4F7UE

The 6s snrnp assembly intermediate
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
78
structure length
78
Chain Sequence
VMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLKGDNITLLQSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Splicing
total genus 17
structure length 78
sequence length 78
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uE00
4M7DF 1I81A 2RD1A 4DQ2A 4M7DB 4RCBA 4C8QD 2Y90A 4M77D 3RKYA 1N9RA 2YHTA 4QVCA 4M7DA 1WQ7A 4XU0A 5LJ5h 4HT9A 5GAN4 2FB7A 4M75D 5LJ3j 3RIRA 4OP0A 3JB9J 4RCCA 2VC8A 5GAN8 3EFRA 3JCMP 3JB9G 4X9CA 4EMGA 4NL2A 4XU3A 2DZCA 3M4GA 3QO3A 1B34B 3RERA 4M78G 2DVEA 4JRIA 1LJOA 5LJ3h 3FB9A 3FJPA 2E64A 4C92G 1B34A 5GAOr 4HT8A 5LJ5d 2VXFA 4M7AD 1LOJA 5GAMd 4QVDA 4EMKB 1M5Q1 1WNLA 2K57A 1KQ1A 2DEQA 4M77G 4M78C 1BIAA 4C8QG 3JCMh 5GMKl 4M78E 1WPYA 5LJ5g 5GAMg 4EMKA 4N0AA 3V7RA 5GAN3 1I5LA 2DTHA 3JB9F 5GANd 3JCMJ 1U1TA 4MMKA 5LJ3d 4X9DA 4M7DD 4M75G 4J6YA 3GIBA 2RM4A 4PJOD 4M78F 4J5YA 4A53A 4M78B 3V8JA 2DTOA 2DJZA 4J6WA 1JRIA 5GANg 3VU3C 3V8KA 4C92B 1I8FA 2E1HA 5GAMe 5GAMf 5LJ3g 4XQ3A 4M78A 1Y96B 2HNIA 5GMKi 5GAOq 3INZA 3QHSA 1D3BB 4NOYA 4C92A 3JCMX 3JB9I 4EMKC 4N0AC 4C8QF 5GAOm 5I21A 1Y96A 4C8QB 5GAN6 3JB9H 4M7AG 5GMKe 1D3BA 3V8LA 3BY7A 4F7UG 5GANe 2VXEA 4XTVA 3JCMg 5GANf 4JLIA 3SWNB 2JN0A 4WF2A 4C8QA 2CGHA 1M8VA 4M75F 3FIFA 4M75B 3L1AA 1HXDA 1JBMA 1HK9A 4HA8A 3SWNA 1MGQA 1YCYA 3QUIA 5GAN7 1H641 4M75A 2DTIA 3BFMA 4XTUA 3EFSA 3JCMb 4C92C 4PJOG 2DZ9A 4C92E 5DY9A 4F7UE 2E65A 3RUXA 2RA2A 2EJFA 3RESA 5GAN2 3JB9D 3JCMc 4A54A 5LJ5e 2DXUA 3V7SA 4C92F 4M7AB 3HFOA 4M77C 4JUVA 4Y91A 4C8QE 4C8QC 4M77E 4F7UB 4F7UF 1TH7A 4M78D 5GAOn 2RB6A 4XU1A 4XTXA 3SWNC 4PNOA 3JCMd 5GAOp 4M7AA 4PJOE 2EAYA 4F7UA 4M75C 4M75E 4J6XA 4M77F 4M77B 4XTYA 3HFNA 5GAMj 5GMKm 5LJ3e 4PJOF 3L2ZA 4XTZA 5LJ3f 3JCMQ 4PJOB 2QTXA 4M77A 2EJGA 3PGGA 4MMLA 4XU2A 3JCMW 3SB2A 2I2LA 4PJOA 2EJ9A 5GMKj 5GAMh 5GANj 4M7AC 4M7DG 2DXTA 2YLCA 3JCMe 4M7AE 3JCMf 1WQWA 3BDUA 4EMHA 2FYKA 1BIBA 2ZGWA 2EWNA 4NL3A 1U1SA 4M7AF 1X01A 1N9SA 2E41A 5GMKh 5GANh 3RKWA 3AHUA 1LNXA 4JRKA 5LJ5f 2DKGA 2E10A 4M7DC 3QSUA 4PJOC 4V2SA 1KQ2A 3V7CA 4M7DE 3HSBA 4XTWA 4C92D 5CAIA 2YLBA 3RKXA 5GAN5 3BW1A 5LJ5j 5GAOl 3JCMV 1I4K1
chains in the Genus database with same CATH superfamily
4M7DF 4DQ2A 2C06A 4BY6C 1BU1A 2FPEA 4M7DA 1WI7A 2O9SA 3CCRT 4DBRA 2KMTA 1D0YA 3Q1JA 2XMFA 4EMGA 2V8KA 2VB6A 4L59A 3KFVA 2MI6A 2X9HA 1PC0A 3OYBA 2VGNA 3CCUA 4AFUC 3AT1B 5AT1B 2COWA 3WXMB 4EMKB 2QA4T 1M2OA 4ME7A 1X2KA 2YUOA 4L6V5 1WJSA 3GIBA 2CP3A 2DL4A 2DILA 3A8HB 4FSXA 3V8KA 1MHNA 2QG9B 5GAOq 1KIKA 3META 3MJXA 2PUOB 2RQWA 1QVFS 2RHUA 2AHJB 1WHKA 1VQ9A 2EQMA 4XTUA 4KH0B 2COZA 1D1BA 3G4SA 3C12A 5KYXB 3OYYA 2O2OA 4FU6A 1AZEA 2JJ9A 3M0PA 3CCUQ 1Y7XA 3L2VA 2E3IA 3FC3A 4BE2A 2EIFA 2COYA 2XKOC 4EDUA 4M75E 4M4ZA 4XTYA 3ZL7C 2A36A 4BI8B 1YHQA 1EZZB 3J81E 2EJGA 1ZSZB 2P0QA 5GMKj 1WX6A 3N5BB 1HJDA 1R8OB 2BE7D 4L5GA 2FEIA 2LQKA 3OS5A 2LQWA 5FROA 1W4SA 4LDYA 2AK5A 3VS0A 1ABQA 2E10A 1K73R 4LD6A 1K0SA 1NPPA 3CCUT 1K73C 3VKIA 4Z02A 1VQ9Q 2MIOA 2LC4A 3IQLA 4GLMA 3G4SQ 2W10A 3SFMA 2FB7A 1K76A 2KGTA 2RJDA 3OYDA 3MO8A 3CPWA 1T3SA 2JNGA 2L3QA 4QQDA 1M2VA 4J9IA 1YITA 2X3WD 1P92A 1PKTA 4JDSA 2D6FA 1UJYA 1YHQQ 5GAOr 4GBQA 1OEBA 1UDLA 4M7AD 2K79A 4D8KA 2C0OA 1M1GA 1GFCA 1X2QA 1RAHB 1VQNQ 2QGGA 1I5LA 1MNDA 5GANd 3JB9F 1VQ9T 4J5YA 3P8HA 2DJZA 2D9TA 2O4XA 4NS5A 3G4ST 1U06A 3PNWC 1KK7A 3VU3C 2FVUA 5GAMf 3HTRA 4BDZA 2KDSA 4B6MA 4ZGDB 3RMSA 4C92A 5IHKA 1JU5C 4QQ6A 5I21A 5D6WA 4C8QB 1U5SA 2NLUA 3EG0A 4HCKA 1FMVA 2KT8A 4K11A 2LQ8A 5IN1A 1YHQT 1G3WA 1YCYA 3QUIA 2NUTA 2LJ3A 4DOWA 4PJOG 4DEYA 1VQNT 2CKKA 3U23A 5GAN2 3CC2A 3PIPA 4HT8A 3V7SA 5CCAA 1EFNA 4RG8A 1SF9A 2DLPA 2P0KA 5KYUB 3PTAA 2YSQA 3SHWA 5GMKm 1WLPB 4HVUA 1ZUYA 1IGQA 1TG0A 3OB9A 3PGGA 3NTHA 1SKUB 1GCQA 1ZBJA 2QQBA 3A98A 4M7AC 2QDLA 4M7DG 2LNHB 2L3RA 3OMGA 2HBWA 1GRIA 1YJWA 2ZPEB 3L2WA 1X27A 1Q86U 2JOYA 5HCKA 3RKWA 3PMIA 4ZN1A 2LMJA 3H0IA 3M0QA 5CVIA 3EGDB 3G1JA 3S3MA 1KJWA 1HYOA 2X4JA 4JZ3A 1BI3A 3M58A 2MWOA 2K3XA 3EFRA 1RLQC 2HZYA 2PUKB 2EQUA 3UF4A 4JS4A 5KE3A 4LUEA 1E6HA 3RNJA 2RJFA 1QVPA 2YDLA 1MMNA 1NM7A 5GMKl 4EMKA 2DE0X 1FMKA 2DTHA 1YJWQ 1D09B 3UPUA 2EYZA 5D6XA 2M0OA 1KQSA 1GXIE 3QPHA 3EGUA 5IHNA 3NGPA 4ZGEB 5GAMe 2V1RA 1OV3A 4CRIA 5CKFA 1TUCA 2RK2A 4RMOA 2OJ2A 3EHRA 2EYQA 2JN0A 2ZAEA 2K5FA 3MP1A 4MDXA 2PVOB 5GAN7 3FDRA 5CKHA 3CCQA 1RAAB 1H8KA 2EYWA 1OU9A 2FZKB 1M90R 1K8AU 1FYNA 2DXBA 1YJWT 1M90C 5KYXA 3CCMA 4ELYC 2HEQA 1Y71A 1M1KR 4CC4B 1M1KC 2KEAA 3MHXA 1VQ8T 2L2PA 3PE0A 4AMCA 1PD0A 3CC7A 2DX1A 1ZSZA 3ULRB 4BY6B 3GNFB 1ZA1B 1YI2A 2VKNA 3QZ5B 4NL3A 2E41A 3MPUB 2K5LA 2DKGA 3V7CA 1HSQA 2YUPA 4LE9A 5L23A 3CCQQ 1PSEA 1QCNA 2CS7A 3REAB 3VS4A 2QEXA 4FYWB 5EC7A 3CCMQ 3ER0A 2MMPA 4IUTA 4LN2A 3JB9G 3ZBDA 3O5ZA 1UGVA 3FLGA 2WACA 1HD3A 2FZGB 2BE9B 2XDDA 2CP0A 4C92G 4HXJA 3CC7Q 1OX8A 4PJMA 4KT0E 3CQTA 3VS7A 1YI2Q 3OYGA 4CC7A 4AFZC 3X20B 3CCQT 3OYAA 4LUDA 1YCSB 1W70A 3M55A 3V8JA 3RBBB 3HKSA 3INZA 3CCMT 1EIFA 2PZ1A 4N0AC 4C8QF 2KYBA 2RQTA 4BDYA 1CSKA 2F2VA 5A0DA 2QEXQ 1GBRA 1SPKA 4JPBW 4WTOB 4C8QA 3A8LB 3FIFA 3CXCA 3G6ET 1NE8A 4KGXB 3CC7T 4PLLA 1NBEB 2CUDA 1PRLC 3EFSA 2MYSA 1YI2T 2A0FB 1ZUKA 1M9SA 2QI2A 2RB6A 1K8AR 4UC4A 3HRUA 1K8AC 2DF6A 4PFPA 1Q82U 5IXFA 5KYUA 4QW2A 3E19A 5GAMh 5GANj 3VS1A 1QW1A 2YLCA 2P4TA 3EG3A 1WQWA 1JJ2A 2WSFE 1WXUA 5IHIA 5A0LA 4E47A 3HP9A 3H41A 2QQRA 2ROTA 2KXDA 5CAIA 1S72T 2X3XD 2BTTA 4E7LA 3OW2S 4IUUA 2DYIA 4DBFA 1G2BA 2HAXA 3SDZA 2LZ6B 3WVEB 3EGDA 3X25B 4AG1C 8ATCB 1TU0B 2RH2A 2A37A 2KBTA 4OB0B 3REBB 5FW9A 4KUDK 1T3LA 5L8RE 3EGXB 1B34B 1MV0B 4JRIA 2GNCA 4ANJA 1PSFA 4PJJA 2GFAA 2GBQA 1WJQA 2X4YA 1M5Q1 1R77A 4RTXA 2OTLQ 2HQXA 4Z88A 1WHJA 2DD4A 1U1TA 5KYYB 2ZPIB 2IVWA 1BB9A 4O5VA 1RUWA 4A4GA 4BE0A 3FRNA 1IHWA 2QXFA 1YWPA 2Y4YA 4C5EA 4QKUA 1GL5A 2RHXA 1OI1A 4WF2A 4DBHA 3SEMA 1X43A 2LT1A 2YRVA 2FG0A 3D7SB 3J80E 2NWMA 2EQKA 4C92E 2OTLT 2GTOA 2EYXA 1WA7A 2CH4A 3S6WA 3G7ZA 4M7AB 1RABB 4XU1A 2BUDA 3PT9A 1M27C 1IB8A 5IAYA 3TCJA 1VQ7A 1PKSA 1H3HA 4E7JA 2OTJA 1E7OA 1UFFA 1G5VA 1QQJA 1QVFP 5KH6A 2L3SA 2A08A 2KNBB 3L42A 2DM1A 3QSUA 4RTYA 2GCXA 2PTKA 5GAN5 4PLIA 2BZYA 1I4K1 1I81A 2CP6A 3GPLA 4QVCA 2SEMA 3E2UA 2CH4W 3H8ZA 3JCMP 3QJYA 1VQ7Q 3RERA 2OTJQ 2MF2A 2VXFA 5GAMd 2XU8A 1DJ7B 2F5TX 2K57A 4C8QG 2KQWA 1RAFB 4M78E 1GCPA 3LYIA 3LLRA 3I56A 2CT3A 3DB4A 4M7DD 2JUFA 4OMFB 3UT1A 4M78B 3M0SA 2CZ6B 2DO3A 2KVQG 2LT4A 3QBYA 5GMKi 3QHSA 3BDLA 1IO6A 2RJEA 2BZ8A 1VQ7T 1ABOA 4IIOA 2BIVA 3CC4A 3MEUA 3CMEA 2OTJT 1F1BB 2M0YA 1VYTA 2QK0A 3O8VA 4MZPA 3GP8A 2B8AA 4A4KA 3H0HA 4ELZC 1Q81R 2DXUA 1VQ6A 4Y91A 1Q81C 5GAOn 4AT1B 4C5IA 4ZN3A 2JM9A 2ABLA 1PWTA 1Y07A 4J6XA 1AVZC 3QWYA 3I56Q 