4F7VA

Crystal structure of e. coli hppk in complex with bisubstrate analogue inhibitor j1d (hp26)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bisubstrate analog inhibitors of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase: New lead exhibits a distinct binding mode.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 45
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 4f7vA00
1DY3A 3MCMA 4M5NA 4AD6A 1EX8A 1RAOA 2CG8A 1RU1A 1Q0NA 3QBCA 1TMMA 3ILIA 3ILLA 5ETSA 5ETTA 1EQMA 1EQ0A 4M5IA 1KBRA 2F63A 1RB0A 3HSZA 3KUGA 4M5KA 1HQ2A 3UDVA 3HCXA 5ETLA 5ETVA 3ILJA 5ETQA 4CYUB 5ETOA 1TMJA 1F9HA 4CWBA 2BMBA 3UDEA 2QX0A 5ETKA 3MCNA 3IP0A 3HT0A 3UD5A 2F65A 5ETNA 3HD1A 4CYUA 5ETRA 1RU2A 1G4CA 4CRJA 1IM6A 3HSGA 3HD2A 1HKAA 3KUEA 4M5JA 3HSJA 3KUHA 4M5MA 5ETMA 4M5GA 1RTZA 4M5LA 3HSDA 3ILOA 5ETPA 3MCOA 1CBKA 4F7VA 4M5HA 4PZVA
chains in the Genus database with same CATH superfamily
5DO2A 3THPA 4PWDA 3EGWB 3KK3A 2XSJB 2A18A 3Q8UA 2D9PA 4ECRA 3EMTA 4KV8A 1R0AA 3HFZB 4IQMA 1NUEA 5KFZA 5L38A 4ED8A 1AFIA 1RJJA 3NS7B 3W5XA 1N5SA 2QMUB 3PJ9A 4FN5A 1UETA 4K2JA 2JC0A 3M2RB 2Q1LA 5KFUA 4R5PB 3FNNA 4KV8B 3UDVA 4KY3A 3CCZA 3OXFA 1VQKS 1WSVA 1MWYA 3H8YA 3S8SA 5GAEU 4W92B 3E2EA 3VQTA 3R9LA 3K5PA 5KG0A 1YJNS 2XLIA 1SV5A 3N28A 3T3FA 1CJKA 2KRBA 3BGLA 1V3ZA 3UQSA 5HQLA 4Z7CA 1FXLA 2HQ3A 3T1HF 3PY8A 4P71A 1N52B 5LL6d 2ZHBA 2MLZA 2DGVA 1Q8LA 3ELHA 1K9MT 2GHVC 1H7XA 1EX8A 2HQIA 2J8SA 3NKYA 2KB2A 3GR0A 3PKYA 3ZTSA 1AXQA 4L73A 2ROPA 1RTDA 3CDEA 5FD1A 4ALZA 1H2TZ 2VFRA 4NEZA 5IOLA 3AJ1A 4PCQA 2VIHA 4DS4A 5B0GA 4WK3A 1KTVA 1TL1A 1Q4RA 1VLOA 2KVIA 4RX6A 3HHLD 3FVYA 3TJ8A 3VGVA 1VRUB 1NPKA 4QYZJ 3HT3A 3T9NA 2BOAA 2C42A 2XMUA 4LF5F 4CH7A 3ZNUA 3O6QA 4QIVA 5D4NA 5EWFA 5D0EA 1XMQJ 1RWWB 2Q43A 2QFIA 1LK7A 3GIRA 4K0KJ 2D3ZA 1NZ8A 4NYOA 1SJRA 4QBUA 4DR1J 2ZH2A 1S1VA 2RILA 5THWA 3SEOA 3TAQA 1RTHB 2E7WA 1O51A 1Q7LB 1R8CA 2OPQA 3QJPA 2MQNA 1N34F 3D1QA 5KFFA 5J2NA 3A3OB 3IRXA 2FGCA 4JP8A 5B0FA 4ECXA 3MMCB 4U6PA 3TYTA 2DH9A 5J2NB 9RUBA 1JLGA 3W9HA 9ATCB 1WORA 3DU6A 4HYKA 4PQUB 2WRMA 3EVWA 1UZHA 1JXLA 1EKRA 2DITA 4W90B 1WG5A 1S77D 3K89A 1AZSB 3T9ZA 3CJSA 3R5AA 4LR7A 2GO9A 3W2WA 5HVHA 2VA3A 5EWEA 2VBYA 3RG6A 4CO1A 4XTTA 3KLGB 1R31A 3K5LA 4DL5A 2G0IA 3BR9A 1R3NA 2H54B 1U2RA 4TYBA 4YOEA 1RT7A 2LA6A 3LP0A 4LRFA 5GAHI 4FDFA 1JJ2R 1S1XB 2NSBA 3ULHA 1S0MA 5FDLA 3C6UB 2DXDA 5KG1A 1TL4A 1VRTB 2BJ7A 2DHHA 5F8MA 1FJGJ 4J9SA 3HI9A 1SJQA 4NMXA 4RNFA 4HI1A 4X4OA 5E3PA 2IMWP 4FF4A 3G9CA 3SFUA 2RKIA 3UFCX 5B7WA 5A8RA 4OX9F 3SQOP 3I96A 2L08A 4L72B 3D5MA 2ZBRA 2G2ZA 3A8KA 1FNOA 4RNHA 5GADI 1XNQJ 4MKVA 2UXDJ 2VD3A 2ZH6A 5KTQA 2V67A 3CJ4A 2RRNA 3H0PA 2KYZA 3RBDA 2C22A 3OSNA 2ZKTA 4C3LA 2WW4A 3MEEB 1S6OA 3QMQA 3TI0A 4LBPA 2RMLA 1AFJA 1IWAA 1FKPB 3JSMB 2CQGA 1D09B 3MM9A 4A8MP 2OO4A 1GMWD 3HSDA 2GNKA 2GV1A 4WP3A 4WFNQ 3O5TB 4ID5B 2LU2A 4CLKA 3CXCR 2B56A 1NSKL 2W24A 3CIMA 4IG0B 2HVEA 4ES3A 2W9CA 1R27B 4DR2F 2L41A 1CULB 4OI0A 5DRKA 1YBTA 5CYMA 5KT5A 5I42B 4OLPA 5C24A 3W8GA 4PQUA 4GMKA 4E98A 5H9FK 4O0NA 2ZDOA 4MKBA 3ZTRA 2IM1A 3MXHP 3TJ9A 1HD0A 4OL8A 1IBMF 2FVQA 1WDDA 1B3TA 4PXEA 2LEPA 1GFWB 4DBQA 3D1HA 3UCZP 3GMGA 2ZZTA 1SUQB 1EP4B 4KB7A 2GAGC 2B9XA 3MPUB 4U8YA 3C6UA 5FLXU 1CBKA 4A8XA 4M5HA 4DCOB 2KTQA 3SXLA 1DTQA 3OSPA 2POKA 1HYSB 1K73T 4B02A 2XG8A 3FK4A 3IC1A 3PFOA 2CJBA 1EP4A 2Z57B 5CD4A 4HACA 5DJBA 2HQFA 4RW9A 5LMNJ 4URSA 3I9V9 2E9RX 3FC9A 3MECB 1EARA 5HO4A 2IA6A 2EWHA 3TX0A 3AD7C 4A48A 4DV3J 4B3MJ 2YPYA 1UVNA 4OI4A 2Q79A 4KTQA 4AL7A 2YKOA 1TL3A 4DL6A 2GA7A 3TQ1A 4OZ1A 5DQIA 3C2PA 3HHEA 4HKQA 1A9NB 2WBRA 2FHMA 2AZ1A 4CO5A 3SQGA 4DPUA 3HT0A 1TL3B 4TVAB 4DCJB 2F4VJ 4UY85 4A8YA 1KDNA 1HQEB 2E5GA 4WIQA 2FHJD 1WTFA 4DCPB 3K5MA 5BXIA 2DY9A 3CWJA 2NZCA 1FJEB 1QJHA 3P45B 3R5BA 4UW2A 4J9NA 3BEGB 1NM2A 4MIWA 1X9WA 4ILRA 2PEBA 4ZVPB 5HBMA 4QIFA 3JXOA 2BE9B 2NR0A 1LXNA 4Q5VA 1K8AT 2ZUGA 2OP5A 2DNHA 3IGNA 4M5IA 4WFBQ 2ZWOA 4DS5A 2YY3A 2FZCB 5AE3A 1I51B 3NGUA 5K5MA 5HP1B 3NL0A 1M1HA 1IBLJ 1LFPA 3P96A 3P3DA 3HKWA 3BV8A 2R7TA 3C15B 4H4KA 3W2VA 4EBCA 1ZTWA 1YI2S 2E9TA 1RT2A 4IRKA 2XS5A 3PYEA 3VV2B 4LSLA 5KOWA 4DR7J 2IAJA 3R8YA 2AJQA 2DGQA 4RW8B 4ITSA 5KG5A 1EKSA 2PMWA 2QSFA 5KFAA 2MGZB 1KKHA 4GC7A 3ZTPA 2MZQA 2ZVSA 1SV5B 4C8ZA 4RW9B 1N36J 4USHA 3NCQA 1D8ZA 1WKLA 4HTIA 3MECA 4AE5A 2ZHAA 2ASJA 1NZAA 1ROFA 1SI9A 1XERA 2DEJA 4WCEQ 2MXYA 1TTHB 4ED2A 2NCKL 3POTA 3N5BA 1N6QA 1VQ9S 4O0IA 2CAJA 3I0RB 1RCOB 3ILIA 2QA4S 2F8HA 3QFWA 3K59A 3LA0A 4FBUA 4DPTA 1PILA 2M52A 1A0OB 5HMWA 4P73A 3LP2A 3VCDA 3OUYB 4XPCA 3FEYB 1HQEA 1NEEA 1YJUA 4Q0BB 1R6YA 4OI1A 2UUAF 3DLGB 3G8QA 2M0GB 4GKKJ 1JX4A 1AA1B 2VOOA 5KFVA 1FWPA 3HSGA 5MAOA 1F5CA 3MR6A 2AGPA 3RGIA 1Q5YA 3PNIA 3QIPB 4EK2A 1XTZA 1JLEA 4ZP9A 3LAMA 4X4PA 2FJAB 1J27A 4X62J 1CS4B 4ZITA 3E8OA 1XC9A 4LSZB 2DNLA 4ZCIA 2KRRA 3P5BP 4A4JA 2NREA 3GP9A 4LF7F 2E7VA 4B9LA 1TELA 2R4FA 2QTWA 1HNXF 3ZZPA 2QLFB 3R5JB 4DQPA 3Q89A 4JI0F 5F8NA 1MU2B 2DO0A 2GCFA 1HQ2A 3DOLA 4F25A 2IC3A 1JXEA 4Y2KA 2JVRA 4J9RA 5LOQA 4I69A 2H1YA 4AT1B 4ZJQA 1F0XA 3SIPB 4U7UK 4OI3A 1F60B 2NZ4A 1IBKF 3VF0B 4NCBA 3IFEA 2R7VA 1G3OA 4R5PA 4AL5A 2MY8A 2LDIA 1IKXB 1WF0A 2YQ0A 3CCWA 1V5IB 2OSQA 5IZHA 4KGMA 4RBUA 5DZ6A 2HWTA 1AROP 2R8HA 2E29A 4ZLNA 4CLYA 4LREA 2F40A 4EWTA 1GMVA 3D4JA 3V81A 3HHKA 1FRLA 1FXDA 2DHGA 2V69A 1N34J 2G4BA 1UJ4A 2PA3A 4WKRA 1WSRA 3ZNJ1 2QSWA 1WC4A 3Q8YA 4M63A 1S6UA 4UT4A 2V4QA 4KKOA 3CJKB 2NYHA 4BC9A 1F2GA 1NJYA 4O3NA 2BJ9A 2ACYA 2X3DA 3DI6B 1HNIB 1RKJA 1URRA 3OTEA 5KFNA 3PW4A 1Y0HA 4CYUB 1LEOA 2HNYA 3QLHA 3VWSA 1H72C 3T1YF 1NH7A 4DFKA 1REGX 3IM8A 1HNIA 1SC1B 2B4UA 2K7JA 2MZSA 3PYGA 4FYYB 4I6AA 3TRGA 3GCXP 2FJBB 2HW3A 2A10A 1OQ3A 2WB1D 2LQ5A 1CC7A 1YRXA 1S6QB 1CVJA 2XSJA 5A2QY 4KHPJ 3BKUA 2M9KA 2QZ8A 3BGRA 5D15A 1M1GA 1PC5A 1X0PA 1FNXH 2JFKA 3FSYA 4RNOA 4JI7J 5GMEA 2R8KA 2DHAA 2OMOA 3OBIA 4CLTA 4ETZA 4DFJA 3HZGA 4LIRA 4F50A 1JJHA 3ZTOA 1XMQF 1HI0P 1FDBA 3FUYA 1SC3B 1KHWA 1Q79A 1FJ7A 1WG1A 4N5SA 1RT4A 2K2PA 4DR1F 2FTRA 3CVKA 1MNEA 4MT1A 4A8FA 3NBPA 3OTOJ 3BGFA 5EWGA 1F3FA 3O8WA 2RNEA 3RYLA 1RHUB 3TJAA 2ERRA 1HBNB 4QWCA 3ENAA 4NLWA 4ZOSA 2V2VA 2LMIA 4XK8C 1F9HA 4TY8B 3AD8C 4C4WA 2Z30B 2IMOA 4OHXA 1TFYA 3GJRB 3FSIA 1UVMA 1WC1A 5K8MA 2ZBIA 3J81Y 1J5EJ 1I5OB 1OJ4A 4F0KA 3KUHA 4I2QA 3AOAA 4ZCLA 2MQ8A 3SCIE 1VQPS 4F3OA 2YKNA 4F3QA 1JLAA 5BYRA 2HGMA 4C3MA 3M6VA 4LFCF 3N9UC 1LWXA 4IUFA 5C5JA 2J6TA 2DBBA 2FLPA 1HW9A 1TK5A 2CQDA 2CZ9A 2YKPA 2V9WA 4DV5F 1ZM2A 4LF4F 3M8PA 3EDQB 4OMFG 1TU0B 2Z8QA 4OX7A 1BHNA 1HI1A 4X4UA 2GQQA 2MHEA 1B0VA 1J2VA 3DLKA 4XAKA 1U1NA 5DGBA 3Q8SB 2X7IA 1M5VC 4B3SJ 5KFDA 5LMUJ 3MUTP 3BSAA 2HHQA 3CW2C 2WTFA 4C8KA 5CYQA 4DQSA 1O0PA 3EGVA 4JV5J 2CPFA 1R89A 1HNZF 4PYAA 5HJXA 4DI6A 3MCOA 4Y00A 1RT1A 3OL7A 4V19J 2UZAA 4RW7A 1JLFA 4USTA 1EIYB 4ECSA 4YB6A 2K3KA 1RT1B 1S7IA 2RQMA 4USIA 4PAAA 2N3LA 2W4DA 4I4BA 4YFUA 2ATCB 