3SNHA 1FHXA 1UPQA 1WG7A 1NTYA 3OANA 4TKNA 1U29A 3TW1A 3PEGA 4C0AA 1J19A 1IRSA 1UNQA 1Y19B 3TVVA 4DBBA 2NZ8B 3D8EA 2QKLA 4EKUA 5L81A 2Z0QA 2K00A 2DHKA 1PMSA 4MT7A 3ODWA 3TCAA 4F7HA 1MKEA 1FHWA 2YS3A 2G35A 2COFA 3ODXA 5C5BB 4CYEA 1H4RA 4A6HA 4GPTB 4HATB 3RCPA 4KHOA 5JHGA 3HQCA 4WSFA 3PZDA 2UVMA 3SYXA 3IVFA 4GN1A 4H8SA 5JP4A 1OQNA 1XCGA 2EMTA 2DX1A 3VIAA 2W2XD 4HDOA 4ZRJA 5CLLB 2DN6A 2MFQA 3KRWA 4L6EA 2DLWA 2P8VA 2HE7A 5D3WA 2KCJA 2L1CA 3O96A 2RVBB 1EF1A 2X18A 3BJIA 1TQZA 1I2HA 1U5FA 1WJ1A 4WJ7A 3ZDTA 1P5TA 1EVHA 2W2XC 4GZUA 2K2JA 2K2UA 2EJ8A 2DHIA 3TFMA 2EC1A 5CLQB 1UPRA 4GMVA 1FGYA 3ULCA 2DYQA 2H7EA 5D3VA 4HHVA 2ELAA 2GCLA 3ZVRA 2GJYA 3PVWA 5DH9B 1FOEA 2ELBA 5HE2A 5D3YA 3D8FA 3PSCA 2LG1A 3F0WA 2D9ZA 4DX8A 2E2XA 2D9VA 5JLJB 3HW2B 2M38A 5KQ1A 2LOZA 2MWNB 1XD4A 1ZM0A 2YS1A 4HAVB 2Z0OA 1H10A 5KCVA 5LOPB 3TO1A 3NSUA 1V5MA 2RUKB 3CIKA 3LJUX 4K2OA 1TJ6A 2J0MA 4HAWB 4BBKA 2DKPA 2D9WA 1U27A 1GC7A 5J3QA 2CY5A 2LYDA 5C6RA 2DHJA 4A5KA 3DXEA 3KRXA 2IFSA 1B55A 1MPHA 2H7DA 3QBVB 4EMOA 1SGHA 3ULBA 4IOYX 3U8ZA 1FGZA 4IFSA 5JHHA 5KQ4A 3DXCA 1J0WA 2VRWB 3AJ4A 2D2QA 4HB0B 3GYOA 1N3HA 5LONB 1FAOA 1V5UA 2DTCA 2YT1A 3D8DA 3PG7A 1ZSQA 1P6SA 2PZ1A 1X1FA 4B6HA 4P7IA 5J3TA 2YSZA 3P7ZA 1NU2A 1W1HA 2DX5A 1BTNA 2MDXA 2COCA 1U5EA 4K17A 2XQNM 5HE3A 4IAPA 2RLOA 3A98B 1Y5OA 2YT0A 2GS0A 2YRYA 1BWNA 1DROA 2VKIA 3WYFB 2Q13A 3GYPA 1M7RA 2RNRB 2Y8GA 1WGUA 5HE1A 5D3XA 3M1IB 3UZTA 1SHCA 1DBHA 1MIZB 3A8QA 1PFJA 4MY6A 5GOWB 2J0KA 2I1KA 4HAXB 4Y94A 2IYBA 3SO6A 3SV1A 1ZC4B 4EJNA 1DDWA 5DI9B 1AWEA 2DKQA 2FJLA 2J59M 5FI0A 2N0YA 3CXBB 2P0FA 1PLSA 1LW3A 1DDVA 2KGXB 4F7UP 4HB3B 2DA0A 2D10A 5DIFB 1ISNA 2GCJA 5DHFB 2CAYA 3F5RA 2EMSA 1WGQA 2D9XA 3X23A 1Q67A 3VOQA 1BTKA 4A6FA 2D9YA 1FHOA 4CHJA 4GXBA 1ZC3B 1UNRA 2I1JA 2MKRA 2JP2A 4HB2B 2R0DA 4DX90 4HAYB 2RGNB 2LKOA 4D0NB 4PQ0A 1V88A 1V61A 2ROZB 2I5FA 4PNKA 1ZVRA 3FEHA 3P6AA 4K81A 4TYZA 1DYNA 2ADZA 2OQBA 1XX0A 4KHAA 4YONA 1E5WA 5DHAB 1AQCA 1BAKA 4HAZB 3U7DA 1K5DB 1MK7B 