2MAMA 5I11A 2QTXA 3HHTB 1JB0E 4ORZA 1UEBA 4MZTA 1M4ZA 2EJ9A 4FCYA 2J05A 1T0HA 1R0BG 3M5AA 2FYKA 3EHQA 1XNIA 1BIBA 2CDTA 3TSWA 4LDWA 2A7YA 3I35A 3OYJA 4M7DC 3CC4Q 3VV0A 3CMEQ 3GNGA 2VGMA 2ENMA 2DL8A 2F69A 1FWZA 3JCMV 1FX7A 1VUBA 1N9RA 3H9NA 2EGAA 1UGRB 1N6AA 3I56T 5J39A 1VQ6Q 1VQNA 2LX7A 3LWIA 4BE1A 2PVDB 1B7TA 3QO3A 3I55A 4DOVA 3FB9A 3EGXA 1B34A 4PFOA 1IREB 1WIEA 4FW2A 1QWFA 2JXBA 1H92A 1C6VX 3CC4T 4M77G 3CMET 2RPNA 3GOXA 5LJ3d 4RTWA 2JM8A 2RQVA 2KI7A 5DM7R 3VUZA 2E1HA 5KYYA 1PD1A 1VQ6T 4QQGA 5DLOA 3S3NA 3A5ZB 4JLIA 3NTKA 3A8OB 2V8IA 5KCOA 1BKBA 3MEAA 3L1AA 5CQYA 2IIMA 4E6RA 5FRNA 1EX4A 5CKDA 5DY9A 4F7UE 3OYLA 3I55Q 2DMOA 1TUDA 1TWBA 3JB9D 4C92F 4C8QE 4KH1B 4F7UB 1OPLA 1KD1U 4M7AA 4J9GA 2KE9A 1VQKA 1S1NA 2CP5A 2KRNA 4GY5A 4RG2A 3QIIA 4MMLA 1YBYA 2JS2A 2HBPA 3OBWA 2KAFA 1V1CA 2M1HA 2B86A 3EH1A 3X24B 3QDFA 2RK1A 1N9SA 2I0NA 2LP5A 1LNXA 1X6OA 3I55T 1W6XA 1UHCA 1B07A 1CKBA 3QYGB 3TQ7P 2FRWA 2LVMA 3M59A 1Y0MA 4LDVA 2YHTA 2GF7A 1VIFA 1OU8A 1MNEA 4HT9A 1W1FA 3KUFA 2KRSA 2W0ZA 4E7HA 1VQKQ 3I9QA 1PHTA 1XJWB 5LJ5d 2VVKA 2QQAA 1AEYA 1VQ8A 2ZPFB 2O01E 1NEGA 2RQUA 4J7FA 3FEOA 3V7RA 2AZVA 3JCMJ 1ZUUA 1K9MU 1VYVA 2RM4A 4M78F 5C0MA 1IRXA 1I07A 2E12A 5GANg 4M78A 2HQEA 1BBZA 3M0TA 1RADB 2A28A 3J7AF 4RTTA 3JB9H 2F1LA 5J3BA 1VQKT 4D8DA 1JBMA 2P84A 3OMCA 1GFDA 2WSCE 2Z0WA 3M54A 3VS5A 2RA2A 3VJPA 4M77E 1VQ8Q 3M56A 5GAOp 2LCLA 4F04B 2DL7A 4M77B 5EG2A 5GAMj 5LJ3f 1JXMA 4JJBA 2MK5A 3OYNA 5FU6C 1RI9A 2L89A 4XU2A 4C0ZA 4DBQA 2DBMA 3DB3A 2XD0A 2X35A 2DRMA 2HSPA 3MP8A 3JCMf 1OYXA 3S3OA 5ECAA 1VIEA 1X01A 2FHDA 2E3HA 2P4RA 2QQ9A 2EQJA 3VS3A 3HL8A 4HVVA 4C5GA 2YLBA 4OMLA 4Y28E 5I2SA 1M8MA 1AT1B 1QMCA 3THKA 2EKOA 3G6EA 2LX9A 3GF5A 1BK2A 3MKDA 2DVJA 4J9DA 2D0QB 3EFOB 4M75D 4A4EA 4RCCA 2K9GA 4JLGA 3TREA 4R55A 4X9CA 3M4GA 3LH5A 5C6SA 2DA9A 2YUNA 1Q86R 3VS2A 4FYXB 2DL3A 3UA6A 1Q86C 4LD9K 4Q5WA 2CP7A 4N0AA 4VUBA 2CYZB 2O31A 1QCOA 2HCKA 2HKNA 1UHFA 3OW2P 3CBOA 4XQ3A 1D1AA 4RTUA 2DRKA 3MEVA 3A8MB 1Q95G 2L0AA 5KYNA 2R5MA 3G6EQ 1S72A 4M7AG 4AFQC 1RAEB 4E7IA 3CPWS 4ZNXA 1WGSA 1HK9A 4HA8A 4PK4A 1W2BP 3JCMb 2LCCA 2DK3A 3P8DA 3RUXA 2ATCB 2EJFA 1RAIB 3OS0A 5LJ5f 4F7UF 1BCMA 5KCHA 1LCKA 3G71T 2M51A 2EQIA 3SWNC 2M9UA 3PFSA 4F7UA 1PCXA 4M75C 2PVGB 3DKMA 1O9SA 5LJ3e 2FO0A 5KYWB 1JXOA 5CR2A 2JS0A 3CCLA 3TVTA 3C94A 3VRZA 5LL6S 3JCMe 2RHZA 4EMHA 2KRMA 2DAQA 1Q7YU 5HK3A 1S72Q 2DD5A 4FL6A 2F2XA 4XTWA 2KT1A 1BCOA 2L8DA 2HD0A 3JAME 1QVFA 2FRYA 1OQKA 4JZ4A 2K3BA 3VYHB 5KE2A 1XTDA 5A2QE 1PNJA 2OTLA 2DERA 1BI1A 1FMWA 1BI2A 2CZ1B 3PVLA 1AWWA 2OAWA 4XU3A 5HK0A 4M78G 2QDYB 3FJPA 2J06A 1X69A 3CCLQ 2M02A 3WVDB 3QZ9B 2J6KA 4OMOA 3TEEA 6AT1B 1ZQ1A 3CBMA 1TUGB 2RHYA 4J6YA 1N8RU 2RI3A 4J83A 2K2MA 4YTLA 4KGVB 2EPDA 4BI4A 4BD3A 1D3BB 3PMTA 4JS5A 2ZPGB 3JCMX 1W2BS 1T0JA 4R0KA 4PKCC 2JTFA 1M8VA 3LW5E 1M30A 3CCLT 4JJDA 1M3CA 1OULA 4F14A 5IXBA 2RNAA 2G6FX 5LJ5e 1WDXA 3VYGA 2PU9B 5D6YA 3JSCA 3M57A 1TH7A 1VQMA 3CCVT 2H3JA 1SRMA 1KHCA 2AZSA 4M77F 3VUBA 1QWEA 3T9NA 3EH2A 3JCMQ 1AWOA 2LRQA 4M77A 1OX9A 2GQVA 1KQSS 2G3RA 1G8XA 3VRYA 3JCMW 4II1A 4M7AE 4J9HA 3OYFA 5CK9A 2R57A 4OMMA 1U1SA 3GBQA 1NLPC 3OYKA 4JRKA 5I2MA 1Z9QA 3UDCA 4HVWA 3ME9A 1UUEA 2CZ0B 2HDAA 4RKUE 3OYHA 1Q82R 2QYZA 2NYSA 1X6BA 1Q82C 2YWWA 3JB9J 5IH2A 3OSVA 1VQMQ 5GJVB 1NZ9A 2FPDA 3EFOA 1PM3A 2L3PA 1WHLA 1LPLA 2ROLA 4IKFA 5IT9E 2D1XA 5LJ3h 1M3AA 2E70A 1BI0A 1X6GA 2XIDA 4LDUA 3L2QA 3CEYA 3M4YA 3M53A 1QVGP 3JCMh 2KSSA 3QKJA 2EKHA 2SRCA 4A4HA 2DIGA 4PJOD 1G83A 2EGEA 2L5QA 1UE9A 1JO8A 3I5SA 1MMGA 2K2VA 3SD4A 4PL6A 1OPKA 1Y96B 2E6ZA 2RMOA 2XI9A 2EFIA 3JB9I 1VQMT 3CD6A 1TTHB 1CKAA 4F7UG 1UB4A 3I5RA 1OZ3A 2D8JA 2AKKA 1VQLA 4B9WA 2XDBA 1O75A 4OMPA 2HQHA 1YJNA 1H641 2DTIA 4EPCA 2DPPB 1KFZA 8AT1B 1SG5A 2E65A 3QYHB 1K73U 3GLXA 1TS9A 3HFOA 3URGA 4Z8AA 4A63B 2EGCA 1SHGA 2P0PA 3HFNA 2KROA 4XTZA 4LDXA 1YP5A 1N27A 5KYWA 2JVVA 1WHHA 1NYGA 4GLKA 5GJWB 2F5KA 5CIUA 3CD6Q 2YXYA 2DIQA 2D0NA 4PJOC 1KQ2A 3CXCS 1VQLQ 2YRDA 4FT2A 2XDPA 2PNIA 2XG8D 1YJNQ 2YT6A 2F2WA 3E9FA 4KGZB 5LJ5h 1K4US 1YN8A 2C0IA 4C0FA 4C0DC 1I0CA 3EG9B 4N4HA 1QVGS 2DVEA 1LJOA 3HRTA 4KULA 2KR3A 1RI0A 1WYXA 3CD6T 2O88A 1U3OA 2YRCA 3OS2A 2RO0A 1M1FA 2DEQA 1ZHIA 3M0UA 5GAMg 1VQLT 5GAN3 1SRLA 1JJ2S 2E5KA 3DLLA 1YJNT 3LX7A 3FJ5A 1NJIU 1IGUA 3JV3A 3C95A 1UECA 1I5OB 3CCSA 3L2RA 1KC8U 2X4XA 2EYYA 1MMAA 2FZCB 5GMKe 1D3BA 3QDRB 3V8LA 3SWNB 2K4YA 2D8HA 4M75B 2J6OA 1D0ZA 1U8RA 1XQHA 3BFMA 3MP6A 5FU7C 2DZ9A 3UWNA 1RACB 5FWBA 1AOJA 1OZ2A 2DYBA 4ZTJA 4E7SA 4F16A 2ECZA 4XTXA 3DLMA 4PNOA 3JCMd 2EAYA 3VS6A 4IUVA 1YIJA 3LGFA 3OQ5A 1D0XA 5AYFA 3L2ZA 1VQOA 1RLPC 4J9BA 1PRMC 2VWFA 3OBYA 1YFNA 2DETA 1NYFA 4J9CA 2I2LA 3PVQA 2GFUA 2QGFB 2E6NA 3CCSQ 4KUIA 2K6DA 3LGLA 4M7AF 2FPFA 2DFUA 4WCIA 4J7IA 2ZPBB 4C92D 3NTIA 4P5NA 3RKXA 4FSSA 3BW1A 2KYMA 1WZOA 1R0CB 2MPXC 3TSZA 3OYEA 3JRZA 3CCJA 1C0MA 4RCBA 1NEBA 4QT7A 3RKYA 5FLXE 2OAUA 2EVRA 4KBMB 4TVRA 4OP0A 4D6WA 2O9VA 2V1QA 4N4IA 1WXTA 1YIJQ 4FIBA 1J3TA 5M9OA 2IPOB 3QJ6A 3CCST 1VQOQ 4C0GA 2E64A 1MUZA 1I1JA 4RTZA 3X28B 4HKEA 1M90U 1WPYA 1YITQ 2PQWA 2DTOA 1M1KU 2X4WA 1G3YA 4XK8E 5LJ3g 2JW4A 1TXQA 1NJIR 1WHGA 3P8BB 4BACA 2R5AA 3CCJQ 1NJIC 1Y96A 5GAN6 3H0FA 1YIJT 1A0NB 3JCMg 1KC8R 1VQOT 2ZZDA 1KC8C 3OW2A 2XHCA 5FRMA 4C92C 2MCNA 1Z9ZA 4ESRA 1KG1A 1FXXA 4OGEA 3RESA 2LJ0A 3JCMc 1UJ0A 2HMAA 1TOVA 3F70A 4IUPA 2ED0A 1D1CA 1YITT 1SEMA 4M78D 2HSEB 3R6OA 2CREA 3C0CA 3OS1A 1JEGA 1SSFA 1W2BA 4RTVA 2R58A 4OB3B 2V26A 3CCJT 4A4FA 2ZCFB 3R6NA 3SB2A 3CC2Q 4HCZA 4BI3A 3MCAB 1LVKA 3BDUA 3BE3A 1UGQB 2E4HA 4JJNK 1M3BA 1K9AA 2VV5A 3CPWP 5GMKh 1ZX6A 3TU4K 1RAGB 3M9QA 4OB1B 1GCQC 4V2SA 7AT1B 2Y4XA 2KK4A 2CSIA 1KD1R 1WJRA 4CC3A 1WXBA 4HCCA 1YWOA 4IURA 1KD1C 3ZFJA 3UA7A 1WQ7A 5GAN4 1AZGB 1QLYA 2LQNA 2BKDN 4X34A 3CC2T 1AD5A 2DZCA 3G71A 3CCEA 3EG9A 3QWXX 2JTMA 4LNPA 4OVAA 4AFSC 4J8OA 2EBPA 4MZMA 2FL7A 2RJCA 5LJ5g 4M78C 1BIAA 2JMAA 4CC2A 2DXCA 4OMNA 3LWHA 4PJNA 2LCSA 1JRIA 2NUPB 3NFCA 4XAXB 4NOYA 1XOVA 4EMKC 4FYYB 5GANf 2K5IA 4C5HA 4M75F 4E7KA 2AIRB 2RI2A 4Z89A 1VQ5A 2KXCA 3SWNA 3OA6A 2DBKA 4M75A 1K1ZA 1V76A 3G71Q 3CCEQ 1MMDA 3KXTA 1K9MR 4JUVA 4B9XA 1K9MC 3CPFA 2RHIA 4PJOE 2DNUA 2QASA 1YJ9A 5CKBA 5CO7A 2NUZA 4PJOB 4J9EA 2J6FA 4FT4A 4R56A 3KBGA 3RMQA 2DXTA 1VQPA 1GBQA 3OYIA 2ZGWA 3EAEA 4ZTFA 1SHFA 3OYMA 3AHUA 4C0DB 3OYCA 3CCET 1UGPB 2WSEE 4BB7A 4M7DE 3HSBA 1VQ5Q 1ZSZC 1E6GA 3HPWA 4OGCA 2RD1A 4M7DB 4C8QD 2Y90A 4N4GA 2YUQA 3UATA 5LJ3j 1N5ZA 1VA7A 2ED1A 4BUGA 1YJ9Q 1K0XA 2C0TA 1KQSP 3CCVA 3A8GB 1G3TA 2AT1B 2EW3A 4AG2C 1ZA2B 2K3YA 5J26A 4QVDA 1UTIA 1Y57A 3CBPA 1B3QA 4RUGA 1VQPQ 1VQ5T 3EG2A 4DEXA 2A3LA 1NG2A 2MOXA 4X9DA 1QKWA 4OB2B 4A53A 4LXCA 2DL5A 2X51A 5CKEA 4ATOA 5FU7B 4O6JA 3NMZC 5HKCA 2HNIA 1NPRA 4PJLA 4X1VA 2AKLA 