4F7HA

The crystal structure of kindlin-2 pleckstrin homology domain in free form
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
135
structure length
135
Chain Sequence
ILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of kindlin-2 PH domain reveals a conformational transition for its membrane anchoring and regulation of integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Fermitin family homolog 2
total genus 30
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4f7hA00
1NI2A 4H8SA 4KVGB 3UZTA 1I7AA 1K5DB 2DKPA 5C6RA 1KZ7A 3V5WA 3FSSA 4GMVA 1TJ6A 2L2IA 2LG1A 2QKMA 2EMSA 5KQ1A 5J3QA 3PZDA 3IVFA 3QBVB 5JP4A 2K00A 1XD4A 2GS0A 2Q13A 2DX1A 2P0DA 1ZSQA 2D11A 5LONB 1N3HA 3DXEA 2LOZA 5HE2A 3KY9A 3ZDTA 4P7IA 1W1HA 1X1GA 1FHXA 1UPQA 1RJ2A 4MY6A 1DDMA 4K2OA 5EFXA 1MK9B 5DHFB 1I2HA 5KCVA 2EC1A 4IAPA 2CY5A 1X86A 2COAA 2EMTA 2RLOA 1QC6A 5C5BB 1J19A 4ZRJA 1ZC4B 3PEGA 4HATB 2Z0PA 2YT0A 1GG3A 2RSGA 1FB8A 2DLWA 1MK7B 4HDQA 4MK0A 2I5CA 2MFQA 3HK0A 1V5PA 4WVFB 4IFSA 1BAKA 1U29A 3VOQA 2IYBA 1SGHA 2YS3A 1WI1A 3D8DA 1WGUA 1RRPB 2MWNB 1Y19B 4BBKA 2W2XD 2RNRB 4HAXB 1Q67A 2YVCA 3MPXA 5HE0A 2DHIA 5FI0A 4ZRKA 1IRSA 1K5GB 5LOPB 2D4QA 3ODXA 1M7EA 1B55A 4EJNA 4KHOA 2J0KA 2AL6A 1OY2A 2J59M 2Y7BA 3CXBB 1WG7A 2VRWB 3KSYA 3SNHA 2KUPA 2L1CA 1UNRA 2G35A 4D0NB 2ELBA 1V89A 2Y8FA 2P8VA 1MIXA 4L6EA 2PZ1A 1ZC3B 2UZSA 3KZ1A 4NY0A 4CHMA 1BTNA 2I1JA 2YRYA 2VKIA 2KGXB 4A6FB 4HB0B 2NMBA 1ISNA 1XCGA 1FHOA 3O96A 1LB1A 2YS1A 2I1KA 2J0JA 3QIJA 5J3YA 1P3RA 3AU5A 1ZVRA 3SYXA 5GOWB 2NZ8B 4EMOA 2MKRA 3GYPA 1BWNA 2D2QA 3RCPA 1GC6A 4A6KA 2DA0A 3U8ZA 4Y94A 1V5UA 2HTHB 4TKNA 4XWXA 1KI1B 2K2UA 1E5WA 1PFJA 1M7RA 2W2WA 4EKUA 3SO6A 1DYNA 1EAZA 1WVHA 2HE7A 2N23A 3D8FA 1MPHA 5L81A 4F7UP 2D10A 1MIZB 2Z0OA 2E2XA 4HAYB 2KCJA 4HAUB 1UNPA 3BJIA 4YONA 4GN1A 3F5RA 3AJ4A 4Z2MB 3AU4A 4NSWA 2ROZB 5D3VA 3U7DA 2COFA 3TVVA 4F7GA 1P5TA 1V88A 4TYZA 4HB2B 2DKQA 2I5FA 4KHBB 1OQNA 2AEHA 2RUKB 2D9VA 2DYQA 1J0WA 3PSCA 2YF0A 1W1GA 4HB4B 2EJ8A 4PNKA 4DBBA 4F7HA 3A8QA 1WJMA 1XODA 4C0AA 5C16A 2N0YA 1PLSA 4ZRIA 2CRFA 4HDOA 2R09A 4GPTB 1Y5OA 2UVMA 2XQNM 2DN6A 2ELAA 4DX90 5HE1A 4A6FA 3ZVRA 3QWMA 4KHAA 3NSUA 2RVBB 3SV1A 3ODOA 2JP2A 3FM8C 1UNQA 5JLJB 3ULBA 2CODA 3X23A 3PP2A 1SHCA 3M1IB 3HQCA 2K2JA 1FAOA 3CIKA 4HAWB 3MDBC 3SUZA 4Z2NA 1FOEA 1XX0A 5JHGA 1XR0B 2RGNB 4YL8A 3T06A 2D9YA 2ADZA 3WYFB 5C5BA 3KRXA 5D3XA 3TCAA 2DFKA 1TXDA 1X11A 2QKLA 1UPRA 1FHWA 2FJLA 1UEFA 4K17A 2X18A 4PQ0A 2DYNA 3A98B 5CLLB 3TFMA 2H7DA 4B6HA 2LOXA 2V76A 1P6SA 2LULA 1FGZA 2DHJA 2J0MA 3BINA 2DHKA 3A8PA 2UZRA 5JHHA 2CAYA 4WSFA 1NU2A 4GMXB 2CY4A 3ODWA 5D27A 1U5GA 2DTCA 3GYOA 4A5KA 2P0FA 2ROVA 3P7ZA 4HAZB 2P0HA 1U27A 3F0WA 1AWEA 1BTKA 2GCLA 3D8EA 5DI9B 1KZGA 3LJUX 3ULCA 2ZPYA 5DHAB 2YSZA 4HB3B 2D9ZA 1GC7A 4CHJA 5DIFB 3PVUA 3DXDA 4HHVA 3ML4A 1NTYA 4GZUA 2D9XA 4K81A 1EF1A 3FEHA 2COCA 1V61A 3WA0A 5D3WA 2LYDA 1DBHA 4DX8A 5KQ4A 1QQGA 1DDVA 