4F7SB

Crystal structure of human cdk8/cycc in the dmg-in conformation
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
267
structure length
267
Chain Sequence
DKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Structure-kinetic relationship study of CDK8/CycC specific compounds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transcription/inhibitor
total genus 99
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f7sB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f7sB01
5HQ0B 5HBEB 2C5VB 5IDNB 1H1SB 4II5B 5CEIB 2CCIB 4EOLB 4EOIB 2IW9B 1GUXB 2W99A 2R7GA 4EOOB 1OKVB 5HNBB 5ACBA 4F70B 1OI9B 3DOGB 1JKWA 2UZEB 3O0GD 3RGFB 2BKZB 4BCGB 5I5ZB 4KRCB 1JSUB 1C9BA 1N4MA 2V22B 2C5OB 1BU2A 4EOSB 1OL2B 4CRLB 1GH6B 3MIAB 4TTHA 4F7JB 5IF1B 3DDQB 2G9XB 1H24B 3EOCB 2QDJA 4EONB 4ELJA 1E9HB 3DDPB 4EC8B 1W98B 5LQFB 2EUFA 1QMZB 1F5QB 1KXUA 1OGUB 3POMA 3G33B 4BCPB 4F7LB 5HBJB 4EOPB 5CYIB 3F5XB 2WMAB 1H1PB 3TNIB 1O9KA 4Y72B 4CXAB 2F2CA 4FX3B 5BNJB 4F6WB 4G6LB 1JOWA 5LMKB 4YOOA 1H4LD 1P5EB 3MY5B 1OKWB 1VOLA 3TNWB 2W9FA 2C6TB 3MI9B 2UZLB 5FGKB 1GY3B 4CFUD 1OIUB 1PKDB 4BCQD 3MY1B 5HBHB 4UN0A 2WMBB 2UUEB 4ROEA 4NSTB 4EOQB 3EJ1B 2WHBB 4YOSA 1GUXA 2WIHB 4F7SB 4BCNB 2WFYB 2WIPB 4EOKB 1H1QB 2UZDB 3BHUB 2X1NB 1VYWB 2BPMB 1D3UB 3BLQB 3M03A 3LQ5B 2IW6B 2UZBB 4CFUB 4BCQB 1H28B 4F7NB 4CFXB 4EOMB 1FINB 4EORB 1AISB 2IW8B 1URCB 1H26B 4BCND 2PMIB 1XO2A 5EFQB 4CFNB 1VINA 4BCKB 3BHVB 1AD6A 1H27B 2JGZB 1TFBA 2WXVB 2WEVB 2WPAB 4YOZA 1ZP2A 4BCIB 4OGRB 1UNGD 2I53A 4IMYB 4ROCA 4F6UB 5IDPB 2C4GB 4BCHB 4YC3B 4KRDB 2CJMB 2IVXA 2PK9B 5ICPB 4CFMB 2W96A 4RODA 4ELLA 3BLHB 4F6SB 3BLRB 4I3ZB 4BCMD 4BCJB 2B9RA 2C5NB 1OL1B 1UNHD 3BHTB 3K7AM 3TNHB 4CFWB 4BCFB 2W2HA 3QHRB 2CCHB 2I40B 1G3NC 4OR5B 1OIYB 3H4CA 3EIDB 4CFVB 1JSTB 2PK2A 1O9KB 4EC9B 1H1RB 3QHWB 1UNLD 2C5XB 3TN8B 2PHGA 4BCOB 5L2WB 5HVYB 1H25B 4BCMB 1FVVB 2W9ZA 4EOJB
chains in the Genus database with same CATH superfamily