4IRDA 2AD9A 4A8QA 5LXYA 2CKWA 1SIWB 2JDJA 2LECA 4YS2A 1LW0B 1DQ8A 2RB7A 3FBBA 2WCXA 3OXGA 3QPIA 3M2VA 1W25A 3KG0A 1SUQA 4GC6A 3T6BA 4WKYA 3HP6A 3KHRA 4DUYF 4P52A 2P9GA 1QVFR 3OR1A 1U24A 3AJDA 3N4WA 1OIAA 5L1JA 4ED3A 1F9EB 3M8WA 4DX5A 1RE1B 3SDEA 3NOCA 3G8TA 1LOUA 3CTRA 1AW0A 2CNOB 1HBOB 2MQPA 1XK8A 2F3JA 2O67A 4RW8A 1JLCB 3W64A 1U47A 4ZMMA 1HBUB 2VL1A 4V1Ak 3D0GE 4HVZA 1NXIA 2CPHA 2MJUA 3SBMA 1N56A 1C1BB 4P2SA 4K4VA 1WWHA 1IR1A 1FERA 5DS7A 1HBUA 3SQGB 3NLCA 4DJBA 2G0CA 3KLEA 2MSSA 1PBAA 1C0TB 3ILJA 3H59A 2LXUA 2ZH3A 2WVBA 1CC8A 2E1MC 4O3OA 1FKPA 2QYCA 1NB7A 1K0VA 2QX0A 3OD2A 3NG8A 3F44A 1C1CB 1NU4A 3BB5A 1VHFA 3D3CJ 3IP0A 2DHXA 3MCNA 4IG3B 2AU0A 1OPZA 2XC9A 1AYEA 3DYAB 5G4DA 2Y1RI 3JSRA 4DUYJ 4FNIA 3NWRA 3IXQA 2V2KA 2AHOB 2YH0A 1XIQA 2VDIA 3A8EA 3ISNC 4EMDA 3O44A 3M8RA 2CQIA 2HPUA 3V4IA 2UU9F 4TNOA 2DH8A 1O6XA 1WKKA 4PWWA 1KWMA 3WHIA 3EVMA 3QBCA 2M70A 4TN2A 3IA0A 1P9YA 1TKDA 1S5ZA 1S9EA 2KXHA 1C4AA 2FPHX 2UV8G 1WEXA 2MZRA 2XTJP 4NYZA 4YN3B 2EVZA 2DYAA 2J9EA 3TZXA 4WTOB 2W8LA 4ANEA 3N6LA 5T7LB 4DV3F 4DLEA 3ITHA 5E3CA 1FJCA 1NDPA 4FVMA 2H48B 1LWCB 4DSKA 1VC5A 2UUBJ 3MAQA 5EGYA 2Z2ZA 3LGNA 4AQYJ 1SQGA 4RNNA 3H4BA 3P5TL 5M2PA 3DCAA 5DQHA 2BRKA 1JQGA 5D77A 1LWCA 4A8KA 1UZDA 2AJ1A 2DKOB 5SUHA 2PO4A 4MMOA 3BJYA 3TEGA 1TKTB 2HRTA 2BKOA 3D6MB 3MF5A 4KIAA 5CZVA 4UOCA 2MKSA 2WAQD 2MGZA 4X64F 2F5GA 2GS8A 3GWCA 3PTWA 2AEFA 4OYBA 5RUBA 3DOMA 4OYIA 1KLMB 2DXEA 3LPYA 3J7AN 2CPEA 1NPPA 2XSFA 3QAEA 2ASLA 4IH5A 4CO4A 1UWBB 3PHEA 4OX8A 5DDQC 2IVYA 3BSCA 1QAJA 1DAXA 1JLBB 3QYYA 3D1OA 4MAKA 2VICA 1Q16B 1QUPA 4X64J 2L9WA 4IOAQ 1YJ7A 4O4RA 1DRZA 1WELA 2CQBA 2LXIA 3L7UA 4ECQA 1CLFA 2HS4A 2VZ9A 4LF8J 1WC0A 2HAFA 4DU7A 4RBVA 1BLUA 2ACMA 3HJVA 4LVOP 2XMAA 2Z56B 3WX4A 3V6KA 3PYDA 3T5HA 3V4MA 5T14A 4WU3A 2C1EB 3MFHA 2FVRA 3AHPA 5CCLA 5KFWA 2XCAA 2IPOB 3OVAA 1DY3A 5HAOA 5KFKA 1RAOA 1HI8A 3EWGA 1UA0A 1UEUA 2MKHA 3DOKA 4F4KA 4B9NA 3LO3A 4F0HA 3RRHA 2VUGA 1KSPA 4QR0A 1WG4A 2KDOA 3D9BA 4N8OA 3PR4A 2UUWA 1X4EA 2CPDA 3AY0A 3G6ES 1VFJA 2D69A 5H1SV 3VALA 3JAMY 2DH7A 2XGQA 1T3NA 2DJWA 1VIOA 1VBYA 2V4JA 2GIRA 2IJRA 2R7UA 2IHR1 3P4UB 4O3QA 4ZLPA 5I3UB 1SKUB 1U2FA 1B0PA 1UAWA 3FCHA 4CWBA 1QAXA 4AYBD 1YIJS 1JJ4A 4JI2F 1KQFB 3UD5A 2HEKA 7AT1B 3SCLE 1OPIA 4UUWA 4OHZA 5D8HB 1LWEA 3KMQA 5C2GA 4KT0C 1G7CB 3I5CA 1OWXA 3CCSS 4RUBA 2J0SD 3WZ0A 2MY7A 3CJKA 3G71S 2ADBA 3VGSA 2D7SA 6FD1A 5M2UA 4LR8A 4ZJLA 1XR5A 2DVIA 2D3O1 2BANA 3FZBA 2R7RA 1DQAA 4PKDB 3OFEA 3M6WA 1S4EA 3DI6A 1RWXB 3TZZA 4DR4F 2RDDA 3W1YC 1U45A 4ICLB 3T1YJ 1RT7B 4QYZK 3N01A 4K4WA 3R7NB 3PW2A 4DLGA 1RHQB 3CDWA 3CULA 2O1PA 1UL3A 2C2RA 3V5RA 4DZDA 2JH3A 3M2UB 1UJ5A 3BH6B 4QPXA 3UE2A 5H9EK 4YB7A 3MPDA 5D4PA 2LA4A 1BE4A 1N4LA 1X4GA 3FRZA 4UUXA 2HBZB 1YJRA 4LF9F 1JKHB 4NA2A 3TP2A 2RS8A 1CSJA 4OHVA 1WACA 2YKQA 2JEFA 2OEKA 3D6FB 3MEGB 3FKBA 3BO3A 2CVIA 2K3IA 5JUMA 2JEGA 3JSMA 2O5DA 3DOLB 3W7BA 3PKMA 1S1VB 5L8RC 4DX7A 5KFCA 1VRQC 2PD1A 2KFYA 2UVUA 2CPYA 1RTHA 5ETSA 2VFUA 3NNAA 4DR5J 2AGQA 2AT1B 4TY8A 2B7CB 2K8GA 2V68A 3AOBA 1N54B 1FI4A 2FHJA 2QG9B 2DIUA 3SSRA 2EW9A 1J5EF 2E1CA 1RWMB 2F9JA 4F2RA 1X7VA 5ETLA 1X4CA 5DG9A 4DUTA 1R8HA 3AJ2A 4F26A 3PIPQ 3SV3A 1VQ8S 1GEHA 3GFXA 2PMHA 2HVIA 1GX5A 1KOOA 2UUTA 3OFFA 3D66A 3DMJA 3TOQA 1RWOB 3U1NA 2GMLA 4F2SA 4LF6J 3J7A1 3OPKA 1IN0A 1GXUA 1JLGB 5HMZA 3RRKA 4WYLA 5LSLA 4IOCQ 4PRFA 2BANB 3GLJA 4H4OB 5DQGA 2HNZA 2CUYA 2ZH9A 1Y4ZB 4EBEA 1YQHA 1VQ4S 3QJJA 2M88A 2NUUG 1ZBTA 3OR1B 3SI8A 5KT4A 2RKIB 3CGIA 4E0DA 3VGTA 3KLGA 4JI4J 1FKOA 4OZ2A 1SKRA 4X4VA 4G1QB 2XLKA 2EXUA 4Y2CA 2QFJA 1FX4A 3DLKB 4XDCA 4B3TF 2HK2A 3S7RA 3JQMA 4OZNA 1AUSL 1BY9A 3BGOP 1YKWA 3HX9A 1IR0A 4HR2A 5I3PA 5KFQA 1U1KA 1HARA 3TA0A 4AXJA 3G6YA 5L1IA 2FD2A 2BDPA 2DR6A 1FFGB 1HNVB 4HT5A 4DQIA 4KGVB 4J9KA 4DR3J 1JXVA 5IV4A 3HULA 1HWIA 1H73A 2DR9A 2YX4A 4O4GA 2RH3A 3J80Y 1FRIA 3U1LA 5CD4H 3ZZOA 2EG2A 2ZNZA 3BGUA 2B7BB 4XO0A 2G1DA 2KU7A 4B08A 5I42A 1QSLA 2W9AA 2B8PA 3DRYA 3R97A 4ZVRB 4B3OB 1C4CA 5C2CA 5EHHA 4KFBB 4FF2A 1UTAA 1QSYA 3W65A 4ID5A 1Q95G 5DDOC 3CC4S 1TK0A 1FO1A 3CNQP 2M7SA 2LCWA 3GYNA 3F41A 3OLBA 2XNRA 2HFSA 1FE4A 4P74A 1YSJA 4HT7A 3UCGA 1EAYC 2HBRB 4YHHJ 5K14B 2JWNA 2Y3YA 1AZSA 3RR7A 2LYVA 3JYTB 4OX9J 3ET6A 2DR8A 1HMVA 4LF2A 3AFGA 1P9QC 3CJ5A 5AT1B 1N0VC 4DV6F 3QO9B 4UQGA 3EZUA 2CXEA 4P72A 3RTVA 4RL1A 1HBMA 1D9AA 4PPDA 2VHGA 3KK1B 2E9ZA 2IJFA 1SB6A 2J6SA 2P9CA 2HIQA 2EBGA 4I6YA 2HZCA 4WWSA 3CUNA 2Y8WA 1UKUA 1MSWD 2YKMB 4TLQA 4K5RA 4PYDA 3M8QB 1T05A 1HR0J 2ZFHA 4K5SA 4OYWA 4JI3F 1EJ7L 2CWXA 3MTKA 2RQ4A 4C8NA 4YUDA 4CTAA 1GXTA 4ZIWA 3GIMA 2ZM6J 4OHYA 2ZOGA 2H9ZA 3I6PA 4HDGA 2NXEA 3KYLA 3PX0A 3KUGA 3CMES 1PJ6A 3BF4A 3V6JA 4HACB 2YWHA 1IXKA 2X1FA 3C16B 4LSNB 3LUYA 4KC5A 4I2PB 1SQFA 4R0JA 2HZAA 3VR1A 4TQSA 1YZ7A 2EK6A 4KRWA 4OX6A 5K20B 3TX8A 3I56S 2BMBA 2M2BA 2WSCC 3J81U 2EC0A 2PFFB 4KQZA 2GMHA 1NDCA 2NYIA 4CP5A 2KHDA 1BQNA 1P1TA 2J5AA 2CIMA 4Z37A 4RW4B 4IFYA 4O23A 3R5GA 5CYMB 3HK2A 3DM2B 3TNVA 5KG7A 3JB9k 3JQJA 2WBMA 4C8YA 1XN9A 2C2ZB 3UDCA 1T7PA 5KT7A 4C0HA 2XEXA 3FZ2A 2ABYA 1X5PA 2AP6A 2XNQA 3ET6B 4DQRA 2PC6A 3V4IB 2C2OB 3A1YG 3TVYA 4PWDB 1UFWA 2ILYA 2RDIA 2V50A 3QGHA 3SSQA 2DNPA 5A8KB 4ILLA 2FVPA 3O1LA 4NRUA 4ETXA 4DV1J 6AT1B 4J9UE 3KLHB 3PM9A 3AQPA 4J91A 3W8PA 4CO3A 1NJWA 2CG4A 3A13A 3Q8QB 3HXMA 3RUBL 5ETNA 2KKHA 3S1TA 3PW0A 2AW0A 1DQ9A 2EEYA 1T05B 3K0JA 2KT2A 3THVA 2UP1A 2ZBQA 2IRXA 3VVTA 4JYAJ 2P6SA 1YK9A 5HK4A 2BJ3A 2YNGA 2XY7A 1UP1A 2JEIA 3SYZA 3HVAA 5KFOA 4K4ZA 4PEOA 3NXZA 4YEAA 3CCES 1TKTA 3MGJA 2ZJPQ 4HH0A 2K06A 3TUZC 4DPXA 4I0WA 3DLGA 1C1CA 4IG3A 5IC4B 2I2YA 2Y8YA 4LRAA 1RAGB 3H5UA 3VAIA 2ZVIA 1RWVB 3RB4A 1S1TB 1W2IA 1TZ0A 2EPIA 1S1UB 1PAUB 2XMTA 3FSXA 3LP2B 3WX8A 5JJBA 1TK8A 1SL1A 1UEVA 2P8IA 3HFKA 3A3PB 4N7TA 3T1HJ 2LP4A 1ZOTA 3TANA 1VQ5S 2WONB 2HNDA 1YBUA 5LM7E 1SC4B 2JHEA 4H54A 3TA2A 2ZBPA 5ITHA 3CD0A 2CPJA 1H3DA 4M5NA 4B17A 4OJ1A 2FC9A 3E01A 2B3TB 1N0UA 3ILLA 3FRYA 3NGDA 4W4MA 1AT1B 4J37A 4U7UD 2MMYA 3D68A 4OLOA 2BQ3A 1K47A 1RWUA 3DGPB 3MZIA 1JK9B 4P6QA 5D78A 4ZDNA 4A8WA 1S0OA 2COLA 2BE2B 1GQEA 1GT8A 4GO7X 1TUGB 4L75A 1PYSB 3X1LB 1OO0B 1ZTTA 3DNCA 3EXYA 3FDSA 4J7CA 2I6WA 4ANDA 3PW7A 2FY1A 1MN9A 3V6DA 5SZTA 3QIDA 1HBNA 3H20A 3I9ZA 5AXLA 2JZ5A 4RU9A 4LF8F 2CA9A 1S1WB 2EBEA 3MPWA 2BXJA 2DT9A 1L3UA 3QAUA 3RBEA 5F8GA 1B99A 1TV6B 1JLQA 8ATCB 2ZWPA 1F2HA 4IYQA 2CWKA 2NXCA 2CRLA 2ZUAA 1V9OA 3KG4A 4OV6A 2FZKB 1ZM3A 3HMJG 1LW2B 3HHLC 1RAJA 1VQYA 2N82B 3AB2B 1WC6A 1JLQB 1M5SA 1OQ6A 4ZHRB 1ZH5A 4JI5F 5A0YB 3MUMP 1WEZA 2QC3A 3IAM9 4FXVA 4QIWD 2HHSA 2G13A 2IM2A 5FJ4A 2L3MA 2R2TA 5ETVA 5L9NA 3GJSB 4B9SA 3JTNA 2WONA 2WVDA 4E8UA 3RB0A 1VQ6S 2HG4A 3K7RA 1IM6A 3UDLA 2DR5A 3H2UB 1F6TA 2KL8A 1RBAA 1U8SA 4NLQA 3KLFA 5DLFA 2HHUA 1H98A 4Z7YA 3ZZ0A 3BQ1A 1K0TA 3DLLQ 4M1KA 4XPEA 3LANA 5D0GA 1YG0A 1CJUB 1GX6A 2P6TA 4KH1B 4M8LA 1S6QA 2F4FA 2XB2D 4ECUA 3QRPA 1HPZB 