2W2WA 1X86A 1W1DA 3AU4A 4Z2NA 1I7AA 1WVHA 1RJ2A 2CRFA 4A6FB 1GC6A 2M14A 3PVUA 2D11A 1WJMA 3PP2A 5FI1A 5J3YA 1Z87A 3KY9A 3PVLA 2D4QA 1V5PA 4HAUB 2P0DA 1U2BA 2ROVA 3WA0A 5EFXA 5C5BA 3QIJA 2J0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDQ A;  1U5G A;  1WI1 A;  3ODO A;  3FM8 C;  4A6K A;  2DFK A;  1RRP B;  1UNP A;  1XOD A;  1P3R A;  2AL6 A;  2P0H A;  2R09 A;  2YF0 A;  3G9W A;  1XR0 B;  2NMB A;  1X1G A;  2LOX A;  4KHB B;  1MIX A;  1U5D A;  1EAZ A;  3T06 A;  2HTH B;  1OY2 A;  2VSZ A;  2L2I A;  4MK0 A;  2QKM A;  4ZRK A;  3HK0 A;  1V89 A;  2AEH A;  4NY0 A;  4WVF B;  4KAX B;  2YVC A;  2BCJ A;  3V5W A;  2CY4 A;  3N7C A;  1GG3 A;  1XKE A;  4K2P A;  3AU5 A;  3A8P A;  1KI1 B;  2YS5 A;  3MPX A;  2KUP A;  1FB8 A;  1KZG A;  2OTX A;  4DXA B;  1NTV A;  2RSG A;  1M7E A;  1UEF A;  4XWX A;  1MAI A;  4Z2M B;  4HB4 B;  2N23 A;  2ZPY A;  3FSS A;  2UZR A;  4YL8 A;  1KZ7 A;  5C16 A;  1TXD A;  1MK9 B;  2Y7B A;  4NSW A;  2I5C A;  1X11 A;  4CHM A;  2Z0P A;  1EGX A;  1NI2 A;  1DDM A;  4F7G A;  2Y8F A;  1OMW A;  3BIN A;  3MDB C;  2UZS A;  4GMX B;  2V76 A;  1LB1 A;  1QC6 A;  2COD A;  3KZ1 A;  2COA A;  3KSY A;  3DXD A;  5HE0 A;  3ML4 A;  3QWM A;  2LUL A;  1W1G A;  2DYN A;  5D27 A;  4KVG B;  3SUZ A;  1QQG A;  4ZRI A;  1K5G B;  5C79 A;  1X05 A;  3SNH A;  1FHX A;  1UPQ A;  1WG7 A;  1NTY A;  3OAN A;  4TKN A;  1U29 A;  3TW1 A;  3PEG A;  4C0A A;  1J19 A;  1IRS A;  1UNQ A;  1Y19 B;  3TVV A;  4DBB A;  2NZ8 B;  3D8E A;  2QKL A;  4EKU A;  5L81 A;  2Z0Q A;  2K00 A;  2DHK A;  1PMS A;  4MT7 A;  3ODW A;  3TCA A;  4F7H A;  1MKE A;  1FHW A;  2YS3 A;  2G35 A;  2COF A;  3ODX A;  5C5B B;  4CYE A;  1H4R A;  4A6H A;  4GPT B;  4HAT B;  3RCP A;  4KHO A;  5JHG A;  3HQC A;  4WSF A;  3PZD A;  2UVM A;  3SYX A;  3IVF A;  4GN1 A;  4H8S A;  5JP4 A;  1OQN A;  1XCG A;  2EMT A;  2DX1 A;  3VIA A;  2W2X D;  4HDO A;  4ZRJ A;  5CLL B;  2DN6 A;  2MFQ A;  3KRW A;  4L6E A;  2DLW A;  2P8V A;  2HE7 A;  5D3W A;  2KCJ A;  2L1C