3TW1A 3VIAA 2OQBA 1WJ1A 4WJ7A 1PMSA 1DDWA 1MAIA 1U2BA 5DH9B 3PVLA 1NTVA 3PG7A 2M38A 2MDXA 1H10A 1TQZA 5FI1A 5C79A 4MT7A 2YS5A 2Y8GA 1V5MA 1EVHA 3G9WA 1ZM0A 2W2XC 1OMWA 2M14A 2D9WA 5HE3A 4KAXB 1W1DA 2BCJA 4HAVB 1X05A 2VSZA 4GXBA 2R0DA 3N7CA 4A6HA 4DXAB 4CYEA 1XKEA 4K2PA 1U5DA 2OTXA 5J3TA 3TO1A 1EGXA 3DXCA 3HW2B 3KRWA 1DROA 2LKOA 2YT1A 2DX5A 4IOYX 5D3YA 3PVWA 1LW3A 2IFSA 1AQCA 2H7EA 2Z0QA 3P6AA 1U5EA 1FGYA 1WGQA 1MKEA 1H4RA 1U5FA 5CLQB 1Z87A 2GCJA 2GJYA 3OANA 1X1FA
chains in the Genus database with same CATH superfamily
1NI2A 4H8SA 2Z14A 3NW8A 4KVGB 3UZTA 1I7AA 4DIXA 1K5DB 2DKPA 5C6RA 1KZ7A 3V5WA 4D6WA 3FSSA 4GMVA 2FJUB 1TJ6A 2L2IA 2LG1A 2QKMA 2EMSA 4QJ3B 3NWDA 2Z13A 3PZDA 5KQ1A 3IVFA 5J3QA 3QBVB 5JP4A 2K00A 1XD4A 2GS0A 2Q13A 2DX1A 2P0DA 1ZSQA 2D11A 5LONB 1N3HA 3DXEA 2LOZA 5HE2A 3KY9A 3ZDTA 4P7IA 1W1HA 1X1GA 1FHXA 1UPQA 1RJ2A 4MY6A 1DDMA 4K2OA 5EFXA 1MK9B 5DHFB 1I2HA 5KCVA 2EC1A 4IAPA 2CY5A 1X86A 2COAA 2EMTA 2RLOA 1QC6A 5C5BB 1J19A 4ZRJA 1ZC4B 3PEGA 4HATB 2Z0PA 2Z4DA 2YT0A 1GG3A 2RSGA 1FB8A 2DLWA 2K49A 1MK7B 1ZYIA 4HDQA 2I5CA 4MK0A 2MFQA 3HK0A 1V5PA 4WVFB 4IFSA 1BAKA 1U29A 3VOQA 2IYBA 1SGHA 2YS3A 1WI1A 3D8DA 1WGUA 1RRPB 2MWNB 1Y19B 4BBKA 2W2XD 2RNRB 1Q67A 2YVCA 4HAXB 3MPXA 5HE0A 2DHIA 2RRFA 5FI0A 4ZRKA 1IRSA 1K5GB 5LOPB 2D4QA 3ODXA 1M7EA 1B55A 4EJNA 4KHOA 2J0KA 2AL6A 3HSAA 1OY2A 2J59M 2Y7BA 3CXBB 1WG7A 2VRWB 3KSYA 3SNHA 3DCXA 2KUPA 2L1CA 1UNRA 2G35A 4D0NB 2ELBA 1V89A 2Y8FA 2P8VA 1MIXA 4L6EA 2PZ1A 1ZC3B 2UZSA 3KZ1A 4NY0A 4CHMA 1BTNA 2I1JA 2YRYA 2VKIA 2KGXB 4A6FB 4HB0B 2NMBA 1ISNA 1XCGA 5IRSA 1FHOA 4KHBA 3O96A 4L1RA 1LB1A 2YS1A 2I1KA 5I2MA 2J0JA 3QIJA 5J3YA 1P3RA 3AU5A 1ZVRA 3SYXA 5GOWB 2NZ8B 4EMOA 2MKRA 3GYPA 1BWNA 2D2QA 2K8EA 3RCPA 1GC6A 2Z59A 4A6KA 2DA0A 3U8ZA 4Y94A 1V5UA 2HTHB 4TKNA 4XWXA 1KI1B 2K2UA 1E5WA 1PFJA 1M7RA 2W2WA 4EKUA 3SO6A 1DYNA 1EAZA 1WVHA 2HE7A 2N23A 4GOUA 3D8FA 1MPHA 5L81A 4F7UP 2D10A 1MIZB 2Z0OA 2E2XA 4QJ5B 4HAYB 2KCJA 4HAUB 1UNPA 3BJIA 4YONA 4GN1A 3F5RA 3AJ4A 4Z2MB 3AU4A 4NSWA 2ROZB 5D3VA 3U7DA 2COFA 3TVVA 4F7GA 1P5TA 1V88A 4OSNA 4TYZA 4HB2B 2DKQA 2I5FA 4KHBB 1OQNA 2AEHA 2RUKB 2D9VA 2DYQA 1J0WA 3PSCA 2YF0A 1W1GA 4HB4B 2EJ8A 4QJ4B 4PNKA 4DBBA 4F7HA 3A8QA 4OT1A 2KIGA 3OHMB 1WJMA 1XODA 4C0AA 5C16A 2N0YA 1PLSA 4ZRIA 2CRFA 4HDOA 2R09A 4GPTB 1Y5OA 2UVMA 2XQNM 2DN6A 2ELAA 4DX90 5HE1A 4A6FA 3ZVRA 3QWMA 4KHAA 3NSUA 2RVBB 4GNKB 3SV1A 3ODOA 2KR0A 2JP2A 3FM8C 1UNQA 5JLJB 3ULBA 2CODA 3X23A 3PP2A 1SHCA 2GUMA 3M1IB 3HQCA 2K2JA 1FAOA 3CIKA 4HAWB 5M4YB 3MDBC 3SUZA 4Z2NA 1FOEA 3HIEA 1XX0A 5JHGA 3FVCA 1XR0B 2RGNB 3U12A 4YL8A 3T06A 2D9YA 2ADZA 3WYFB 5C5BA 3B77A 3KRXA 5D3XA 3A58A 3TCAA 2DFKA 1TXDA 1X11A 2KUQA 3NWAA 5I2SA 2QKLA 1UPRA 1FHWA 2FJLA 1UEFA 4K17A 2X18A 4PQ0A 2DYNA 3A98B 5CLLB 3TFMA 2H7DA 4B6HA 2LOXA 2V76A 1P6SA 2LULA 1FGZA 2DHJA 2J0MA 3BINA 2DHKA 3A8PA 2UZRA 5JHHA 2CAYA 4WSFA 1NU2A 4GMXB 2CY4A 3ODWA 5D27A 1U5GA 1MI1A 2DTCA 