3O3LA 3DN9A 5F41A 1Y11A 3TEHB 4L74A 1VC0A 2CJKA 3K8VA 4P75A 4X84A 3QT5A 4OZ3A 3CIZA 1C0UB 1RHJB 4X66J 2ZZNA 4LJMA 1I1GA 2MB0B 4B9VA 4C9DA 1TVRB 3M1VB 3ZXWA 2OIHA 2GO8A 1H74A 5LMUF 3R27A 2CNNB 2W9BB 1FWLA 2RIJA 4I1TA 1U6ZA 1TVRA 2OELA 4TY9A 2EC2A 4N47A 4NOHA 5GAHU 3OTOF 5J2PA 1UVKA 3KJVB 5B0AA 1S1XA 5K8OA 4DR3F 2NUHA 4CLSA 1S48A 4U95A 1U7LA 1LWFB 2MEWA 3M8ZA 3DGVA 4UOHA 4ELUA 4BBYA 4F7VA 2V5HG 1S4FA 2E5HA 2DRBA 2AWZA 2E44A 3QRQA 4QW9A 1ZM4A 5A0YA 1PAEX 4MKAA 2G9OA 5D0HA 2WHOA 3D6TB 3Q86A 3HZEA 2KYXA 2QE5A 3MMBA 3PRDA 3TZWA 4BLGA 2RU9A 2ZJQQ 5HROA 4H4KC 4YHHF 3PO4A 3UR0A 1TL7B 2LQ9A 2ZOMA 3ZZZA 4TU8A 1VBXA 3AODA 3IG1B 2QGFB 3MCSA 3O2IA 3MDFA 5K8PA 3I55S 3KK2A 3GV8B 4DV7F 3R3TA 2ILZA 3MMBB 5KG3A 5HROB 3I32A 4IRCA 4JV5F 2BEFA 3AOCA 2IIHA 4FPIA 1VC6A 1Y00A 1RYSA 2HK3A 3NCRA 1IR2A 1KFSA 4OZLA 1VI7A 3BPDA 2BA9A 4CIOA 4ILMA 2WZ1A 3I5BA 1KR4A 2MJNA 2XHCA 2QN6B 3KHLA 3ETMA 2AJ4A 1EETB 2YNHA 3OQ2A 2WW8A 2VB6A 4KFBA 3J7YI 2HZVA 2KZMA 2FDNA 2OFHX 3ETOA 2DRAA 4DX6A 4F0MA 3HHLB 1RK8A 2XHWA 2RDJA 3PRBA 1CEZA 4WZMA 1IQTA 1R43A 3BN7A 2YWKA 1BC6A 3LOUA 1X0FA 2W2MP 2BM0A 3GSDA 5ETTA 3QATA 4BC7A 1U48A 3KJFB 1YLXA 4C8LA 1KQSR 4FPRA 4RW7B 5KFPA 1I94F 3LP1A 3NGTA 3HPOA 1SL0A 2AX0A 3G82B 1ZZFA 4YMEA 4LF4J 4P2MA 3G4SS 2IM3A 2N7CA 3QFHA 1QY7A 1MROB 2B6AB 5T41A 4I2QB 3UN5A 3EJMA 2HVHA 1NAQA 2K1RA 3NGKA 5K14A 2BUNA 3GIKA 2XLJA 2XQCA 2DGOA 4JI3J 1JLAB 4EZ6A 3JYTA 1W26A 3R1LA 1N32F 4C48A 1X4FA 3MHYA 2VQFJ 1Q1KA 5ETMA 3PR5B 4J9OA 4TLRA 1RDRA 1SBRA 2MPUA 4I6WA 3DLEA 4KBIA 3FBCA 5AJ3F 3TW0A 4YB1P 1S72S 1YJVA 4U9RA 5J1EA 3PW5A 4ZVFA 5GAEI 3KLEB 2OTLS 3NMRA 1X4AA 1FK9B 4L3KA 2FYXA 4NYPA 5HVGA 1DTTB 1NSQA 4DU8A 1APSA 4JBCA 2KM8C 1C1BA 2N7YA 1R8AA 4H4MA 1WI8A 5E0OA 4YR3A 3CCLS 3DKDA 3IBFB 4F02A 3FMWA 1RA7A 3OUYA 4QYRA 4A8OA 3MR5A 1PYTA 1WOSA 1IKVB 1ELOA 3GONA 4H4MB 4TXSA 3JSYA 2CQCA 3W5ZA 2JVOA 2V2QA 1M0SA 2VJVA 3BQ0A 4BDPA 2Z58B 4E2FB 1Q82T 1T9XA 1D0EA 3DYAA 4WK1A 3FEZA 2D3OR 1FKAF 3DRPB 2LXFA 4MK8A 1CQNA 1V3RA 2ATLA 1Y5NB 3IBCB 4ZVOB 5IQ6A 2DHSA 4P7VA 3D3BJ 3MD3A 4R8UA 5A6PA 4AQYF 3QGPA 1WI6A 2B6AA 5IT0A 1HLWA 1FWKA 1PG5B 3HJFA 1IQZA 3L3CA 4KAIA 4JI1J 2AJ2A 1HWJA 3CJ3A 1OY6A 3CCTA 1FHTA 4HI2A 5ETOA 3CT9A 2DCLA 2VG6B 1KNZA 3C66A 2BJEA 5GMKa 1VBKA 2KT3A 5I3QA 4OI2A 5DZ7A 1FTCA 3GFZA 2VQEF 5KOXA 3B82A 1E6YA 1NDKA 5I3UA 2PGCA 4M5GA 4ZVUB 2HLTA 5J2QB 3A8JA 4F4AA 4ZA1A 2CVEA 1UFLA 4CLWA 4LF7J 2Q66A 3TARA 5CCMA 1XMOJ 2YX1A 1TP7A 2E66A 2H5JB 4NLPA 4ECYA 1YJWS 1KN6A 1UA1A 4ZCKA 4LBHA 1S1WA 1T03A 2Y9HA 3SCKE 4C8OA 4TU9A 1QD1A 2XZWA 1N88A 1XMBA 4Q45A 4Q8FA 4LFBF 1SJ1A 2W2OP 5DDPC 4CLZA 1U25A 4EGLA 4GKKF 2MSTA 1PC4A 1FTRA 4P2XA 4RW6A 1N6QB 1EZZB 2XMKA 5U47A 4DPWA 2DGUA 1FVQA 3CDAA 1IKVA 2XI2A 3IS9A 3R6LB 4JUZA 5HJYA 4IQXA 4K50A 3EM1A 1NK9A 4JI6J 3UN2A 1UVLA 4QU7A 2HHWA 4RW6B 1VLYA 5IT9U 2JLEA 1OYEA 1WEYA 3HF5A 3L4BC 1JLBA 2NLWA 1ZZNA 1X4DA 4XIUA 1TL5A 4ZPVR 2HBQB 3MR2A 3K5NA 1RACB 2W2NP 3LGHA 2V4RA 3PVXA 4DOZA 2J0QD 3D28A 4DL7A 4OYOA 3ZZTA 2VV5A 3PJWA 2IYGA 1T9WA 1FRXA 2CG8A 4NX9A 2XMJA 3DRXA 4IDKB 4WTYA 4ES2A 5LJ5Y 3OJSA 4QWBA 2C3OA 3IGVA 1RTIB 5A8KA 2UVRA 3LW5C 1Y7PA 3C6TB 2BW7A 4WP9A 2XI3A 3Q24A 3KDNA 4MFBA 4ZVGA 5JVHQ 1J5OA 3DHWC 1FFWB 1RB0A 1IUJA 2Z2LA 3MEKA 1HNWJ 4OV1A 4Y2MA 3H4DA 1RWNB 1MW7A 3KFWX 4EBDA 2OEMA 1N48A 4NXMF 1RT4B 4Y3CA 4K8RA 2AIRB 3GU0A 1TUWA 4QR1A 4CT8A 4RUHA 5J2QA 4ANCA 3FBFA 3MMAB 5L1LA 3I4HX 3MR3A 3VAMA 1N8RT 1MLAA 2QL5B 3V81B 4EO6A 4DHVA 5A2QU 3CPWR 1Y9OA 2KO1A 2VBWA 5E7OB 1IBCB 4CLUA 4NXMJ 3ZZRA 3QSYB 2FHOB 4M5DB 1NH8A 2Z2MA 5CABA 1BWEA 2QT7A 3M9MB 3VQSA 2RHQB 1Q0NA 4DL3A 3UD3P 2O3DA 5BYQA 2BZ2A 3Q2TC 1YRTA 2MZTA 4X66F 2W7OA 2HNYB 1NK6A 2JFDA 5AXKA 4NE9C 4WIIA 4ZPBA 4Q0BA 3TQEA 4NA3A 1RAEB 4K4SA 5L39A 4LRDA 3W60A 1RT6B 2CPZA 2XWXA 3RAQA 1F5AA 4KO0B 5EUHA 1HL6A 1S76D 4HL9A 3NOGA 1M5HA 1Q8IA 5HMXA 3EXCX 5LXRA 4C97A 4F67A 2MLYA 4OJ3A 4DV4F 2E7XA 1IBKJ 2JSXA 3TVZA 4UY8T 3DU5A 1O8BA 2H3EB 2H51B 3DRRA 3KUEA 3VZIA 3J7YU 1YJ9S 4O3SA 5AE1A 1YZ6A 1RTZA 2V8VA 1RT5A 1UJ6A 2JLFA 1NPRA 3P49B 4PABA 2GJFA 3GSIA 3RW7A 2VJUA 4OJGA 1VJWA 3CMAS 1VQLS 4C2MA 2NXUA 2QJ3A 4Q43A 4DFPA 2VPZB 3F73A 4B3OA 2VF3A 3DDNA 3EGNA 2FJWA 4AUKA 3W63A 2V0NA 2VOPA 1G2EA 1UMJA 2ZHOA 5J2PB 2E5IA 3DRSB 2KM8B 4JI8J 1FXRA 4ZS6A 1O5JA 3LP1B 4M5DA 4ECZA 2XS7A 3AQOA 2GW8A 4HHUA 1S49A 1IKYB 1LW0A 3AT1B 3PYFA 4C0OC 4HH1A 4L3NA 5F8HA 2MZ1A 2R9LA 3LALA 4M5JA 1YJTA 3G6VA 2JL9A 1KVIA 2C3MA 1WOOA 4NCAA 4NLYA 2HVZA 3ILOA 1ZM9A 3A8IA 2QL7B 5HQMA 4RNMA 3IR6B 3MCMA 1JNZB 4F4ZA 2QIFA 4DPYA 2YTCA 2DGWA 5F8LA 2KJVA 3ZC4A 4LFAF 5AE2A 2QLJB 2IBKA 2YX7A 3V6HA 4LMZA 2CNKB 4ZIVA 2PIIA 2B9YA 4WYWA 4RLEA 3GQCA 1D9FA 3KLIB 4CTAB 3CF5Q 4LFCJ 3PFEA 2FLNA 2FJVA 4EU0A 2RJZA 3PCOB 3MEEA 4DV2J 2HFOA 1IBMJ 4XDDA 3PV8A 3I5AA 4G1IA 5DM7Q 3KK2B 2LQBA 3RJMB 1C2PA 3NNHA 3MM5B 3MEGA 2ZEJA 3QZ7A 2FLLA 4K4UA 1WHXA 4LQ3A 2BKPA 5IFMA 3D0IE 4DV0F 1RLDA 3IN5A 2KH9A 2FIUA 1K1SA 4DEZA 2I0XA 4B3SF 3IR5B 1ZAWA 3RBZA 3G2XA 4DSEA 5K9FA 1P8GA 3HVTB 3EYZA 3VAFA 1SKSA 1CJTA 3DM2A 3WIUA 2J6UA 3NP5A 3NNCA 3RU0A 4NLGA 2LQJA 3BBBA 5FLXY 1T3OA 2IYIA 3W5YA 4FYXB 2DGTA 4C98A 2J7WA 2W9BA 4DV5J 3Q22A 3HHNB 1VCTA 1L3KA 2AJ0A 3MAAB 3CDUA 4ZP6A 3D54A 4QCLA 1U6BA 1TMJA 1RHKB 2H5IB 3DDIA 2F4VF 3TAMB 3SDEB 1WNEA 2W2QP 2BJDA 1T02A 3CJQA 3DXSX 3IR7B 3DC2A 4PXDA 4MYUA 2CYYA 1MROA 3KLHA 4CM2A 3L9ZA 1S0NA 1L3SA 2FC8A 3N5FA 4QIEA 4K7QA 1NDLA 4M5LA 3GIIA 1ZS6A 2U2FA 1WUUA 4C0BA 4P10A 3M8PB 2IFXA 1Y3KA 1VQMS 3IG1A 2AZ3A 4ED0A 3FCWA 3I87A 1HWUA 4GVLA 4YB5A 3VAGA 1PO6A 2YKMA 4USJC 4X4RA 4USVA 1HHTP 2DY1A 1EQMA 2A3JA 2I8EA 4CO2A 1OS5A 4D3HA 1U1PA 4O3PA 4V19X 4EUVA 5HI7A 1IBLF 4NXNF 4X2BA 2GX8A 5J1EB 5CXTA 2JJ4D 3MM5A 4KPYA 4AXIA 4QU6A 1MMLA 4Q7AA 1F9FA 1Z4UA 1U4BA 4DR7F 2V8HA 2W25A 1YRUA 3C14A 1WJ9A 1UVJA 3K2YA 1K1QA 2UU9J 3BKTA 2XYPB 2HMIB 2GQ2A 2J0WA 4HTJA 3HHLA 2I38A 2ROEA 4ZVTB 1NMEB 4ZP8A 4ZVHA 2AQ4A 3T1AA 1KHVA 1ZAXA 1E6VA 2F8EX 2RF2B 3GZ7A 2FJEB 2CQHA 2VG5A 2ROGA 3OR2A 5BR8F 4YP3A 5DG7A 4D3GA 3C3LA 2JEJA 4DR6J 2ZC4A 4RW4A 3VVUA 1PCAA 3VAJA 4OI6A 2VG5B 2GJ2A 1X31C 3OR2B 1JWWA 3VAHA 2XZDB 3UO0A 2V2ZA 1FRMA 1DBDA 3L09A 2WOMB 4WFZA 2F63A 3HO1A 3TAMA 1GTEA 3ICLA 5EX3A 4DL4A 1F3VA 4ZPDA 4RU2A 1RISA 2AYBA 5ETQA 2J9CA 3EVOA 4B9MA 1BQMB 1S79A 3NCPA 5KFIA 1FT8A 1H7WA 1X4BA 3BM7A 4KR0B 4WE1B 1FNMA 4Z2XA 2B4OA 2UUCJ 1WF1A 3GPAA 1UEKA 2IDEA 4K59A 2ZITA 1HYSA 5C7PA 1BQMA 2O01C 1RXOB 1T9VA 2ZDPA 3NAHA 4DQQA 2XYGB 4WFAQ 4OJHA 2MYFA 4EZ9A 3I0RA 5E33A 1WTBA 1CJKB 3N6NA 4N76A 4WF9Q 3B6BA 3MR7A 1NK8A 1Q8KA 4HLBA 3EPIA 2D1CA 1NK4A 3VHQA 4R0EA 4GKJJ 2BKNA 3OTBA 4CH1A 1P27B 3HKZD 4LUBA 2AGOA 5HMYA 1RT3B 5KG6A 1EQ0A 3ZZYA 2RD5C 1AB8A 3AD9C 3VAKA 3CD6S 1S1UA 5KG4A 4A47A 2GHWA 3MM6B 2FUG9 5ADZA 1LW2A 3Q8RB 1X9MA 2SXLA 2FZGB 2D3UA 3B54A 2VFVA 3UNYA 3CCUS 3QT7A 2PDAA 3QGGA 4DX8H 3KHHA 2QA2A 4GRSA 2BR0A 2IVFB 1ZAVA 2Z4PA 