1H1SB 4II5B 3VKHA 2IW9B 3QYBA 2QF7A 5HNBB 3O0GD 2BKZB 5I5ZB 1JSUB 3QWLA 2ZZDB 2D0QB 3X24B 1BU2A 4EOSB 3MIAB 3A8MB 2WJ9A 4HLQA 4EC8B 2LW4A 2EUFA 1OGUB 4BCPB 4OB1B 3F5XB 4CXAB 4FX3B 1AHJB 4JX6A 1H4LD 3MY5B 3X20B 1VOLA 5DQWA 2C6TB 2BS3A 3MI9B 2UZLB 4BY1X 4OB0B 3WVDB 4BCNB 1VYWB 5EJCA 1H28B 4EOMB 2IW8B 3BG5A 3X25B 5EFQB 4CFNB 4BCKB 1TFBA 4BCIB 4OGRB 4ROCA 4AKIA 5IDPB 2C4GB 5ICPB 4RODA 1UNHD 2DMEA 2I40B 1G3NC 3H4CA 1O9KB 3QHWB 1UNLD 2C5XB 3TN8B 1V29B 2CZ0B 4EOJB 5HQ0B 5IDNB 2DD4B 5CEIB 3WVEB 2CCIB 3X28B 2KR6A 2R7GA 4EOOB 1OKVB 1UGPB 2QGSA 4MIMA 1JKWA 2UZEB 4BCGB 2DD5B 4HL4A 3QYHB 1GH6B 4F7JB 3NDQA 5IF1B 3DDQB 4MFEA 4ZGJB 4QSHA 4HNUA 5IHYA 5LQFB 1F5QB 3POMA 3G33B 2CZ1B 2WMAB 1H1PB 1O9KA 2CZ6B 4F6WB 4G6LB 3A8OB 1JOWA 4YOOA 1P5EB 2ZPEB 2W9FA 5FGKB 4CFUD 1PKDB 4BCQD 3MY1B 4HNVA 3DL1A 4ROEA 2G77A 4YOSA 3TW6A 4EOKB 4AKGA 2QFZA 3BLQB 2DXCB 4CFUB 4BCQB 4CFXB 1AISB 4BY7X 4BCND 1IREB 1VINA 3BHVB 1AD6A 1H27B 2JGZB 1UGSB 2QDYB 2WEVB 2WPAB 3HBLA 1UNGD 4IMYB 1FKMA 2CJMB 2PK9B 4LOCA 2W96A 4ELLA 4F6SB 4BCMD 3BHTB 3TNHB 2W2HA 3QHRB 3PO3S 3VYGB 3KHIA 2PK2A 4ZGEB 1H1RB 4OB2B 5L2WB 4BBSM 3VKGA 4BCMB 3A8LB 1FVVB 2W9ZA 2C5VB 4EOIB 2W99A 4NC6A 3A8GB 5ACBA 1OI9B 3BG9A 3RGFB 1ENWA 4FM4B 1N4MA 2DXBB 2V22B 1OL2B 4CRLB 3X26B 2G9XB 4EONB 4ZGDB 3DTOA 3DDPB 1QMZB 4BBRM 1KXUA 3QYGB 5CYIB 3TNIB 4Y72B 2F2CA 1OKWB 4AKHA 5DQVA 1GY3B 3DJBA 4MFDA 2DPPB 2WMBB 4EOQB 2WHBB 2WIHB 2WFYB 2WIPB 1H1QB 2UZDB 3BHUB 2X1NB 2BPMB 1D3UB 3LQ5B 2IW6B 2AHJB 1TD6A 4F7NB 4EORB 1H26B 2IN3A 3QYEA 2PMIB 1XO2A 2WXVB 3TW7A 4YOZA 2ZPHB 4JX4A 4F6UB 2KMGA 4JX5A 4BCHB 4YC3B 2IVXA 3BLRB 4I3ZB 4BCJB 4HNTA 1OL1B 2CYZB 4CFWB 4BCFB 2CCHB 4OR5B 1OIYB 3EIDB 4CFVB 1JSTB 3HB9A 2ZPFB 2BS4A 2PHGA 3BG3A 1H25B 5HBEB 3QXEB 4EOLB 3B57A 1GUXB 3QZ9B 4F70B 4BXXX 2ZPGB 3DOGB 4KRCB 1C9BA 3GTMS 2C5OB 2BS2A 4TTHA 1H24B 3EOCB 2QDJA 4ELJA 3HO8A 1E9HB 3HHTB 1W98B 1UGQB 4F7LB 4EOPB 3VYHB 2ZCFB 4AI6A 1UGRB 5BNJB 5LMKB 3HZJA 3TNWB 1OIUB 5HBHB 4UN0A 2UUEB 4NSTB 3EJ1B 1GUXA 2PJQA 3QZ5B 4F7SB 3M03A 2QQ8A 2UZBB 1FINB 1URCB 4OB3B 1QLBA 1ZP2A 2I53A 4Z6YA 2CZ7B 4KRDB 4CFMB 3BLHB 2B9RA 2C5NB 3K7AM 3A8HB 1E7PA 4EC9B 2ZPBB 2ZPIB 4BCOB 5HVYB 5HBJB 4M6VA
chains in the Genus database with same CATH topology