2KIEA 3GYOA 4A5KA 2P0FA 2ROVA 3P7ZA 4HSIA 4HAZB 2P0HA 1U27A 3F0WA 2YT2A 1AWEA 1BTKA 2GCLA 3D8EA 5DI9B 1KZGA 3LJUX 3ULCA 2ZPYA 5DHAB 2YSZA 4HB3B 2D9ZA 1GC7A 4CHJA 5DIFB 3PVUA 3DXDA 5LG4B 4HHVA 3ML4A 1NTYA 4GZUA 2D9XA 4K81A 1EF1A 3FEHA 2COCA 1V61A 3WA0A 5D3WA 2LYDA 1DBHA 4DX8A 5KQ4A 1QQGA 1DDVA 3TW1A 3VIAA 2OQBA 1WJ1A 4WJ7A 1PMSA 1DDWA 1MAIA 2ZKMX 1U2BA 5DH9B 3PVLA 1NTVA 3PG7A 2M38A 2MDXA 1H10A 2NBVA 1TQZA 5FI1A 5C79A 4QXAB 4MT7A 2YS5A 2Y8GA 1V5MA 1EVHA 3G9WA 1ZM0A 2R2YA 1OMWA 2M14A 2W2XC 2D9WA 5HE3A 4KAXB 1W1DA 2BCJA 4HAVB 1X05A 3NWFA 2VSZA 4GXBA 2R0DA 3N7CA 4A6HA 4DXAB 4CYEA 1XKEA 4K2PA 1U5DA 1T77A 2OTXA 5J3TA 3TO1A 1EGXA 3DXCA 3HW2B 3KRWA 1DROA 2LKOA 2YT1A 2DX5A 4IOYX 5D3YA 3PVWA 1LW3A 2IFSA 1AQCA 2H7EA 2Z0QA 3P6AA 1U5EA 1FGYA 1WGQA 1MKEA 4CSQA 1H4RA 1U5FA 5CLQB 1Z87A 2GCJA 2GJYA 3OANA 1X1FA
chains in the Genus database with same CATH topology
1NI2A 4H8SA 4KVGB 3UZTA 1I7AA 1K5DB 2DKPA 5C6RA 1KZ7A 3V5WA 3FSSA 4GMVA 1TJ6A 2L2IA 2LG1A 2QKMA 2EMSA 5KQ1A 5J3QA 3PZDA 3IVFA 3QBVB 5JP4A 2K00A 1XD4A 2GS0A 2Q13A 2DX1A 2P0DA 1ZSQA 2D11A 5LONB 1N3HA 3DXEA 2LOZA 5HE2A 3KY9A 3ZDTA 4P7IA 1W1HA 1X1GA 1FHXA 1UPQA 1RJ2A 4MY6A 1DDMA 4K2OA 5EFXA 1MK9B 5DHFB 1I2HA 5KCVA 2EC1A 4IAPA 2CY5A 1X86A 2COAA 2EMTA 2RLOA 1QC6A 5C5BB 1J19A 4ZRJA 1ZC4B 3PEGA 4HATB 2Z0PA 2YT0A 1GG3A 2RSGA 1FB8A 2DLWA 1MK7B 4HDQA 4MK0A 2I5CA 2MFQA 3HK0A 1V5PA 4WVFB 4IFSA 1BAKA 1U29A 3VOQA 2IYBA 1SGHA 2YS3A 1WI1A 3D8DA 1WGUA 1RRPB 2MWNB 1Y19B 4BBKA 2W2XD 2RNRB 4HAXB 1Q67A 2YVCA 3MPXA 5HE0A 2DHIA 5FI0A 4ZRKA 1IRSA 1K5GB 5LOPB 2D4QA 3ODXA 1M7EA 1B55A 4EJNA 4KHOA 2J0KA 2AL6A 1OY2A 2J59M 2Y7BA 3CXBB 1WG7A 2VRWB 3KSYA 3SNHA 2KUPA 2L1CA 1UNRA 2G35A 4D0NB 2ELBA 1V89A 2Y8FA 2P8VA 1MIXA 4L6EA 2PZ1A 1ZC3B 2UZSA 3KZ1A 4NY0A 4CHMA 1BTNA 2I1JA 2YRYA 2VKIA 2KGXB 4A6FB 4HB0B 2NMBA 1ISNA 1XCGA 1FHOA 3O96A 1LB1A 2YS1A 2I1KA 2J0JA 3QIJA 5J3YA 1P3RA 3AU5A 1ZVRA 3SYXA 5GOWB 2NZ8B 4EMOA 2MKRA 3GYPA 1BWNA 2D2QA 3RCPA 1GC6A 4A6KA 2DA0A 3U8ZA 4Y94A 1V5UA 2HTHB 4TKNA 4XWXA 1KI1B 2K2UA 1E5WA 1PFJA 1M7RA 2W2WA 4EKUA 3SO6A 1DYNA 1EAZA 1WVHA 2HE7A 2N23A 3D8FA 1MPHA 5L81A 4F7UP 2D10A 1MIZB 2Z0OA 2E2XA 4HAYB 2KCJA 4HAUB 1UNPA 3BJIA 4YONA 4GN1A 3F5RA 3AJ4A 4Z2MB 3AU4A 4NSWA 2ROZB 5D3VA 3U7DA 2COFA 3TVVA 4F7GA 1P5TA 1V88A 4TYZA 4HB2B 2DKQA 2I5FA 4KHBB 1OQNA 2AEHA 2RUKB 2D9VA 2DYQA 1J0WA 3PSCA 2YF0A 1W1GA 4HB4B 2EJ8A 4PNKA 4DBBA 4F7HA 3A8QA 1WJMA 1XODA 4C0AA 5C16A 2N0YA 1PLSA 4ZRIA 2CRFA 4HDOA 2R09A 4GPTB 1Y5OA 2UVMA 2XQNM 2DN6A 2ELAA 4DX90 5HE1A 4A6FA 3ZVRA 3QWMA 4KHAA 3NSUA 2RVBB 3SV1A 3ODOA 2JP2A 3FM8C 1UNQA 5JLJB 3ULBA 2CODA 3X23A 3PP2A 1SHCA 3M1IB 3HQCA 2K2JA 1FAOA 3CIKA 4HAWB 3MDBC 3SUZA 4Z2NA 1FOEA 1XX0A 5JHGA 1XR0B 2RGNB 4YL8A 3T06A 2D9YA 2ADZA 3WYFB 5C5BA 3KRXA 5D3XA 3TCAA 2DFKA 1TXDA 1X11A 2QKLA 1UPRA 1FHWA 2FJLA 1UEFA 4K17A 2X18A 4PQ0A 2DYNA 3A98B 5CLLB 3TFMA 2H7DA 4B6HA 2LOXA 2V76A 1P6SA 2LULA 1FGZA 