3ISND 1GNKA 4CRJA 3RB3A 1RAHB 4M5MA 2OJ3A 1ZETA 2W01A 1V6HA 4GO5X 4DXLA 4X65F 4QZVB 4PG5A 4EO8A 1RGVA 2EFQA 3QT6A 4JI0J 2UUAJ 3KXDA 4Y65A 4NI2A 4URGA 5AXNA 2KN4A 3DGPA 1RQ0A 2RAQA 1RAFB 5B08A 2Z0GA 4LF1A 2HAIA 4NA1A 2OHDA 2G0JA 3H5XA 4NL5A 5FIIA 1KBRA 1SL2A 3C15A 3EGZA 3KK3B 3T19A 2J9DE 2W4PA 3MPYA 4L76A 5D3GA 3TA1A 1QLNA 1IKXA 4O44B 3IRXB 5E3RA 4Y0FA 1S99A 2HRYA 2XCPA 1HWKA 1U1LA 2N4DA 2HHHF 3FFIB 2VBZA 2HLUA 4HEA9 4ZPWR 2I1RA 2BE2A 1BMQB 1Q53A 3CO9A 3I0SA 2L9NA 2V8GA 5E3QA 4JOUA 1R0BG 1VQNS 1RAAB 2HGNA 2JLGA 3U02A 1SH2A 2B8QA 1VMBA 3POTB 1Z1ZA 3V6DB 4ICLA 1GXLA 4MK7A 1VS3A 2BV3A 4JI2J 1WF2A 3M30A 3UWTA 2Z2YB 2CADA 1RU1A 2PFDA 4X62F 1L3VA 1YVFA 2HNZB 2RRAA 1QDUB 3ENWA 2ZH5A 3VGUA 1VRUA 1T8EA 3CJ8A 4U8VA 2B5JB 2GGPB 2QV6A 1BD6A 5CHCB 2HS3A 3M9NB 5FDLB 1FD2A 4KSEB 3OL6A 1DURA 2B0GA 3RZAA 3S6EA 3DLBA 1JKHA 2LEBA 4QQBA 2LU1A 2ZD1A 3OVSA 1JLEB 2XMMA 3BZQA 1D1UA 4IR9A 4ED5A 4NLTA 3I31A 2OPQB 4RUAA 4OZJA 3CCMS 4NI2B 2L48A 4Y28C 4Y2AA 2QA4G 5F9NA 4IDKA 3U1MA 5DG8A 4OIXA 4ECWA 1UW4A 2KVQE 5HN0A 3Q8VA 2AYEA 2BJ8A 2YNFB 5C42A 2MQQA 4F4YA 3NBPB 3TUPA 3MM9B 4MJKA 3M4XA 2UVWA 2R8GA 4BHQA 3HVRA 3C19A 1WHWA 3M1VA 4OFZA 4BWMA 2B51A 1SJ3P 1IM4A 2ZOFA 1SKWA 3CJRA 4BCAA 1M90T 4G3IA 4KHPF 2DIVA 1EHWA 3MMAA 2G2YA 3KJQB 1HIYA 3L7PA 1NRKA 3MAHA 2HYIB 2W7AA 4EI2A 1JIHA 1NSPA 3EPGA 1KVJA 3G87A 4AFFA 1B7YB 1LWEB 2NXJA 2BW2A 5F8IA 4PUOA 2WK4A 3MM7A 2YKNB 4FVCA 3ZTQA 3GJQB 4ELTA 4UQTA 2WVCA 3P6YC 1JB0C 1H0HB 2DGXA 1HKAA 3DRSA 3ENQA 3KDOA 4Y34A 2YVSA 3GYXB 1JNRB 2CZ4A 3TZYA 4ES1A 2X1AA 2LVWA 1Q86T 3MD1A 3DLHA 2I5JA 4P9SA 1NHUA 4CT9A 1VRTA 2AX1A 3J7Z5 1RP5A 3BS9A 4PXBA 2DO4A 3RW6A 1WC3A 3HVWA 4YDXA 3BSOA 2OH2A 2OI2A 3T5KA 4B9UA 4ATNA 2OGUA 3DLEB 2GC8A 2J0XA 2AF6A 2ZE2A 1U1RA 8RUCA 1NKEA 2O66A 5GVQA 1L5UA 2XS2A 1FX2A 1TAQA 2HBYB 2F8MA 1HNVA 2AV5A 2ZD1B 5KFMA 4DF8A 2RE1A 1QSSA 1H2UX 2PEHA 5IWAJ 2GIFA 4NLDA 2WVEA 3CEDA 3GTYX 4MIAA 1FK9A 3W66A 3DRRB 4OHWA 1B0TA 3PG9A 2XY6A 1TFWA 4LFAJ 1VIXA 2HRUA 2Y1IA 4LR9A 4USMA 4ZVEA 1Z2LA 3C16A 3GR1A 4LSNA 3W61A 3PEHA 2CQ1A 2R2UA 3F56A 3SSSA 2CJ9A 2FQQB 5AJ3J 3K5OA 1M1KT 2M3DA 1RHMB 1QM9A 5HLFB 1QTMA 3AAWB 2Y0BB 2GVZB 4CLPA 5CH7B 2CFXA 5KFTA 2ASYA 2DXFA 3KKFA 1N5TA 2DNZA 4FS2A 4YY3J 1T11A 3LAKA 2GVZA 4W98A 3MAAA 2HURA 3UCUP 5HATA 2XBPA 2VU5A 4ZLLA 3OT9A 1V5VA 3DRPA 1B7FA 2A1BA 2R2SA 2BQRA 4PG6A 2C2NA 3Q2SC 4DN9A 2ASDA 3I4PA 2GQCA 4NCGB 1HBMB 1S12A 2DB1A 2OEJA 5AXMA 4A46A 2VKZG 2VH7A 3EX7B 2H65B 1MN7A 4U7CA 1XWLA 1TR0A 5CZXA 3G82A 2RQCA 4CI0B 2LQ8A 3MM8B 3AXKA 3OLAA 3SZ2A 2EFOA 1HMVB 2FLOA 2AKWB 1R6VA 4KE5A 5HANA 1SPBP 3W2VB 2APOA 2RU3A 1U1OA 4ELVA 3R2CJ 4DV0J 2R42A 4G1QA 1H38A 2B4VA 1T9UA 3N0VA 3R1HA 1NJXA 2V63A 1RZMA 3OJUA 4FXDA 4ZJOA 2E1RA 5IM0B 1X8DA 3PDNA 5LSOA 2HFZA 2RRBA 2VQFF 4I67A 2OPRB 1HBOA 3N79A 3ZZUA 2NQPA 4I7FB 2DNNA 3BREA 2RSQA 1GAOA 4FKXA 4Q2LA 2B9WA 1Q5VA 4F4WA 3CCQS 2ZKUA 8AT1B 2HWHA 2YBVA 4N41A 4RR5A 4IR1A 2OPPA 3NGSA 3OTCA 5GMDA 4JV2A 3GYGA 4NMLA 5B09A 4U67Q 2FVCA 3GIJA 2BABA 5H9EJ 4J5OA 1SH0A 3KMSA 1IWGA 2QLWA 2RVJA 5ETPA 3W9IA 3NGRA 2VFTA 4DUZJ 4RBTA 3KOAA 1Q78A 1BQNB 1HA1A 2IDLA 1E6VB 3FBEA 1HR0F 3GJTB 2YWGA 4ZCMA 2LFVA 4MKYA 3M2VB 3E51A 5E5NA 4FF1A 2C3YA 4WE1A 4RUCA 2UXCF 5KFRA 2PE8A 1XNRF 3U27A 2ZH8A 4B3MF 2DNGA 3B4MA 4TYAA 1S6PB 2IAJB 1Q8BA 3CSKA 3SV4A 3FGVA 2MTLA 2KHCA 4NXNJ 2VONA 2WSEC 1E6YB 4P2FA 1NNDA 2G1HA 4WFXA 4JYAF 4X4QA 3IAS9 2QA1A 3CD5A 5KFSA 3MFIA 4ED6A 3GG1A 3GV7B 2X3GA 3ITHB 3BBCA 1KEKA 3H5SA 1XNRJ 3H40A 1QE1A 5F8JA 1KONA 4USUA 4KH0B 2NS1B 3SFGA 2A2DA 1X60A 2FHKA 5CA5A 3HM9A 3VTIA 2HKEA 1IJEB 3OVBA 4CLFA 1KLMA 3PEJA 5KAKA 1HD1A 4PG7A 4OYZA 1QE1B 3PO5A 4DSIA 2R7XA 4DUZF 4DR6F 3KNGA 4PQAA 2OPPB 2D41A 1VYAA 2OTJS 2C2KB 3IBWA 3LH2S 4LRBA 4J90A 1S1TA 2DEIA 2QMXA 2UV8A 2W4CA 3C14B 3HSZA 2YKAA 3MEDA 1WHVA 1U09A 4KKOB 1X5SA 5D0RA 2ZZMA 2OD6A 3CJ0A 5DLGA 1ICEB 4UZBA 3BO4A 2IRUA 1P1LA 2ZC3A 3KWMA 3X3UA 2IVMA 4NZ0A 3M05A 2HVDA 2HWIA 1RHRB 5BYSA 3IWNC 3R5CA 4I56A 1QAYA 2NSCA 3CB4A 1Y3JA 5G0RB 4EFAC 3PIOQ 1M5KC 2OKQA 4HDHA 1S57A 4MH8A 1SIZA 3H42A 1UPMB 5C25A 4OQJA 4WXOA 1N36F 2MLXA 2R7SA 3FQLA 2V4JB 1WD6A 3BGRB 4RJVA 4JI5J 2MKJA 3ISZA 1CJUA 2KI2A 3UNGC 1U1MA 4CO0A 1VQ7S 4DSLA 3DOKB 1U0HB 1X4HA 1B4SA 1RUSA 4G1PA 4DR2J 4CZCA 1VK3A 3EICA 5EDWA 2Y1JA 3M32B 2D9OA 1U0HA 2A6MA 1RBLA 3BR8A 2V9KA 4M94A 1FVSA 1RU2A 2KG1A 1LFWA 2BACA 4ID8A 2MDAA 3UN3A 2YWFA 4ED4A 2G2OA 1S59A 3G96A 1RYRA 2XO7A 1HQUB 3DMJB 4DG1B 2HGLA 4KJIA 4FYVB 2OD4A 4USWA 5B0DA 1OYDA 1KP6A 2CNLB 2ADCA 5LSRA 4DMZA 4H4OA 4K4TA 1HQUA 1RT6A 2KXFA 4USKA 1NB2A 5HL7Q 1FFSB 4NLUA 4C3KA 1XQIA 1YITS 2IA0A 4LF5J 2HQDA 1KLNA 5DDRC 3BKFA 1ZPVA 2M5YA 1DLOB 4IFVA 1I6JA 2AYGA 1HNWF 4LT6A 3IMQJ 4ENOA 4Y2IA 4DN0A 4NEYA 3KLIA 3UDEA 3KLFB 4FXWA 4FZVA 4FYDA 1TQLA 1RT5B 1XBWA 1DLOA 2CQ2A 4FYWB 1CS4A 2CDQA 2W2PP 3FMBA 3GG0A 3BQ2A 1DHMA 1PJ5A 1SXLA 3PJXA 2VA2A 1X9SA 1X5TA 3TUJC 2Q6CA 4PPZA 4Q8EA 1X5OA 5B0EA 2J7UA 2BE7D 1T94A 1HWLA 2DPIA 1B70B 5KFYA 2WSFC 4DV4J 3MMCA 2YXLA 4B3RF 2DNQA 2QYGA 1JMTA 5D3GB 4B3TJ 1IKWB 1S10A 2DNRA 4PWUA 3WBZA 5F0UA 1G1XA 3NAIA 1KFDA 2JC1A 4IG0A 4IH6A 3UI3A 1NK7A 3T5LA 4WZQA 3RRGA 1WHYA 1N5YB 3HLUA 3PX4A 4KHMA 2E5LF 3HCXA 4ED7A 3I0SB 3KLVA 2QO3A 1VQSA 4ZVSB 3KJVA 4J9QA 1S0VA 4A8SA 4ZPCA 3BYRA 2HFVA 5KFEA 1B64A 1UVIA 3V2UC 2ZH1A 2CQPA 3UW1A 1FRHA 2HFNA 2QL9B 1PYOB 4HHHA 3AXMA 2VFSA 3EDRB 1BUXA 4RWWA 4URQU 3JS9A 4DPOA 3LPEA 3H5YA 3T5JA 4U96A 1U49A 1F1BB 2K1RB 2J76E 2MKCA 3DDKA 3MM7B 3GV5B 2BQUA 1S9GA 4K2XA 1S97A 3B8HA 2N3OA 2RT3A 4ZHRA 1U6FA 2KJWA 3M6XA 2B5JA 2GGPA 3OTDA 2J9DA 2PI4A 2YH1A 2LLZA 2IRYA 1NO8A 4NWBA 1BXNA 1OMSA 2PMZD 5KFLA 2FGOA 2XZTB 2X1GA 3PACA 3H25A 2W7PA 3R7SB 3H2LA 1XJWB 1NJZA 2PI5A 3LTOA 2ZH4A 5EX0A 2EFVA 4DV6J 4J9VA 4GVBB 4FBTA 3LWMA 2W1BA 1FJGF 2HS0A 2M8DB 1RAIB 2BYCA 1DFDA 1FDDA 4I2PA 2KG0A 2C28A 1D9DA 3H2VE 1N5QA 2YNFA 2VPWB 4LIWA 4QPTA 5IQQA 4NPOA 3S01A 1HW8A 2L9DA 3PRVA 4TQRA 2W9CB 3K57A 1IKWA 3AA8A 1NK0A 2UXDF 2DRDA 2RHSB 1SCJB 4ER8A 3RR8A 5KFGA 4C6AA 3WC0A 4B9TA 1SH3A 2XMVA 4YQWA 2CJQA 3KHGA 4JI4F 3NY0A 3G86A 1JLFB 3P8BB 1SJFA 1TUVA 4WBFA 1CULA 1Z2ZA 1Y5LB 3WDOA 1IKYA 1RTJA 2YPZA 5C24B 5MLCV 2ZNYA 3KK1A 4ZN1A 1S9EB 3NWGA 3J80U 1KOHA 3RAMA 3LWLA 5KFBA 1YGYA 4F8RA 2QLXA 1S6PA 1SVDA 1R8PA 2F65A 3HD1A 1MMNA 3HDSA 4QIGA 4ZPAA 2YQ1A 3WIVA 3M9OB 4EYHB 2JNJA 4ED1A 3IWLA 3RBXA 1D3WA 2VPYB 1TKXA 4NRTA 1D8YA 1R8BA 2CQ3A 3C46A 5KFXA 4DL2A 1MG7A 5L1KA 1Q81T 4KHRA 4FF3A 1HNZJ 1PGZA 3BDPA 1GH8A 5HQ8A 3K58A 4ECTA 2R2RA 1U0SA 4P7TA 4CCHA 4WU2A 1N32J 1VJQA 3M8QA 1RADB 1RABB 2HHXA 1JLCA 1FRKA 4RZRA 3QNWB 3Q8PB 4DV1F 2DNKA 1WKJA 2VASA 3Q83A 3DOMB 2EI5A 1KQGB 4RPFA 1EETA 1PIEA 2YNHB 4OYPA 1DTTA 2DNYA 2BJ1A 4NLVA 1TKZB 3BH7B 1GTHA 3D67A 3IS9B 2AYMA 2VPXB 3E3XA 3IO1A 4IO1A 3OFGA 5E3AA 5JVGQ 1H2VZ 3RAXA 4PXCA 5F3TA 5IS2A 1REVB 1U1QA 3W3SA 2PSZA 4GKJF 4IO9Q 3Q23A 3BPSP 