A;  3O96 A;  2RVB B;  1EF1 A;  2X18 A;  3BJI A;  1TQZ A;  1I2H A;  1U5F A;  1WJ1 A;  4WJ7 A;  3ZDT A;  1P5T A;  1EVH A;  2W2X C;  4GZU A;  2K2J A;  2K2U A;  2EJ8 A;  2DHI A;  3TFM A;  2EC1 A;  5CLQ B;  1UPR A;  4GMV A;  1FGY A;  3ULC A;  2DYQ A;  2H7E A;  5D3V A;  4HHV A;  2ELA A;  2GCL A;  3ZVR A;  2GJY A;  3PVW A;  5DH9 B;  1FOE A;  2ELB A;  5HE2 A;  5D3Y A;  3D8F A;  3PSC A;  2LG1 A;  3F0W A;  2D9Z A;  4DX8 A;  2E2X A;  2D9V A;  5JLJ B;  3HW2 B;  2M38 A;  5KQ1 A;  2LOZ A;  2MWN B;  1XD4 A;  1ZM0 A;  2YS1 A;  4HAV B;  2Z0O A;  1H10 A;  5KCV A;  5LOP B;  3TO1 A;  3NSU A;  1V5M A;  2RUK B;  3CIK A;  3LJU X;  4K2O A;  1TJ6 A;  2J0M A;  4HAW B;  4BBK A;  2DKP A;  2D9W A;  1U27 A;  1GC7 A;  5J3Q A;  2CY5 A;  2LYD A;  5C6R A;  2DHJ A;  4A5K A;  3DXE A;  3KRX A;  2IFS A;  1B55 A;  1MPH A;  2H7D A;  3QBV B;  4EMO A;  1SGH A;  3ULB A;  4IOY X;  3U8Z A;  1FGZ A;  4IFS A;  5JHH A;  5KQ4 A;  3DXC A;  1J0W A;  2VRW B;  3AJ4 A;  2D2Q A;  4HB0 B;  3GYO A;  1N3H A;  5LON B;  1FAO A;  1V5U A;  2DTC A;  2YT1 A;  3D8D A;  3PG7 A;  1ZSQ A;  1P6S A;  2PZ1 A;  1X1F A;  4B6H A;  4P7I A;  5J3T A;  2YSZ A;  3P7Z A;  1NU2 A;  1W1H A;  2DX5 A;  1BTN A;  2MDX A;  2COC A;  1U5E A;  4K17 A;  2XQN M;  5HE3 A;  4IAP A;  2RLO A;  3A98 B;  1Y5O A;  2YT0 A;  2GS0 A;  2YRY A;  1BWN A;  1DRO A;  2VKI A;  3WYF B;  2Q13 A;  3GYP A;  1M7R A;  2RNR B;  2Y8G A;  1WGU A;  5HE1 A;  5D3X A;  3M1I B;  3UZT A;  1SHC A;  1DBH A;  1MIZ B;  3A8Q A;  1PFJ A;  4MY6 A;  5GOW B;  2J0K A;  2I1K A;  4HAX B;  4Y94 A;  2IYB A;  3SO6 A;  3SV1 A;  1ZC4 B;  4EJN A;  1DDW A;  5DI9 B;  1AWE A;  2DKQ A;  2FJL A;  2J59 M;  5FI0 A;  2N0Y A;  3CXB B;  2P0F A;  1PLS A;  1LW3 A;  1DDV A;  2KGX B;  4F7U P;  4HB3 B;  2DA0 A;  2D10 A;  5DIF B;  1ISN A;  2GCJ A;  5DHF B;  2CAY A;  3F5R A;  2EMS A;  1WGQ A;  2D9X A;  3X23 A;  1Q67 A;  3VOQ A;  1BTK A;  4A6F A;  2D9Y A;  1FHO A;  4CHJ A;  4GXB A;  1ZC3 B;  1UNR A;  2I1J A;  2MKR A;  