2DHJA 2J0MA 3BINA 2DHKA 3A8PA 2UZRA 5JHHA 2CAYA 4WSFA 1NU2A 4GMXB 2CY4A 3ODWA 5D27A 1U5GA 2DTCA 3GYOA 4A5KA 2P0FA 2ROVA 3P7ZA 4HAZB 2P0HA 1U27A 3F0WA 1AWEA 1BTKA 2GCLA 3D8EA 5DI9B 1KZGA 3LJUX 3ULCA 2ZPYA 5DHAB 2YSZA 4HB3B 2D9ZA 1GC7A 4CHJA 5DIFB 3PVUA 3DXDA 4HHVA 3ML4A 1NTYA 4GZUA 2D9XA 4K81A 1EF1A 3FEHA 2COCA 1V61A 3WA0A 5D3WA 2LYDA 1DBHA 4DX8A 5KQ4A 1QQGA 1DDVA 3TW1A 3VIAA 2OQBA 1WJ1A 4WJ7A 1PMSA 1DDWA 1MAIA 1U2BA 5DH9B 3PVLA 1NTVA 3PG7A 2M38A 2MDXA 1H10A 1TQZA 5FI1A 5C79A 4MT7A 2YS5A 2Y8GA 1V5MA 1EVHA 3G9WA 1ZM0A 2W2XC 1OMWA 2M14A 2D9WA 5HE3A 4KAXB 1W1DA 2BCJA 4HAVB 1X05A 2VSZA 4GXBA 2R0DA 3N7CA 4A6HA 4DXAB 4CYEA 1XKEA 4K2PA 1U5DA 2OTXA 5J3TA 3TO1A 1EGXA 3DXCA 3HW2B 3KRWA 1DROA 2LKOA 2YT1A 2DX5A 4IOYX 5D3YA 3PVWA 1LW3A 2IFSA 1AQCA 2H7EA 2Z0QA 3P6AA 1U5EA 1FGYA 1WGQA 1MKEA 1H4RA 1U5FA 5CLQB 1Z87A 2GCJA 2GJYA 3OANA 1X1FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI2 A;  4H8S A;  4KVG B;  3UZT A;  1I7A A;  1K5D B;  2DKP A;  5C6R A;  1KZ7 A;  3V5W A;  3FSS A;  4GMV A;  1TJ6 A;  2L2I A;  2LG1 A;  2QKM A;  2EMS A;  5KQ1 A;  5J3Q A;  3PZD A;  3IVF A;  3QBV B;  5JP4 A;  2K00 A;  1XD4 A;  2GS0 A;  2Q13 A;  2DX1 A;  2P0D A;  1ZSQ A;  2D11 A;  5LON B;  1N3H A;  3DXE A;  2LOZ A;  5HE2 A;  3KY9 A;  3ZDT A;  4P7I A;  1W1H A;  1X1G A;  1FHX A;  1UPQ A;  1RJ2 A;  4MY6 A;  1DDM A;  4K2O A;  5EFX A;  1MK9 B;  5DHF B;  1I2H A;  5KCV A;  2EC1 A;  4IAP A;  2CY5 A;  1X86 A;  2COA A;  2EMT A;  2RLO A;  1QC6 A;  5C5B B;  1J19 A;  4ZRJ A;  1ZC4 B;  3PEG A;  4HAT B;  2Z0P A;  2YT0 A;  1GG3 A;  2RSG A;  1FB8 A;  2DLW A;  1MK7 B;  4HDQ A;  4MK0 A;  2I5C A;  2MFQ A;  3HK0 A;  1V5P A;  4WVF B;  4IFS A;  1BAK A;  1U29 A;  3VOQ A;  2IYB A;  1SGH A;  2YS3 A;  1WI1 A;  3D8D A;  1WGU A;  1RRP B;  2MWN B;  1Y19 B;  4BBK A;  2W2X D;  2RNR B;  4HAX B;  1Q67 A;  2YVC A;  3MPX A;  5HE0 A;  2DHI A;  5FI0 A;  4ZRK A;  1IRS A;  1K5G B;  5LOP B;  2D4Q A;  3ODX A;  1M7E A;  1B55 A;  4EJN A;  4KHO A;  2J0K A;  2AL6 A;  1OY2 A;  2J59 M;  2Y7B A;  3CXB B;  1WG7 A;  2VRW B;  3KSY A;  3SNH A;  2KUP A;  2L1C A;  1UNR A;  2G35 A;  4D0N B;  2ELB A;  1V89 A;  2Y8F A;  2P8V A;  1MIX A;  4L6E A;  2PZ1 A;  1ZC3 B;  2UZS A;  3KZ1 A;  4NY0 A;  4CHM A;  1BTN A;  2I1J A;  2YRY A;  2VKI A;  2KGX B;  4A6F B;  4HB0 B;  2NMB A;  1ISN A;  1XCG A;  1FHO A;  3O96 A;  1LB1 A;  2YS1 A;  2I1K A;  2J0J A;  3QIJ A;  5J3Y A;  1P3R A;  3AU5 A;  1ZVR A;  3SYX A;  5GOW B;  2NZ8 B;  4EMO A;  2MKR A;  3GYP A;  1BWN A;  2D2Q A;  3RCP A;  1GC6 A;  4A6K A;  2DA0 A;  3U8Z A;  4Y94 A;  1V5U A;  2HTH B;  4TKN A;  4XWX A;  1KI1 B;  2K2U A;  1E5W A;  1PFJ A;  1M7R A;  2W2W A;  4EKU A;  3SO6 A;  1DYN A;  1EAZ A;  1WVH A;  2HE7 A;  2N23 A;  3D8F A;  1MPH A;  5L81 A;  4F7U P;  2D10 A;  1MIZ B;  2Z0O A;  2E2X A;  4HAY B;  2KCJ A;  4HAU B;  1UNP A;  3BJI A;  4YON A;  4GN1 A;  3F5R A;  3AJ4 A;  4Z2M B;  3AU4 