4EEYA 1RA6A 2MKYA 2P2CB 1SJ4P 2HHHJ 2LEAA 4NLOA 1W7WA 2E5JA 3QRRA 5I4MA 2MQLA 4KGXB 3IWXA 1SC6A 1T9TA 2ZM6F 3CD7A 3BSNA 3FQKA 4FNHA 2VG6A 2IBOA 3QO9A 3E01B 1VISA 2F9DA 3MUVP 2FJDB 4LSLB 4JI6F 1QAIA 3CO0P 1R0AB 1WOPA 3VZHA 4BS2A 2MHNA 4L6V3 4R8UB 2CZVC 2WOMA 1LK5A 4X4SA 3DHXA 3BYPA 5HP1A 1QVGR 4F3MA 2K7KA 1G6BA 2UVVA 3J81j 2I9SA 4X65J 1KS2A 2YNGB 3A12A 4LFBJ 1R7IA 4JI1F 2FB0A 1T03B 1I3OB 3AA9A 4OYXA 4DZ6A 2W8KA 3D2WA 2UXBJ 4ZKAA 2PT0A 4ZN3A 1NLKL 4N77A 4G65A 1FF2A 4QWAA 3NEKA 2RUGA 3NRBA 4ZVQB 3QWUA 3A4TA 3EUNA 4PR6A 4TU7A 3F0NA 2XO6A 3OV7A 1NKBA 2RQKA 2HSEB 4WPAA 4JV0A 5J2MB 3QGIA 1DJ0A 1OSDA 2J8AA 3DFEA 1MWQA 3MURP 4NLXA 7FD1A 2UXBF 1IVZA 2NPFA 3CCRS 3D0HE 4M5KA 4KYZA 5IC6B 2V94A 1OY9A 2OAUA 1CJVA 1NHVA 4DSJA 2UXCJ 2VDHA 2VG7A 3OW2R 1CG2A 1K44A 3QIPA 1TL1B 2C2EA 3CC7S 2CPIA 2HNDB 3MM6A 3QQCD 5B0CA 2RF2A 2OPSA 4TKTA 4O3RA 3HHDA 5IT4A 1REVA 2YNIA 2ZBCA 4OYAA 3K8WA 4UZCA 5ETRA 2VG7B 1DARA 5GAGI 5E41A 4IOBA 2CPXA 1M5OC 1LKZA 2P9EA 3R2DJ 5BJRA 2YWWA 3NS5A 4RKUC 3W62A 2RUSA 1LNQA 2IM0A 3C6TA 1NKCA 4X4TA 3MPVA 1PSDA 1GMUA 2R7OA 3ZFVA 2VBXA 5CAAA 5KFJA 1XMOF 1WC5A 3R5DA 1N5VA 2IC3B 1LQ9A 3OHBA 4K4XA 1Q7YT 3RB6A 1NSAA 4G6VB 4YDDB 3QT8A 2DR7A 3FFIA 2Q3PA 1RT2B 3MMJA 5KT6A 3CJ2A 4DF4A 1L3TA 4WFYA 3TR5A 1U02A 3JTPA 1FEEA 1FRJA 2KZZA 2DPJA 2VC0A 3EE3A 1VBZA 5F9LA 1DZ5A 1HNXJ 4DG1A 3U7JA 2NXNA 3FCVA 4LRCA 1F5BA 2JRSA 4FKYA 3GB0A 5F3ZA 2RS2A 3PX6A 3T6JA 3GILA 2JOQA 1RT3A 4MIBA 5H9FJ 7FDRA 3GCWP 1PKUA 4CQ1A 2GMJA 3MEDB 5JXSA 4DSFA 2PA8D 1LWFA 3AB4B 4Q2MA 3SMZA 4DR5F 2HHTA 5EN1A 1LV5A 2YWEA 1GMWA 2R7QA 3QLHB 2VODA 1WDTA 1KQKA 2HQGA 1PBUA 2GFFA 4CM0A 2DD8S 3GFHA 2YNIB 3JAMU 1XR7A 4LF6F 2ALYB 4DR4J 4JI7F 1XEZA 2M4MA 5LJ3Y 5G0RA 3M2UA 4B3RJ 5KFHA 1T0TV 3NS6A 3D6HB 4QWEA 2R7WA 5C42B 4KGZB 4JV1A 2GAHC 2XGPA 3IM9A 1MWZA 2OMLA 4FS1A 1NK5A 2H4WB 2EFNA 4CNZA 2DTJA 4KGKA 4AD6A 2MZJA 2MQMA 3TAPA 4JB8B 3GE9A 3UR3C 1MU2A 4LF9J 1YWXA 1N5YA 3CDBA 1TMMA 4JI8F 5A76A 1CQMA 5GADU 1VDHA 3ENVA 3UD4P 2V8PA 1YTYA 3KNAA 2B9EA 1R0CB 2F1FA 3MWBA 5F0WA 5IWAF 4DV2F 2DK2A 4LBIA 2WVFA 1CJTB 3CC2S 3W2WB 4Y6IA 1OY8A 4LVNP 3W9JA 2H4YB 2X1BA 1ZA2B 1C0UA 4MTPA 2DNOA 1KD1T 2R3VA 5CQGA 1RTJB 2HHPA 4M95A 2QRRA 1G4CA 1S7HA 3M8SA 3KJNB 3HSJA 3M30B 3M8YA 1M5PC 2E5LJ 3G6XA 4PUOB 2QMWA 2GZOA 3LGMA 1RTDB 2ZE2B 3C8YA 3UPFA 3J7ZT 1Y5IB 2KT5A 4QJVA 1OSCA 3MM8A 1RWKB 5ETKA 4ERDA 1NCLA 4K0KF 4YY3F 4J9MA 1YBAA 2CQ4A 4MYTA 3KTQA 1QUVA 3B4DA 4OYMA 1FE0A 2OUGA 2I5JB 2NPIA 3ZO7A 5D6GA 1S9GB 3L7OA 4QW8A 4F04B 1YX2A 4KO0A 6FDRA 3LP0B 2CJYB 2OSRA 3DXBA 3T41A 3G8SA 4ECVA 4EYIB 3BN4A 5IM0A 1FKOB 2FJXA 2HHVA 2KFNA 1FDAA 4R25A 1VK8A 4C7QA 2BVZA 4KPCA 3UVJB 2V6AA 2C2MB 2JX2A 2XMWA 1VOMA 2V8DA 3NMAA 2ZH7A 4C11B 4DDFA 1RLCL 5A8RB 3B78A 2OFGX 4J9LA 4CH0S 5M2RA 1C0TA 4AL6A 5HSPA 2AJFE 4GVBA 1XR6A 2C3PA 2Y0SD 1HPZA 2YQ3A 1EB0A 3TO8A 3TUIC 3OXLA 3QZ8A 3OFHA 1BGXT 2GHPA 4YR2A 2OLWA 1UW9A 2BRLA 1ZPWX 2CQ0A 2ALZA 5IXUA 2EFGA 5LMNF 4PG4A 1TAUA 2BM1A 3CCJS 3H7HB 4F36A 1N33F 1BQXA 1RBOB 5LT5A 4UTGA 2Y1LB 1T9YA 3CJTA 4DV7J 1FEHA 1KTQA 3M6UA 5KG2A 2DNMA 3MOJB 1TKXB 3L95X 4RWXA 1UPPA 1YDLA 1XNQF 3FJ2A 1FCAA 5T7LA 1HHSA 5A8WA 1FESA 2XULA 1DTQB 3ADAC 3HFVA 3QSIA 5CYJA 2MQOA 5DM6Q 3D7SB 3OL9A 4QWDA 2EKYA 5HVFA 3WQPA 3BO2A 4UF4A 2AMCB 3MI7X 2B4PA 4PZVA 5A8WB 2HIYA 1GK8A 2HFUA 2GIQA 1UWAA 1TL7A 2E1AA 1BWVA 1RKIA 1IJFB 4ZLJA 5KT3A 2MKIA 3PZPA 2A6OA 3BDEA 2FVSA 3JSBA 3I82A 5KT2A 3BBFA 2KFZA 1A6LA 3JQKA 3UVJA 3IRWP 1W2BR 2J7KA 4NASA 2IJNA 1URNA 4C11A 3THTA 2EKNA 2XYHB 1U8WA 1H6KX 1N33J 2OPRA 1I94J 2Q6BA 1U26A 3R6GB 4BWJA 5CYQB 2C2DA 4I7FA 2HMIA 2UUBF 1Y10A 2EK1A 3KG1A 4O4GB 2N4CA 1V3SA 3MTJA 3SCJE 3EZOA 3M7VA 3FEXB 5K8NA 5D4LA 1NBEB 5HLFA 4X4NA 3QJLA 4IH7A 2AEMA 1S9FA 1LXJA 5DETA 2CDRB 1QTNB 2QLBB 3HVTA 2DCUB 4I64A 5HBMB 4Q44A 1UCNA 3DLJA 1KRPA 2OPSB 2QEXS 5D4OA 2CJXB 2FY8A 5A6WA 1RWPB 4DWIA 3OHAA 3TVKA 1T95A 1VGYA 2E1PA 4IFYB 4RO0A 4DFMA 4NCGA 4NLSA 2M8HA 3N6MA 2KXNB 2HQCA 3LF0A 2V34A 1RCXB 5E2QA 4N56A 3QWPA 4ZK7M 5BR8J 2P5VA 4WXWA 3R7BB 2VQEJ 4J9PA 3OL8A 2H5EA 2XM3A 1RTIA 4K4YA 3JTOA 2A2CA 4C8MA 4CDIA 4MFBB 1KC8T 1J5OB 5IV3A 1UFKA 3Q0AA 4F4XA 1MMDA 4YR0A 1NHKL 3K17A 3M2RA 4S0MA 5B0BA 1JJCB 2EFPA 2X51A 4CNYA 4LQ9A 1HHQA 2CJAA 3ONQA 4MK9A 5JMNA 4O44A 1SQEA 4N8NA 2BOPA 3M32A 3EZ5A 2EG1A 2LKZA 1NJIT 4PG8A 1ZYQA 2MKKA 2LDYA 2VC1A 3AH6A 3CMQA 2F7VA 2ZJRQ 1ACMB 1VQOS 4FP9A 4HHJA 2U1AA 1PJ7A 5L46A 2IY5B 5IT9Y 4CLLA 1VHIA 1FD8A 3GFYA 2UUCF 4OZ0A 1UWBA 2GJIA 4QOTA 2DISA 3WC2A 1CJVB 1AUDA 1U2CA 1TV6A 2C3UA 3A3NB 3CE8A 4IKAA 2BX6A 1FA0A 4ZPTR 1YHQS 1RSCA 2AEJA 2DGSA 3PHTA 5J1NA 1RI7A 2D74B 1ZA1B 2XY5A 1FDNA 2WB4A 3H90A 2A0FB 4NZ7A 5J2MA 1TKZA 4OZ5A 5DGAA 1A7GE 2VKRA 4UOGA 4I68A 4WJBA 3H98A 4DL0C 2R8JA 1P6TA 2GVDB 4WP8A 1ITPA 4NZ6A 3PXGa 2R8IA 3LQVA 2PN6A 3US5A 4IFVB 2BBEA 1VR6A 4ZP7A 4CYUA 3HD2A 5L9XA 3TWZA 5J1PA 4NLRA 5C25B 2GVDA 1HFEL 3MOZA 1KVKA 2XWYA 1ULRA 3CCVS 4UOFA 5GAGU 2B43A 4QR2A 1CPZA
chains in the Genus database with same CATH topology
1DY3A 3MCMA 4M5NA 4AD6A 1EX8A 1RAOA 2CG8A 1RU1A 1Q0NA 3QBCA 1TMMA 3ILIA 3ILLA 5ETSA 5ETTA 1EQMA 1EQ0A 4M5IA 1KBRA 2F63A 1RB0A 3HSZA 3KUGA 4M5KA 1HQ2A 3UDVA 3HCXA 5ETLA 5ETVA 3ILJA 5ETQA 4CYUB 5ETOA 1TMJA 1F9HA 4CWBA 2BMBA 3UDEA 2QX0A 5ETKA 3MCNA 3IP0A 3HT0A 3UD5A 2F65A 5ETNA 3HD1A 4CYUA 5ETRA 1RU2A 1G4CA 4CRJA 1IM6A 3HSGA 3HD2A 1HKAA 3KUEA 4M5JA 3HSJA 3KUHA 4M5MA 5ETMA 4M5GA 1RTZA 4M5LA 3HSDA 3ILOA 5ETPA 3MCOA 1CBKA 4F7VA 4M5HA 4PZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DY3 A;  3MCM A;  4M5N A;  4AD6 A;  1EX8 A;  1RAO A;  2CG8 A;  1RU1 A;  1Q0N A;  3QBC A;  1TMM A;  3ILI A;  3ILL A;  5ETS A;  5ETT A;  1EQM A;  1EQ0 A;  4M5I A;  1KBR A;  2F63 A;  1RB0 A;  3HSZ A;  3KUG A;  4M5K A;  1HQ2 A;  3UDV A;  3HCX A;  5ETL A;  5ETV A;  3ILJ A;  5ETQ A;  4CYU B;  5ETO A;  1TMJ A;  1F9H A;  4CWB A;  2BMB A;  3UDE A;  2QX0 A;  5ETK A;  3MCN A;  3IP0 A;  3HT0 A;  3UD5 A;  2F65 A;  5ETN A;  3HD1 A;  4CYU A;  5ETR A;  1RU2 A;  1G4C A;  4CRJ A;  1IM6 A;  3HSG A;  3HD2 A;  1HKA A;  3KUE A;  4M5J A;  3HSJ A;  3KUH A;  4M5M A;  5ETM A;  4M5G A;  1RTZ A;  4M5L A;  3HSD A;  3ILO A;  5ETP A;  3MCO A;  1CBK A;  4F7V A;  4M5H A;  4PZV A; 
#chains in the Genus database with same CATH topology