1QVGA 5GAOm 1VOMA 1ACMB 5GANe 2JT4A 1YJ9T 2VXEA 5FWCA 4JJCA 1OOTA 1HXDA 2OI3A 5DLQE 1JQQA 3NHNA 2QEXT 1QKXA 3MEWA 2GGRA 3CMAA 1IZ6A 1VQPT 2RI5A 3CCVQ 4A54A 5GAN8 4MDWA 4C8QC 2HL5C 1WFWA 1BYMA 3E1SA 3E9GA 2IG0A 3NPFA 2H8HA 4E7ZA 2CT4A 2ZPHB 1VQ4A 2QAZA 3LH0A 4J9FA 1UGSB 1QP2A 3M0RA 4Y92A 4OF1A 1PG5B 5A0GA 1IHVA 2VUBA 4QVZA 1YNZA 2OX7A 3QG1A 1QCFA 2K7AA 1ZLMA 2CP2A 9ATCB 2JMCA 3EG1A 2RN8A 4FYVB 5D7UA 1ZBXA 1X75C 5GAOl 5LJ5j 1V29B 2GQIA 3HRSA 2CZ7B 1TSFA 4M77D 3CMAQ 2VASA 1RL2A 4ZGJB 4XU0A 3ZEHA 1M2VB 2XK0A 3L2UA 2DJQA 3RIRA 2VC8A 2DEUA 4NL2A 1VQ4Q 4HCBA 1Q7YR 1LOJA 2VYTA 3C4SA 1Q7YC 1WNLA 1KQ1A 2RF0A 1VYUA 3X26B 4IIMA 1H3ZA 1Q81U 5HY6A 4JRPA 2J7IA 2ESWA 2O4XB 1KHIA 5CQXA 4MMKA 3CCRA 4M75G 1AHJB 3CXCP 1QP3A 2QQSA 4J6WA 2RQRA 4FM4B 3CMAT 2KY9A 4C92B 1I8FA 2H3EB 2JTEA 1UG1A 1NLOC 2NUPA 3BY7A 1C1AA 4XTVA 4F17A 4EIKA 2CGHA 2QA4A 1ARKA 2NUTB 1VQ4T 3QXEB 2E5QA 1MGQA 3A1PA 3ASKA 2JZ2A 1G3SA 4OMQA 4DA4A 1WHMA 4PFZA 1SSHA 3OSSC 3OY9A 4M77C 2LNVA 3RDVA 1N8RR 2XICA 1KSWA 4CI0C 1JJ2P 1N8RC 3RR6A 4E2FB 1ZSGA 2LJ1A 2LTOA 1AWJA 4PJOF 2HKQB 2HL3A 3CCRQ 2LDMA 4FW1A 4PJOA 1IXDA 2CUBA 2BZXA 1MV3A 5FU6B 2EWNA 4IUQA 2M16A 5GANh 2GTJA 5I22A 2QTVA 2MWPA 2QA4Q 2V8JA 3H6ZA 4JRQA 3PIOA 4KRTA 2CSQA 1AWXA
chains in the Genus database with same CATH topology
4M7DF 2EKOA 4DQ2A 4RCBA 3SDZA 2LX9A 4BY6C 3G6EA 3GF5A 2C06A 3RKYA 5FLXE 2OAUA 3WVEB 4M7DA 4KBMB 2D0QB 3CCRT 4M75D 3X25B 2KMTA 4TVRA 4A4EA 4OP0A 2RH2A 4RCCA 3Q1JA 4JLGA 3TREA 4OB0B 4D6WA 4R55A 4X9CA 4EMGA 4N4IA 4KUDK 5L8RE 2V8KA 3M4GA 1B34B 4FIBA 4L59A 5M9OA 4JRIA 2MI6A 1PSFA 3QJ6A 3OYBA 5C6SA 4C0GA 3CCST 2E64A 2GFAA 2VGNA 3CCUA 1WJQA 2X4YA 3WXMB 4EMKB 1M5Q1 3X28B 4HKEA 1Q86C 2QA4T 4LD9K 2HQXA 4Q5WA 1M90U 1WPYA 4ME7A 4N0AA 4VUBA 2CYZB 4L6V5 1WJSA 2DD4A 1U1TA 3GIBA 2PQWA 2ZPIB 2IVWA 2DTOA 3A8HB 1M1KU 4FSXA 2X4WA 1G3YA 3CBOA 4XK8E 3V8KA 4O5VA 1MHNA 4A4GA 5LJ3g 1W2BS 4XQ3A 4BE0A 3FRNA 5GAOq 3MEVA 3A8MB 3P8BB 2QXFA 4BACA 2R5AA 2Y4YA 3META 4C5EA 1NJIC 1Y96A 5GAN6 2R5MA 4M7AG 1S72A 2PUOB 1QVFS 1YIJT 2RHXA 2RHUA 3JCMg 2AHJB 1OI1A 4WF2A 4E7IA 3CPWS 1VQOT 2ZZDA 1KC8C 1WGSA 2LT1A 1HK9A 4HA8A 2YRVA 3OW2A 2XHCA 1VQ9A 2EQMA 3JCMb 4XTUA 5FRMA 4C92C 3J80E 2EQKA 4C92E 2LCCA 2DK3A 2OTLT 3P8DA 3C12A 3RUXA 3G4SA 1FXXA 3OYYA 4OGEA 1KG1A 2EJFA 3RESA 4FU6A 3OS0A 3S6WA 3G7ZA 3JCMc 5LJ5f 4M7AB 4F7UF 3F70A 4IUPA 1Y7XA 1YITT 5KCHA 4M78D 3G71T 4XU1A 3R6OA 2BUDA 3PT9A 3SWNC 3L2VA 2M9UA 3FC3A 4BE2A 3CC4A 2EIFA 3PFSA 4F7UA 4EDUA 2XKOC 4M75C 3TCJA 5IAYA 2PVGB 1SSFA 4M75E 3OS1A 1VQ7A 1W2BA 4XTYA 3DKMA 1O9SA 4BI8B 5LJ3e 1YHQA 4E7JA 2OTJA 2R58A 4OB3B 5CR2A 3J81E 3CCJT 2EJGA 3CCLA 4A4FA 2P0QA 2ZCFB 3SB2A 3C94A 4HCZA 1G5VA 5GMKj 5LL6S 4BI3A 3MCAB 3JCMe 3N5BB 2RHZA 3BDUA 4EMHA 1UGQB 5KH6A 1R8OB 2DAQA 4JJNK 1Q7YU 4L5GA 2VV5A 3L42A 5HK3A 2LQKA 3OS5A 5FROA 5GMKh 1W4SA 4LDYA 3TU4K 2DD5A 3M9QA 2E10A 4FL6A 4OB1B 3QSUA 4LD6A 4V2SA 4XTWA 2GCXA 2Y4XA 1NPPA 2KK4A 3CCUT 1K73C 5GAN5 4PLIA 3VKIA 4Z02A 1WJRA 2L8DA 2LC4A 1I4K1 1I81A 2HD0A 3JAME 4HCCA 4IURA 1KD1C 1QVFA 3ZFJA 3GPLA 4QVCA 3VYHB 3SFMA 1WQ7A 5KE2A 1XTDA 5GAN4 2FB7A 5A2QE 3OYDA 2RJDA 3CPWA 3MO8A 2OTLA 3H8ZA 1BI1A 2BKDN 2JNGA 1BI2A 4X34A 2CZ1B 3CC2T 4QQDA 3JCMP 3QJYA 4XU3A 2DZCA 5HK0A 1YITA 3G71A 3CCEA 3RERA 4M78G 1P92A 4JDSA 2D6FA 2JTMA 2QDYB 3FJPA 5GAOr 4OVAA 2MF2A 2VXFA 4M7AD 5GAMd 2XU8A 3WVDB 3QZ9B 1M1GA 4J8OA 4MZMA 1DJ7B 3TEEA 2FL7A 2F5TX 2K57A 4C8QG 2RJCA 5LJ5g 4M78C 1BIAA 2KQWA 1ZQ1A 3CBMA 4M78E 3LYIA 1I5LA 3LLRA 5GANd 3I56A 3JB9F 2DXCA 1VQ9T 2RHYA 3LWHA 3DB4A 4M7DD 4J6YA 1N8RU 2JUFA 4J5YA 4OMFB 2RI3A 4M78B 3UT1A 3P8HA 2DJZA 2CZ6B 2D9TA 2DO3A 2KVQG 1JRIA 2O4XA 4J83A 2LT4A 4NS5A 3PNWC 3QBYA 4YTLA 3VU3C 2FVUA 5GAMf 3NFCA 4XAXB 4BDZA 2KDSA 5GMKi 4BI4A 3QHSA 4ZGDB 3BDLA 4BD3A 1D3BB 3PMTA 4NOYA 2ZPGB 3RMSA 4C92A 3JCMX 4JS5A 1XOVA 4QQ6A 4EMKC 5I21A 5D6WA 4C8QB 2RJEA 1VQ7T 5GANf 2NLUA 4PKCC 2K5IA 4C5HA 2JTFA 1M8VA 2BIVA 4M75F 4E7KA 2LQ8A 3LW5E 2RI2A 3MEUA 5IN1A 3CMEA 1YHQT 1G3WA 1VQ5A 2OTJT 3SWNA 3OA6A 3CCLT 1YCYA 3QUIA 4M75A 3O8VA 4MZPA 4DOWA 3GP8A 2B8AA 4PJOG 4A4KA 1VQNT 4ELZC 2CKKA 5GAN2 3CC2A 5LJ5e 3KXTA 3PIPA 2DXUA 3V7SA 4HT8A 3VYGA 1VQ6A 4Y91A 2PU9B 4JUVA 5D6YA 3JSCA 3M57A 4C5IA 4ZN3A 1TH7A 4B9XA 5GAOn 1Q81C 5CCAA 1VQMA 1K9MC 3CCVT 3CPFA 2RHIA 4PJOE 2H3JA 4RG8A 1YJ9A 1KHCA 4M77F 1Y07A 4J6XA 2P0KA 5CKBA 5CO7A 3T9NA 3VUBA 3PTAA 5GMKm 1YJWT 3JCMQ 4PJOB 2MAMA 2QTXA 2LRQA 3HHTB 4M77A 2GQVA 1KQSS 1JB0E 3OB9A 1UEBA 2G3RA 3NTHA 3PGGA 4MZTA 3JCMW 1M4ZA 4FT4A 2EJ9A 4II1A 2QQBA 3OYEA 4R56A 3KBGA 3M5AA 3RMQA 4M7AC 4M7DG 2DXTA 4M7AE 1VQPA 2L3RA 3OMGA 2FYKA 1XNIA 3OYFA 1BIBA 2ZGWA 2ZPEB 3OYIA 3L2WA 1YJWA 3EAEA 5CK9A 2R57A 4ZTFA 1U1SA 4LDWA 3OYMA 2A7YA 2JOYA 3RKWA 4C0DB 1Q86U 3AHUA 3OYKA 3OYCA 4JRKA 3CCET 1UGPB 3OYJA 2WSEE 3PMIA 5I2MA 4BB7A 4M7DC 4M7DE 3VV0A 3HSBA 3GNGA 2VGMA 3UDCA 4ZN1A 2F69A 3ME9A 1FWZA 3HPWA 4OGCA 3JCMV 2RD1A 4M7DB 4C8QD 1FX7A 1VUBA 2CZ0B 2Y90A 4RKUE 4N4GA 5CVIA 1N9RA 3OYHA 1UGRB 3S3MA 1N6AA 3I56T 5J39A 2X4JA 1Q82C 1VQNA 5LJ3j 1BI3A 3JB9J 3M58A 3OSVA 3LWIA 1NZ9A 2MWOA 2K3XA 3EFRA 4BE1A 4BUGA 2PUKB 2PVDB 3QO3A 3I55A 2EQUA 4IKFA 4Y28E 4JS4A 5IT9E 3CCVA 5KE3A 3A8GB 5LJ3h 1G3TA 4DOVA 3FB9A 1B34A 1IREB 2E70A 1BI0A 2K3YA 5J26A 2XIDA 4LDUA 2RJFA 3CEYA 4QVDA 3L2QA 3CBPA 3M4YA 3M53A 1QVPA 3CC4T 4M77G 3CMET 3JCMh 5GMKl 1VQ5T 4EMKA 2KSSA 3GOXA 3QKJA 2DTHA 2A3LA 3UPUA 5LJ3d 4X9DA 4A4HA 5D6XA 2DIGA 2M0OA 1KQSA 4PJOD 2L5QA 3QPHA 4OB2B 4A53A 1GXIE 3G4ST 5CKEA 4ATOA 5FU7B 4ZGEB 5DM7R 2K2VA 5GAMe 3VUZA 2E1HA 4O6JA 4CRIA 3SD4A 4PL6A 5HKCA 1Y96B 2HNIA 1NPRA 5CKFA 1VQ6T 2E6ZA 4QQGA 2RK2A 4RMOA 1YJNT 2XI9A 5DLOA 2EFIA 3JB9I 1QVGA 5GAOm 1VQMT 2EYQA 3S3NA 3CD6A 4F7UG 5GANe 1YJ9T 1UB4A 2VXEA 3A5ZB 3NTKA 1OZ3A 2JN0A 3A8OB 2V8IA 4JLIA 5KCOA 2K5FA 1BKBA 3MEAA 1VQLA 3L1AA 3MP1A 1HXDA 5DLQE 4B9WA 2XDBA 5CQYA 1O75A 4MDXA 2PVOB 2QEXT 5FRNA 5GAN7 1YJNA 1H641 3FDRA 5CKHA 2DTIA 4EPCA 3CCQA 3MEWA 2DPPB 5CKDA 5DY9A 4F7UE 3OYLA 2E65A 3QYHB 3CMAA 1IZ6A 1VQPT 2RI5A 1K8AU 1K73U 3JB9D 3GLXA 4A54A 2DXBA 4C92F 4MDWA 4C8QC 3HFOA 5GAN8 3URGA 4C8QE 4F7UB 3CCMA 1M90C 4ELYC 1Y71A 3E1SA 3E9GA 1KD1U 2IG0A 1BYMA 4M7AA 1VQKA 1M1KC 3MHXA 2P0PA 1VQ8T 3HFNA 2ZPHB 1VQ4A 4GY5A 4RG2A 3QIIA 4XTZA 3LH0A 4LDXA 3CC7A 1UGSB 1QP2A 4MMLA 1N27A 4OF1A 1YBYA 5A0GA 2HBPA 2JVVA 2VUBA 3OBWA 4QVZA 4GLKA 4BY6B 3GNFB 2KAFA 3QG1A 1YI2A 2M1HA 3X24B 3QZ5B 2F5KA 2RK1A 4NL3A 5CIUA 2E41A 1N9SA 2DIQA 1LNXA 2K5LA 1X6OA 3I55T 2DKGA 4PJOC 1KQ2A 3V7CA 3CXCS 3QYGB 4FT2A 1ZBXA 1X75C 2XDPA 5GAOl 5LJ5j 2XG8D 1PSEA 1V29B 2CS7A 2LVMA 3HRSA 3M59A 2CZ7B 4M77D 4LDVA 2QEXA 2YHTA 2GF7A 1VIFA 1RL2A 3E9FA 4XU0A 4ZGJB 3ZEHA 5LJ5h 4HT9A 3KUFA 2XK0A 4C0FA 3L2UA 3RIRA 3ER0A 4C0DC 2VC8A 2MMPA 