5HQ0B 5HBEB 2C5VB 5IDNB 1H1SB 4II5B 5CEIB 2CCIB 4EOLB 4EOIB 2IW9B 1GUXB 2W99A 2R7GA 4EOOB 1OKVB 5HNBB 5ACBA 4F70B 1OI9B 3DOGB 1JKWA 2UZEB 3O0GD 3RGFB 2BKZB 4BCGB 5I5ZB 4KRCB 1JSUB 1C9BA 1N4MA 2V22B 2C5OB 1BU2A 4EOSB 1OL2B 4CRLB 1GH6B 3MIAB 4TTHA 4F7JB 5IF1B 3DDQB 2G9XB 1H24B 3EOCB 2QDJA 4EONB 4ELJA 1E9HB 3DDPB 4EC8B 1W98B 5LQFB 2EUFA 1QMZB 1F5QB 1KXUA 1OGUB 3POMA 3G33B 4BCPB 4F7LB 5HBJB 4EOPB 5CYIB 3F5XB 2WMAB 1H1PB 3TNIB 1O9KA 4Y72B 4CXAB 2F2CA 4FX3B 5BNJB 4F6WB 4G6LB 1JOWA 5LMKB 4YOOA 1H4LD 1P5EB 3MY5B 1OKWB 1VOLA 3TNWB 2W9FA 2C6TB 3MI9B 2UZLB 5FGKB 1GY3B 4CFUD 1OIUB 1PKDB 4BCQD 3MY1B 5HBHB 4UN0A 2WMBB 2UUEB 4ROEA 4NSTB 4EOQB 3EJ1B 2WHBB 4YOSA 1GUXA 2WIHB 4F7SB 4BCNB 2WFYB 2WIPB 4EOKB 1H1QB 2UZDB 3BHUB 2X1NB 1VYWB 2BPMB 1D3UB 3BLQB 3M03A 3LQ5B 2IW6B 2UZBB 4CFUB 4BCQB 1H28B 4F7NB 4CFXB 4EOMB 1FINB 4EORB 1AISB 2IW8B 1URCB 1H26B 4BCND 2PMIB 1XO2A 5EFQB 4CFNB 1VINA 4BCKB 3BHVB 1AD6A 1H27B 2JGZB 1TFBA 2WXVB 2WEVB 2WPAB 4YOZA 1ZP2A 4BCIB 4OGRB 1UNGD 2I53A 4IMYB 4ROCA 4F6UB 5IDPB 2C4GB 4BCHB 4YC3B 4KRDB 2CJMB 2IVXA 2PK9B 5ICPB 4CFMB 2W96A 4RODA 4ELLA 3BLHB 4F6SB 3BLRB 4I3ZB 4BCMD 4BCJB 2B9RA 2C5NB 1OL1B 1UNHD 3BHTB 3K7AM 3TNHB 4CFWB 4BCFB 2W2HA 3QHRB 2CCHB 2I40B 1G3NC 4OR5B 1OIYB 3H4CA 3EIDB 4CFVB 1JSTB 2PK2A 1O9KB 4EC9B 1H1RB 3QHWB 1UNLD 2C5XB 3TN8B 2PHGA 4BCOB 5L2WB 5HVYB 1H25B 4BCMB 1FVVB 2W9ZA 4EOJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HQ0 B;  5HBE B;  2C5V B;  5IDN B;  1H1S B;  4II5 B;  5CEI B;  2CCI B;  4EOL B;  4EOI B;  2IW9 B;  1GUX B;  2W99 A;  2R7G A;  4EOO B;  1OKV B;  5HNB B;  5ACB A;  4F70 B;  1OI9 B;  3DOG B;  1JKW A;  2UZE B;  3O0G D;  3RGF B;  2BKZ B;  4BCG B;  5I5Z B;  4KRC B;  1JSU B;  1C9B A;  1N4M A;  2V22 B;  2C5O B;  1BU2 A;  4EOS B;  1OL2 B;  4CRL B;  1GH6 B;  3MIA B;  4TTH A;  4F7J B;  5IF1 B;  3DDQ B;  2G9X B;  1H24 B;  3EOC B;  2QDJ A;  4EON B;  4ELJ A;  1E9H B;  3DDP B;  4EC8 B;  1W98 B;  5LQF B;  2EUF A;  1QMZ B;  1F5Q B;  1KXU A;  1OGU B;  3POM A;  3G33 B;  4BCP B;  4F7L B;  5HBJ B;  4EOP B;  5CYI B;  3F5X B;  2WMA B;  1H1P B;  3TNI B;  1O9K A;  4Y72 B;  4CXA B;  2F2C A;  4FX3 B;  5BNJ B;  4F6W B;  4G6L B;  1JOW A;  5LMK B;  4YOO A;  1H4L D;  1P5E B;  3MY5 B;  1OKW B;  1VOL A;  3TNW B;  2W9F A;  2C6T B;  3MI9 B;  2UZL B;  5FGK B;  1GY3 B;  4CFU D;  1OIU B;  1PKD B;  4BCQ D;  3MY1 B;  5HBH B;  4UN0 A;  2WMB B;  2UUE B;  4ROE