A;  4NSW A;  2ROZ B;  5D3V A;  3U7D A;  2COF A;  3TVV A;  4F7G A;  1P5T A;  1V88 A;  4TYZ A;  4HB2 B;  2DKQ A;  2I5F A;  4KHB B;  1OQN A;  2AEH A;  2RUK B;  2D9V A;  2DYQ A;  1J0W A;  3PSC A;  2YF0 A;  1W1G A;  4HB4 B;  2EJ8 A;  4PNK A;  4DBB A;  4F7H A;  3A8Q A;  1WJM A;  1XOD A;  4C0A A;  5C16 A;  2N0Y A;  1PLS A;  4ZRI A;  2CRF A;  4HDO A;  2R09 A;  4GPT B;  1Y5O A;  2UVM A;  2XQN M;  2DN6 A;  2ELA A;  4DX9 0;  5HE1 A;  4A6F A;  3ZVR A;  3QWM A;  4KHA A;  3NSU A;  2RVB B;  3SV1 A;  3ODO A;  2JP2 A;  3FM8 C;  1UNQ A;  5JLJ B;  3ULB A;  2COD A;  3X23 A;  3PP2 A;  1SHC A;  3M1I B;  3HQC A;  2K2J A;  1FAO A;  3CIK A;  4HAW B;  3MDB C;  3SUZ A;  4Z2N A;  1FOE A;  1XX0 A;  5JHG A;  1XR0 B;  2RGN B;  4YL8 A;  3T06 A;  2D9Y A;  2ADZ A;  3WYF B;  5C5B A;  3KRX A;  5D3X A;  3TCA A;  2DFK A;  1TXD A;  1X11 A;  2QKL A;  1UPR A;  1FHW A;  2FJL A;  1UEF A;  4K17 A;  2X18 A;  4PQ0 A;  2DYN A;  3A98 B;  5CLL B;  3TFM A;  2H7D A;  4B6H A;  2LOX A;  2V76 A;  1P6S A;  2LUL A;  1FGZ A;  2DHJ A;  2J0M A;  3BIN A;  2DHK A;  3A8P A;  2UZR A;  5JHH A;  2CAY A;  4WSF A;  1NU2 A;  4GMX B;  2CY4 A;  3ODW A;  5D27 A;  1U5G A;  2DTC A;  3GYO A;  4A5K A;  2P0F A;  2ROV A;  3P7Z A;  4HAZ B;  2P0H A;  1U27 A;  3F0W A;  1AWE A;  1BTK A;  2GCL A;  3D8E A;  5DI9 B;  1KZG A;  3LJU X;  3ULC A;  2ZPY A;  5DHA B;  2YSZ A;  4HB3 B;  2D9Z A;  1GC7 A;  4CHJ A;  5DIF B;  3PVU A;  3DXD A;  4HHV A;  3ML4 A;  1NTY A;  4GZU A;  2D9X A;  4K81 A;  1EF1 A;  3FEH A;  2COC A;  1V61 A;  3WA0 A;  5D3W A;  2LYD A;  1DBH A;  4DX8 A;  5KQ4 A;  1QQG A;  1DDV A;  3TW1 A;  3VIA A;  2OQB A;  1WJ1 A;  4WJ7 A;  1PMS A;  1DDW A;  1MAI A;  1U2B A;  5DH9 B;  3PVL A;  1NTV A;  3PG7 A;  2M38 A;  2MDX A;  1H10 A;  1TQZ A;  5FI1 A;  5C79 A;  4MT7 A;  2YS5 A;  2Y8G A;  1V5M A;  1EVH A;  3G9W A;  1ZM0 A;  2W2X C;  1OMW A;  2M14 A;  2D9W A;  5HE3 A;  4KAX B;  1W1D A;  2BCJ A;  4HAV B;  1X05 A;  2VSZ A;  4GXB A;  2R0D A;  3N7C A;  4A6H A;  4DXA B;  4CYE A;  1XKE A;  4K2P A;  1U5D A;  2OTX A;  5J3T A;  3TO1 A;  1EGX A;  3DXC A;  3HW2 B;  3KRW A;  1DRO A;  2LKO A;  2YT1 A;  2DX5 A;  4IOY X;  5D3Y A;  3PVW A;  1LW3 A;  2IFS A;  1AQC A;  2H7E A;  2Z0Q A;  3P6A A;  1U5E A;  1FGY A;  1WGQ A;  1MKE A;  1H4R A;  1U5F A;  5CLQ B;  1Z87 A;  2GCJ A;  2GJY A;  3OAN A;  1X1F A; 
#chains in the Genus database with same CATH topology
 1NI2 A;  4H8S A;  2Z14 A;  3NW8 A;  4KVG B;  3UZT A;  1I7A A;  4DIX A;  1K5D B;  2DKP A;  5C6R A;  1KZ7 A;  3V5W A;  4D6W A;  3FSS A;  4GMV A;  2FJU B;  1TJ6 A;  2L2I A;  2LG1 A;  2QKM A;  2EMS A;  4QJ3 B;  3NWD A;  2Z13 A;  3PZD A;  5KQ1 A;  3IVF A;  5J3Q A;  3QBV B;  5JP4 A;  2K00 A;  1XD4 A;  2GS0 A;  2Q13 A;  2DX1 A;  2P0D A;  1ZSQ A;  2D11 A;  5LON B;  1N3H A;  3DXE A;  2LOZ A;  5HE2 A;  3KY9 A;  3ZDT A;  4P7I A;  1W1H A;  1X1G A;  1FHX A;  1UPQ A;  1RJ2 A;  4MY6 A;  1DDM A;  4K2O