4F7HA

The crystal structure of kindlin-2 pleckstrin homology domain in free form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
ILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fermitin family homolog 2
publication title Crystal structure of kindlin-2 PH domain reveals a conformational transition for its membrane anchoring and regulation of integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 30
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4f7hA00
2J59M 4F7GA 4K2OA 2K2JA 3T06A 1XR0B 4GMVA 2P0FA 1WG7A 4KHAA 5D3YA 2CY4A 2YVCA 2ZPYA 1NI2A 4KAXB 1UPRA 2UZRA 4TYZA 4A6FB 1EAZA 2Z0PA 4EMOA 4HB0B 1QC6A 3FSSA 2DHIA 2YT0A 3F5RA 3RCPA 4ZRJA 1ZC3B 2I5CA 1WGUA 2E2XA 4A6HA 1XODA 2EC1A 2VRWB 1U27A 2YT1A 4C0AA 4NY0A 1XKEA 4CYEA 1E5WA 3WA0A 2DTCA 2DN6A 1M7EA 1Y19B 4YONA 2QKLA 2G35A 1ZVRA 2P0DA 2CODA 1FHWA 2COAA 5JHGA 2UVMA 4F7UP 3PVUA 3PVWA 4Y94A 2CY5A 2FJLA 1MKEA 1X05A 4DBBA 4HAZB 3PSCA 4F7HA 2DYNA 2VSZA 1WI1A 2J0KA 2DX5A 2MWNB 5KQ1A 2YRYA 4GN1A 4ZRIA 1OMWA 1XX0A 4YL8A 3SV1A 3D8FA 2DYQA 5D3WA 2COCA 2NMBA 1I7AA 4GZUA 2LOXA 5C16A 1BTKA 3PEGA 2V76A 2N0YA 2NZ8B 3FEHA 4K81A 1GC6A 4HAYB 1X86A 1U29A 2RNRB 1NTYA 1MK7B 5DH9B 3LJUX 2MDXA 3KZ1A 5FI1A 5KQ4A 2W2XC 1FHOA 3TFMA 1NTVA 2YS5A 5C5BB 5D3XA 2H7EA 4A6KA 3X23A 3O96A 1Y5OA 2D2QA 3HW2B 4EJNA 4Z2MB 1UNQA 2YS1A 3U7DA 2J0JA 1H4RA 2Y8GA 4HDOA 5JLJB 1FGYA 1J19A 1UPQA 3A8QA 1V5MA 1ZC4B 2GS0A 4HAWB 3TVVA 3SO6A 2JP2A 3PVLA 2ADZA 2MFQA 5L81A 5D3VA 5DHAB 1I2HA 1OQNA 2I1JA 2KGXB 2M38A 4EKUA 4GPTB 2DKPA 5C5BA 2DKQA 3TW1A 4P7IA 1DDWA 1UNRA 1OY2A 4A5KA 1Z87A 2H7DA 3AU5A 2I1KA 2D11A 2RVBB 1B55A 2LULA 2Z0QA 3VIAA 4HAUB 4HB4B 1FGZA 5HE1A 2GCLA 3UZTA 1XD4A 2W2WA 1IRSA 2CAYA 1X1GA 5LONB 4A6FA 3U8ZA 1ZM0A 4H8SA 2K2UA 5J3QA 2YF0A 1U2BA 2HE7A 1FOEA 1WJMA 2RUKB 5GOWB 1XCGA 3CIKA 1RJ2A 1U5EA 1KZ7A 1SGHA 3P6AA 2LOZA 3DXEA 3QBVB 2GCJA 3HQCA 3KY9A 1PMSA 2Y8FA 2OTXA 1DYNA 2EMSA 5CLLB 1KZGA 1N3HA 1M7RA 1U5FA 1MAIA 2ELBA 4HDQA 1DBHA 2HTHB 5HE3A 1V61A 4IOYX 3G9WA 2Z0OA 2W2XD 4IFSA 3IVFA 3TCAA 1ISNA 2Y7BA 3CXBB 4HHVA 1V5UA 4CHMA 3V5WA 1X1FA 3BINA 1TJ6A 1DDMA 5JP4A 5C6RA 1X11A 4HAVB 2AEHA 1BWNA 1EVHA 1KI1B 3N7CA 2D9ZA 2DHKA 3HK0A 4HB2B 4WVFB 2QKMA 2ELAA 1Q67A 4MT7A 2D9VA 4KVGB 1P6SA 1U5DA 4Z2NA 2IYBA 5J3TA 1EGXA 3A98B 1GC7A 2D9WA 2K00A 3AU4A 2DA0A 1AWEA 3KSYA 1FB8A 1PFJA 2COFA 4NSWA 3PZDA 3ULBA 3DXDA 2YSZA 2D9YA 2DX1A 2DHJA 5J3YA 4KHOA 2RSGA 1SHCA 1U5GA 5DHFB 1UNPA 4K2PA 1QQGA 5CLQB 1ZSQA 1AQCA 2BCJA 3PP2A 1MPHA 1EF1A 3MPXA 3TO1A 1LW3A 1TXDA 4GXBA 3MDBC 1DDVA 2L2IA 4CHJA 3GYOA 1TQZA 2EJ8A 1FAOA 2M14A 2PZ1A 1K5DB 1PLSA 3ZVRA 1BTNA 5EFXA 4WSFA 3ODWA 4B6HA 1MIZB 4KHBB 5HE2A 3ZDTA 4TKNA 2DFKA 3D8DA 2YS3A 2LYDA 1P5TA 1V5PA 5C79A 3ODXA 2IFSA 5DI9B 5FI0A 2L1CA 2R09A 3DXCA 4HB3B 2MKRA 1DROA 1RRPB 4PQ0A 4BBKA 3KRXA 3PG7A 3ODOA 4MY6A 2RLOA 2I5FA 2UZSA 2P0HA 1J0WA 1V88A 2EMTA 3OANA 4PNKA 2KUPA 1W1DA 3FM8C 5JHHA 1V89A 