A;  4NST B;  4EOQ B;  3EJ1 B;  2WHB B;  4YOS A;  1GUX A;  2WIH B;  4F7S B;  4BCN B;  2WFY B;  2WIP B;  4EOK B;  1H1Q B;  2UZD B;  3BHU B;  2X1N B;  1VYW B;  2BPM B;  1D3U B;  3BLQ B;  3M03 A;  3LQ5 B;  2IW6 B;  2UZB B;  4CFU B;  4BCQ B;  1H28 B;  4F7N B;  4CFX B;  4EOM B;  1FIN B;  4EOR B;  1AIS B;  2IW8 B;  1URC B;  1H26 B;  4BCN D;  2PMI B;  1XO2 A;  5EFQ B;  4CFN B;  1VIN A;  4BCK B;  3BHV B;  1AD6 A;  1H27 B;  2JGZ B;  1TFB A;  2WXV B;  2WEV B;  2WPA B;  4YOZ A;  1ZP2 A;  4BCI B;  4OGR B;  1UNG D;  2I53 A;  4IMY B;  4ROC A;  4F6U B;  5IDP B;  2C4G B;  4BCH B;  4YC3 B;  4KRD B;  2CJM B;  2IVX A;  2PK9 B;  5ICP B;  4CFM B;  2W96 A;  4ROD A;  4ELL A;  3BLH B;  4F6S B;  3BLR B;  4I3Z B;  4BCM D;  4BCJ B;  2B9R A;  2C5N B;  1OL1 B;  1UNH D;  3BHT B;  3K7A M;  3TNH B;  4CFW B;  4BCF B;  2W2H A;  3QHR B;  2CCH B;  2I40 B;  1G3N C;  4OR5 B;  1OIY B;  3H4C A;  3EID B;  4CFV B;  1JST B;  2PK2 A;  1O9K B;  4EC9 B;  1H1R B;  3QHW B;  1UNL D;  2C5X B;  3TN8 B;  2PHG A;  4BCO B;  5L2W B;  5HVY B;  1H25 B;  4BCM B;  1FVV B;  2W9Z A;  4EOJ B; 
#chains in the Genus database with same CATH topology
 1H1S B;  4II5 B;  3VKH A;  2IW9 B;  3QYB A;  2QF7 A;  5HNB B;  3O0G D;  2BKZ B;  5I5Z B;  1JSU B;  3QWL A;  2ZZD B;  2D0Q B;  3X24 B;  1BU2 A;  4EOS B;  3MIA B;  3A8M B;  2WJ9 A;  4HLQ A;  4EC8 B;  2LW4 A;  2EUF A;  1OGU B;  4BCP B;  4OB1 B;  3F5X B;  4CXA B;  4FX3 B;  1AHJ B;  4JX6 A;  1H4L D;  3MY5 B;  3X20 B;  1VOL A;  5DQW A;  2C6T B;  2BS3 A;  3MI9 B;  2UZL B;  4BY1 X;  4OB0 B;  3WVD B;  4BCN B;  1VYW B;  5EJC A;  1H28 B;  4EOM B;  2IW8 B;  3BG5 A;  3X25 B;  5EFQ B;  4CFN B;  4BCK B;  1TFB A;  4BCI B;  4OGR B;  4ROC A;  4AKI A;  5IDP B;  2C4G B;  5ICP B;  4ROD A;  1UNH D;  2DME A;  2I40 B;  1G3N C;  3H4C A;  1O9K B;  3QHW B;  1UNL D;  2C5X B;  3TN8 B;  1V29 B;  2CZ0 B;  4EOJ B;  5HQ0 B;  5IDN B;  2DD4 B;  5CEI B;  3WVE B;  2CCI B;  3X28 B;  2KR6 A;  2R7G A;  4EOO B;  1OKV B;  1UGP B;  2QGS A;  4MIM A;  1JKW A;  2UZE B;  4BCG B;  2DD5 B;  4HL4 A;  3QYH B;  1GH6 B;  4F7J B;  3NDQ A;  5IF1 B;  3DDQ B;  4MFE A;  4ZGJ B;  4QSH A;  4HNU A;  5IHY A;  5LQF B;  1F5Q B;  3POM A;  3G33 B;  2CZ1 