4IUTA 4E7HA 3JB9G 4N4HA 1QVGS 3ZBDA 4NL2A 2DVEA 1LJOA 3HRTA 3FLGA 2WACA 4HCBA 4KULA 2XDDA 4C92G 5LJ5d 1RI0A 1LOJA 2QQAA 2VYTA 1VQ8A 3CD6T 2ZPFB 3C4SA 1Q7YC 2O01E 4KT0E 3OS2A 2RO0A 4J7FA 1M1FA 1WNLA 1KQ1A 2DEQA 1ZHIA 3X26B 5GAMg 1VQLT 3FEOA 3V7RA 5GAN3 5HY6A 1Q81U 1JJ2S 3OYGA 4JRPA 1K9MU 1H3ZA 5CQXA 2O4XB 1KHIA 3DLLA 4MMKA 3LX7A 3CCRA 3X20B 3CCQT 4M75G 3OYAA 3JCMJ 1AHJB 2RM4A 4M78F 5C0MA 1QP3A 3M55A 2QQSA 3V8JA 1NJIU 4J6WA 4FM4B 2E12A 3CMAT 2KY9A 5GANg 4C92B 1I8FA 4M78A 3HKSA 3C95A 3INZA 3CCMT 3CCSA 2HQEA 3L2RA 1EIFA 1KC8U 2X4XA 4N0AC 4C8QF 4BDYA 3J7AF 3JB9H 5GMKe 1D3BA 3QDRB 3BY7A 5J3BA 3V8LA 5A0DA 4XTVA 1VQKT 3SWNB 4C8QA 3A8LB 2CGHA 2QA4A 2K4YA 1VQ4T 3FIFA 3QXEB 4M75B 3CXCA 3G6ET 1NE8A 1JBMA 1U8RA 2E5QA 3OMCA 4PLLA 3CC7T 1MGQA 1XQHA 2WSCE 3BFMA 3MP6A 3EFSA 5FU7C 3ASKA 2DZ9A 3UWNA 3M54A 2JZ2A 1G3SA 2HAXA 2RA2A 1OZ2A 4DA4A 1YI2T 3OSSC 4ZTJA 3OY9A 4M77C 3VJPA 2LNVA 4M77E 1M9SA 2XICA 2QI2A 2RB6A 3M56A 4XTXA 3DLMA 4PNOA 3JCMd 5GAOp 4CI0C 2EAYA 4UC4A 2LCLA 1N8RC 3HRUA 4IUVA 1YIJA 3LGFA 1K8AC 3OQ5A 4M77B 5EG2A 5GAMj 1Q82U 2LTOA 5AYFA 4PJOF 3L2ZA 5LJ3f 1VQOA 3OYNA 2LDMA 4QW2A 3OBYA 5FU6C 2L89A 4XU2A 2I2LA 4PJOA 4C0ZA 3E19A 3DB3A 2XD0A 2GFUA 2X35A 5GAMh 5GANj 1QW1A 2YLCA 3MP8A 2P4TA 3JCMf 1WQWA 2E6NA 5FU6B 1OYXA 3S3OA 1JJ2A 4KUIA 2WSFE 2EWNA 3LGLA 4IUQA 4M7AF 1VIEA 1X01A 5A0LA 2FHDA 2M16A 5GANh 4E47A 2QQ9A 3HP9A 2EQJA 4J7IA 2MWPA 2QQRA 2V8JA 2ZPBB 3HL8A 3H6ZA 4C92D 5CAIA 1S72T 4C5GA 3NTIA 2YLBA 4P5NA 3RKXA 4JRQA 3PIOA 4E7LA 3OW2S 3BW1A 4IUUA 5I2SA 3CCJA 3JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D F;  1I81 A;  2RD1 A;  4DQ2 A;  4M7D B;  4RCB A;  4C8Q D;  2Y90 A;  4M77 D;  3RKY A;  1N9R A;  2YHT A;  4QVC A;  4M7D A;  1WQ7 A;  4XU0 A;  5LJ5 h;  4HT9 A;  5GAN 4;  2FB7 A;  4M75 D;  5LJ3 j;  3RIR A;  4OP0 A;  3JB9 J;  4RCC A;  2VC8 A;  5GAN 8;  3EFR A;  3JCM P;  3JB9 G;  4X9C A;  4EMG A;  4NL2 A;  4XU3 A;  2DZC A;  3M4G A;  3QO3 A;  1B34 B;  3RER A;  4M78 G;  2DVE A;  4JRI A;  1LJO A;  5LJ3 h;  3FB9 A;  3FJP A;  2E64 A;  4C92 G;  1B34 A;  5GAO r;  4HT8 A;  5LJ5 d;  2VXF A;  4M7A D;  1LOJ A;  5GAM d;  4QVD A;  4EMK B;  1M5Q 1;  1WNL A;  2K57 A;  1KQ1 A;  2DEQ A;  4M77 G;  4M78 C;  1BIA A;  4C8Q G;  3JCM h;  5GMK l;  4M78 E;  1WPY A;  5LJ5 g;  5GAM g;  4EMK A;  4N0A A;  3V7R A;  5GAN 3;  1I5L A;  2DTH A;  3JB9 F;  5GAN d;  3JCM J;  1U1T A;  4MMK A;  5LJ3 d;  4X9D A;  4M7D D;  4M75 G;  4J6Y A;  3GIB A;  2RM4 A;  4PJO D;  4M78 F;  4J5Y A;  4A53 A;  4M78 B;  3V8J A;  2DTO A;  2DJZ A;  4J6W A;  1JRI A;  5GAN g;  3VU3 C;  3V8K A;  4C92 B;  1I8F A;  2E1H A;  5GAM e;  5GAM f;  5LJ3 g;  4XQ3 A;  4M78 A;  1Y96 B;  2HNI A;  5GMK i;  5GAO q;  3INZ A;  3QHS A;  1D3B B;  4NOY A;  4C92 A;  3JCM X;  3JB9 I;  4EMK C;  4N0A C;  4C8Q F;  5GAO m;  5I21 A;  1Y96 A;  4C8Q B;  5GAN 6;  3JB9 H;  4M7A G;  5GMK e;  1D3B A;  3V8L A;  3BY7 A;  4F7U G;  5GAN e;  2VXE A;  4XTV A;  3JCM g;  5GAN f;  4JLI A;  3SWN B;  2JN0 A;  4WF2 A;  4C8Q A;  2CGH A;  1M8V A;  4M75 F;  3FIF A;  4M75 B;  3L1A A;  1HXD A;  1JBM A;  1HK9 A;  4HA8 A;  3SWN A;  1MGQ A;  1YCY A;  3QUI A;  5GAN 7;  1H64 1;  4M75 A;  2DTI A;  3BFM A;  4XTU A;  3EFS A;  3JCM b;  4C92 C;  4PJO G;  2DZ9 A;  4C92 E;  5DY9 A;  4F7U E;  2E65 A;  3RUX A;  2RA2 A;  2EJF A;  3RES A;  5GAN 2;  3JB9 D;  3JCM c;  4A54 A;  5LJ5 e;  2DXU A;  3V7S A;  4C92 F;  4M7A B;  3HFO A;  4M77 C;  4JUV A;  4Y91 A;  4C8Q E;  4C8Q C;  4M77 E;  4F7U B;  4F7U F;  1TH7 A;  4M78 D;  5GAO n;  2RB6 A;  4XU1 A;  4XTX A;  3SWN C;  4PNO A;  3JCM d;  5GAO p;  4M7A A;  4PJO E;  2EAY A;  4F7U A;  4M75 C;  4M75 E;  4J6X A;  4M77 F;  4M77 B;  4XTY A;  3HFN A;  5GAM j;  5GMK m;  5LJ3 e;  4PJO F;  3L2Z A;  4XTZ A;  5LJ3 f;  3JCM Q;  4PJO B;  2QTX A;  4M77 A;  2EJG A;  3PGG A;  4MML A;  4XU2 A;  3JCM W;  3SB2 A;  2I2L A;  4PJO A;  2EJ9 A;  5GMK j;  5GAM h;  5GAN j;  4M7A C;  4M7D G;  2DXT A;  2YLC A;  3JCM e;  4M7A E;  3JCM f;  1WQW A;  3BDU A;  4EMH A;  2FYK A;  1BIB A;  2ZGW A;  2EWN A;  4NL3 A;  1U1S A;  4M7A F;  1X01 A;  1N9S A;  2E41 A;  5GMK h;  5GAN h;  3RKW A;  3AHU A;  1LNX A;  4JRK A;  5LJ5 f;  2DKG A;  2E10 A;  4M7D C;  3QSU A;  4PJO C;  4V2S A;  1KQ2 A;  3V7C A;  4M7D E;  3HSB A;  4XTW A;  4C92 D;  5CAI A;  2YLB A;  3RKX A;  5GAN 5;  3BW1 A;  5LJ5 j;  5GAO l;  3JCM V;  1I4K 1; 
#chains in the Genus database with same CATH topology
 4M7D F;  4DQ2 A;  2C06 A;  4BY6 C;  1BU1 A;  2FPE A;  4M7D A;  1WI7 A;  2O9S A;  3CCR T;  4DBR A;  2KMT A;  1D0Y A;  3Q1J A;  2XMF A;  4EMG A;  2V8K A;  2VB6 A;  4L59 A;  3KFV A;  2MI6 A;  2X9H A;  1PC0 A;  3OYB A;  2VGN A;  3CCU A;  4AFU C;  3AT1 B;  5AT1 B;  2COW A;  3WXM B;  4EMK B;  2QA4 T;  1M2O A;  4ME7 A;  1X2K A;  2YUO A;  4L6V 5;  1WJS A;  3GIB A;  2CP3 A;  2DL4 A;  2DIL A;  3A8H B;  4FSX A;  3V8K A;  1MHN A;  2QG9 B;  5GAO q;  1KIK A;  3MET A;  3MJX A;  2PUO B;  2RQW A;  1QVF S;  2RHU A;  2AHJ B;  1WHK A;  1VQ9 A;  2EQM A;  4XTU A;  4KH0 B;  2COZ A;  1D1B A;  3G4S A;  3C12 A;  5KYX B;  3OYY A;  2O2O A;  4FU6 A;  1AZE A;  2JJ9 A;  3M0P A;  3CCU Q;  1Y7X A;  3L2V A;  2E3I A;  3FC3 A;  4BE2 A;  2EIF A;  2COY A;  2XKO C;  4EDU A;  4M75 E;  4M4Z A;  4XTY A;  3ZL7 C;  2A36 A;  4BI8 B;  1YHQ A;  1EZZ B;  3J81 E;  2EJG A;  1ZSZ B;  2P0Q A;  5GMK j;  1WX6 A;  3N5B B;  1HJD A;  1R8O B;  2BE7 D;  4L5G A;  2FEI A;  2LQK A;  3OS5 A;  2LQW A;  5FRO A;  1W4S A;  4LDY A;  2AK5 A;  3VS0 A;  1ABQ A;  2E10 A;  1K73 R;  4LD6 A;  1K0S A;  1NPP A;  3CCU T;  1K73 C;  3VKI A;  4Z02 A;  1VQ9 Q;  2MIO A;  2LC4 A;  3IQL A;  4GLM A;  3G4S Q;  2W10 A;  3SFM A;  2FB7 A;  1K76 A;  2KGT A;  2RJD A;  3OYD A;  3MO8 A;  3CPW A;  1T3S A;  2JNG A;  2L3Q A;  4QQD A;  1M2V A;  4J9I A;  1YIT A;  2X3W D;  1P92 A;  1PKT A;  4JDS A;  2D6F A;  1UJY A;  1YHQ Q;  5GAO r;  4GBQ A;  1OEB A;  1UDL A;  4M7A D;  2K79 A;  4D8K A;  2C0O A;  1M1G A;  1GFC A;  1X2Q A;  1RAH B;  1VQN Q;  2QGG A;  1I5L A;  1MND A;  5GAN d;  3JB9 F;  1VQ9 T;  4J5Y A;  3P8H A;  2DJZ A;  2D9T A;  2O4X A;  4NS5 A;  3G4S T;  1U06 A;  3PNW C;  1KK7 A;  3VU3 C;  2FVU A;  5GAM f;  3HTR A;  4BDZ A;  2KDS A;  4B6M A;  4ZGD B;  3RMS A;  4C92 A;  5IHK A;  1JU5 C;  4QQ6 A;  5I21 A;  5D6W A;  4C8Q B;  1U5S A;  2NLU A;  3EG0 A;  4HCK A;  1FMV A;  2KT8 A;  4K11 A;  2LQ8 A;  5IN1 A;  1YHQ T;  1G3W A;  1YCY A;  3QUI A;  2NUT A;  2LJ3 A;  4DOW A;  4PJO G;  4DEY A;  1VQN T;  2CKK A;  3U23 A;  5GAN 2;  3CC2 A;  3PIP A;  4HT8 A;  3V7S A;  5CCA A;  1EFN A;  4RG8 A;  1SF9 A;  2DLP A;  2P0K A;  5KYU B;  3PTA A;  2YSQ A;  3SHW A;  5GMK m;  1WLP B;  4HVU A;  1ZUY A;  1IGQ A;  1TG0 A;  3OB9 A;  