2JP2 A;  4HB2 B;  2R0D A;  4DX9 0;  4HAY B;  2RGN B;  2LKO A;  4D0N B;  4PQ0 A;  1V88 A;  1V61 A;  2ROZ B;  2I5F A;  4PNK A;  1ZVR A;  3FEH A;  3P6A A;  4K81 A;  4TYZ A;  1DYN A;  2ADZ A;  2OQB A;  1XX0 A;  4KHA A;  4YON A;  1E5W A;  5DHA B;  1AQC A;  1BAK A;  4HAZ B;  3U7D A;  1K5D B;  1MK7 B;  2W2W A;  1X86 A;  1W1D A;  3AU4 A;  4Z2N A;  1I7A A;  1WVH A;  1RJ2 A;  2CRF A;  4A6F B;  1GC6 A;  2M14 A;  3PVU A;  2D11 A;  1WJM A;  3PP2 A;  5FI1 A;  5J3Y A;  1Z87 A;  3KY9 A;  3PVL A;  2D4Q A;  1V5P A;  4HAU B;  2P0D A;  1U2B A;  2ROV A;  3WA0 A;  5EFX A;  5C5B A;  3QIJ A;  2J0J A; 
#chains in the Genus database with same CATH topology
 4HDQ A;  1U5G A;  1WI1 A;  3ODO A;  5I2S A;  3FM8 C;  4A6K A;  2DFK A;  1RRP B;  1UNP A;  1XOD A;  1P3R A;  2AL6 A;  2P0H A;  2R09 A;  3HIE A;  2YF0 A;  4OT1 A;  3G9W A;  1XR0 B;  2NMB A;  2KUQ A;  1X1G A;  5I2M A;  2LOX A;  4KHB B;  3NWD A;  4DIX A;  1MIX A;  4OSN A;  1U5D A;  1EAZ A;  3T06 A;  2HTH B;  1OY2 A;  2VSZ A;  2L2I A;  4MK0 A;  2QKM A;  4ZRK A;  3HK0 A;  1V89 A;  2AEH A;  4NY0 A;  4WVF B;  4KAX B;  2YVC A;  2BCJ A;  3V5W A;  2CY4 A;  3N7C A;  1GG3 A;  2NBV A;  1XKE A;  4K2P A;  3AU5 A;  3A8P A;  1KI1 B;  2Z59 A;  2YS5 A;  3MPX A;  2KUP A;  4D6W A;  1FB8 A;  1KZG A;  2OTX A;  4DXA B;  1NTV A;  2RSG A;  1M7E A;  1UEF A;  2YT2 A;  4CSQ A;  1ZYI A;  4XWX A;  1MAI A;  4Z2M B;  4HB4 B;  2N23 A;  2ZPY A;  3FSS A;  2UZR A;  4YL8 A;  1KZ7 A;  5C16 A;  1TXD A;  1MK9 B;  2Y7B A;  5LG4 B;  4NSW A;  2I5C A;  1X11 A;  4CHM A;  2Z0P A;  1EGX A;  1NI2 A;  1DDM A;  4F7G A;  2Y8F A;  1OMW A;  3BIN A;  3MDB C;  2KIG A;  2UZS A;  4GMX B;  2V76 A;  1LB1 A;  1QC6 A;  2COD A;  3KZ1 A;  2COA A;  3KSY A;  3DXD A;  5HE0 A;  3ML4 A;  3QWM A;  2LUL A;  1W1G A;  2DYN A;  5D27 A;  4KVG B;  3SUZ A;  1QQG A;  4ZRI A;  1K5G B;  5C79 A;  1X05 A;  3SNH A;  1FHX A;  1UPQ A;  1WG7 A;  4GOU A;  1NTY A;  3OAN A;  4TKN A;  1U29 A;  3TW1 A;  3PEG A;  4C0A A;  