 5DO2 A;  3THP A;  4PWD A;  3EGW B;  3KK3 A;  2XSJ B;  2A18 A;  3Q8U A;  2D9P A;  4ECR A;  3EMT A;  4KV8 A;  1R0A A;  3HFZ B;  4IQM A;  1NUE A;  5KFZ A;  5L38 A;  4ED8 A;  1AFI A;  1RJJ A;  3NS7 B;  3W5X A;  1N5S A;  2QMU B;  3PJ9 A;  4FN5 A;  1UET A;  4K2J A;  2JC0 A;  3M2R B;  2Q1L A;  5KFU A;  4R5P B;  3FNN A;  4KV8 B;  3UDV A;  4KY3 A;  3CCZ A;  3OXF A;  1VQK S;  1WSV A;  1MWY A;  3H8Y A;  3S8S A;  5GAE U;  4W92 B;  3E2E A;  3VQT A;  3R9L A;  3K5P A;  5KG0 A;  1YJN S;  2XLI A;  1SV5 A;  3N28 A;  3T3F A;  1CJK A;  2KRB A;  3BGL A;  1V3Z A;  3UQS A;  5HQL A;  4Z7C A;  1FXL A;  2HQ3 A;  3T1H F;  3PY8 A;  4P71 A;  1N52 B;  5LL6 d;  2ZHB A;  2MLZ A;  2DGV A;  1Q8L A;  3ELH A;  1K9M T;  2GHV C;  1H7X A;  1EX8 A;  2HQI A;  2J8S A;  3NKY A;  2KB2 A;  3GR0 A;  3PKY A;  3ZTS A;  1AXQ A;  4L73 A;  2ROP A;  1RTD A;  3CDE A;  5FD1 A;  4ALZ A;  1H2T Z;  2VFR A;  4NEZ A;  5IOL A;  3AJ1 A;  4PCQ A;  2VIH A;  4DS4 A;  5B0G A;  4WK3 A;  1KTV A;  1TL1 A;  1Q4R A;  1VLO A;  2KVI A;  4RX6 A;  3HHL D;  3FVY A;  3TJ8 A;  3VGV A;  1VRU B;  1NPK A;  4QYZ J;  3HT3 A;  3T9N A;  2BOA A;  2C42 A;  2XMU A;  4LF5 F;  4CH7 A;  3ZNU A;  3O6Q A;  4QIV A;  5D4N A;  5EWF A;  5D0E A;  1XMQ J;  1RWW B;  2Q43 A;  2QFI A;  1LK7 A;  3GIR A;  4K0K J;  2D3Z A;  1NZ8 A;  4NYO A;  1SJR A;  4QBU A;  4DR1 J;  2ZH2 A;  1S1V A;  2RIL A;  5THW A;  3SEO A;  3TAQ A;  1RTH B;  2E7W A;  1O51 A;  1Q7L B;  1R8C A;  2OPQ A;  3QJP A;  2MQN A;  1N34 F;  3D1Q A;  5KFF A;  5J2N A;  3A3O B;  3IRX A;  2FGC A;  4JP8 A;  5B0F A;  4ECX A;  3MMC B;  4U6P A;  3TYT A;  2DH9 A;  5J2N B;  9RUB A;  1JLG A;  3W9H A;  9ATC B;  1WOR A;  3DU6 A;  4HYK A;  4PQU B;  2WRM A;  3EVW A;  1UZH A;  1JXL A;  1EKR A;  2DIT A;  4W90 B;  1WG5 A;  1S77 D;  3K89 A;  1AZS B;  3T9Z A;  3CJS A;  3R5A A;  4LR7 A;  2GO9 A;  3W2W A;  5HVH A;  2VA3 A;  5EWE A;  2VBY A;  3RG6 A;  4CO1 A;  4XTT A;  3KLG B;  1R31 A;  3K5L A;  4DL5 A;  2G0I A;  3BR9 A;  1R3N A;  2H54 B;  1U2R A;  4TYB A;  4YOE A;  1RT7 A;  2LA6 A;  3LP0 A;  4LRF A;  5GAH I;  4FDF A;  1JJ2 R;  1S1X B;  2NSB A;  3ULH A;  1S0M A;  5FDL A;  3C6U B;  2DXD A;  5KG1 A;  1TL4 A;  1VRT B;  2BJ7 A;  2DHH A;  5F8M A;  1FJG J;  4J9S A;  3HI9 A;  1SJQ A;  4NMX A;  4RNF A;  4HI1 A;  4X4O A;  5E3P A;  2IMW P;  4FF4 A;  3G9C A;  3SFU A;  2RKI A;  3UFC X;  5B7W A;  5A8R A;  4OX9 F;  3SQO P;  3I96 A;  2L08 A;  4L72 B;  3D5M A;  2ZBR A;  2G2Z A;  3A8K A;  1FNO A;  4RNH A;  5GAD I;  1XNQ J;  4MKV A;  2UXD J;  2VD3 A;  2ZH6 A;  5KTQ A;  2V67 A;  3CJ4 A;  2RRN A;  3H0P A;  2KYZ A;  3RBD A;  2C22 A;  3OSN A;  2ZKT A;  4C3L A;  2WW4 A;  3MEE B;  1S6O A;  3QMQ A;  3TI0 A;  4LBP A;  2RML A;  1AFJ A;  1IWA A;  1FKP B;  3JSM B;  2CQG A;  1D09 B;  3MM9 A;  4A8M P;  2OO4 A;  1GMW D;  3HSD A;  2GNK A;  2GV1 A;  4WP3 A;  4WFN Q;  3O5T B;  4ID5 B;  2LU2 A;  4CLK A;  3CXC R;  2B56 A;  1NSK L;  2W24 A;  3CIM A;  4IG0 B;  2HVE A;  4ES3 A;  2W9C A;  1R27 B;  4DR2 F;  2L41 A;  1CUL B;  4OI0 A;  5DRK A;  1YBT A;  5CYM A;  5KT5 A;  5I42 B;  4OLP A;  5C24 A;  3W8G A;  4PQU A;  4GMK A;  4E98 A;  5H9F K;  4O0N A;  2ZDO A;  4MKB A;  3ZTR A;  2IM1 A;  3MXH P;  3TJ9 A;  1HD0 A;  4OL8 A;  1IBM F;  2FVQ A;  1WDD A;  1B3T A;  4PXE A;  2LEP A;  1GFW B;  4DBQ A;  3D1H A;  3UCZ P;  3GMG A;  2ZZT A;  1SUQ B;  1EP4 B;  4KB7 A;  2GAG C;  2B9X A;  3MPU B;  4U8Y A;  3C6U A;  5FLX U;  1CBK A;  4A8X A;  4M5H A;  4DCO B;  2KTQ A;  3SXL A;  1DTQ A;  3OSP A;  2POK A;  1HYS B;  1K73 T;  4B02 A;  2XG8 A;  3FK4 A;  3IC1 A;  3PFO A;  2CJB A;  1EP4 A;  2Z57 B;  5CD4 A;  4HAC A;  5DJB A;  2HQF A;  4RW9 A;  5LMN J;  4URS A;  3I9V 9;  2E9R X;  3FC9 A;  3MEC B;  1EAR A;  5HO4 A;  2IA6 A;  2EWH A;  3TX0 A;  3AD7 C;  4A48 A;  4DV3 J;  4B3M J;  2YPY A;  1UVN A;  4OI4 A;  2Q79 A;  4KTQ A;  4AL7 A;  2YKO A;  1TL3 A;  4DL6 A;  2GA7 A;  3TQ1 A;  4OZ1 A;  5DQI A;  3C2P A;  3HHE A;  4HKQ A;  1A9N B;  2WBR A;  2FHM A;  2AZ1 A;  4CO5 A;  3SQG A;  4DPU A;  3HT0 A;  1TL3 B;  4TVA B;  4DCJ B;  2F4V J;  4UY8 5;  4A8Y A;  1KDN A;  1HQE B;  2E5G A;  4WIQ A;  2FHJ D;  1WTF A;  4DCP B;  3K5M A;  5BXI A;  2DY9 A;  3CWJ A;  2NZC A;  1FJE B;  1QJH A;  3P45 B;  3R5B A;  4UW2 A;  4J9N A;  3BEG B;  1NM2 A;  4MIW A;  1X9W A;  4ILR A;  2PEB A;  4ZVP B;  5HBM A;  4QIF A;  3JXO A;  2BE9 B;  2NR0 A;  1LXN A;  4Q5V A;  1K8A T;  2ZUG A;  2OP5 A;  2DNH A;  3IGN A;  4M5I A;  4WFB Q;  2ZWO A;  4DS5 A;  2YY3 A;  2FZC B;  5AE3 A;  1I51 B;  3NGU A;  5K5M A;  5HP1 B;  3NL0 A;  1M1H A;  1IBL J;  1LFP A;  3P96 A;  3P3D A;  3HKW A;  3BV8 A;  2R7T A;  3C15 B;  4H4K A;  3W2V A;  4EBC A;  1ZTW A;  1YI2 S;  2E9T A;  1RT2 A;  4IRK A;  2XS5 A;  3PYE A;  3VV2 B;  4LSL A;  5KOW A;  4DR7 J;  2IAJ A;  3R8Y A;  2AJQ A;  2DGQ A;  4RW8 B;  4ITS A;  5KG5 A;  1EKS A;  2PMW A;  2QSF A;  5KFA A;  2MGZ B;  1KKH A;  4GC7 A;  3ZTP A;  2MZQ A;  2ZVS A;  1SV5 B;  4C8Z A;  4RW9 B;  1N36 J;  4USH A;  3NCQ A;  1D8Z A;  1WKL A;  4HTI A;  3MEC A;  4AE5 A;  2ZHA A;  2ASJ A;  1NZA A;  1ROF A;  1SI9 A;  1XER A;  2DEJ A;  4WCE Q;  2MXY A;  1TTH B;  4ED2 A;  2NCK L;  3POT A;  3N5B A;  1N6Q A;  1VQ9 S;  4O0I A;  2CAJ A;  3I0R B;  1RCO B;  3ILI A;  2QA4 S;  2F8H A;  3QFW A;  3K59 A;  3LA0 A;  4FBU A;  4DPT A;  1PIL A;  2M52 A;  1A0O B;  5HMW A;  4P73 A;  3LP2 A;  3VCD A;  3OUY B;  4XPC A;  3FEY B;  1HQE A;  1NEE A;  1YJU A;  4Q0B B;  1R6Y A;  4OI1 A;  2UUA F;  3DLG B;  3G8Q A;  2M0G B;  4GKK J;  1JX4 A;  1AA1 B;  2VOO A;  5KFV A;  1FWP A;  3HSG A;  5MAO A;  1F5C A;  3MR6 A;  2AGP A;  3RGI A;  1Q5Y A;  3PNI A;  3QIP B;  4EK2 A;  1XTZ A;  1JLE A;  4ZP9 A;  3LAM A;  4X4P A;  2FJA B;  1J27 A;  4X62 J;  1CS4 B;  4ZIT A;  3E8O A;  1XC9 A;  4LSZ B;  2DNL A;  4ZCI A;  2KRR A;  3P5B P;  4A4J A;  2NRE A;  3GP9 A;  4LF7 F;  2E7V A;  4B9L A;  1TEL A;  2R4F A;  2QTW A;  1HNX F;  3ZZP A;  2QLF B;  3R5J B;  4DQP A;  3Q89 A;  4JI0 F;  5F8N A;  1MU2 B;  2DO0 A;  2GCF A;  1HQ2 A;  3DOL A;  4F25 A;  2IC3 A;  1JXE A;  4Y2K A;  2JVR A;  4J9R A;  5LOQ A;  4I69 A;  2H1Y A;  4AT1 B;  4ZJQ A;  1F0X A;  3SIP B;  4U7U K;  4OI3 A;  1F60 B;  2NZ4 A;  1IBK F;  3VF0 B;  4NCB A;  3IFE A;  2R7V A;  1G3O A;  4R5P A;  4AL5 A;  2MY8 A;  2LDI A;  1IKX B;  1WF0 A;  2YQ0 A;  3CCW A;  1V5I B;  2OSQ A;  5IZH A;  4KGM A;  4RBU A;  5DZ6 A;  2HWT A;  1ARO P;  2R8H A;  2E29 A;  4ZLN A;  4CLY A;  4LRE A;  2F40 A;  4EWT A;  1GMV A;  3D4J A;  3V81 A;  3HHK A;  1FRL A;  1FXD A;  2DHG A;  2V69 A;  1N34 J;  2G4B A;  1UJ4 A;  2PA3 A;  4WKR A;  1WSR A;  3ZNJ 1;  2QSW A;  1WC4 A;  3Q8Y A;  4M63 A;  1S6U A;  4UT4 A;  2V4Q A;  4KKO A;  3CJK B;  2NYH A;  4BC9 A;  1F2G A;  1NJY A;  4O3N A;  2BJ9 A;  2ACY A;  2X3D A;  3DI6 B;  1HNI B;  1RKJ A;  1URR A;  3OTE A;  5KFN A;  3PW4 A;  1Y0H A;  4CYU B;  1LEO A;  2HNY A;  3QLH A;  3VWS A;  1H72 C;  3T1Y F;  1NH7 A;  4DFK A;  1REG X;  3IM8 A;  1HNI A;  1SC1 B;  2B4U A;  2K7J A;  2MZS A;  3PYG A;  4FYY B;  4I6A A;  3TRG A;  3GCX P;  2FJB B;  2HW3 A;  2A10 A;  1OQ3 A;  2WB1 D;  2LQ5 A;  1CC7 A;  1YRX A;  1S6Q B;  1CVJ A;  2XSJ A;  5A2Q Y;  4KHP J;  3BKU A;  2M9K A;  2QZ8 A;  3BGR A;  5D15 A;  1M1G A;  1PC5 A;  1X0P A;  1FNX H;  2JFK A;  3FSY A;  4RNO A;  4JI7 J;  5GME A;  2R8K A;  2DHA A;  2OMO A;  3OBI A;  4CLT A;  4ETZ A;  4DFJ A;  3HZG A;  4LIR A;  4F50 A;  1JJH A;  3ZTO A;  1XMQ F;  1HI0 P;  