2DLWA 2P8VA 2R0DA 2RGNB 4DX8A 4HATB 4K17A 1MK9B 3WYFB 1MIXA 3BJIA 5DIFB 3KRWA 3AJ4A 1NU2A 1LB1A 1FHXA 3M1IB 4GMXB 1BAKA 3SNHA 1P3RA 2J0MA 2D9XA 4IAPA 3NSUA 2LG1A 3F0WA 5KCVA 4HAXB 2X18A 2N23A 3QWMA 1WGQA 1WVHA 4ZRKA 3D8EA 1GG3A 2D4QA 5HE0A 2OQBA 1K5GB 1W1GA 5D27A 3QIJA 2Q13A 2AL6A 2KCJA 3GYPA 3SYXA 2VKIA 4L6EA 3A8PA 3VOQA 3P7ZA 4MK0A 4DX90 3ML4A 1H10A 4WJ7A 4D0NB 3SUZA 3ULCA 1W1HA 5LOPB 2ROZB 2D10A 2GJYA 2LKOA 4DXAB 2CRFA 1UEFA 4XWXA 2XQNM 1WJ1A 2ROVA
chains in the Genus database with same CATH superfamily
2J59M 4F7GA 4K2OA 2K2JA 3T06A 1XR0B 4GMVA 2P0FA 1WG7A 4KHAA 5D3YA 2CY4A 2YVCA 2ZPYA 1NI2A 4KAXB 1UPRA 2UZRA 4GOUA 4TYZA 4A6FB 1EAZA 2Z0PA 4EMOA 4HB0B 1QC6A 3FSSA 2DHIA 2YT0A 3F5RA 3RCPA 4ZRJA 1ZC3B 2I5CA 1WGUA 2Z59A 2E2XA 4A6HA 1XODA 2EC1A 2RRFA 2VRWB 1U27A 2YT1A 4C0AA 4NY0A 2Z13A 1XKEA 4CSQA 4CYEA 1E5WA 3WA0A 2DTCA 2DN6A 1M7EA 1Y19B 2Z4DA 4YONA 2QKLA 2G35A 1ZVRA 2P0DA 2Z14A 4KHBA 2CODA 1FHWA 2COAA 5JHGA 2UVMA 3DCXA 4F7UP 3PVUA 3PVWA 4Y94A 2CY5A 2FJLA 3HSAA 1MKEA 1X05A 4DBBA 4HAZB 3PSCA 4F7HA 2DYNA 2KUQA 2VSZA 4QJ3B 1WI1A 2J0KA 2DX5A 2MWNB 5KQ1A 2YRYA 4GN1A 4ZRIA 1OMWA 1XX0A 4YL8A 3SV1A 3NWAA 3D8FA 2DYQA 5D3WA 2COCA 2NMBA 1I7AA 4GZUA 2LOXA 5C16A 1BTKA 3PEGA 2V76A 2N0YA 2NZ8B 2KIGA 3FEHA 4K81A 3NW8A 1GC6A 4HAYB 1X86A 1U29A 2RNRB 1NTYA 4QXAB 1MK7B 5DH9B 3LJUX 2MDXA 4DIXA 3KZ1A 5FI1A 5KQ4A 2W2XC 1FHOA 3TFMA 1NTVA 2YS5A 5C5BB 5D3XA 2H7EA 4A6KA 2R2YA 3X23A 3O96A 1Y5OA 2D2QA 3HW2B 4EJNA 3FVCA 4Z2MB 1UNQA 2YS1A 3U7DA 2J0JA 1H4RA 2Y8GA 4HDOA 5JLJB 1FGYA 1J19A 1UPQA 3A8QA 1V5MA 1ZC4B 2GS0A 4HAWB 3TVVA 3SO6A 2JP2A 3PVLA 2ADZA 2MFQA 2YT2A 5M4YB 5L81A 5D3VA 5DHAB 1I2HA 1OQNA 2I1JA 2KGXB 3NWDA 2M38A 4EKUA 4GPTB 2DKPA 5C5BA 2DKQA 3U12A 3TW1A 4P7IA 1DDWA 1UNRA 1OY2A 4A5KA 1Z87A 2H7DA 3AU5A 2I1KA 2D11A 2RVBB 1B55A 2LULA 2Z0QA 3VIAA 1T77A 4HAUB 4HB4B 1FGZA 5HE1A 2GCLA 3UZTA 1XD4A 2W2WA 1IRSA 2CAYA 1X1GA 5LONB 4A6FA 3U8ZA 1ZM0A 4H8SA 2K2UA 5J3QA 2YF0A 1U2BA 2ZKMX 2HE7A 1FOEA 1WJMA 2RUKB 5GOWB 1XCGA 3CIKA 1RJ2A 1U5EA 1ZYIA 4GNKB 1KZ7A 1SGHA 3P6AA 2LOZA 3DXEA 3QBVB 2GCJA 3HQCA 3KY9A 1PMSA 2Y8FA 2OTXA 1DYNA 4QJ5B 2EMSA 5CLLB 1KZGA 1N3HA 1M7RA 1U5FA 2K49A 1MAIA 2ELBA 4HDQA 1DBHA 2HTHB 5HE3A 1V61A 4IOYX 3G9WA 2Z0OA 2NBVA 2W2XD 4IFSA 3IVFA 3TCAA 1ISNA 2Y7BA 3CXBB 4HHVA 1V5UA 3OHMB 4CHMA 3V5WA 1X1FA 2KR0A 3BINA 1TJ6A 1DDMA 5JP4A 5C6RA 1X11A 4HAVB 2AEHA 4OSNA 1BWNA 1EVHA 1KI1B 2D9ZA 2DHKA 3HK0A 3N7CA 4HB2B 4WVFB 2QKMA 2ELAA 1Q67A 4MT7A 2D9VA 4KVGB 1P6SA 1U5DA 4Z2NA 2IYBA 5J3TA 1EGXA 3A98B 1GC7A 2D9WA 2K00A 3AU4A 2DA0A 1AWEA 3KSYA 1FB8A 1PFJA 2COFA 4NSWA 2FJUB 3PZDA 3ULBA 3DXDA 5I2MA 3B77A 2YSZA 2D9YA 2DX1A 2DHJA 5J3YA 4KHOA 2RSGA 1SHCA 1U5GA 5DHFB 1UNPA 4K2PA 1QQGA 5CLQB 1ZSQA 1AQCA 2BCJA 3PP2A 1MPHA 1EF1A 2KIEA 3MPXA 3TO1A 1LW3A 1TXDA 4GXBA 3MDBC 1DDVA 2L2IA 4CHJA 3GYOA 1TQZA 2EJ8A 1FAOA 2M14A 2PZ1A 1K5DB 1PLSA 3ZVRA 1MI1A 1BTNA 5EFXA 4WSFA 3ODWA 4B6HA 