1J19 A;  1IRS A;  1UNQ A;  1Y19 B;  3TVV A;  4DBB A;  2NZ8 B;  3D8E A;  2QKL A;  4EKU A;  5L81 A;  3HSA A;  2Z0Q A;  2K00 A;  2DHK A;  1PMS A;  4MT7 A;  3ODW A;  3TCA A;  4F7H A;  1MKE A;  1FHW A;  2YS3 A;  2G35 A;  2ZKM X;  2COF A;  3ODX A;  5C5B B;  4CYE A;  1H4R A;  4A6H A;  4GPT B;  4HAT B;  3RCP A;  4KHO A;  5JHG A;  3FVC A;  4QJ4 B;  3HQC A;  4WSF A;  3PZD A;  2UVM A;  2KR0 A;  3SYX A;  3IVF A;  4GN1 A;  4H8S A;  5JP4 A;  1OQN A;  1XCG A;  2EMT A;  2DX1 A;  3VIA A;  2W2X D;  4HDO A;  4ZRJ A;  5CLL B;  2DN6 A;  2MFQ A;  3KRW A;  4L6E A;  2DLW A;  2P8V A;  2HE7 A;  5D3W A;  3NWF A;  2KCJ A;  2L1C A;  3O96 A;  2RVB B;  1EF1 A;  2X18 A;  3BJI A;  4QJ5 B;  1TQZ A;  1I2H A;  1U5F A;  1WJ1 A;  4WJ7 A;  3ZDT A;  1P5T A;  1EVH A;  2W2X C;  4GZU A;  2K2J A;  2K2U A;  2EJ8 A;  2DHI A;  3TFM A;  2EC1 A;  5CLQ B;  1UPR A;  4GMV A;  1FGY A;  3ULC A;  2DYQ A;  2H7E A;  5D3V A;  4HHV A;  2ELA A;  2GCL A;  3ZVR A;  2GJY A;  3PVW A;  5DH9 B;  1FOE A;  2ELB A;  2FJU B;  5HE2 A;  5D3Y A;  3D8F A;  3PSC A;  2LG1 A;  3F0W A;  2D9Z A;  4DX8 A;  2E2X A;  2D9V A;  5JLJ B;  3HW2 B;  3B77 A;  2M38 A;  5KQ1 A;  2LOZ A;  2MWN B;  1XD4 A;  1ZM0 A;  2YS1 A;  4HAV B;  2Z14 A;  1H10 A;  2Z0O A;  5KCV A;  5LOP B;  3TO1 A;  3NSU A;  1V5M A;  2RUK B;  3CIK A;  3LJU X;  4K2O A;  3U12 A;  1TJ6 A;  2J0M A;  4HAW B;  4BBK A;  2DKP A;  2D9W A;  1U27 A;  1GC7 A;  5J3Q A;  2CY5 A;  2LYD A;  5C6R A;  2K8E A;  5IRS A;  2DHJ A;  4A5K A;  2RRF A;  3DXE A;  3KRX A;  2IFS A;  1B55 A;  1MPH A;  2H7D A;  3QBV B;  4EMO A;  1SGH A;  3ULB A;  4IOY X;  3U8Z A;  1FGZ A;  4IFS A;  5JHH A;  1MI1 A;  5KQ4 A;  3DXC A;  1J0W A;  2VRW B;  3AJ4 A;  2D2Q A;  4HB0 B;  3DCX A;  3GYO A;  1N3H A;  5LON B;  1FAO A;  1V5U A;  2DTC A;  2YT1 A;  3D8D A;  3PG7 A;  1ZSQ A;  1P6S A;  2PZ1 A;  1X1F A;  4HSI A;  4B6H A;  4P7I A;  4GNK B;  5J3T A;  2YSZ A;  3P7Z A;  1NU2 A;  1W1H A;  2DX5 A;  1BTN A;  2MDX A;  2COC A;  4QXA B;  1U5E