3PGG A;  3NTH A;  1SKU B;  1GCQ A;  1ZBJ A;  2QQB A;  3A98 A;  4M7A C;  2QDL A;  4M7D G;  2LNH B;  2L3R A;  3OMG A;  2HBW A;  1GRI A;  1YJW A;  2ZPE B;  3L2W A;  1X27 A;  1Q86 U;  2JOY A;  5HCK A;  3RKW A;  3PMI A;  4ZN1 A;  2LMJ A;  3H0I A;  3M0Q A;  5CVI A;  3EGD B;  3G1J A;  3S3M A;  1KJW A;  1HYO A;  2X4J A;  4JZ3 A;  1BI3 A;  3M58 A;  2MWO A;  2K3X A;  3EFR A;  1RLQ C;  2HZY A;  2PUK B;  2EQU A;  3UF4 A;  4JS4 A;  5KE3 A;  4LUE A;  1E6H A;  3RNJ A;  2RJF A;  1QVP A;  2YDL A;  1MMN A;  1NM7 A;  5GMK l;  4EMK A;  2DE0 X;  1FMK A;  2DTH A;  1YJW Q;  1D09 B;  3UPU A;  2EYZ A;  5D6X A;  2M0O A;  1KQS A;  1GXI E;  3QPH A;  3EGU A;  5IHN A;  3NGP A;  4ZGE B;  5GAM e;  2V1R A;  1OV3 A;  4CRI A;  5CKF A;  1TUC A;  2RK2 A;  4RMO A;  2OJ2 A;  3EHR A;  2EYQ A;  2JN0 A;  2ZAE A;  2K5F A;  3MP1 A;  4MDX A;  2PVO B;  5GAN 7;  3FDR A;  5CKH A;  3CCQ A;  1RAA B;  1H8K A;  2EYW A;  1OU9 A;  2FZK B;  1M90 R;  1K8A U;  1FYN A;  2DXB A;  1YJW T;  1M90 C;  5KYX A;  3CCM A;  4ELY C;  2HEQ A;  1Y71 A;  1M1K R;  4CC4 B;  1M1K C;  2KEA A;  3MHX A;  1VQ8 T;  2L2P A;  3PE0 A;  4AMC A;  1PD0 A;  3CC7 A;  2DX1 A;  1ZSZ A;  3ULR B;  4BY6 B;  3GNF B;  1ZA1 B;  1YI2 A;  2VKN A;  3QZ5 B;  4NL3 A;  2E41 A;  3MPU B;  2K5L A;  2DKG A;  3V7C A;  1HSQ A;  2YUP A;  4LE9 A;  5L23 A;  3CCQ Q;  1PSE A;  1QCN A;  2CS7 A;  3REA B;  3VS4 A;  2QEX A;  4FYW B;  5EC7 A;  3CCM Q;  3ER0 A;  2MMP A;  4IUT A;  4LN2 A;  3JB9 G;  3ZBD A;  3O5Z A;  1UGV A;  3FLG A;  2WAC A;  1HD3 A;  2FZG B;  2BE9 B;  2XDD A;  2CP0 A;  4C92 G;  4HXJ A;  3CC7 Q;  1OX8 A;  4PJM A;  4KT0 E;  3CQT A;  3VS7 A;  1YI2 Q;  3OYG A;  4CC7 A;  4AFZ C;  3X20 B;  3CCQ T;  3OYA A;  4LUD A;  1YCS B;  1W70 A;  3M55 A;  3V8J A;  3RBB B;  3HKS A;  3INZ A;  3CCM T;  1EIF A;  2PZ1 A;  4N0A C;  4C8Q F;  2KYB A;  2RQT A;  4BDY A;  1CSK A;  2F2V A;  5A0D A;  2QEX Q;  1GBR A;  1SPK A;  4JPB W;  4WTO B;  4C8Q A;  3A8L B;  3FIF A;  3CXC A;  3G6E T;  1NE8 A;  4KGX B;  3CC7 T;  4PLL A;  1NBE B;  2CUD A;  1PRL C;  3EFS A;  2MYS A;  1YI2 T;  2A0F B;  1ZUK A;  1M9S A;  2QI2 A;  2RB6 A;  1K8A R;  4UC4 A;  3HRU A;  1K8A C;  2DF6 A;  4PFP A;  1Q82 U;  5IXF A;  5KYU A;  4QW2 A;  3E19 A;  5GAM h;  5GAN j;  3VS1 A;  1QW1 A;  2YLC A;  2P4T A;  3EG3 A;  1WQW A;  1JJ2 A;  2WSF E;  1WXU A;  5IHI A;  5A0L A;  4E47 A;  3HP9 A;  3H41 A;  2QQR A;  2ROT A;  2KXD A;  5CAI A;  1S72 T;  2X3X D;  2BTT A;  4E7L A;  3OW2 S;  4IUU A;  2DYI A;  4DBF A;  1G2B A;  2HAX A;  3SDZ A;  2LZ6 B;  3WVE B;  3EGD A;  3X25 B;  4AG1 C;  8ATC B;  1TU0 B;  2RH2 A;  2A37 A;  2KBT A;  4OB0 B;  3REB B;  5FW9 A;  4KUD K;  1T3L A;  5L8R E;  3EGX B;  1B34 B;  1MV0 B;  4JRI A;  2GNC A;  4ANJ A;  1PSF A;  4PJJ A;  2GFA A;  2GBQ A;  1WJQ A;  2X4Y A;  1M5Q 1;  1R77 A;  4RTX A;  2OTL Q;  2HQX A;  4Z88 A;  1WHJ A;  2DD4 A;  1U1T A;  5KYY B;  2ZPI B;  2IVW A;  1BB9 A;  4O5V A;  1RUW A;  4A4G A;  4BE0 A;  3FRN A;  1IHW A;  2QXF A;  1YWP A;  2Y4Y A;  4C5E A;  4QKU A;  1GL5 A;  2RHX A;  1OI1 A;  4WF2 A;  4DBH A;  3SEM A;  1X43 A;  2LT1 A;  2YRV A;  2FG0 A;  3D7S B;  3J80 E;  2NWM A;  2EQK A;  4C92 E;  2OTL T;  2GTO A;  2EYX A;  1WA7 A;  2CH4 A;  3S6W A;  3G7Z A;  4M7A B;  1RAB B;  4XU1 A;  2BUD A;  3PT9 A;  1M27 C;  1IB8 A;  5IAY A;  3TCJ A;  1VQ7 A;  1PKS A;  1H3H A;  4E7J A;  2OTJ A;  1E7O A;  1UFF A;  1G5V A;  1QQJ A;  1QVF P;  5KH6 A;  2L3S A;  2A08 A;  2KNB B;  3L42 A;  2DM1 A;  3QSU A;  4RTY A;  2GCX A;  2PTK A;  5GAN 5;  4PLI A;  2BZY A;  1I4K 1;  1I81 A;  2CP6 A;  3GPL A;  4QVC A;  2SEM A;  3E2U A;  2CH4 W;  3H8Z A;  3JCM P;  3QJY A;  1VQ7 Q;  3RER A;  2OTJ Q;  2MF2 A;  2VXF A;  5GAM d;  2XU8 A;  1DJ7 B;  2F5T X;  2K57 A;  4C8Q G;  2KQW A;  1RAF B;  4M78 E;  1GCP A;  3LYI A;  3LLR A;  3I56 A;  2CT3 A;  3DB4 A;  4M7D D;  2JUF A;  4OMF B;  3UT1 A;  4M78 B;  3M0S A;  2CZ6 B;  2DO3 A;  2KVQ G;  2LT4 A;  3QBY A;  5GMK i;  3QHS A;  3BDL A;  1IO6 A;  2RJE A;  2BZ8 A;  1VQ7 T;  1ABO A;  4IIO A;  2BIV A;  3CC4 A;  3MEU A;  3CME A;  2OTJ T;  1F1B B;  2M0Y A;  1VYT A;  2QK0 A;  3O8V A;  4MZP A;  3GP8 A;  2B8A A;  4A4K A;  3H0H A;  4ELZ C;  1Q81 R;  2DXU A;  1VQ6 A;  4Y91 A;  1Q81 C;  5GAO n;  4AT1 B;  4C5I A;  4ZN3 A;  2JM9 A;  2ABL A;  1PWT A;  1Y07 A;  4J6X A;  1AVZ C;  3QWY A;  3I56 Q;  2MAM A;  5I11 A;  2QTX A;  3HHT B;  1JB0 E;  4ORZ A;  1UEB A;  4MZT A;  1M4Z A;  2EJ9 A;  4FCY A;  2J05 A;  1T0H A;  1R0B G;  3M5A A;  2FYK A;  3EHQ A;  1XNI A;  1BIB A;  2CDT A;  3TSW A;  4LDW A;  2A7Y A;  3I35 A;  3OYJ A;  4M7D C;  3CC4 Q;  3VV0 A;  3CME Q;  3GNG A;  2VGM A;  2ENM A;  2DL8 A;  2F69 A;  1FWZ A;  3JCM V;  1FX7 A;  1VUB A;  1N9R A;  3H9N A;  2EGA A;  1UGR B;  1N6A A;  3I56 T;  5J39 A;  1VQ6 Q;  1VQN A;  2LX7 A;  3LWI A;  4BE1 A;  2PVD B;  1B7T A;  3QO3 A;  3I55 A;  4DOV A;  3FB9 A;  3EGX A;  1B34 A;  4PFO A;  1IRE B;  1WIE A;  4FW2 A;  1QWF A;  2JXB A;  1H92 A;  1C6V X;  3CC4 T;  4M77 G;  3CME T;  2RPN A;  3GOX A;  5LJ3 d;  4RTW A;  2JM8 A;  2RQV A;  2KI7 A;  5DM7 R;  3VUZ A;  2E1H A;  5KYY A;  1PD1 A;  1VQ6 T;  4QQG A;  5DLO A;  3S3N A;  3A5Z B;  4JLI A;  3NTK A;  3A8O B;  2V8I A;  5KCO A;  1BKB A;  3MEA A;  3L1A A;  5CQY A;  2IIM A;  4E6R A;  5FRN A;  1EX4 A;  5CKD A;  5DY9 A;  4F7U E;  3OYL A;  3I55 Q;  2DMO A;  1TUD A;  1TWB A;  3JB9 D;  4C92 F;  4C8Q E;  4KH1 B;  4F7U B;  1OPL A;  1KD1 U;  4M7A A;  4J9G A;  2KE9 A;  1VQK A;  1S1N A;  2CP5 A;  2KRN A;  4GY5 A;  4RG2 A;  3QII A;  4MML A;  1YBY A;  2JS2 A;  2HBP A;  3OBW A;  2KAF A;  1V1C A;  2M1H A;  2B86 A;  3EH1 A;  3X24 B;  3QDF A;  2RK1 A;  1N9S A;  2I0N A;  2LP5 A;  1LNX A;  1X6O A;  3I55 T;  1W6X A;  1UHC A;  1B07 A;  1CKB A;  3QYG B;  3TQ7 P;  2FRW A;  2LVM A;  3M59 A;  1Y0M A;  4LDV A;  2YHT A;  2GF7 A;  1VIF A;  1OU8 A;  1MNE A;  4HT9 A;  1W1F A;  3KUF A;  2KRS A;  2W0Z A;  4E7H A;  1VQK Q;  3I9Q A;  1PHT A;  1XJW B;  5LJ5 d;  2VVK A;  2QQA A;  1AEY A;  1VQ8 A;  2ZPF B;  2O01 E;  1NEG A;  2RQU A;  4J7F A;  3FEO A;  3V7R A;  2AZV A;  3JCM J;  1ZUU A;  1K9M U;  1VYV A;  2RM4 A;  4M78 F;  5C0M A;  1IRX A;  1I07 A;  2E12 A;  5GAN g;  4M78 A;  2HQE A;  1BBZ A;  3M0T A;  1RAD B;  2A28 A;  3J7A F;  4RTT A;  3JB9 H;  2F1L A;  5J3B A;  1VQK T;  4D8D A;  1JBM A;  2P84 A;  3OMC A;  1GFD A;  2WSC E;  2Z0W A;  3M54 A;  3VS5 A;  2RA2 A;  3VJP A;  4M77 E;  1VQ8 Q;  3M56 A;  5GAO p;  2LCL A;  4F04 B;  2DL7 A;  4M77 B;  5EG2 A;  5GAM j;  5LJ3 f;  1JXM A;  4JJB A;  2MK5 A;  3OYN A;  5FU6 C;  1RI9 A;  2L89 A;  4XU2 A;  4C0Z A;  4DBQ A;  2DBM A;  3DB3 A;  2XD0 A;  2X35 A;  2DRM A;  2HSP A;  3MP8 A;  3JCM f;  1OYX A;  3S3O A;  5ECA A;  1VIE