1MIZB 4KHBB 5HE2A 3ZDTA 4TKNA 2DFKA 3D8DA 2YS3A 2LYDA 1P5TA 1V5PA 5C79A 3ODXA 2IFSA 5DI9B 5FI0A 2L1CA 2R09A 3DXCA 4HB3B 2MKRA 1DROA 1RRPB 4PQ0A 4BBKA 3KRXA 3PG7A 3ODOA 4MY6A 2RLOA 2I5FA 2UZSA 3NWFA 2P0HA 1J0WA 1V88A 2EMTA 3OANA 4PNKA 2KUPA 3A58A 1W1DA 3FM8C 5JHHA 3HIEA 1V89A 2DLWA 2P8VA 2R0DA 2RGNB 4DX8A 4HATB 4K17A 1MK9B 3WYFB 1MIXA 3BJIA 5DIFB 3KRWA 3AJ4A 1NU2A 1LB1A 1FHXA 3M1IB 4L1RA 4GMXB 1BAKA 2GUMA 3SNHA 1P3RA 2J0MA 2D9XA 4IAPA 4HSIA 3NSUA 2LG1A 3F0WA 5KCVA 4HAXB 2X18A 4QJ4B 2N23A 3QWMA 1WGQA 1WVHA 4ZRKA 3D8EA 1GG3A 2D4QA 5HE0A 2OQBA 1K5GB 1W1GA 2K8EA 4D6WA 5D27A 3QIJA 2Q13A 2AL6A 2KCJA 3GYPA 3SYXA 2VKIA 4L6EA 3A8PA 3VOQA 3P7ZA 4MK0A 5IRSA 4DX90 3ML4A 1H10A 4WJ7A 4D0NB 3SUZA 3ULCA 1W1HA 5LG4B 5LOPB 2ROZB 4OT1A 2D10A 2GJYA 2LKOA 4DXAB 2CRFA 1UEFA 4XWXA 2XQNM 5I2SA 1WJ1A 2ROVA
chains in the Genus database with same CATH topology
2J59M 4F7GA 4K2OA 2K2JA 3T06A 1XR0B 4GMVA 2P0FA 1WG7A 4KHAA 5D3YA 2CY4A 2YVCA 2ZPYA 1NI2A 4KAXB 1UPRA 2UZRA 4TYZA 4A6FB 1EAZA 2Z0PA 4EMOA 4HB0B 1QC6A 3FSSA 2DHIA 2YT0A 3F5RA 3RCPA 4ZRJA 1ZC3B 2I5CA 1WGUA 2E2XA 4A6HA 1XODA 2EC1A 2VRWB 1U27A 2YT1A 4C0AA 4NY0A 1XKEA 4CYEA 1E5WA 3WA0A 2DTCA 2DN6A 1M7EA 1Y19B 4YONA 2QKLA 2G35A 1ZVRA 2P0DA 2CODA 1FHWA 2COAA 5JHGA 2UVMA 4F7UP 3PVUA 3PVWA 4Y94A 2CY5A 2FJLA 1MKEA 1X05A 4DBBA 4HAZB 3PSCA 4F7HA 2DYNA 2VSZA 1WI1A 2J0KA 2DX5A 2MWNB 5KQ1A 2YRYA 4GN1A 4ZRIA 1OMWA 1XX0A 4YL8A 3SV1A 3D8FA 2DYQA 5D3WA 2COCA 2NMBA 1I7AA 4GZUA 2LOXA 5C16A 1BTKA 3PEGA 2V76A 2N0YA 2NZ8B 3FEHA 4K81A 1GC6A 4HAYB 1X86A 1U29A 2RNRB 1NTYA 1MK7B 5DH9B 3LJUX 2MDXA 3KZ1A 5FI1A 5KQ4A 2W2XC 1FHOA 3TFMA 1NTVA 2YS5A 5C5BB 5D3XA 2H7EA 4A6KA 3X23A 3O96A 1Y5OA 2D2QA 3HW2B 4EJNA 4Z2MB 1UNQA 2YS1A 3U7DA 2J0JA 1H4RA 2Y8GA 4HDOA 5JLJB 1FGYA 1J19A 1UPQA 3A8QA 1V5MA 1ZC4B 2GS0A 4HAWB 3TVVA 3SO6A 2JP2A 3PVLA 2ADZA 2MFQA 5L81A 5D3VA 5DHAB 1I2HA 1OQNA 2I1JA 2KGXB 2M38A 4EKUA 4GPTB 2DKPA 5C5BA 2DKQA 3TW1A 4P7IA 1DDWA 1UNRA 1OY2A 4A5KA 1Z87A 2H7DA 3AU5A 2I1KA 2D11A 2RVBB 1B55A 2LULA 2Z0QA 3VIAA 4HAUB 4HB4B 1FGZA 5HE1A 2GCLA 3UZTA 1XD4A 2W2WA 1IRSA 2CAYA 1X1GA 5LONB 4A6FA 3U8ZA 1ZM0A 4H8SA 2K2UA 5J3QA 2YF0A 1U2BA 2HE7A 1FOEA 1WJMA 2RUKB 5GOWB 1XCGA 3CIKA 1RJ2A 1U5EA 1KZ7A 1SGHA 3P6AA 2LOZA 3DXEA 3QBVB 2GCJA 3HQCA 3KY9A 1PMSA 2Y8FA 2OTXA 1DYNA 2EMSA 5CLLB 1KZGA 1N3HA 1M7RA 1U5FA 1MAIA 2ELBA 4HDQA 1DBHA 2HTHB 5HE3A 1V61A 4IOYX 3G9WA 2Z0OA 2W2XD 4IFSA 3IVFA 3TCAA 1ISNA 2Y7BA 3CXBB 4HHVA 1V5UA 4CHMA 3V5WA 1X1FA 3BINA 1TJ6A 1DDMA 5JP4A 5C6RA 1X11A 4HAVB 2AEHA 1BWNA 1EVHA 1KI1B 3N7CA 2D9ZA 2DHKA 3HK0A 4HB2B 4WVFB 2QKMA 2ELAA 1Q67A 4MT7A 2D9VA 4KVGB 1P6SA 1U5DA 4Z2NA 2IYBA 5J3TA 1EGXA 3A98B 1GC7A 2D9WA 2K00A 3AU4A 2DA0A 1AWEA 3KSYA 1FB8A 1PFJA 2COFA 4NSWA 3PZDA 3ULBA 3DXDA 2YSZA 2D9YA 2DX1A 2DHJA 5J3YA 4KHOA 2RSGA 1SHCA 1U5GA 5DHFB 1UNPA 4K2PA 1QQGA 5CLQB 1ZSQA 1AQCA 2BCJA 3PP2A 1MPHA 1EF1A 3MPXA 3TO1A 1LW3A 1TXDA 4GXBA 