A;  4K17 A;  2XQN M;  5HE3 A;  4IAP A;  2RLO A;  3A98 B;  1Y5O A;  2YT0 A;  2GS0 A;  2YRY A;  1BWN A;  1DRO A;  2VKI A;  3WYF B;  2Q13 A;  3GYP A;  1M7R A;  2RNR B;  2Y8G A;  5M4Y B;  1WGU A;  5HE1 A;  5D3X A;  3M1I B;  3UZT A;  1SHC A;  1DBH A;  1MIZ B;  3A8Q A;  3OHM B;  1PFJ A;  3NWA A;  4MY6 A;  5GOW B;  2J0K A;  2I1K A;  4KHB A;  4HAX B;  4Y94 A;  2IYB A;  3SO6 A;  3SV1 A;  1ZC4 B;  4EJN A;  1DDW A;  5DI9 B;  1AWE A;  2DKQ A;  2FJL A;  2J59 M;  5FI0 A;  2N0Y A;  3CXB B;  2P0F A;  3NW8 A;  1PLS A;  2Z13 A;  2Z4D A;  1LW3 A;  1DDV A;  2KGX B;  4F7U P;  2KIE A;  4HB3 B;  2DA0 A;  2K49 A;  2D10 A;  3A58 A;  5DIF B;  1T77 A;  1ISN A;  2GCJ A;  5DHF B;  2CAY A;  3F5R A;  2EMS A;  1WGQ A;  2D9X A;  3X23 A;  1Q67 A;  3VOQ A;  1BTK A;  4A6F A;  2D9Y A;  1FHO A;  4CHJ A;  4GXB A;  1ZC3 B;  1UNR A;  2GUM A;  2I1J A;  2MKR A;  2JP2 A;  4HB2 B;  2R0D A;  4DX9 0;  4HAY B;  2RGN B;  2LKO A;  4D0N B;  4PQ0 A;  1V88 A;  1V61 A;  2ROZ B;  2I5F A;  4PNK A;  1ZVR A;  3FEH A;  3P6A A;  4K81 A;  4TYZ A;  1DYN A;  2ADZ A;  4L1R A;  2OQB A;  1XX0 A;  4KHA A;  4YON A;  1E5W A;  5DHA B;  1AQC A;  1BAK A;  4HAZ B;  3U7D A;  1K5D B;  1MK7 B;  4QJ3 B;  2W2W A;  1X86 A;  1W1D A;  2R2Y A;  3AU4 A;  4Z2N A;  1I7A A;  1WVH A;  1RJ2 A;  2CRF A;  4A6F B;  1GC6 A;  2M14 A;  3PVU A;  2D11 A;  1WJM A;  3PP2 A;  5FI1 A;  5J3Y A;  1Z87 A;  3KY9 A;  3PVL A;  2D4Q A;  1V5P A;  4HAU B;  2P0D A;  1U2B A;  2ROV A;  3WA0 A;  5EFX A;  5C5B A;  3QIJ A;  2J0J A; 
#chains in the Genus database with same CATH homology
 4HDQ A;  1U5G A;  1WI1 A;  3ODO A;  3FM8 C;  4A6K A;  2DFK A;  1RRP B;  1UNP A;  1XOD A;  1P3R A;  2AL6 A;  2P0H A;  2R09 A;  2YF0 A;  3G9W A;  1XR0 B;  2NMB A;  1X1G A;  2LOX A;  4KHB B;  1MIX A;  1U5D A;  1EAZ A;  3T06 A;  2HTH B;  1OY2 A;  2VSZ A;  2L2I A;  4MK0 A;  2QKM A;  4ZRK A;  3HK0 A;  1V89 A;  2AEH A;  4NY0 A;  4WVF B;  4KAX B;  2YVC A;  2BCJ A;  3V5W A;  2CY4 A;  3N7C A;  1GG3 