B;  2WMA B;  1H1P B;  1O9K A;  2CZ6 B;  4F6W B;  4G6L B;  3A8O B;  1JOW A;  4YOO A;  1P5E B;  2ZPE B;  2W9F A;  5FGK B;  4CFU D;  1PKD B;  4BCQ D;  3MY1 B;  4HNV A;  3DL1 A;  4ROE A;  2G77 A;  4YOS A;  3TW6 A;  4EOK B;  4AKG A;  2QFZ A;  3BLQ B;  2DXC B;  4CFU B;  4BCQ B;  4CFX B;  1AIS B;  4BY7 X;  4BCN D;  1IRE B;  1VIN A;  3BHV B;  1AD6 A;  1H27 B;  2JGZ B;  1UGS B;  2QDY B;  2WEV B;  2WPA B;  3HBL A;  1UNG D;  4IMY B;  1FKM A;  2CJM B;  2PK9 B;  4LOC A;  2W96 A;  4ELL A;  4F6S B;  4BCM D;  3BHT B;  3TNH B;  2W2H A;  3QHR B;  3PO3 S;  3VYG B;  3KHI A;  2PK2 A;  4ZGE B;  1H1R B;  4OB2 B;  5L2W B;  4BBS M;  3VKG A;  4BCM B;  3A8L B;  1FVV B;  2W9Z A;  2C5V B;  4EOI B;  2W99 A;  4NC6 A;  3A8G B;  5ACB A;  1OI9 B;  3BG9 A;  3RGF B;  1ENW A;  4FM4 B;  1N4M A;  2DXB B;  2V22 B;  1OL2 B;  4CRL B;  3X26 B;  2G9X B;  4EON B;  4ZGD B;  3DTO A;  3DDP B;  1QMZ B;  4BBR M;  1KXU A;  3QYG B;  5CYI B;  3TNI B;  4Y72 B;  2F2C A;  1OKW B;  4AKH A;  5DQV A;  1GY3 B;  3DJB A;  4MFD A;  2DPP B;  2WMB B;  4EOQ B;  2WHB B;  2WIH B;  2WFY B;  2WIP B;  1H1Q B;  2UZD B;  3BHU B;  2X1N B;  2BPM B;  1D3U B;  3LQ5 B;  2IW6 B;  2AHJ B;  1TD6 A;  4F7N B;  4EOR B;  1H26 B;  2IN3 A;  3QYE A;  2PMI B;  1XO2 A;  2WXV B;  3TW7 A;  4YOZ A;  2ZPH B;  4JX4 A;  4F6U B;  2KMG A;  4JX5 A;  4BCH B;  4YC3 B;  2IVX A;  3BLR B;  4I3Z B;  4BCJ B;  4HNT A;  1OL1 B;  2CYZ B;  4CFW B;  4BCF B;  2CCH B;  4OR5 B;  1OIY B;  3EID B;  4CFV B;  1JST B;  3HB9 A;  2ZPF B;  2BS4 A;  2PHG A;  3BG3 A;  1H25 B;  5HBE B;  3QXE B;  4EOL B;  3B57 A;  1GUX B;  3QZ9 B;  4F70 B;  4BXX X;  2ZPG B;  3DOG B;  4KRC B;  1C9B A;  3GTM S;  2C5O B;  2BS2 A;  4TTH A;  1H24 B;  3EOC B;  2QDJ A;  4ELJ A;  3HO8 A;  1E9H B;  3HHT B;  1W98 B;  1UGQ B;  4F7L B;  4EOP B;  3VYH B;  2ZCF B;  4AI6 A;  1UGR B;  5BNJ B;  5LMK B;  3HZJ A;  3TNW B;  1OIU B;  5HBH B;  4UN0 A;  2UUE B;  4NST B;  3EJ1 B;  1GUX A;  2PJQ A;  3QZ5 B;  4F7S B;  3M03 A;  2QQ8 A;  2UZB B;  1FIN B;  1URC B;  4OB3 B;  1QLB A;  1ZP2 A;  2I53 A;  4Z6Y A;  2CZ7 B;  4KRD B;  4CFM B;  3BLH B;  2B9R A;  2C5N B;  3K7A M;  3A8H B;  1E7P A;  4EC9 B;  2ZPB B;  2ZPI B;  4BCO B;  5HVY B;  5HBJ B;  4M6V A; 