3MDBC 1DDVA 2L2IA 4CHJA 3GYOA 1TQZA 2EJ8A 1FAOA 2M14A 2PZ1A 1K5DB 1PLSA 3ZVRA 1BTNA 5EFXA 4WSFA 3ODWA 4B6HA 1MIZB 4KHBB 5HE2A 3ZDTA 4TKNA 2DFKA 3D8DA 2YS3A 2LYDA 1P5TA 1V5PA 5C79A 3ODXA 2IFSA 5DI9B 5FI0A 2L1CA 2R09A 3DXCA 4HB3B 2MKRA 1DROA 1RRPB 4PQ0A 4BBKA 3KRXA 3PG7A 3ODOA 4MY6A 2RLOA 2I5FA 2UZSA 2P0HA 1J0WA 1V88A 2EMTA 3OANA 4PNKA 2KUPA 1W1DA 3FM8C 5JHHA 1V89A 2DLWA 2P8VA 2R0DA 2RGNB 4DX8A 4HATB 4K17A 1MK9B 3WYFB 1MIXA 3BJIA 5DIFB 3KRWA 3AJ4A 1NU2A 1LB1A 1FHXA 3M1IB 4GMXB 1BAKA 3SNHA 1P3RA 2J0MA 2D9XA 4IAPA 3NSUA 2LG1A 3F0WA 5KCVA 4HAXB 2X18A 2N23A 3QWMA 1WGQA 1WVHA 4ZRKA 3D8EA 1GG3A 2D4QA 5HE0A 2OQBA 1K5GB 1W1GA 5D27A 3QIJA 2Q13A 2AL6A 2KCJA 3GYPA 3SYXA 2VKIA 4L6EA 3A8PA 3VOQA 3P7ZA 4MK0A 4DX90 3ML4A 1H10A 4WJ7A 4D0NB 3SUZA 3ULCA 1W1HA 5LOPB 2ROZB 2D10A 2GJYA 2LKOA 4DXAB 2CRFA 1UEFA 4XWXA 2XQNM 1WJ1A 2ROVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J59 M;  4F7G A;  4K2O A;  2K2J A;  3T06 A;  1XR0 B;  4GMV A;  2P0F A;  1WG7 A;  4KHA A;  5D3Y A;  2CY4 A;  2YVC A;  2ZPY A;  1NI2 A;  4KAX B;  1UPR A;  2UZR A;  4TYZ A;  4A6F B;  1EAZ A;  2Z0P A;  4EMO A;  4HB0 B;  1QC6 A;  3FSS A;  2DHI A;  2YT0 A;  3F5R A;  3RCP A;  4ZRJ A;  1ZC3 B;  2I5C A;  1WGU A;  2E2X A;  4A6H A;  1XOD A;  2EC1 A;  2VRW B;  1U27 A;  2YT1 A;  4C0A A;  4NY0 A;  1XKE A;  4CYE A;  1E5W A;  3WA0 A;  2DTC A;  2DN6 A;  1M7E A;  1Y19 B;  4YON A;  2QKL A;  2G35 A;  1ZVR A;  2P0D A;  2COD A;  1FHW A;  2COA A;  5JHG A;  2UVM A;  4F7U P;  3PVU A;  3PVW A;  4Y94 A;  2CY5 A;  2FJL A;  1MKE A;  1X05 A;  4DBB A;  4HAZ B;  3PSC A;  4F7H A;  2DYN A;  2VSZ A;  1WI1 A;  2J0K A;  2DX5 A;  2MWN B;  5KQ1 A;  2YRY A;  4GN1 A;  4ZRI A;  1OMW A;  1XX0 A;  4YL8 A;  3SV1 A;  3D8F A;  2DYQ A;  5D3W A;  2COC A;  2NMB A;  1I7A A;  4GZU A;  2LOX A;  5C16 A;  1BTK A;  3PEG A;  2V76 A;  2N0Y A;  2NZ8 B;  3FEH A;  4K81 A;  1GC6 A;  4HAY B;  1X86 A;  1U29 A;  2RNR B;  1NTY A;  1MK7 B;  5DH9 B;  3LJU X;  2MDX A;  3KZ1 A;  5FI1 A;  5KQ4 A;  2W2X C;  1FHO A;  3TFM A;  1NTV A;  2YS5 A;  5C5B B;  5D3X A;  2H7E A;  4A6K A;  3X23 A;  3O96 A;  1Y5O A;  2D2Q A;  3HW2 B;  4EJN A;  4Z2M B;  1UNQ A;  2YS1 A;  3U7D A;  2J0J A;  1H4R A;  2Y8G A;  4HDO A;  5JLJ B;  1FGY A;  1J19 A;  1UPQ A;  3A8Q A;  1V5M A;  1ZC4 B;  2GS0 A;  4HAW B;  3TVV A;  3SO6 A;  2JP2 A;  3PVL A;  2ADZ A;  2MFQ A;  5L81 A;  5D3V A;  5DHA B;  1I2H A;  1OQN A;  2I1J A;  2KGX B;  2M38 A;  4EKU A;  4GPT B;  2DKP A;  5C5B A;  2DKQ A;  3TW1 A;  4P7I A;  1DDW A;  1UNR A;  1OY2 A;  4A5K A;  1Z87 A;  2H7D A;  3AU5 A;  2I1K A;  2D11 A;  2RVB B;  1B55 A;  2LUL A;  2Z0Q A;  3VIA A;  4HAU B;  4HB4 B;  1FGZ A;  5HE1 A;  2GCL A;  3UZT A;  1XD4 A;  2W2W A;  1IRS A;  2CAY A;  1X1G A;  5LON B;  4A6F A;  3U8Z A;  1ZM0 A;  4H8S A;  2K2U A;  5J3Q A;  2YF0 A;  1U2B A;  2HE7 A;  1FOE A;  1WJM A;  2RUK B;  5GOW B;  1XCG A;  3CIK A;  1RJ2 A;  1U5E