A;  5EFX A;  1MK9 B;  5DHF B;  1I2H A;  5KCV A;  2EC1 A;  4IAP A;  2CY5 A;  1X86 A;  2COA A;  2EMT A;  2RLO A;  1QC6 A;  5C5B B;  1J19 A;  4ZRJ A;  1ZC4 B;  3PEG A;  4HAT B;  2Z0P A;  2Z4D A;  2YT0 A;  1GG3 A;  2RSG A;  1FB8 A;  2DLW A;  2K49 A;  1MK7 B;  1ZYI A;  4HDQ A;  2I5C A;  4MK0 A;  2MFQ A;  3HK0 A;  1V5P A;  4WVF B;  4IFS A;  1BAK A;  1U29 A;  3VOQ A;  2IYB A;  1SGH A;  2YS3 A;  1WI1 A;  3D8D A;  1WGU A;  1RRP B;  2MWN B;  1Y19 B;  4BBK A;  2W2X D;  2RNR B;  1Q67 A;  2YVC A;  4HAX B;  3MPX A;  5HE0 A;  2DHI A;  2RRF A;  5FI0 A;  4ZRK A;  1IRS A;  1K5G B;  5LOP B;  2D4Q A;  3ODX A;  1M7E A;  1B55 A;  4EJN A;  4KHO A;  2J0K A;  2AL6 A;  3HSA A;  1OY2 A;  2J59 M;  2Y7B A;  3CXB B;  1WG7 A;  2VRW B;  3KSY A;  3SNH A;  3DCX A;  2KUP A;  2L1C A;  1UNR A;  2G35 A;  4D0N B;  2ELB A;  1V89 A;  2Y8F A;  2P8V A;  1MIX A;  4L6E A;  2PZ1 A;  1ZC3 B;  2UZS A;  3KZ1 A;  4NY0 A;  4CHM A;  1BTN A;  2I1J A;  2YRY A;  2VKI A;  2KGX B;  4A6F B;  4HB0 B;  2NMB A;  1ISN A;  1XCG A;  5IRS A;  1FHO A;  4KHB A;  3O96 A;  4L1R A;  1LB1 A;  2YS1 A;  2I1K A;  5I2M A;  2J0J A;  3QIJ A;  5J3Y A;  1P3R A;  3AU5 A;  1ZVR A;  3SYX A;  5GOW B;  2NZ8 B;  4EMO A;  2MKR A;  3GYP A;  1BWN A;  2D2Q A;  2K8E A;  3RCP A;  1GC6 A;  2Z59 A;  4A6K A;  2DA0 A;  3U8Z A;  4Y94 A;  1V5U A;  2HTH B;  4TKN A;  4XWX A;  1KI1 B;  2K2U A;  1E5W A;  1PFJ A;  1M7R A;  2W2W A;  4EKU A;  3SO6 A;  1DYN A;  1EAZ A;  1WVH A;  2HE7 A;  2N23 A;  4GOU A;  3D8F A;  1MPH A;  5L81 A;  4F7U P;  2D10 A;  1MIZ B;  2Z0O A;  2E2X A;  4QJ5 B;  4HAY B;  2KCJ A;  4HAU B;  1UNP A;  3BJI A;  4YON A;  4GN1 A;  3F5R A;  3AJ4 A;  4Z2M B;  3AU4 A;  4NSW A;  2ROZ B;  5D3V A;  3U7D A;  2COF A;  3TVV A;  4F7G A;  1P5T A;  1V88 A;  4OSN A;  4TYZ A;  4HB2 B;  2DKQ A;  2I5F A;  4KHB B;  1OQN A;  2AEH A;  2RUK B;  2D9V A;  2DYQ A;  1J0W A;  3PSC A;  2YF0 A;  1W1G A;  4HB4 B;  2EJ8 A;  4QJ4 B;  4PNK A;  4DBB A;  4F7H A;  3A8Q A;  4OT1 A;  2KIG A;  3OHM B;  1WJM A;  1XOD A;  4C0A A;  5C16 A;  2N0Y A;  1PLS A;  4ZRI A;  2CRF A;  4HDO A;  2R09 A;  4GPT B;  1Y5O A;  2UVM A;  2XQN M;  2DN6 A;  2ELA A;  4DX9 0;  5HE1 A;  4A6F A;  3ZVR A;  3QWM A;  4KHA A;  3NSU A;  2RVB B;  4GNK B;  3SV1 A;  3ODO A;  2KR0 A;  2JP2 A;  3FM8 C;  1UNQ A;  5JLJ B;  3ULB A;  2COD A;  3X23 A;  3PP2 A;  1SHC A;  2GUM A;  3M1I B;  3HQC A;  2K2J A;  1FAO A;  3CIK A;  4HAW B;  5M4Y B;  3MDB C;  3SUZ A;  4Z2N A;  1FOE A;  3HIE A;  1XX0 A;  5JHG A;  3FVC A;  1XR0 B;  2RGN B;  3U12 A;  4YL8 A;  3T06 A;  2D9Y A;  2ADZ A;  3WYF B;  5C5B A;  3B77 A;  3KRX A;  5D3X A;  3A58 A;  3TCA A;  2DFK A;  1TXD A;  1X11 A;  2KUQ A;  3NWA A;  5I2S A;  2QKL A;  1UPR A;  1FHW A;  2FJL A;  1UEF A;  4K17 A;  2X18 A;  4PQ0 A;  2DYN A;  3A98 B;  5CLL B;  3TFM A;  2H7D A;  4B6H A;  2LOX A;  2V76 A;  1P6S A;  2LUL A;  1FGZ A;  2DHJ A;  2J0M A;  3BIN A;  2DHK A;  