A;  1X01 A;  2FHD A;  2E3H A;  2P4R A;  2QQ9 A;  2EQJ A;  3VS3 A;  3HL8 A;  4HVV A;  4C5G A;  2YLB A;  4OML A;  4Y28 E;  5I2S A;  1M8M A;  1AT1 B;  1QMC A;  3THK A;  2EKO A;  3G6E A;  2LX9 A;  3GF5 A;  1BK2 A;  3MKD A;  2DVJ A;  4J9D A;  2D0Q B;  3EFO B;  4M75 D;  4A4E A;  4RCC A;  2K9G A;  4JLG A;  3TRE A;  4R55 A;  4X9C A;  3M4G A;  3LH5 A;  5C6S A;  2DA9 A;  2YUN A;  1Q86 R;  3VS2 A;  4FYX B;  2DL3 A;  3UA6 A;  1Q86 C;  4LD9 K;  4Q5W A;  2CP7 A;  4N0A A;  4VUB A;  2CYZ B;  2O31 A;  1QCO A;  2HCK A;  2HKN A;  1UHF A;  3OW2 P;  3CBO A;  4XQ3 A;  1D1A A;  4RTU A;  2DRK A;  3MEV A;  3A8M B;  1Q95 G;  2L0A A;  5KYN A;  2R5M A;  3G6E Q;  1S72 A;  4M7A G;  4AFQ C;  1RAE B;  4E7I A;  3CPW S;  4ZNX A;  1WGS A;  1HK9 A;  4HA8 A;  4PK4 A;  1W2B P;  3JCM b;  2LCC A;  2DK3 A;  3P8D A;  3RUX A;  2ATC B;  2EJF A;  1RAI B;  3OS0 A;  5LJ5 f;  4F7U F;  1BCM A;  5KCH A;  1LCK A;  3G71 T;  2M51 A;  2EQI A;  3SWN C;  2M9U A;  3PFS A;  4F7U A;  1PCX A;  4M75 C;  2PVG B;  3DKM A;  1O9S A;  5LJ3 e;  2FO0 A;  5KYW B;  1JXO A;  5CR2 A;  2JS0 A;  3CCL A;  3TVT A;  3C94 A;  3VRZ A;  5LL6 S;  3JCM e;  2RHZ A;  4EMH A;  2KRM A;  2DAQ A;  1Q7Y U;  5HK3 A;  1S72 Q;  2DD5 A;  4FL6 A;  2F2X A;  4XTW A;  2KT1 A;  1BCO A;  2L8D A;  2HD0 A;  3JAM E;  1QVF A;  2FRY A;  1OQK A;  4JZ4 A;  2K3B A;  3VYH B;  5KE2 A;  1XTD A;  5A2Q E;  1PNJ A;  2OTL A;  2DER A;  1BI1 A;  1FMW A;  1BI2 A;  2CZ1 B;  3PVL A;  1AWW A;  2OAW A;  4XU3 A;  5HK0 A;  4M78 G;  2QDY B;  3FJP A;  2J06 A;  1X69 A;  3CCL Q;  2M02 A;  3WVD B;  3QZ9 B;  2J6K A;  4OMO A;  3TEE A;  6AT1 B;  1ZQ1 A;  3CBM A;  1TUG B;  2RHY A;  4J6Y A;  1N8R U;  2RI3 A;  4J83 A;  2K2M A;  4YTL A;  4KGV B;  2EPD A;  4BI4 A;  4BD3 A;  1D3B B;  3PMT A;  4JS5 A;  2ZPG B;  3JCM X;  1W2B S;  1T0J A;  4R0K A;  4PKC C;  2JTF A;  1M8V A;  3LW5 E;  1M30 A;  3CCL T;  4JJD A;  1M3C A;  1OUL A;  4F14 A;  5IXB A;  2RNA A;  2G6F X;  5LJ5 e;  1WDX A;  3VYG A;  2PU9 B;  5D6Y A;  3JSC A;  3M57 A;  1TH7 A;  1VQM A;  3CCV T;  2H3J A;  1SRM A;  1KHC A;  2AZS A;  4M77 F;  3VUB A;  1QWE A;  3T9N A;  3EH2 A;  3JCM Q;  1AWO A;  2LRQ A;  4M77 A;  1OX9 A;  2GQV A;  1KQS S;  2G3R A;  1G8X A;  3VRY A;  3JCM W;  4II1 A;  4M7A E;  4J9H A;  3OYF A;  5CK9 A;  2R57 A;  4OMM A;  1U1S A;  3GBQ A;  1NLP C;  3OYK A;  4JRK A;  5I2M A;  1Z9Q A;  3UDC A;  4HVW A;  3ME9 A;  1UUE A;  2CZ0 B;  2HDA A;  4RKU E;  3OYH A;  1Q82 R;  2QYZ A;  2NYS A;  1X6B A;  1Q82 C;  2YWW A;  3JB9 J;  5IH2 A;  3OSV A;  1VQM Q;  5GJV B;  1NZ9 A;  2FPD A;  3EFO A;  1PM3 A;  2L3P A;  1WHL A;  1LPL A;  2ROL A;  4IKF A;  5IT9 E;  2D1X A;  5LJ3 h;  1M3A A;  2E70 A;  1BI0 A;  1X6G A;  2XID A;  4LDU A;  3L2Q A;  3CEY A;  3M4Y A;  3M53 A;  1QVG P;  3JCM h;  2KSS A;  3QKJ A;  2EKH A;  2SRC A;  4A4H A;  2DIG A;  4PJO D;  1G83 A;  2EGE A;  2L5Q A;  1UE9 A;  1JO8 A;  3I5S A;  1MMG A;  2K2V A;  3SD4 A;  4PL6 A;  1OPK A;  1Y96 B;  2E6Z A;  2RMO A;  2XI9 A;  2EFI A;  3JB9 I;  1VQM T;  3CD6 A;  1TTH B;  1CKA A;  4F7U G;  1UB4 A;  3I5R A;  1OZ3 A;  2D8J A;  2AKK A;  1VQL A;  4B9W A;  2XDB A;  1O75 A;  4OMP A;  2HQH A;  1YJN A;  1H64 1;  2DTI A;  4EPC A;  2DPP B;  1KFZ A;  8AT1 B;  1SG5 A;  2E65 A;  3QYH B;  1K73 U;  3GLX A;  1TS9 A;  3HFO A;  3URG A;  4Z8A A;  4A63 B;  2EGC A;  1SHG A;  2P0P A;  3HFN A;  2KRO A;  4XTZ A;  4LDX A;  1YP5 A;  1N27 A;  5KYW A;  2JVV A;  1WHH A;  1NYG A;  4GLK A;  5GJW B;  2F5K A;  5CIU A;  3CD6 Q;  2YXY A;  2DIQ A;  2D0N A;  4PJO C;  1KQ2 A;  3CXC S;  1VQL Q;  2YRD A;  4FT2 A;  2XDP A;  2PNI A;  2XG8 D;  1YJN Q;  2YT6 A;  2F2W A;  3E9F A;  4KGZ B;  5LJ5 h;  1K4U S;  1YN8 A;  2C0I A;  4C0F A;  4C0D C;  1I0C A;  3EG9 B;  4N4H A;  1QVG S;  2DVE A;  1LJO A;  3HRT A;  4KUL A;  2KR3 A;  1RI0 A;  1WYX A;  3CD6 T;  2O88 A;  1U3O A;  2YRC A;  3OS2 A;  2RO0 A;  1M1F A;  2DEQ A;  1ZHI A;  3M0U A;  5GAM g;  1VQL T;  5GAN 3;  1SRL A;  1JJ2 S;  2E5K A;  3DLL A;  1YJN T;  3LX7 A;  3FJ5 A;  1NJI U;  1IGU A;  3JV3 A;  3C95 A;  1UEC A;  1I5O B;  3CCS A;  3L2R A;  1KC8 U;  2X4X A;  2EYY A;  1MMA A;  2FZC B;  5GMK e;  1D3B A;  3QDR B;  3V8L A;  3SWN B;  2K4Y A;  2D8H A;  4M75 B;  2J6O A;  1D0Z A;  1U8R A;  1XQH A;  3BFM A;  3MP6 A;  5FU7 C;  2DZ9 A;  3UWN A;  1RAC B;  5FWB A;  1AOJ A;  1OZ2 A;  2DYB A;  4ZTJ A;  4E7S A;  4F16 A;  2ECZ A;  4XTX A;  3DLM A;  4PNO A;  3JCM d;  2EAY A;  3VS6 A;  4IUV A;  1YIJ A;  3LGF A;  3OQ5 A;  1D0X A;  5AYF A;  3L2Z A;  1VQO A;  1RLP C;  4J9B A;  1PRM C;  2VWF A;  3OBY A;  1YFN A;  2DET A;  1NYF A;  4J9C A;  2I2L A;  3PVQ A;  2GFU A;  2QGF B;  2E6N A;  3CCS Q;  4KUI A;  2K6D A;  3LGL A;  4M7A F;  2FPF A;  2DFU A;  4WCI A;  4J7I A;  2ZPB B;  4C92 D;  3NTI A;  4P5N A;  3RKX A;  4FSS A;  3BW1 A;  2KYM A;  1WZO A;  1R0C B;  2MPX C;  3TSZ A;  3OYE A;  3JRZ A;  3CCJ A;  1C0M A;  4RCB A;  1NEB A;  4QT7 A;  3RKY A;  5FLX E;  2OAU A;  2EVR A;  4KBM B;  4TVR A;  4OP0 A;  4D6W A;  2O9V A;  2V1Q A;  4N4I A;  1WXT A;  1YIJ Q;  4FIB A;  1J3T A;  5M9O A;  2IPO B;  3QJ6 A;  3CCS T;  1VQO Q;  4C0G A;  2E64 A;  1MUZ A;  1I1J A;  4RTZ A;  3X28 B;  4HKE A;  1M90 U;  1WPY A;  1YIT Q;  2PQW A;  2DTO A;  1M1K U;  2X4W A;  1G3Y A;  4XK8 E;  5LJ3 g;  2JW4 A;  1TXQ A;  1NJI R;  1WHG A;  3P8B B;  4BAC A;  2R5A A;  3CCJ Q;  1NJI C;  1Y96 A;  5GAN 6;  3H0F A;  1YIJ T;  1A0N B;  3JCM g;  1KC8 R;  1VQO T;  2ZZD A;  1KC8 C;  3OW2 A;  2XHC A;  5FRM A;  4C92 C;  2MCN A;  1Z9Z A;  4ESR A;  1KG1 A;  1FXX A;  4OGE A;  3RES A;  2LJ0 A;  3JCM c;  1UJ0 A;  2HMA A;  1TOV A;  3F70 A;  4IUP A;  2ED0 A;  1D1C A;  1YIT T;  1SEM A;  4M78 D;  2HSE B;  3R6O A;  2CRE A;  3C0C A;  3OS1 A;  1JEG A;  1SSF A;  1W2B A;  4RTV A;  2R58 A;  4OB3 B;  2V26 A;  3CCJ T;  4A4F A;  2ZCF B;  3R6N A;  3SB2 A;  3CC2 Q;  4HCZ A;  4BI3 A;  3MCA B;  1LVK A;  3BDU A;  3BE3 A;  1UGQ B;  2E4H A;  4JJN K;  1M3B A;  1K9A A;  2VV5 A;  3CPW P;  5GMK h;  1ZX6 A;  3TU4 K;  1RAG B;  3M9Q A;  4OB1 B;  1GCQ C;  4V2S A;  7AT1 B;  2Y4X A;  2KK4 A;  2CSI A;  1KD1 R;  1WJR A;  4CC3 A;  1WXB A;  4HCC A;  1YWO A;  4IUR A;  1KD1 C;  3ZFJ A;  3UA7 A;  1WQ7 A;  5GAN 4;  1AZG B;  1QLY A;  2LQN A;  2BKD N;  4X34 A;  3CC2 T;  1AD5 A;  2DZC A;  3G71 A;  3CCE A;  3EG9 A;  3QWX X;  2JTM A;  4LNP A;  4OVA A;  4AFS C;  4J8O A;  2EBP A;  4MZM A;  2FL7 A;  2RJC A;  5LJ5 g;  4M78 C;  1BIA A;  2JMA A;  4CC2 A;  2DXC A;  4OMN A;  3LWH A;  4PJN A;  2LCS A;  1JRI A;  2NUP B;  3NFC A;  4XAX B;  4NOY A;  1XOV A;  4EMK C;  4FYY B;  5GAN f;  2K5I A;  4C5H A;  4M75 F;  4E7K A;  2AIR B;  2RI2 A;  4Z89 A;  1VQ5 A;  2KXC A;  3SWN A;  3OA6 A;  2DBK A;  4M75 A;  1K1Z A;  1V76 