A;  1KZ7 A;  1SGH A;  3P6A A;  2LOZ A;  3DXE A;  3QBV B;  2GCJ A;  3HQC A;  3KY9 A;  1PMS A;  2Y8F A;  2OTX A;  1DYN A;  2EMS A;  5CLL B;  1KZG A;  1N3H A;  1M7R A;  1U5F A;  1MAI A;  2ELB A;  4HDQ A;  1DBH A;  2HTH B;  5HE3 A;  1V61 A;  4IOY X;  3G9W A;  2Z0O A;  2W2X D;  4IFS A;  3IVF A;  3TCA A;  1ISN A;  2Y7B A;  3CXB B;  4HHV A;  1V5U A;  4CHM A;  3V5W A;  1X1F A;  3BIN A;  1TJ6 A;  1DDM A;  5JP4 A;  5C6R A;  1X11 A;  4HAV B;  2AEH A;  1BWN A;  1EVH A;  1KI1 B;  3N7C A;  2D9Z A;  2DHK A;  3HK0 A;  4HB2 B;  4WVF B;  2QKM A;  2ELA A;  1Q67 A;  4MT7 A;  2D9V A;  4KVG B;  1P6S A;  1U5D A;  4Z2N A;  2IYB A;  5J3T A;  1EGX A;  3A98 B;  1GC7 A;  2D9W A;  2K00 A;  3AU4 A;  2DA0 A;  1AWE A;  3KSY A;  1FB8 A;  1PFJ A;  2COF A;  4NSW A;  3PZD A;  3ULB A;  3DXD A;  2YSZ A;  2D9Y A;  2DX1 A;  2DHJ A;  5J3Y A;  4KHO A;  2RSG A;  1SHC A;  1U5G A;  5DHF B;  1UNP A;  4K2P A;  1QQG A;  5CLQ B;  1ZSQ A;  1AQC A;  2BCJ A;  3PP2 A;  1MPH A;  1EF1 A;  3MPX A;  3TO1 A;  1LW3 A;  1TXD A;  4GXB A;  3MDB C;  1DDV A;  2L2I A;  4CHJ A;  3GYO A;  1TQZ A;  2EJ8 A;  1FAO A;  2M14 A;  2PZ1 A;  1K5D B;  1PLS A;  3ZVR A;  1BTN A;  5EFX A;  4WSF A;  3ODW A;  4B6H A;  1MIZ B;  4KHB B;  5HE2 A;  3ZDT A;  4TKN A;  2DFK A;  3D8D A;  2YS3 A;  2LYD A;  1P5T A;  1V5P A;  5C79 A;  3ODX A;  2IFS A;  5DI9 B;  5FI0 A;  2L1C A;  2R09 A;  3DXC A;  4HB3 B;  2MKR A;  1DRO A;  1RRP B;  4PQ0 A;  4BBK A;  3KRX A;  3PG7 A;  3ODO A;  4MY6 A;  2RLO A;  2I5F A;  2UZS A;  2P0H A;  1J0W A;  1V88 A;  2EMT A;  3OAN A;  4PNK A;  2KUP A;  1W1D A;  3FM8 C;  5JHH A;  1V89 A;  2DLW A;  2P8V A;  2R0D A;  2RGN B;  4DX8 A;  4HAT B;  4K17 A;  1MK9 B;  3WYF B;  1MIX A;  3BJI A;  5DIF B;  3KRW A;  3AJ4 A;  1NU2 A;  1LB1 A;  1FHX A;  3M1I B;  4GMX B;  1BAK A;  3SNH A;  1P3R A;  2J0M A;  2D9X A;  4IAP A;  3NSU A;  2LG1 A;  3F0W A;  5KCV A;  4HAX B;  2X18 A;  2N23 A;  3QWM A;  1WGQ A;  1WVH A;  4ZRK A;  3D8E A;  1GG3 A;  2D4Q A;  5HE0 A;  2OQB A;  1K5G B;  1W1G A;  5D27 A;  3QIJ A;  2Q13 A;  2AL6 A;  2KCJ A;  3GYP A;  3SYX A;  2VKI A;  4L6E A;  3A8P A;  3VOQ A;  3P7Z A;  4MK0 A;  4DX9 0;  3ML4 A;  1H10 A;  4WJ7 A;  4D0N B;  3SUZ A;  3ULC A;  1W1H A;  5LOP B;  2ROZ B;  2D10 A;  2GJY A;  2LKO A;  4DXA B;  2CRF A;  1UEF A;  4XWX A;  2XQN M;  1WJ1 A;  2ROV A; 
#chains in the Genus database with same CATH topology
 2J59 M;  4F7G A;  4K2O A;  2K2J A;  3T06 A;  1XR0 B;  4GMV A;  2P0F A;  1WG7 A;  4KHA A;  5D3Y A;  2CY4 A;  2YVC A;  2ZPY A;  1NI2 A;  4KAX B;  1UPR A;  2UZR A;  4GOU A;  4TYZ A;  4A6F B;  1EAZ A;  2Z0P A;  4EMO A;  4HB0 B;  1QC6 A;  3FSS A;  2DHI A;  2YT0 A;  3F5R A;  3RCP A;  4ZRJ A;  1ZC3 B;  2I5C A;  1WGU A;  2Z59 A;  2E2X A;  4A6H A;  1XOD A;  2EC1 A;  2RRF A;  2VRW B;  1U27 A;  2YT1 A;  4C0A A;  4NY0 A;  2Z13 A;  1XKE A;  4CSQ A;  4CYE A;  1E5W A;  3WA0 A;  2DTC A;  2DN6 A;  1M7E A;  