3A8P A;  2UZR A;  5JHH A;  2CAY A;  4WSF A;  1NU2 A;  4GMX B;  2CY4 A;  3ODW A;  5D27 A;  1U5G A;  1MI1 A;  2DTC A;  2KIE A;  3GYO A;  4A5K A;  2P0F A;  2ROV A;  3P7Z A;  4HSI A;  4HAZ B;  2P0H A;  1U27 A;  3F0W A;  2YT2 A;  1AWE A;  1BTK A;  2GCL A;  3D8E A;  5DI9 B;  1KZG A;  3LJU X;  3ULC A;  2ZPY A;  5DHA B;  2YSZ A;  4HB3 B;  2D9Z A;  1GC7 A;  4CHJ A;  5DIF B;  3PVU A;  3DXD A;  5LG4 B;  4HHV A;  3ML4 A;  1NTY A;  4GZU A;  2D9X A;  4K81 A;  1EF1 A;  3FEH A;  2COC A;  1V61 A;  3WA0 A;  5D3W A;  2LYD A;  1DBH A;  4DX8 A;  5KQ4 A;  1QQG A;  1DDV A;  3TW1 A;  3VIA A;  2OQB A;  1WJ1 A;  4WJ7 A;  1PMS A;  1DDW A;  1MAI A;  2ZKM X;  1U2B A;  5DH9 B;  3PVL A;  1NTV A;  3PG7 A;  2M38 A;  2MDX A;  1H10 A;  2NBV A;  1TQZ A;  5FI1 A;  5C79 A;  4QXA B;  4MT7 A;  2YS5 A;  2Y8G A;  1V5M A;  1EVH A;  3G9W A;  1ZM0 A;  2R2Y A;  1OMW A;  2M14 A;  2W2X C;  2D9W A;  5HE3 A;  4KAX B;  1W1D A;  2BCJ A;  4HAV B;  1X05 A;  3NWF A;  2VSZ A;  4GXB A;  2R0D A;  3N7C A;  4A6H A;  4DXA B;  4CYE A;  1XKE A;  4K2P A;  1U5D A;  1T77 A;  2OTX A;  5J3T A;  3TO1 A;  1EGX A;  3DXC A;  3HW2 B;  3KRW A;  1DRO A;  2LKO A;  2YT1 A;  2DX5 A;  4IOY X;  5D3Y A;  3PVW A;  1LW3 A;  2IFS A;  1AQC A;  2H7E A;  2Z0Q A;  3P6A A;  1U5E A;  1FGY A;  1WGQ A;  1MKE A;  4CSQ A;  1H4R A;  1U5F A;  5CLQ B;  1Z87 A;  2GCJ A;  2GJY A;  3OAN A;  1X1F A; 
#chains in the Genus database with same CATH homology
 1NI2 A;  4H8S A;  4KVG B;  3UZT A;  1I7A A;  1K5D B;  2DKP A;  5C6R A;  1KZ7 A;  3V5W A;  3FSS A;  4GMV A;  1TJ6 A;  2L2I A;  2LG1 A;  2QKM A;  2EMS A;  5KQ1 A;  5J3Q A;  3PZD A;  3IVF A;  3QBV B;  5JP4 A;  2K00 A;  1XD4 A;  2GS0 A;  2Q13 A;  2DX1 A;  2P0D A;  1ZSQ A;  2D11 A;  5LON B;  1N3H A;  3DXE A;  2LOZ A;  5HE2 A;  3KY9 A;  3ZDT A;  4P7I A;  1W1H A;  1X1G A;  1FHX A;  1UPQ A;  1RJ2 A;  4MY6 A;  1DDM A;  4K2O A;  5EFX A;  1MK9 B;  5DHF B;  1I2H A;  5KCV A;  2EC1 A;  4IAP A;  2CY5 A;  1X86 A;  2COA A;  2EMT A;  2RLO A;  1QC6 A;  5C5B B;  1J19 A;  4ZRJ A;  1ZC4 B;  3PEG A;  4HAT B;  2Z0P A;  2YT0 A;  1GG3 A;  2RSG A;  1FB8 A;  2DLW A;  1MK7 B;  4HDQ A;  4MK0 A;  2I5C A;  2MFQ A;  3HK0 A;  1V5P A;  4WVF B;  4IFS A;  1BAK A;  1U29 A;  3VOQ A;  2IYB A;  1SGH A;  2YS3 A;  1WI1 A;  3D8D A;  1WGU A;  1RRP B;  2MWN B;  1Y19 B;  4BBK A;  2W2X D;  2RNR B;  4HAX B;  1Q67 A;  2YVC A;  3MPX A;  5HE0 A;  2DHI A;  5FI0 A;  4ZRK A;  1IRS A;  1K5G B;  5LOP B;  2D4Q A;  3ODX A;  1M7E A;  1B55 A;  4EJN A;  4KHO A;  2J0K A;  2AL6 A;  1OY2 A;  2J59 M;  2Y7B A;  3CXB B;  1WG7 A;  2VRW B;  3KSY A;  3SNH A;  2KUP A;  2L1C A;  1UNR A;  2G35 A;  4D0N B;  2ELB A;  1V89 A;  2Y8F A;  2P8V A;  1MIX A;  4L6E A;  2PZ1 A;  1ZC3 B;  2UZS A;  3KZ1 A;  4NY0 A;  4CHM A;  1BTN A;  2I1J A;  2YRY A;  2VKI A;  2KGX B;  4A6F B;  4HB0 B;  2NMB A;  1ISN A;  1XCG A;  1FHO A;  3O96 A;  1LB1 A;  2YS1 A;  2I1K A;  2J0J A;  