A;  3G71 Q;  3CCE Q;  1MMD A;  3KXT A;  1K9M R;  4JUV A;  4B9X A;  1K9M C;  3CPF A;  2RHI A;  4PJO E;  2DNU A;  2QAS A;  1YJ9 A;  5CKB A;  5CO7 A;  2NUZ A;  4PJO B;  4J9E A;  2J6F A;  4FT4 A;  4R56 A;  3KBG A;  3RMQ A;  2DXT A;  1VQP A;  1GBQ A;  3OYI A;  2ZGW A;  3EAE A;  4ZTF A;  1SHF A;  3OYM A;  3AHU A;  4C0D B;  3OYC A;  3CCE T;  1UGP B;  2WSE E;  4BB7 A;  4M7D E;  3HSB A;  1VQ5 Q;  1ZSZ C;  1E6G A;  3HPW A;  4OGC A;  2RD1 A;  4M7D B;  4C8Q D;  2Y90 A;  4N4G A;  2YUQ A;  3UAT A;  5LJ3 j;  1N5Z A;  1VA7 A;  2ED1 A;  4BUG A;  1YJ9 Q;  1K0X A;  2C0T A;  1KQS P;  3CCV A;  3A8G B;  1G3T A;  2AT1 B;  2EW3 A;  4AG2 C;  1ZA2 B;  2K3Y A;  5J26 A;  4QVD A;  1UTI A;  1Y57 A;  3CBP A;  1B3Q A;  4RUG A;  1VQP Q;  1VQ5 T;  3EG2 A;  4DEX A;  2A3L A;  1NG2 A;  2MOX A;  4X9D A;  1QKW A;  4OB2 B;  4A53 A;  4LXC A;  2DL5 A;  2X51 A;  5CKE A;  4ATO A;  5FU7 B;  4O6J A;  3NMZ C;  5HKC A;  2HNI A;  1NPR A;  4PJL A;  4X1V A;  2AKL A;  1QVG A;  5GAO m;  1VOM A;  1ACM B;  5GAN e;  2JT4 A;  1YJ9 T;  2VXE A;  5FWC A;  4JJC A;  1OOT A;  1HXD A;  2OI3 A;  5DLQ E;  1JQQ A;  3NHN A;  2QEX T;  1QKX A;  3MEW A;  2GGR A;  3CMA A;  1IZ6 A;  1VQP T;  2RI5 A;  3CCV Q;  4A54 A;  5GAN 8;  4MDW A;  4C8Q C;  2HL5 C;  1WFW A;  1BYM A;  3E1S A;  3E9G A;  2IG0 A;  3NPF A;  2H8H A;  4E7Z A;  2CT4 A;  2ZPH B;  1VQ4 A;  2QAZ A;  3LH0 A;  4J9F A;  1UGS B;  1QP2 A;  3M0R A;  4Y92 A;  4OF1 A;  1PG5 B;  5A0G A;  1IHV A;  2VUB A;  4QVZ A;  1YNZ A;  2OX7 A;  3QG1 A;  1QCF A;  2K7A A;  1ZLM A;  2CP2 A;  9ATC B;  2JMC A;  3EG1 A;  2RN8 A;  4FYV B;  5D7U A;  1ZBX A;  1X75 C;  5GAO l;  5LJ5 j;  1V29 B;  2GQI A;  3HRS A;  2CZ7 B;  1TSF A;  4M77 D;  3CMA Q;  2VAS A;  1RL2 A;  4ZGJ B;  4XU0 A;  3ZEH A;  1M2V B;  2XK0 A;  3L2U A;  2DJQ A;  3RIR A;  2VC8 A;  2DEU A;  4NL2 A;  1VQ4 Q;  4HCB A;  1Q7Y R;  1LOJ A;  2VYT A;  3C4S A;  1Q7Y C;  1WNL A;  1KQ1 A;  2RF0 A;  1VYU A;  3X26 B;  4IIM A;  1H3Z A;  1Q81 U;  5HY6 A;  4JRP A;  2J7I A;  2ESW A;  2O4X B;  1KHI A;  5CQX A;  4MMK A;  3CCR A;  4M75 G;  1AHJ B;  3CXC P;  1QP3 A;  2QQS A;  4J6W A;  2RQR A;  4FM4 B;  3CMA T;  2KY9 A;  4C92 B;  1I8F A;  2H3E B;  2JTE A;  1UG1 A;  1NLO C;  2NUP A;  3BY7 A;  1C1A A;  4XTV A;  4F17 A;  4EIK A;  2CGH A;  2QA4 A;  1ARK A;  2NUT B;  1VQ4 T;  3QXE B;  2E5Q A;  1MGQ A;  3A1P A;  3ASK A;  2JZ2 A;  1G3S A;  4OMQ A;  4DA4 A;  1WHM A;  4PFZ A;  1SSH A;  3OSS C;  3OY9 A;  4M77 C;  2LNV A;  3RDV A;  1N8R R;  2XIC A;  1KSW A;  4CI0 C;  1JJ2 P;  1N8R C;  3RR6 A;  4E2F B;  1ZSG A;  2LJ1 A;  2LTO A;  1AWJ A;  4PJO F;  2HKQ B;  2HL3 A;  3CCR Q;  2LDM A;  4FW1 A;  4PJO A;  1IXD A;  2CUB A;  2BZX A;  1MV3 A;  5FU6 B;  2EWN A;  4IUQ A;  2M16 A;  5GAN h;  2GTJ A;  5I22 A;  2QTV A;  2MWP A;  2QA4 Q;  2V8J A;  3H6Z A;  4JRQ A;  3PIO A;  4KRT A;  2CSQ A;  1AWX A; 
#chains in the Genus database with same CATH homology
 4M7D F;  2EKO A;  4DQ2 A;  4RCB A;  3SDZ A;  2LX9 A;  4BY6 C;  3G6E A;  3GF5 A;  2C06 A;  3RKY A;  5FLX E;  2OAU A;  3WVE B;  4M7D A;  4KBM B;  2D0Q B;  3CCR T;  4M75 D;  3X25 B;  2KMT A;  4TVR A;  4A4E A;  4OP0 A;  2RH2 A;  4RCC A;  3Q1J A;  4JLG A;  3TRE A;  4OB0 B;  4D6W A;  4R55 A;  4X9C A;  4EMG A;  4N4I A;  4KUD K;  5L8R E;  2V8K A;  3M4G A;  1B34 B;  4FIB A;  4L59 A;  5M9O A;  4JRI A;  2MI6 A;  1PSF A;  3QJ6 A;  3OYB A;  5C6S A;  4C0G A;  3CCS T;  2E64 A;  2GFA A;  2VGN A;  3CCU A;  1WJQ A;  2X4Y A;  3WXM B;  4EMK B;  1M5Q 1;  3X28 B;  4HKE A;  1Q86 C;  2QA4 T;  4LD9 K;  2HQX A;  4Q5W A;  1M90 U;  1WPY A;  4ME7 A;  4N0A A;  4VUB A;  2CYZ B;  4L6V 5;  1WJS A;  2DD4 A;  1U1T A;  3GIB A;  2PQW A;  2ZPI B;  2IVW A;  2DTO A;  3A8H B;  1M1K U;  4FSX A;  2X4W A;  1G3Y A;  3CBO A;  4XK8 E;  3V8K A;  4O5V A;  1MHN A;  4A4G A;  5LJ3 g;  1W2B S;  4XQ3 A;  4BE0 A;  3FRN A;  5GAO q;  3MEV A;  3A8M B;  3P8B B;  2QXF A;  4BAC A;  2R5A A;  2Y4Y A;  3MET A;  4C5E A;  1NJI C;  1Y96 A;  5GAN 6;  2R5M A;  4M7A G;  1S72 A;  2PUO B;  1QVF S;  1YIJ T;  2RHX A;  2RHU A;  3JCM g;  2AHJ B;  1OI1 A;  4WF2 A;  4E7I A;  3CPW S;  1VQO T;  2ZZD A;  1KC8 C;  1WGS A;  2LT1 A;  1HK9 A;  4HA8 A;  2YRV A;  3OW2 A;  2XHC A;  1VQ9 A;  2EQM A;  3JCM b;  4XTU A;  5FRM A;  4C92 C;  3J80 E;  2EQK A;  4C92 E;  2LCC A;  2DK3 A;  2OTL T;  3P8D A;  3C12 A;  3RUX A;  3G4S A;  1FXX A;  3OYY A;  4OGE A;  1KG1 A;  2EJF A;  3RES A;  4FU6 A;  3OS0 A;  3S6W A;  3G7Z A;  3JCM c;  5LJ5 f;  4M7A B;  4F7U F;  3F70 A;  4IUP A;  1Y7X A;  1YIT T;  5KCH A;  4M78 D;  3G71 T;  4XU1 A;  3R6O A;  2BUD A;  3PT9 A;  3SWN C;  3L2V A;  2M9U A;  3FC3 A;  4BE2 A;  3CC4 A;  2EIF A;  3PFS A;  4F7U A;  4EDU A;  2XKO C;  4M75 C;  3TCJ A;  5IAY A;  2PVG B;  1SSF A;  4M75 E;  3OS1 A;  1VQ7 A;  1W2B A;  4XTY A;  3DKM A;  1O9S A;  4BI8 B;  5LJ3 e;  1YHQ A;  4E7J A;  2OTJ A;  2R58 A;  4OB3 B;  5CR2 A;  3J81 E;  3CCJ T;  2EJG A;  3CCL A;  4A4F A;  2P0Q A;  2ZCF B;  3SB2 A;  3C94 A;  4HCZ A;  1G5V A;  5GMK j;  5LL6 S;  4BI3 A;  3MCA B;  3JCM e;  3N5B B;  2RHZ A;  3BDU A;  4EMH A;  1UGQ B;  5KH6 A;  1R8O B;  2DAQ A;  4JJN K;  1Q7Y U;  4L5G A;  2VV5 A;  3L42 A;  5HK3 A;  2LQK A;  3OS5 A;  5FRO A;  5GMK h;  1W4S A;  4LDY A;  3TU4 K;  2DD5 A;  3M9Q A;  2E10 A;  4FL6 A;  4OB1 B;  3QSU A;  4LD6 A;  4V2S A;  4XTW A;  2GCX A;  2Y4X A;  1NPP A;  2KK4 A;  3CCU T;  1K73 C;  5GAN 5;  4PLI A;  3VKI A;  4Z02 A;  1WJR A;  2L8D A;  2LC4 A;  1I4K 1;  1I81 A;  2HD0 A;  3JAM E;  4HCC A;  4IUR A;  1KD1 C;  1QVF A;  3ZFJ A;  3GPL A;  4QVC A;  3VYH B;  3SFM A;  1WQ7 A;  5KE2 A;  1XTD A;  5GAN 4;  2FB7 A;  5A2Q E;  3OYD A;  2RJD A;  3CPW A;  3MO8 A;  2OTL A;  3H8Z A;  1BI1 A;  2BKD N;  2JNG A;  1BI2 A;  4X34 A;  2CZ1 B;  3CC2 T;  4QQD A;  3JCM P;  3QJY A;  4XU3 A;  2DZC A;  5HK0 A;  1YIT A;  3G71 A;  3CCE A;  3RER A;  4M78 G;  1P92 A;  4JDS A;  2D6F A;  2JTM A;  2QDY B;  3FJP A;  5GAO r;  4OVA A;  2MF2 A;  2VXF A;  4M7A D;  5GAM d;  2XU8 A;  3WVD B;  3QZ9 B;  1M1G A;  4J8O A;  4MZM A;  1DJ7 B;  3TEE A;  2FL7 A;  2F5T X;  2K57 A;  4C8Q G;  2RJC A;  5LJ5 g;  4M78 C;  1BIA A;  2KQW A;  1ZQ1 A;  3CBM A;  4M78 E;  3LYI A;  1I5L A;  3LLR A;  5GAN d;  3I56 A;  3JB9 F;  2DXC A;  1VQ9 T;  2RHY A;  3LWH A;  3DB4 A;  4M7D D;  4J6Y A;  1N8R U;  2JUF A;  4J5Y A;  4OMF B;  2RI3 A;  4M78 B;  3UT1 A;  3P8H A;  2DJZ A;  2CZ6 B;  2D9T A;  2DO3 A;  2KVQ G;  1JRI A;  2O4X A;  4J83 A;  2LT4 A;  4NS5 A;  3PNW C;  3QBY A;  4YTL A;  3VU3 C;  2FVU A;  5GAM f;  3NFC A;  4XAX B;  4BDZ A;  2KDS A;  5GMK i;  4BI4 A;  3QHS A;  4ZGD B;  3BDL A;  4BD3 A;  1D3B B;  3PMT A;  4NOY A;  2ZPG B;  3RMS A;  4C92 A;  3JCM X;  4JS5 A;  1XOV A;  