1FDB A;  3FUY A;  1SC3 B;  1KHW A;  1Q79 A;  1FJ7 A;  1WG1 A;  4N5S A;  1RT4 A;  2K2P A;  4DR1 F;  2FTR A;  3CVK A;  1MNE A;  4MT1 A;  4A8F A;  3NBP A;  3OTO J;  3BGF A;  5EWG A;  1F3F A;  3O8W A;  2RNE A;  3RYL A;  1RHU B;  3TJA A;  2ERR A;  1HBN B;  4QWC A;  3ENA A;  4NLW A;  4ZOS A;  2V2V A;  2LMI A;  4XK8 C;  1F9H A;  4TY8 B;  3AD8 C;  4C4W A;  2Z30 B;  2IMO A;  4OHX A;  1TFY A;  3GJR B;  3FSI A;  1UVM A;  1WC1 A;  5K8M A;  2ZBI A;  3J81 Y;  1J5E J;  1I5O B;  1OJ4 A;  4F0K A;  3KUH A;  4I2Q A;  3AOA A;  4ZCL A;  2MQ8 A;  3SCI E;  1VQP S;  4F3O A;  2YKN A;  4F3Q A;  1JLA A;  5BYR A;  2HGM A;  4C3M A;  3M6V A;  4LFC F;  3N9U C;  1LWX A;  4IUF A;  5C5J A;  2J6T A;  2DBB A;  2FLP A;  1HW9 A;  1TK5 A;  2CQD A;  2CZ9 A;  2YKP A;  2V9W A;  4DV5 F;  1ZM2 A;  4LF4 F;  3M8P A;  3EDQ B;  4OMF G;  1TU0 B;  2Z8Q A;  4OX7 A;  1BHN A;  1HI1 A;  4X4U A;  2GQQ A;  2MHE A;  1B0V A;  1J2V A;  3DLK A;  4XAK A;  1U1N A;  5DGB A;  3Q8S B;  2X7I A;  1M5V C;  4B3S J;  5KFD A;  5LMU J;  3MUT P;  3BSA A;  2HHQ A;  3CW2 C;  2WTF A;  4C8K A;  5CYQ A;  4DQS A;  1O0P A;  3EGV A;  4JV5 J;  2CPF A;  1R89 A;  1HNZ F;  4PYA A;  5HJX A;  4DI6 A;  3MCO A;  4Y00 A;  1RT1 A;  3OL7 A;  4V19 J;  2UZA A;  4RW7 A;  1JLF A;  4UST A;  1EIY B;  4ECS A;  4YB6 A;  2K3K A;  1RT1 B;  1S7I A;  2RQM A;  4USI A;  4PAA A;  2N3L A;  2W4D A;  4I4B A;  4YFU A;  2ATC B;  4IRD A;  2AD9 A;  4A8Q A;  5LXY A;  2CKW A;  1SIW B;  2JDJ A;  2LEC A;  4YS2 A;  1LW0 B;  1DQ8 A;  2RB7 A;  3FBB A;  2WCX A;  3OXG A;  3QPI A;  3M2V A;  1W25 A;  3KG0 A;  1SUQ A;  4GC6 A;  3T6B A;  4WKY A;  3HP6 A;  3KHR A;  4DUY F;  4P52 A;  2P9G A;  1QVF R;  3OR1 A;  1U24 A;  3AJD A;  3N4W A;  1OIA A;  5L1J A;  4ED3 A;  1F9E B;  3M8W A;  4DX5 A;  1RE1 B;  3SDE A;  3NOC A;  3G8T A;  1LOU A;  3CTR A;  1AW0 A;  2CNO B;  1HBO B;  2MQP A;  1XK8 A;  2F3J A;  2O67 A;  4RW8 A;  1JLC B;  3W64 A;  1U47 A;  4ZMM A;  1HBU B;  2VL1 A;  4V1A k;  3D0G E;  4HVZ A;  1NXI A;  2CPH A;  2MJU A;  3SBM A;  1N56 A;  1C1B B;  4P2S A;  4K4V A;  1WWH A;  1IR1 A;  1FER A;  5DS7 A;  1HBU A;  3SQG B;  3NLC A;  4DJB A;  2G0C A;  3KLE A;  2MSS A;  1PBA A;  1C0T B;  3ILJ A;  3H59 A;  2LXU A;  2ZH3 A;  2WVB A;  1CC8 A;  2E1M C;  4O3O A;  1FKP A;  2QYC A;  1NB7 A;  1K0V A;  2QX0 A;  3OD2 A;  3NG8 A;  3F44 A;  1C1C B;  1NU4 A;  3BB5 A;  1VHF A;  3D3C J;  3IP0 A;  2DHX A;  3MCN A;  4IG3 B;  2AU0 A;  1OPZ A;  2XC9 A;  1AYE A;  3DYA B;  5G4D A;  2Y1R I;  3JSR A;  4DUY J;  4FNI A;  3NWR A;  3IXQ A;  2V2K A;  2AHO B;  2YH0 A;  1XIQ A;  2VDI A;  3A8E A;  3ISN C;  4EMD A;  3O44 A;  3M8R A;  2CQI A;  2HPU A;  3V4I A;  2UU9 F;  4TNO A;  2DH8 A;  1O6X A;  1WKK A;  4PWW A;  1KWM A;  3WHI A;  3EVM A;  3QBC A;  2M70 A;  4TN2 A;  3IA0 A;  1P9Y A;  1TKD A;  1S5Z A;  1S9E A;  2KXH A;  1C4A A;  2FPH X;  2UV8 G;  1WEX A;  2MZR A;  2XTJ P;  4NYZ A;  4YN3 B;  2EVZ A;  2DYA A;  2J9E A;  3TZX A;  4WTO B;  2W8L A;  4ANE A;  3N6L A;  5T7L B;  4DV3 F;  4DLE A;  3ITH A;  5E3C A;  1FJC A;  1NDP A;  4FVM A;  2H48 B;  1LWC B;  4DSK A;  1VC5 A;  2UUB J;  3MAQ A;  5EGY A;  2Z2Z A;  3LGN A;  4AQY J;  1SQG A;  4RNN A;  3H4B A;  3P5T L;  5M2P A;  3DCA A;  5DQH A;  2BRK A;  1JQG A;  5D77 A;  1LWC A;  4A8K A;  1UZD A;  2AJ1 A;  2DKO B;  5SUH A;  2PO4 A;  4MMO A;  3BJY A;  3TEG A;  1TKT B;  2HRT A;  2BKO A;  3D6M B;  3MF5 A;  4KIA A;  5CZV A;  4UOC A;  2MKS A;  2WAQ D;  2MGZ A;  4X64 F;  2F5G A;  2GS8 A;  3GWC A;  3PTW A;  2AEF A;  4OYB A;  5RUB A;  3DOM A;  4OYI A;  1KLM B;  2DXE A;  3LPY A;  3J7A N;  2CPE A;  1NPP A;  2XSF A;  3QAE A;  2ASL A;  4IH5 A;  4CO4 A;  1UWB B;  3PHE A;  4OX8 A;  5DDQ C;  2IVY A;  3BSC A;  1QAJ A;  1DAX A;  1JLB B;  3QYY A;  3D1O A;  4MAK A;  2VIC A;  1Q16 B;  1QUP A;  4X64 J;  2L9W A;  4IOA Q;  1YJ7 A;  4O4R A;  1DRZ A;  1WEL A;  2CQB A;  2LXI A;  3L7U A;  4ECQ A;  1CLF A;  2HS4 A;  2VZ9 A;  4LF8 J;  1WC0 A;  2HAF A;  4DU7 A;  4RBV A;  1BLU A;  2ACM A;  3HJV A;  4LVO P;  2XMA A;  2Z56 B;  3WX4 A;  3V6K A;  3PYD A;  3T5H A;  3V4M A;  5T14 A;  4WU3 A;  2C1E B;  3MFH A;  2FVR A;  3AHP A;  5CCL A;  5KFW A;  2XCA A;  2IPO B;  3OVA A;  1DY3 A;  5HAO A;  5KFK A;  1RAO A;  1HI8 A;  3EWG A;  1UA0 A;  1UEU A;  2MKH A;  3DOK A;  4F4K A;  4B9N A;  3LO3 A;  4F0H A;  3RRH A;  2VUG A;  1KSP A;  4QR0 A;  1WG4 A;  2KDO A;  3D9B A;  4N8O A;  3PR4 A;  2UUW A;  1X4E A;  2CPD A;  3AY0 A;  3G6E S;  1VFJ A;  2D69 A;  5H1S V;  3VAL A;  3JAM Y;  2DH7 A;  2XGQ A;  1T3N A;  2DJW A;  1VIO A;  1VBY A;  2V4J A;  2GIR A;  2IJR A;  2R7U A;  2IHR 1;  3P4U B;  4O3Q A;  4ZLP A;  5I3U B;  1SKU B;  1U2F A;  1B0P A;  1UAW A;  3FCH A;  4CWB A;  1QAX A;  4AYB D;  1YIJ S;  1JJ4 A;  4JI2 F;  1KQF B;  3UD5 A;  2HEK A;  7AT1 B;  3SCL E;  1OPI A;  4UUW A;  4OHZ A;  5D8H B;  1LWE A;  3KMQ A;  5C2G A;  4KT0 C;  1G7C B;  3I5C A;  1OWX A;  3CCS S;  4RUB A;  2J0S D;  3WZ0 A;  2MY7 A;  3CJK A;  3G71 S;  2ADB A;  3VGS A;  2D7S A;  6FD1 A;  5M2U A;  4LR8 A;  4ZJL A;  1XR5 A;  2DVI A;  2D3O 1;  2BAN A;  3FZB A;  2R7R A;  1DQA A;  4PKD B;  3OFE A;  3M6W A;  1S4E A;  3DI6 A;  1RWX B;  3TZZ A;  4DR4 F;  2RDD A;  3W1Y C;  1U45 A;  4ICL B;  3T1Y J;  1RT7 B;  4QYZ K;  3N01 A;  4K4W A;  3R7N B;  3PW2 A;  4DLG A;  1RHQ B;  3CDW A;  3CUL A;  2O1P A;  1UL3 A;  2C2R A;  3V5R A;  4DZD A;  2JH3 A;  3M2U B;  1UJ5 A;  3BH6 B;  4QPX A;  3UE2 A;  5H9E K;  4YB7 A;  3MPD A;  5D4P A;  2LA4 A;  1BE4 A;  1N4L A;  1X4G A;  3FRZ A;  4UUX A;  2HBZ B;  1YJR A;  4LF9 F;  1JKH B;  4NA2 A;  3TP2 A;  2RS8 A;  1CSJ A;  4OHV A;  1WAC A;  2YKQ A;  2JEF A;  2OEK A;  3D6F B;  3MEG B;  3FKB A;  3BO3 A;  2CVI A;  2K3I A;  5JUM A;  2JEG A;  3JSM A;  2O5D A;  3DOL B;  3W7B A;  3PKM A;  1S1V B;  5L8R C;  4DX7 A;  5KFC A;  1VRQ C;  2PD1 A;  2KFY A;  2UVU A;  2CPY A;  1RTH A;  5ETS A;  2VFU A;  3NNA A;  4DR5 J;  2AGQ A;  2AT1 B;  4TY8 A;  2B7C B;  2K8G A;  2V68 A;  3AOB A;  1N54 B;  1FI4 A;  2FHJ A;  2QG9 B;  2DIU A;  3SSR A;  2EW9 A;  1J5E F;  2E1C A;  1RWM B;  2F9J A;  4F2R A;  1X7V A;  5ETL A;  1X4C A;  5DG9 A;  4DUT A;  1R8H A;  3AJ2 A;  4F26 A;  3PIP Q;  3SV3 A;  1VQ8 S;  1GEH A;  3GFX A;  2PMH A;  2HVI A;  1GX5 A;  1KOO A;  2UUT A;  3OFF A;  3D66 A;  3DMJ A;  3TOQ A;  1RWO B;  3U1N A;  2GML A;  4F2S A;  4LF6 J;  3J7A 1;  3OPK A;  1IN0 A;  1GXU A;  1JLG B;  5HMZ A;  3RRK A;  4WYL A;  5LSL A;  4IOC Q;  4PRF A;  2BAN B;  3GLJ A;  4H4O B;  5DQG A;  2HNZ A;  2CUY A;  2ZH9 A;  1Y4Z B;  4EBE A;  1YQH A;  1VQ4 S;  3QJJ A;  2M88 A;  2NUU G;  1ZBT A;  3OR1 B;  3SI8 A;  5KT4 A;  2RKI B;  3CGI A;  4E0D A;  3VGT A;  3KLG A;  4JI4 J;  1FKO A;  4OZ2 A;  1SKR A;  4X4V A;  4G1Q B;  2XLK A;  2EXU A;  4Y2C A;  2QFJ A;  1FX4 A;  3DLK B;  4XDC A;  4B3T F;  2HK2 A;  3S7R A;  3JQM A;  4OZN A;  