3QIJ A;  5J3Y A;  1P3R A;  3AU5 A;  1ZVR A;  3SYX A;  5GOW B;  2NZ8 B;  4EMO A;  2MKR A;  3GYP A;  1BWN A;  2D2Q A;  3RCP A;  1GC6 A;  4A6K A;  2DA0 A;  3U8Z A;  4Y94 A;  1V5U A;  2HTH B;  4TKN A;  4XWX A;  1KI1 B;  2K2U A;  1E5W A;  1PFJ A;  1M7R A;  2W2W A;  4EKU A;  3SO6 A;  1DYN A;  1EAZ A;  1WVH A;  2HE7 A;  2N23 A;  3D8F A;  1MPH A;  5L81 A;  4F7U P;  2D10 A;  1MIZ B;  2Z0O A;  2E2X A;  4HAY B;  2KCJ A;  4HAU B;  1UNP A;  3BJI A;  4YON A;  4GN1 A;  3F5R A;  3AJ4 A;  4Z2M B;  3AU4 A;  4NSW A;  2ROZ B;  5D3V A;  3U7D A;  2COF A;  3TVV A;  4F7G A;  1P5T A;  1V88 A;  4TYZ A;  4HB2 B;  2DKQ A;  2I5F A;  4KHB B;  1OQN A;  2AEH A;  2RUK B;  2D9V A;  2DYQ A;  1J0W A;  3PSC A;  2YF0 A;  1W1G A;  4HB4 B;  2EJ8 A;  4PNK A;  4DBB A;  4F7H A;  3A8Q A;  1WJM A;  1XOD A;  4C0A A;  5C16 A;  2N0Y A;  1PLS A;  4ZRI A;  2CRF A;  4HDO A;  2R09 A;  4GPT B;  1Y5O A;  2UVM A;  2XQN M;  2DN6 A;  2ELA A;  4DX9 0;  5HE1 A;  4A6F A;  3ZVR A;  3QWM A;  4KHA A;  3NSU A;  2RVB B;  3SV1 A;  3ODO A;  2JP2 A;  3FM8 C;  1UNQ A;  5JLJ B;  3ULB A;  2COD A;  3X23 A;  3PP2 A;  1SHC A;  3M1I B;  3HQC A;  2K2J A;  1FAO A;  3CIK A;  4HAW B;  3MDB C;  3SUZ A;  4Z2N A;  1FOE A;  1XX0 A;  5JHG A;  1XR0 B;  2RGN B;  4YL8 A;  3T06 A;  2D9Y A;  2ADZ A;  3WYF B;  5C5B A;  3KRX A;  5D3X A;  3TCA A;  2DFK A;  1TXD A;  1X11 A;  2QKL A;  1UPR A;  1FHW A;  2FJL A;  1UEF A;  4K17 A;  2X18 A;  4PQ0 A;  2DYN A;  3A98 B;  5CLL B;  3TFM A;  2H7D A;  4B6H A;  2LOX A;  2V76 A;  1P6S A;  2LUL A;  1FGZ A;  2DHJ A;  2J0M A;  3BIN A;  2DHK A;  3A8P A;  2UZR A;  5JHH A;  2CAY A;  4WSF A;  1NU2 A;  4GMX B;  2CY4 A;  3ODW A;  5D27 A;  1U5G A;  2DTC A;  3GYO A;  4A5K A;  2P0F A;  2ROV A;  3P7Z A;  4HAZ B;  2P0H A;  1U27 A;  3F0W A;  1AWE A;  1BTK A;  2GCL A;  3D8E A;  5DI9 B;  1KZG A;  3LJU X;  3ULC A;  2ZPY A;  5DHA B;  2YSZ A;  4HB3 B;  2D9Z A;  1GC7 A;  4CHJ A;  5DIF B;  3PVU A;  3DXD A;  4HHV A;  3ML4 A;  1NTY A;  4GZU A;  2D9X A;  4K81 A;  1EF1 A;  3FEH A;  2COC A;  1V61 A;  3WA0 A;  5D3W A;  2LYD A;  1DBH A;  4DX8 A;  5KQ4 A;  1QQG A;  1DDV A;  3TW1 A;  3VIA A;  2OQB A;  1WJ1 A;  4WJ7 A;  1PMS A;  1DDW A;  1MAI A;  1U2B A;  5DH9 B;  3PVL A;  1NTV A;  3PG7 A;  2M38 A;  2MDX A;  1H10 A;  1TQZ A;  5FI1 A;  5C79 A;  4MT7 A;  2YS5 A;  2Y8G A;  1V5M A;  1EVH A;  3G9W A;  1ZM0 A;  2W2X C;  1OMW A;  2M14 A;  2D9W A;  5HE3 A;  4KAX B;  1W1D A;  2BCJ A;  4HAV B;  1X05 A;  2VSZ A;  4GXB A;  2R0D A;  3N7C A;  4A6H A;  4DXA B;  4CYE A;  1XKE A;  4K2P A;  1U5D A;  2OTX A;  5J3T A;  3TO1 A;  1EGX A;  3DXC A;  3HW2 B;  3KRW A;  1DRO A;  2LKO A;  2YT1 A;  2DX5 A;  4IOY X;  5D3Y A;  3PVW A;  1LW3 A;  2IFS A;  1AQC A;  2H7E A;  2Z0Q A;  3P6A A;  1U5E A;  1FGY A;  1WGQ A;  1MKE A;  1H4R A;  1U5F A;  5CLQ B;  1Z87 A;  2GCJ A;  2GJY A;  3OAN A;  1X1F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...