1Y19 B;  2Z4D A;  4YON A;  2QKL A;  2G35 A;  1ZVR A;  2P0D A;  2Z14 A;  4KHB A;  2COD A;  1FHW A;  2COA A;  5JHG A;  2UVM A;  3DCX A;  4F7U P;  3PVU A;  3PVW A;  4Y94 A;  2CY5 A;  2FJL A;  3HSA A;  1MKE A;  1X05 A;  4DBB A;  4HAZ B;  3PSC A;  4F7H A;  2DYN A;  2KUQ A;  2VSZ A;  4QJ3 B;  1WI1 A;  2J0K A;  2DX5 A;  2MWN B;  5KQ1 A;  2YRY A;  4GN1 A;  4ZRI A;  1OMW A;  1XX0 A;  4YL8 A;  3SV1 A;  3NWA A;  3D8F A;  2DYQ A;  5D3W A;  2COC A;  2NMB A;  1I7A A;  4GZU A;  2LOX A;  5C16 A;  1BTK A;  3PEG A;  2V76 A;  2N0Y A;  2NZ8 B;  2KIG A;  3FEH A;  4K81 A;  3NW8 A;  1GC6 A;  4HAY B;  1X86 A;  1U29 A;  2RNR B;  1NTY A;  4QXA B;  1MK7 B;  5DH9 B;  3LJU X;  2MDX A;  4DIX A;  3KZ1 A;  5FI1 A;  5KQ4 A;  2W2X C;  1FHO A;  3TFM A;  1NTV A;  2YS5 A;  5C5B B;  5D3X A;  2H7E A;  4A6K A;  2R2Y A;  3X23 A;  3O96 A;  1Y5O A;  2D2Q A;  3HW2 B;  4EJN A;  3FVC A;  4Z2M B;  1UNQ A;  2YS1 A;  3U7D A;  2J0J A;  1H4R A;  2Y8G A;  4HDO A;  5JLJ B;  1FGY A;  1J19 A;  1UPQ A;  3A8Q A;  1V5M A;  1ZC4 B;  2GS0 A;  4HAW B;  3TVV A;  3SO6 A;  2JP2 A;  3PVL A;  2ADZ A;  2MFQ A;  2YT2 A;  5M4Y B;  5L81 A;  5D3V A;  5DHA B;  1I2H A;  1OQN A;  2I1J A;  2KGX B;  3NWD A;  2M38 A;  4EKU A;  4GPT B;  2DKP A;  5C5B A;  2DKQ A;  3U12 A;  3TW1 A;  4P7I A;  1DDW A;  1UNR A;  1OY2 A;  4A5K A;  1Z87 A;  2H7D A;  3AU5 A;  2I1K A;  2D11 A;  2RVB B;  1B55 A;  2LUL A;  2Z0Q A;  3VIA A;  1T77 A;  4HAU B;  4HB4 B;  1FGZ A;  5HE1 A;  2GCL A;  3UZT A;  1XD4 A;  2W2W A;  1IRS A;  2CAY A;  1X1G A;  5LON B;  4A6F A;  3U8Z A;  1ZM0 A;  4H8S A;  2K2U A;  5J3Q A;  2YF0 A;  1U2B A;  2ZKM X;  2HE7 A;  1FOE A;  1WJM A;  2RUK B;  5GOW B;  1XCG A;  3CIK A;  1RJ2 A;  1U5E A;  1ZYI A;  4GNK B;  1KZ7 A;  1SGH A;  3P6A A;  2LOZ A;  3DXE A;  3QBV B;  2GCJ A;  3HQC A;  3KY9 A;  1PMS A;  2Y8F A;  2OTX A;  1DYN A;  4QJ5 B;  2EMS A;  5CLL B;  1KZG A;  1N3H A;  1M7R A;  1U5F A;  2K49 A;  1MAI A;  2ELB A;  4HDQ A;  1DBH A;  2HTH B;  5HE3 A;  1V61 A;  4IOY X;  3G9W A;  2Z0O A;  2NBV A;  2W2X D;  4IFS A;  3IVF A;  3TCA A;  1ISN A;  2Y7B A;  3CXB B;  4HHV A;  1V5U A;  3OHM B;  4CHM A;  3V5W A;  1X1F A;  2KR0 A;  3BIN A;  1TJ6 A;  1DDM A;  5JP4 A;  5C6R A;  1X11 A;  4HAV B;  2AEH A;  4OSN A;  1BWN A;  1EVH A;  1KI1 B;  2D9Z A;  2DHK A;  3HK0 A;  3N7C A;  4HB2 B;  4WVF B;  2QKM A;  2ELA A;  1Q67 A;  4MT7 A;  2D9V A;  4KVG B;  1P6S A;  1U5D A;  4Z2N A;  2IYB A;  5J3T A;  1EGX A;  3A98 B;  1GC7 A;  2D9W A;  2K00 A;  3AU4 A;  2DA0 A;  1AWE A;  3KSY A;  1FB8 A;  1PFJ A;  2COF A;  4NSW A;  2FJU B;  3PZD A;  3ULB A;  3DXD A;  5I2M A;  3B77 A;  2YSZ A;  2D9Y A;  2DX1 A;  2DHJ A;  5J3Y A;  4KHO A;  2RSG A;  1SHC A;  1U5G A;  5DHF B;  1UNP A;  4K2P A;  1QQG A;  5CLQ B;  1ZSQ A;  1AQC A;  2BCJ A;  3PP2 A;  1MPH A;  1EF1 A;  2KIE A;  3MPX A;  3TO1 A;  1LW3 A;  1TXD A;  4GXB A;  3MDB C;  1DDV A;  2L2I A;  4CHJ A;  3GYO