A;  1XKE A;  4K2P A;  3AU5 A;  3A8P A;  1KI1 B;  2YS5 A;  3MPX A;  2KUP A;  1FB8 A;  1KZG A;  2OTX A;  4DXA B;  1NTV A;  2RSG A;  1M7E A;  1UEF A;  4XWX A;  1MAI A;  4Z2M B;  4HB4 B;  2N23 A;  2ZPY A;  3FSS A;  2UZR A;  4YL8 A;  1KZ7 A;  5C16 A;  1TXD A;  1MK9 B;  2Y7B A;  4NSW A;  2I5C A;  1X11 A;  4CHM A;  2Z0P A;  1EGX A;  1NI2 A;  1DDM A;  4F7G A;  2Y8F A;  1OMW A;  3BIN A;  3MDB C;  2UZS A;  4GMX B;  2V76 A;  1LB1 A;  1QC6 A;  2COD A;  3KZ1 A;  2COA A;  3KSY A;  3DXD A;  5HE0 A;  3ML4 A;  3QWM A;  2LUL A;  1W1G A;  2DYN A;  5D27 A;  4KVG B;  3SUZ A;  1QQG A;  4ZRI A;  1K5G B;  5C79 A;  1X05 A;  3SNH A;  1FHX A;  1UPQ A;  1WG7 A;  1NTY A;  3OAN A;  4TKN A;  1U29 A;  3TW1 A;  3PEG A;  4C0A A;  1J19 A;  1IRS A;  1UNQ A;  1Y19 B;  3TVV A;  4DBB A;  2NZ8 B;  3D8E A;  2QKL A;  4EKU A;  5L81 A;  2Z0Q A;  2K00 A;  2DHK A;  1PMS A;  4MT7 A;  3ODW A;  3TCA A;  4F7H A;  1MKE A;  1FHW A;  2YS3 A;  2G35 A;  2COF A;  3ODX A;  5C5B B;  4CYE A;  1H4R A;  4A6H A;  4GPT B;  4HAT B;  3RCP A;  4KHO A;  5JHG A;  3HQC A;  4WSF A;  3PZD A;  2UVM A;  3SYX A;  3IVF A;  4GN1 A;  4H8S A;  5JP4 A;  1OQN A;  1XCG A;  2EMT A;  2DX1 A;  3VIA A;  2W2X D;  4HDO A;  4ZRJ A;  5CLL B;  2DN6 A;  2MFQ A;  3KRW A;  4L6E A;  2DLW A;  2P8V A;  2HE7 A;  5D3W A;  2KCJ A;  2L1C A;  3O96 A;  2RVB B;  1EF1 A;  2X18 A;  3BJI A;  1TQZ A;  1I2H A;  1U5F A;  1WJ1 A;  4WJ7 A;  3ZDT A;  1P5T A;  1EVH A;  2W2X C;  4GZU A;  2K2J A;  2K2U A;  2EJ8 A;  2DHI A;  3TFM A;  2EC1 A;  5CLQ B;  1UPR A;  4GMV A;  1FGY A;  3ULC A;  2DYQ A;  2H7E A;  5D3V A;  4HHV A;  2ELA A;  2GCL A;  3ZVR A;  2GJY A;  3PVW A;  5DH9 B;  1FOE A;  2ELB A;  5HE2 A;  5D3Y A;  3D8F A;  3PSC A;  2LG1 A;  3F0W A;  2D9Z A;  4DX8 A;  2E2X A;  2D9V A;  5JLJ B;  3HW2 B;  2M38 A;  5KQ1 A;  2LOZ A;  2MWN B;  1XD4 A;  1ZM0 A;  2YS1 A;  4HAV B;  2Z0O A;  1H10 A;  5KCV A;  5LOP B;  3TO1 A;  3NSU A;  1V5M A;  2RUK B;  3CIK A;  3LJU X;  4K2O A;  1TJ6 A;  