#chains in the Genus database with same CATH homology
 5HQ0 B;  5HBE B;  2C5V B;  5IDN B;  1H1S B;  4II5 B;  5CEI B;  2CCI B;  4EOL B;  4EOI B;  2IW9 B;  1GUX B;  2W99 A;  2R7G A;  4EOO B;  1OKV B;  5HNB B;  5ACB A;  4F70 B;  1OI9 B;  3DOG B;  1JKW A;  2UZE B;  3O0G D;  3RGF B;  2BKZ B;  4BCG B;  5I5Z B;  4KRC B;  1JSU B;  1C9B A;  1N4M A;  2V22 B;  2C5O B;  1BU2 A;  4EOS B;  1OL2 B;  4CRL B;  1GH6 B;  3MIA B;  4TTH A;  4F7J B;  5IF1 B;  3DDQ B;  2G9X B;  1H24 B;  3EOC B;  2QDJ A;  4EON B;  4ELJ A;  1E9H B;  3DDP B;  4EC8 B;  1W98 B;  5LQF B;  2EUF A;  1QMZ B;  1F5Q B;  1KXU A;  1OGU B;  3POM A;  3G33 B;  4BCP B;  4F7L B;  5HBJ B;  4EOP B;  5CYI B;  3F5X B;  2WMA B;  1H1P B;  3TNI B;  1O9K A;  4Y72 B;  4CXA B;  2F2C A;  4FX3 B;  5BNJ B;  4F6W B;  4G6L B;  1JOW A;  5LMK B;  4YOO A;  1H4L D;  1P5E B;  3MY5 B;  1OKW B;  1VOL A;  3TNW B;  2W9F A;  2C6T B;  3MI9 B;  2UZL B;  5FGK B;  1GY3 B;  4CFU D;  1OIU B;  1PKD B;  4BCQ D;  3MY1 B;  5HBH B;  4UN0 A;  2WMB B;  2UUE B;  4ROE A;  4NST B;  4EOQ B;  3EJ1 B;  2WHB B;  4YOS A;  1GUX A;  2WIH B;  4F7S B;  4BCN B;  2WFY B;  2WIP B;  4EOK B;  1H1Q B;  2UZD B;  3BHU B;  2X1N B;  1VYW B;  2BPM B;  1D3U B;  3BLQ B;  3M03 A;  3LQ5 B;  2IW6 B;  2UZB B;  4CFU B;  4BCQ B;  1H28 B;  4F7N B;  4CFX B;  4EOM B;  1FIN B;  4EOR B;  1AIS B;  2IW8 B;  1URC B;  1H26 B;  4BCN D;  2PMI B;  1XO2 A;  5EFQ B;  4CFN B;  1VIN A;  4BCK B;  3BHV B;  1AD6 A;  1H27 B;  2JGZ B;  1TFB A;  2WXV B;  2WEV B;  2WPA B;  4YOZ A;  1ZP2 A;  4BCI B;  4OGR B;  1UNG D;  2I53 A;  4IMY B;  4ROC A;  4F6U B;  5IDP B;  2C4G B;  4BCH B;  4YC3 B;  4KRD B;  2CJM B;  2IVX A;  2PK9 B;  5ICP B;  4CFM B;  2W96 A;  4ROD A;  4ELL A;  3BLH B;  4F6S B;  3BLR B;  4I3Z B;  4BCM D;  4BCJ B;  2B9R A;  2C5N B;  1OL1 B;  1UNH D;  3BHT B;  3K7A M;  3TNH B;  4CFW B;  4BCF B;  2W2H A;  3QHR B;  2CCH B;  2I40 B;  1G3N C;  4OR5 B;  1OIY B;  3H4C A;  3EID B;  4CFV B;  1JST B;  2PK2 A;  1O9K B;  4EC9 B;  1H1R B;  3QHW B;  1UNL D;  2C5X B;  3TN8 B;  2PHG A;  4BCO B;  5L2W B;  5HVY B;  1H25 B;  4BCM B;  1FVV B;  2W9Z A;  4EOJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...