A;  1TQZ A;  2EJ8 A;  1FAO A;  2M14 A;  2PZ1 A;  1K5D B;  1PLS A;  3ZVR A;  1MI1 A;  1BTN A;  5EFX A;  4WSF A;  3ODW A;  4B6H A;  1MIZ B;  4KHB B;  5HE2 A;  3ZDT A;  4TKN A;  2DFK A;  3D8D A;  2YS3 A;  2LYD A;  1P5T A;  1V5P A;  5C79 A;  3ODX A;  2IFS A;  5DI9 B;  5FI0 A;  2L1C A;  2R09 A;  3DXC A;  4HB3 B;  2MKR A;  1DRO A;  1RRP B;  4PQ0 A;  4BBK A;  3KRX A;  3PG7 A;  3ODO A;  4MY6 A;  2RLO A;  2I5F A;  2UZS A;  3NWF A;  2P0H A;  1J0W A;  1V88 A;  2EMT A;  3OAN A;  4PNK A;  2KUP A;  3A58 A;  1W1D A;  3FM8 C;  5JHH A;  3HIE A;  1V89 A;  2DLW A;  2P8V A;  2R0D A;  2RGN B;  4DX8 A;  4HAT B;  4K17 A;  1MK9 B;  3WYF B;  1MIX A;  3BJI A;  5DIF B;  3KRW A;  3AJ4 A;  1NU2 A;  1LB1 A;  1FHX A;  3M1I B;  4L1R A;  4GMX B;  1BAK A;  2GUM A;  3SNH A;  1P3R A;  2J0M A;  2D9X A;  4IAP A;  4HSI A;  3NSU A;  2LG1 A;  3F0W A;  5KCV A;  4HAX B;  2X18 A;  4QJ4 B;  2N23 A;  3QWM A;  1WGQ A;  1WVH A;  4ZRK A;  3D8E A;  1GG3 A;  2D4Q A;  5HE0 A;  2OQB A;  1K5G B;  1W1G A;  2K8E A;  4D6W A;  5D27 A;  3QIJ A;  2Q13 A;  2AL6 A;  2KCJ A;  3GYP A;  3SYX A;  2VKI A;  4L6E A;  3A8P A;  3VOQ A;  3P7Z A;  4MK0 A;  5IRS A;  4DX9 0;  3ML4 A;  1H10 A;  4WJ7 A;  4D0N B;  3SUZ A;  3ULC A;  1W1H A;  5LG4 B;  5LOP B;  2ROZ B;  4OT1 A;  2D10 A;  2GJY A;  2LKO A;  4DXA B;  2CRF A;  1UEF A;  4XWX A;  2XQN M;  5I2S A;  1WJ1 A;  2ROV A; 
#chains in the Genus database with same CATH homology
 2J59 M;  4F7G A;  4K2O A;  2K2J A;  3T06 A;  1XR0 B;  4GMV A;  2P0F A;  1WG7 A;  4KHA A;  5D3Y A;  2CY4 A;  2YVC A;  2ZPY A;  1NI2 A;  4KAX B;  1UPR A;  2UZR A;  4TYZ A;  4A6F B;  1EAZ A;  2Z0P A;  4EMO A;  4HB0 B;  1QC6 A;  3FSS A;  2DHI A;  2YT0 A;  3F5R A;  3RCP A;  4ZRJ A;  1ZC3 B;  2I5C A;  1WGU A;  2E2X A;  4A6H A;  1XOD A;  2EC1 A;  2VRW B;  1U27 A;  2YT1 A;  4C0A A;  4NY0 A;  1XKE A;  4CYE A;  1E5W A;  3WA0 A;  2DTC A;  2DN6 A;  1M7E A;  1Y19 B;  4YON A;  2QKL A;  2G35 A;  1ZVR A;  2P0D A;  2COD A;  1FHW A;  2COA A;  5JHG A;  2UVM A;  4F7U P;  3PVU A;  3PVW A;  4Y94 A;  2CY5 A;  2FJL A;  1MKE A;  1X05 A;  4DBB A;  4HAZ B;  3PSC A;  4F7H A;  2DYN A;  2VSZ A;  1WI1 A;  2J0K A;  2DX5 A;  2MWN B;  5KQ1 A;  2YRY A;  4GN1 A;  4ZRI A;  1OMW A;  1XX0 A;  4YL8 A;  3SV1 A;  3D8F A;  2DYQ A;  5D3W A;  2COC A;  2NMB A;  1I7A A;  4GZU A;  2LOX A;  5C16 A;  1BTK A;  3PEG A;  2V76 A;  2N0Y A;  2NZ8 B;  3FEH A;  4K81 A;  1GC6 A;  4HAY B;  1X86 A;  1U29 A;  2RNR B;  1NTY A;  1MK7 B;  5DH9 B;  3LJU X;  2MDX A;  3KZ1 A;  5FI1 A;  5KQ4 A;  2W2X C;  1FHO A;  3TFM A;  1NTV A;  2YS5 A;  5C5B B;  5D3X A;  2H7E A;  4A6K A;  3X23 A;  3O96 A;  1Y5O A;  2D2Q A;  3HW2 B;  4EJN A;  4Z2M B;  1UNQ A;  2YS1 A;  3U7D A;  2J0J A;  1H4R A;  2Y8G A;  4HDO A;  5JLJ B;  1FGY A;  1J19 A;  1UPQ A;  3A8Q A;  1V5M A;  1ZC4 B;  2GS0 A;  4HAW B;  3TVV A;  3SO6 A;  2JP2 A;  3PVL A;  2ADZ A;  2MFQ A;  5L81 A;  5D3V A;  