2J0M A;  4HAW B;  4BBK A;  2DKP A;  2D9W A;  1U27 A;  1GC7 A;  5J3Q A;  2CY5 A;  2LYD A;  5C6R A;  2DHJ A;  4A5K A;  3DXE A;  3KRX A;  2IFS A;  1B55 A;  1MPH A;  2H7D A;  3QBV B;  4EMO A;  1SGH A;  3ULB A;  4IOY X;  3U8Z A;  1FGZ A;  4IFS A;  5JHH A;  5KQ4 A;  3DXC A;  1J0W A;  2VRW B;  3AJ4 A;  2D2Q A;  4HB0 B;  3GYO A;  1N3H A;  5LON B;  1FAO A;  1V5U A;  2DTC A;  2YT1 A;  3D8D A;  3PG7 A;  1ZSQ A;  1P6S A;  2PZ1 A;  1X1F A;  4B6H A;  4P7I A;  5J3T A;  2YSZ A;  3P7Z A;  1NU2 A;  1W1H A;  2DX5 A;  1BTN A;  2MDX A;  2COC A;  1U5E A;  4K17 A;  2XQN M;  5HE3 A;  4IAP A;  2RLO A;  3A98 B;  1Y5O A;  2YT0 A;  2GS0 A;  2YRY A;  1BWN A;  1DRO A;  2VKI A;  3WYF B;  2Q13 A;  3GYP A;  1M7R A;  2RNR B;  2Y8G A;  1WGU A;  5HE1 A;  5D3X A;  3M1I B;  3UZT A;  1SHC A;  1DBH A;  1MIZ B;  3A8Q A;  1PFJ A;  4MY6 A;  5GOW B;  2J0K A;  2I1K A;  4HAX B;  4Y94 A;  2IYB A;  3SO6 A;  3SV1 A;  1ZC4 B;  4EJN A;  1DDW A;  5DI9 B;  1AWE A;  2DKQ A;  2FJL A;  2J59 M;  5FI0 A;  2N0Y A;  3CXB B;  2P0F A;  1PLS A;  1LW3 A;  1DDV A;  2KGX B;  4F7U P;  4HB3 B;  2DA0 A;  2D10 A;  5DIF B;  1ISN A;  2GCJ A;  5DHF B;  2CAY A;  3F5R A;  2EMS A;  1WGQ A;  2D9X A;  3X23 A;  1Q67 A;  3VOQ A;  1BTK A;  4A6F A;  2D9Y A;  1FHO A;  4CHJ A;  4GXB A;  1ZC3 B;  1UNR A;  2I1J A;  2MKR A;  2JP2 A;  4HB2 B;  2R0D A;  4DX9 0;  4HAY B;  2RGN B;  2LKO A;  4D0N B;  4PQ0 A;  1V88 A;  1V61 A;  2ROZ B;  2I5F A;  4PNK A;  1ZVR A;  3FEH A;  3P6A A;  4K81 A;  4TYZ A;  1DYN A;  2ADZ A;  2OQB A;  1XX0 A;  4KHA A;  4YON A;  1E5W A;  5DHA B;  1AQC A;  1BAK A;  4HAZ B;  3U7D A;  1K5D B;  1MK7 B;  2W2W A;  1X86 A;  1W1D A;  3AU4 A;  4Z2N A;  1I7A A;  1WVH A;  1RJ2 A;  2CRF A;  4A6F B;  1GC6 A;  2M14 A;  3PVU A;  2D11 A;  1WJM A;  3PP2 A;  5FI1 A;  5J3Y A;  1Z87 A;  3KY9 A;  3PVL A;  2D4Q A;  1V5P A;  4HAU B;  2P0D A;  1U2B A;  2ROV A;  3WA0 A;  5EFX A;  5C5B A;  3QIJ A;  2J0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...