4QQ6 A;  4EMK C;  5I21 A;  5D6W A;  4C8Q B;  2RJE A;  1VQ7 T;  5GAN f;  2NLU A;  4PKC C;  2K5I A;  4C5H A;  2JTF A;  1M8V A;  2BIV A;  4M75 F;  4E7K A;  2LQ8 A;  3LW5 E;  2RI2 A;  3MEU A;  5IN1 A;  3CME A;  1YHQ T;  1G3W A;  1VQ5 A;  2OTJ T;  3SWN A;  3OA6 A;  3CCL T;  1YCY A;  3QUI A;  4M75 A;  3O8V A;  4MZP A;  4DOW A;  3GP8 A;  2B8A A;  4PJO G;  4A4K A;  1VQN T;  4ELZ C;  2CKK A;  5GAN 2;  3CC2 A;  5LJ5 e;  3KXT A;  3PIP A;  2DXU A;  3V7S A;  4HT8 A;  3VYG A;  1VQ6 A;  4Y91 A;  2PU9 B;  4JUV A;  5D6Y A;  3JSC A;  3M57 A;  4C5I A;  4ZN3 A;  1TH7 A;  4B9X A;  5GAO n;  1Q81 C;  5CCA A;  1VQM A;  1K9M C;  3CCV T;  3CPF A;  2RHI A;  4PJO E;  2H3J A;  4RG8 A;  1YJ9 A;  1KHC A;  4M77 F;  1Y07 A;  4J6X A;  2P0K A;  5CKB A;  5CO7 A;  3T9N A;  3VUB A;  3PTA A;  5GMK m;  1YJW T;  3JCM Q;  4PJO B;  2MAM A;  2QTX A;  2LRQ A;  3HHT B;  4M77 A;  2GQV A;  1KQS S;  1JB0 E;  3OB9 A;  1UEB A;  2G3R A;  3NTH A;  3PGG A;  4MZT A;  3JCM W;  1M4Z A;  4FT4 A;  2EJ9 A;  4II1 A;  2QQB A;  3OYE A;  4R56 A;  3KBG A;  3M5A A;  3RMQ A;  4M7A C;  4M7D G;  2DXT A;  4M7A E;  1VQP A;  2L3R A;  3OMG A;  2FYK A;  1XNI A;  3OYF A;  1BIB A;  2ZGW A;  2ZPE B;  3OYI A;  3L2W A;  1YJW A;  3EAE A;  5CK9 A;  2R57 A;  4ZTF A;  1U1S A;  4LDW A;  3OYM A;  2A7Y A;  2JOY A;  3RKW A;  4C0D B;  1Q86 U;  3AHU A;  3OYK A;  3OYC A;  4JRK A;  3CCE T;  1UGP B;  3OYJ A;  2WSE E;  3PMI A;  5I2M A;  4BB7 A;  4M7D C;  4M7D E;  3VV0 A;  3HSB A;  3GNG A;  2VGM A;  3UDC A;  4ZN1 A;  2F69 A;  3ME9 A;  1FWZ A;  3HPW A;  4OGC A;  3JCM V;  2RD1 A;  4M7D B;  4C8Q D;  1FX7 A;  1VUB A;  2CZ0 B;  2Y90 A;  4RKU E;  4N4G A;  5CVI A;  1N9R A;  3OYH A;  1UGR B;  3S3M A;  1N6A A;  3I56 T;  5J39 A;  2X4J A;  1Q82 C;  1VQN A;  5LJ3 j;  1BI3 A;  3JB9 J;  3M58 A;  3OSV A;  3LWI A;  1NZ9 A;  2MWO A;  2K3X A;  3EFR A;  4BE1 A;  4BUG A;  2PUK B;  2PVD B;  3QO3 A;  3I55 A;  2EQU A;  4IKF A;  4Y28 E;  4JS4 A;  5IT9 E;  3CCV A;  5KE3 A;  3A8G B;  5LJ3 h;  1G3T A;  4DOV A;  3FB9 A;  1B34 A;  1IRE B;  2E70 A;  1BI0 A;  2K3Y A;  5J26 A;  2XID A;  4LDU A;  2RJF A;  3CEY A;  4QVD A;  3L2Q A;  3CBP A;  3M4Y A;  3M53 A;  1QVP A;  3CC4 T;  4M77 G;  3CME T;  3JCM h;  5GMK l;  1VQ5 T;  4EMK A;  2KSS A;  3GOX A;  3QKJ A;  2DTH A;  2A3L A;  3UPU A;  5LJ3 d;  4X9D A;  4A4H A;  5D6X A;  2DIG A;  2M0O A;  1KQS A;  4PJO D;  2L5Q A;  3QPH A;  4OB2 B;  4A53 A;  1GXI E;  3G4S T;  5CKE A;  4ATO A;  5FU7 B;  4ZGE B;  5DM7 R;  2K2V A;  5GAM e;  3VUZ A;  2E1H A;  4O6J A;  4CRI A;  3SD4 A;  4PL6 A;  5HKC A;  1Y96 B;  2HNI A;  1NPR A;  5CKF A;  1VQ6 T;  2E6Z A;  4QQG A;  2RK2 A;  4RMO A;  1YJN T;  2XI9 A;  5DLO A;  2EFI A;  3JB9 I;  1QVG A;  5GAO m;  1VQM T;  2EYQ A;  3S3N A;  3CD6 A;  4F7U G;  5GAN e;  1YJ9 T;  1UB4 A;  2VXE A;  3A5Z B;  3NTK A;  1OZ3 A;  2JN0 A;  3A8O B;  2V8I A;  4JLI A;  5KCO A;  2K5F A;  1BKB A;  3MEA A;  1VQL A;  3L1A A;  3MP1 A;  1HXD A;  5DLQ E;  4B9W A;  2XDB A;  5CQY A;  1O75 A;  4MDX A;  2PVO B;  2QEX T;  5FRN A;  5GAN 7;  1YJN A;  1H64 1;  3FDR A;  5CKH A;  2DTI A;  4EPC A;  3CCQ A;  3MEW A;  2DPP B;  5CKD A;  5DY9 A;  4F7U E;  3OYL A;  2E65 A;  3QYH B;  3CMA A;  1IZ6 A;  1VQP T;  2RI5 A;  1K8A U;  1K73 U;  3JB9 D;  3GLX A;  4A54 A;  2DXB A;  4C92 F;  4MDW A;  4C8Q C;  3HFO A;  5GAN 8;  3URG A;  4C8Q E;  4F7U B;  3CCM A;  1M90 C;  4ELY C;  1Y71 A;  3E1S A;  3E9G A;  1KD1 U;  2IG0 A;  1BYM A;  4M7A A;  1VQK A;  1M1K C;  3MHX A;  2P0P A;  1VQ8 T;  3HFN A;  2ZPH B;  1VQ4 A;  4GY5 A;  4RG2 A;  3QII A;  4XTZ A;  3LH0 A;  4LDX A;  3CC7 A;  1UGS B;  1QP2 A;  4MML A;  1N27 A;  4OF1 A;  1YBY A;  5A0G A;  2HBP A;  2JVV A;  2VUB A;  3OBW A;  4QVZ A;  4GLK A;  4BY6 B;  3GNF B;  2KAF A;  3QG1 A;  1YI2 A;  2M1H A;  3X24 B;  3QZ5 B;  2F5K A;  2RK1 A;  4NL3 A;  5CIU A;  2E41 A;  1N9S A;  2DIQ A;  1LNX A;  2K5L A;  1X6O A;  3I55 T;  2DKG A;  4PJO C;  1KQ2 A;  3V7C A;  3CXC S;  3QYG B;  4FT2 A;  1ZBX A;  1X75 C;  2XDP A;  5GAO l;  5LJ5 j;  2XG8 D;  1PSE A;  1V29 B;  2CS7 A;  2LVM A;  3HRS A;  3M59 A;  2CZ7 B;  4M77 D;  4LDV A;  2QEX A;  2YHT A;  2GF7 A;  1VIF A;  1RL2 A;  3E9F A;  4XU0 A;  4ZGJ B;  3ZEH A;  5LJ5 h;  4HT9 A;  3KUF A;  2XK0 A;  4C0F A;  3L2U A;  3RIR A;  3ER0 A;  4C0D C;  2VC8 A;  2MMP A;  4IUT A;  4E7H A;  3JB9 G;  4N4H A;  1QVG S;  3ZBD A;  4NL2 A;  2DVE A;  1LJO A;  3HRT A;  3FLG A;  2WAC A;  4HCB A;  4KUL A;  2XDD A;  4C92 G;  5LJ5 d;  1RI0 A;  1LOJ A;  2QQA A;  2VYT A;  1VQ8 A;  3CD6 T;  2ZPF B;  3C4S A;  1Q7Y C;  2O01 E;  4KT0 E;  3OS2 A;  2RO0 A;  4J7F A;  1M1F A;  1WNL A;  1KQ1 A;  2DEQ A;  1ZHI A;  3X26 B;  5GAM g;  1VQL T;  3FEO A;  3V7R A;  5GAN 3;  5HY6 A;  1Q81 U;  1JJ2 S;  3OYG A;  4JRP A;  1K9M U;  1H3Z A;  5CQX A;  2O4X B;  1KHI A;  3DLL A;  4MMK A;  3LX7 A;  3CCR A;  3X20 B;  3CCQ T;  4M75 G;  3OYA A;  3JCM J;  1AHJ B;  2RM4 A;  4M78 F;  5C0M A;  1QP3 A;  3M55 A;  2QQS A;  3V8J A;  1NJI U;  4J6W A;  4FM4 B;  2E12 A;  3CMA T;  2KY9 A;  5GAN g;  4C92 B;  1I8F A;  4M78 A;  3HKS A;  3C95 A;  3INZ A;  3CCM T;  3CCS A;  2HQE A;  3L2R A;  1EIF A;  1KC8 U;  2X4X A;  4N0A C;  4C8Q F;  4BDY A;  3J7A F;  3JB9 H;  5GMK e;  1D3B A;  3QDR B;  3BY7 A;  5J3B A;  3V8L A;  5A0D A;  4XTV A;  1VQK T;  3SWN B;  4C8Q A;  3A8L B;  2CGH A;  2QA4 A;  2K4Y A;  1VQ4 T;  3FIF A;  3QXE B;  4M75 B;  3CXC A;  3G6E T;  1NE8 A;  1JBM A;  1U8R A;  2E5Q A;  3OMC A;  4PLL A;  3CC7 T;  1MGQ A;  1XQH A;  2WSC E;  3BFM A;  3MP6 A;  3EFS A;  5FU7 C;  3ASK A;  2DZ9 A;  3UWN A;  3M54 A;  2JZ2 A;  1G3S A;  2HAX A;  2RA2 A;  1OZ2 A;  4DA4 A;  1YI2 T;  3OSS C;  4ZTJ A;  3OY9 A;  4M77 C;  3VJP A;  2LNV A;  4M77 E;  1M9S A;  2XIC A;  2QI2 A;  2RB6 A;  3M56 A;  4XTX A;  3DLM A;  4PNO A;  3JCM d;  5GAO p;  4CI0 C;  2EAY A;  4UC4 A;  2LCL A;  1N8R C;  3HRU A;  4IUV A;  1YIJ A;  3LGF A;  1K8A C;  3OQ5 A;  4M77 B;  5EG2 A;  5GAM j;  1Q82 U;  2LTO A;  5AYF A;  4PJO F;  3L2Z A;  5LJ3 f;  1VQO A;  3OYN A;  2LDM A;  4QW2 A;  3OBY A;  5FU6 C;  2L89 A;  4XU2 A;  2I2L A;  4PJO A;  4C0Z A;  3E19 A;  3DB3 A;  2XD0 A;  2GFU A;  2X35 A;  5GAM h;  5GAN j;  1QW1 A;  2YLC A;  3MP8 A;  2P4T A;  3JCM f;  1WQW A;  2E6N A;  5FU6 B;  1OYX A;  3S3O A;  1JJ2 A;  4KUI A;  2WSF E;  2EWN A;  3LGL A;  4IUQ A;  4M7A F;  1VIE A;  1X01 A;  5A0L A;  2FHD A;  2M16 A;  5GAN h;  4E47 A;  2QQ9 A;  3HP9 A;  2EQJ A;  4J7I A;  2MWP A;  2QQR A;  2V8J A;  2ZPB B;  3HL8 A;  3H6Z A;  4C92 D;  5CAI A;  1S72 T;  4C5G A;  3NTI A;  2YLB A;  4P5N A;  3RKX A;  4JRQ A;  3PIO A;  4E7L A;  3OW2 S;  3BW1 A;  4IUU A;  5I2S A;  3CCJ A;  3JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...