5DHA B;  1I2H A;  1OQN A;  2I1J A;  2KGX B;  2M38 A;  4EKU A;  4GPT B;  2DKP A;  5C5B A;  2DKQ A;  3TW1 A;  4P7I A;  1DDW A;  1UNR A;  1OY2 A;  4A5K A;  1Z87 A;  2H7D A;  3AU5 A;  2I1K A;  2D11 A;  2RVB B;  1B55 A;  2LUL A;  2Z0Q A;  3VIA A;  4HAU B;  4HB4 B;  1FGZ A;  5HE1 A;  2GCL A;  3UZT A;  1XD4 A;  2W2W A;  1IRS A;  2CAY A;  1X1G A;  5LON B;  4A6F A;  3U8Z A;  1ZM0 A;  4H8S A;  2K2U A;  5J3Q A;  2YF0 A;  1U2B A;  2HE7 A;  1FOE A;  1WJM A;  2RUK B;  5GOW B;  1XCG A;  3CIK A;  1RJ2 A;  1U5E A;  1KZ7 A;  1SGH A;  3P6A A;  2LOZ A;  3DXE A;  3QBV B;  2GCJ A;  3HQC A;  3KY9 A;  1PMS A;  2Y8F A;  2OTX A;  1DYN A;  2EMS A;  5CLL B;  1KZG A;  1N3H A;  1M7R A;  1U5F A;  1MAI A;  2ELB A;  4HDQ A;  1DBH A;  2HTH B;  5HE3 A;  1V61 A;  4IOY X;  3G9W A;  2Z0O A;  2W2X D;  4IFS A;  3IVF A;  3TCA A;  1ISN A;  2Y7B A;  3CXB B;  4HHV A;  1V5U A;  4CHM A;  3V5W A;  1X1F A;  3BIN A;  1TJ6 A;  1DDM A;  5JP4 A;  5C6R A;  1X11 A;  4HAV B;  2AEH A;  1BWN A;  1EVH A;  1KI1 B;  3N7C A;  2D9Z A;  2DHK A;  3HK0 A;  4HB2 B;  4WVF B;  2QKM A;  2ELA A;  1Q67 A;  4MT7 A;  2D9V A;  4KVG B;  1P6S A;  1U5D A;  4Z2N A;  2IYB A;  5J3T A;  1EGX A;  3A98 B;  1GC7 A;  2D9W A;  2K00 A;  3AU4 A;  2DA0 A;  1AWE A;  3KSY A;  1FB8 A;  1PFJ A;  2COF A;  4NSW A;  3PZD A;  3ULB A;  3DXD A;  2YSZ A;  2D9Y A;  2DX1 A;  2DHJ A;  5J3Y A;  4KHO A;  2RSG A;  1SHC A;  1U5G A;  5DHF B;  1UNP A;  4K2P A;  1QQG A;  5CLQ B;  1ZSQ A;  1AQC A;  2BCJ A;  3PP2 A;  1MPH A;  1EF1 A;  3MPX A;  3TO1 A;  1LW3 A;  1TXD A;  4GXB A;  3MDB C;  1DDV A;  2L2I A;  4CHJ A;  3GYO A;  1TQZ A;  2EJ8 A;  1FAO A;  2M14 A;  2PZ1 A;  1K5D B;  1PLS A;  3ZVR A;  1BTN A;  5EFX A;  4WSF A;  3ODW A;  4B6H A;  1MIZ B;  4KHB B;  5HE2 A;  3ZDT A;  4TKN A;  2DFK A;  3D8D A;  2YS3 A;  2LYD A;  1P5T A;  1V5P A;  5C79 A;  3ODX A;  2IFS A;  5DI9 B;  5FI0 A;  2L1C A;  2R09 A;  3DXC A;  4HB3 B;  2MKR A;  1DRO A;  1RRP B;  4PQ0 A;  4BBK A;  3KRX A;  3PG7 A;  3ODO A;  4MY6 A;  2RLO A;  2I5F A;  2UZS A;  2P0H A;  1J0W A;  1V88 A;  2EMT A;  3OAN A;  4PNK A;  2KUP A;  1W1D A;  3FM8 C;  5JHH A;  1V89 A;  2DLW A;  2P8V A;  2R0D A;  2RGN B;  4DX8 A;  4HAT B;  4K17 A;  1MK9 B;  3WYF B;  1MIX A;  3BJI A;  5DIF B;  3KRW A;  3AJ4 A;  1NU2 A;  1LB1 A;  1FHX A;  3M1I B;  4GMX B;  1BAK A;  3SNH A;  1P3R A;  2J0M A;  2D9X A;  4IAP A;  3NSU A;  2LG1 A;  3F0W A;  5KCV A;  4HAX B;  2X18 A;  2N23 A;  3QWM A;  1WGQ A;  1WVH A;  4ZRK A;  3D8E A;  1GG3 A;  2D4Q A;  5HE0 A;  2OQB A;  1K5G B;  1W1G A;  5D27 A;  3QIJ A;  2Q13 A;  2AL6 A;  2KCJ A;  3GYP A;  3SYX A;  2VKI A;  4L6E A;  3A8P A;  3VOQ A;  3P7Z A;  4MK0 A;  4DX9 0;  3ML4 A;  1H10 A;  4WJ7 A;  4D0N B;  3SUZ A;  3ULC A;  1W1H A;  5LOP B;  2ROZ B;  2D10 A;  2GJY A;  2LKO A;  4DXA B;  2CRF A;  1UEF A;  4XWX A;  2XQN M;  1WJ1 A;  2ROV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...