1AUS L;  1BY9 A;  3BGO P;  1YKW A;  3HX9 A;  1IR0 A;  4HR2 A;  5I3P A;  5KFQ A;  1U1K A;  1HAR A;  3TA0 A;  4AXJ A;  3G6Y A;  5L1I A;  2FD2 A;  2BDP A;  2DR6 A;  1FFG B;  1HNV B;  4HT5 A;  4DQI A;  4KGV B;  4J9K A;  4DR3 J;  1JXV A;  5IV4 A;  3HUL A;  1HWI A;  1H73 A;  2DR9 A;  2YX4 A;  4O4G A;  2RH3 A;  3J80 Y;  1FRI A;  3U1L A;  5CD4 H;  3ZZO A;  2EG2 A;  2ZNZ A;  3BGU A;  2B7B B;  4XO0 A;  2G1D A;  2KU7 A;  4B08 A;  5I42 A;  1QSL A;  2W9A A;  2B8P A;  3DRY A;  3R97 A;  4ZVR B;  4B3O B;  1C4C A;  5C2C A;  5EHH A;  4KFB B;  4FF2 A;  1UTA A;  1QSY A;  3W65 A;  4ID5 A;  1Q95 G;  5DDO C;  3CC4 S;  1TK0 A;  1FO1 A;  3CNQ P;  2M7S A;  2LCW A;  3GYN A;  3F41 A;  3OLB A;  2XNR A;  2HFS A;  1FE4 A;  4P74 A;  1YSJ A;  4HT7 A;  3UCG A;  1EAY C;  2HBR B;  4YHH J;  5K14 B;  2JWN A;  2Y3Y A;  1AZS A;  3RR7 A;  2LYV A;  3JYT B;  4OX9 J;  3ET6 A;  2DR8 A;  1HMV A;  4LF2 A;  3AFG A;  1P9Q C;  3CJ5 A;  5AT1 B;  1N0V C;  4DV6 F;  3QO9 B;  4UQG A;  3EZU A;  2CXE A;  4P72 A;  3RTV A;  4RL1 A;  1HBM A;  1D9A A;  4PPD A;  2VHG A;  3KK1 B;  2E9Z A;  2IJF A;  1SB6 A;  2J6S A;  2P9C A;  2HIQ A;  2EBG A;  4I6Y A;  2HZC A;  4WWS A;  3CUN A;  2Y8W A;  1UKU A;  1MSW D;  2YKM B;  4TLQ A;  4K5R A;  4PYD A;  3M8Q B;  1T05 A;  1HR0 J;  2ZFH A;  4K5S A;  4OYW A;  4JI3 F;  1EJ7 L;  2CWX A;  3MTK A;  2RQ4 A;  4C8N A;  4YUD A;  4CTA A;  1GXT A;  4ZIW A;  3GIM A;  2ZM6 J;  4OHY A;  2ZOG A;  2H9Z A;  3I6P A;  4HDG A;  2NXE A;  3KYL A;  3PX0 A;  3KUG A;  3CME S;  1PJ6 A;  3BF4 A;  3V6J A;  4HAC B;  2YWH A;  1IXK A;  2X1F A;  3C16 B;  4LSN B;  3LUY A;  4KC5 A;  4I2P B;  1SQF A;  4R0J A;  2HZA A;  3VR1 A;  4TQS A;  1YZ7 A;  2EK6 A;  4KRW A;  4OX6 A;  5K20 B;  3TX8 A;  3I56 S;  2BMB A;  2M2B A;  2WSC C;  3J81 U;  2EC0 A;  2PFF B;  4KQZ A;  2GMH A;  1NDC A;  2NYI A;  4CP5 A;  2KHD A;  1BQN A;  1P1T A;  2J5A A;  2CIM A;  4Z37 A;  4RW4 B;  4IFY A;  4O23 A;  3R5G A;  5CYM B;  3HK2 A;  3DM2 B;  3TNV A;  5KG7 A;  3JB9 k;  3JQJ A;  2WBM A;  4C8Y A;  1XN9 A;  2C2Z B;  3UDC A;  1T7P A;  5KT7 A;  4C0H A;  2XEX A;  3FZ2 A;  2ABY A;  1X5P A;  2AP6 A;  2XNQ A;  3ET6 B;  4DQR A;  2PC6 A;  3V4I B;  2C2O B;  3A1Y G;  3TVY A;  4PWD B;  1UFW A;  2ILY A;  2RDI A;  2V50 A;  3QGH A;  3SSQ A;  2DNP A;  5A8K B;  4ILL A;  2FVP A;  3O1L A;  4NRU A;  4ETX A;  4DV1 J;  6AT1 B;  4J9U E;  3KLH B;  3PM9 A;  3AQP A;  4J91 A;  3W8P A;  4CO3 A;  1NJW A;  2CG4 A;  3A13 A;  3Q8Q B;  3HXM A;  3RUB L;  5ETN A;  2KKH A;  3S1T A;  3PW0 A;  2AW0 A;  1DQ9 A;  2EEY A;  1T05 B;  3K0J A;  2KT2 A;  3THV A;  2UP1 A;  2ZBQ A;  2IRX A;  3VVT A;  4JYA J;  2P6S A;  1YK9 A;  5HK4 A;  2BJ3 A;  2YNG A;  2XY7 A;  1UP1 A;  2JEI A;  3SYZ A;  3HVA A;  5KFO A;  4K4Z A;  4PEO A;  3NXZ A;  4YEA A;  3CCE S;  1TKT A;  3MGJ A;  2ZJP Q;  4HH0 A;  2K06 A;  3TUZ C;  4DPX A;  4I0W A;  3DLG A;  1C1C A;  4IG3 A;  5IC4 B;  2I2Y A;  2Y8Y A;  4LRA A;  1RAG B;  3H5U A;  3VAI A;  2ZVI A;  1RWV B;  3RB4 A;  1S1T B;  1W2I A;  1TZ0 A;  2EPI A;  1S1U B;  1PAU B;  2XMT A;  3FSX A;  3LP2 B;  3WX8 A;  5JJB A;  1TK8 A;  1SL1 A;  1UEV A;  2P8I A;  3HFK A;  3A3P B;  4N7T A;  3T1H J;  2LP4 A;  1ZOT A;  3TAN A;  1VQ5 S;  2WON B;  2HND A;  1YBU A;  5LM7 E;  1SC4 B;  2JHE A;  4H54 A;  3TA2 A;  2ZBP A;  5ITH A;  3CD0 A;  2CPJ A;  1H3D A;  4M5N A;  4B17 A;  4OJ1 A;  2FC9 A;  3E01 A;  2B3T B;  1N0U A;  3ILL A;  3FRY A;  3NGD A;  4W4M A;  1AT1 B;  4J37 A;  4U7U D;  2MMY A;  3D68 A;  4OLO A;  2BQ3 A;  1K47 A;  1RWU A;  3DGP B;  3MZI A;  1JK9 B;  4P6Q A;  5D78 A;  4ZDN A;  4A8W A;  1S0O A;  2COL A;  2BE2 B;  1GQE A;  1GT8 A;  4GO7 X;  1TUG B;  4L75 A;  1PYS B;  3X1L B;  1OO0 B;  1ZTT A;  3DNC A;  3EXY A;  3FDS A;  4J7C A;  2I6W A;  4AND A;  3PW7 A;  2FY1 A;  1MN9 A;  3V6D A;  5SZT A;  3QID A;  1HBN A;  3H20 A;  3I9Z A;  5AXL A;  2JZ5 A;  4RU9 A;  4LF8 F;  2CA9 A;  1S1W B;  2EBE A;  3MPW A;  2BXJ A;  2DT9 A;  1L3U A;  3QAU A;  3RBE A;  5F8G A;  1B99 A;  1TV6 B;  1JLQ A;  8ATC B;  2ZWP A;  1F2H A;  4IYQ A;  2CWK A;  2NXC A;  2CRL A;  2ZUA A;  1V9O A;  3KG4 A;  4OV6 A;  2FZK B;  1ZM3 A;  3HMJ G;  1LW2 B;  3HHL C;  1RAJ A;  1VQY A;  2N82 B;  3AB2 B;  1WC6 A;  1JLQ B;  1M5S A;  1OQ6 A;  4ZHR B;  1ZH5 A;  4JI5 F;  5A0Y B;  3MUM P;  1WEZ A;  2QC3 A;  3IAM 9;  4FXV A;  4QIW D;  2HHS A;  2G13 A;  2IM2 A;  5FJ4 A;  2L3M A;  2R2T A;  5ETV A;  5L9N A;  3GJS B;  4B9S A;  3JTN A;  2WON A;  2WVD A;  4E8U A;  3RB0 A;  1VQ6 S;  2HG4 A;  3K7R A;  1IM6 A;  3UDL A;  2DR5 A;  3H2U B;  1F6T A;  2KL8 A;  1RBA A;  1U8S A;  4NLQ A;  3KLF A;  5DLF A;  2HHU A;  1H98 A;  4Z7Y A;  3ZZ0 A;  3BQ1 A;  1K0T A;  3DLL Q;  4M1K A;  4XPE A;  3LAN A;  5D0G A;  1YG0 A;  1CJU B;  1GX6 A;  2P6T A;  4KH1 B;  4M8L A;  1S6Q A;  2F4F A;  2XB2 D;  4ECU A;  3QRP A;  1HPZ B;  3O3L A;  3DN9 A;  5F41 A;  1Y11 A;  3TEH B;  4L74 A;  1VC0 A;  2CJK A;  3K8V A;  4P75 A;  4X84 A;  3QT5 A;  4OZ3 A;  3CIZ A;  1C0U B;  1RHJ B;  4X66 J;  2ZZN A;  4LJM A;  1I1G A;  2MB0 B;  4B9V A;  4C9D A;  1TVR B;  3M1V B;  3ZXW A;  2OIH A;  2GO8 A;  1H74 A;  5LMU F;  3R27 A;  2CNN B;  2W9B B;  1FWL A;  2RIJ A;  4I1T A;  1U6Z A;  1TVR A;  2OEL A;  4TY9 A;  2EC2 A;  4N47 A;  4NOH A;  5GAH U;  3OTO F;  5J2P A;  1UVK A;  3KJV B;  5B0A A;  1S1X A;  5K8O A;  4DR3 F;  2NUH A;  4CLS A;  1S48 A;  4U95 A;  1U7L A;  1LWF B;  2MEW A;  3M8Z A;  3DGV A;  4UOH A;  4ELU A;  4BBY A;  4F7V A;  2V5H G;  1S4F A;  2E5H A;  2DRB A;  2AWZ A;  2E44 A;  3QRQ A;  4QW9 A;  1ZM4 A;  5A0Y A;  1PAE X;  4MKA A;  2G9O A;  5D0H A;  2WHO A;  3D6T B;  3Q86 A;  3HZE A;  2KYX A;  2QE5 A;  3MMB A;  3PRD A;  3TZW A;  4BLG A;  2RU9 A;  2ZJQ Q;  5HRO A;  4H4K C;  4YHH F;  3PO4 A;  3UR0 A;  1TL7 B;  2LQ9 A;  2ZOM A;  3ZZZ A;  4TU8 A;  1VBX A;  3AOD A;  3IG1 B;  2QGF B;  3MCS A;  3O2I A;  3MDF A;  5K8P A;  3I55 S;  3KK2 A;  3GV8 B;  4DV7 F;  3R3T A;  2ILZ A;  3MMB B;  5KG3 A;  5HRO B;  3I32 A;  4IRC A;  4JV5 F;  2BEF A;  3AOC A;  2IIH A;  4FPI A;  1VC6 A;  1Y00 A;  1RYS A;  2HK3 A;  3NCR A;  1IR2 A;  1KFS A;  4OZL A;  1VI7 A;  3BPD A;  2BA9 A;  4CIO A;  4ILM A;  2WZ1 A;  3I5B A;  1KR4 A;  2MJN A;  2XHC A;  2QN6 B;  3KHL A;  3ETM A;  2AJ4 A;  1EET B;  2YNH A;  3OQ2 A;  2WW8 A;  2VB6 A;  4KFB A;  3J7Y I;  2HZV A;  2KZM A;  2FDN A;  2OFH X;  3ETO A;  2DRA A;  4DX6 A;  4F0M A;  3HHL B;  1RK8 A;  2XHW A;  2RDJ A;  3PRB A;  1CEZ A;  4WZM A;  1IQT A;  1R43 A;  3BN7 A;  2YWK A;  1BC6 A;  3LOU A;  1X0F A;  2W2M P;  2BM0 A;  3GSD A;  5ETT A;  3QAT A;  4BC7 A;  1U48 A;  3KJF B;  1YLX A;  4C8L A;  1KQS R;  4FPR A;  4RW7 B;  5KFP A;  1I94 F;  3LP1 A;  3NGT A;  3HPO A;  1SL0 A;  2AX0 A;  3G82 B;  1ZZF A;  4YME A;  4LF4 J;  4P2M A;  3G4S S;  2IM3 A;  2N7C A;  3QFH A;  1QY7 A;  1MRO B;  2B6A B;  5T41 A;  4I2Q B;  3UN5 A;  3EJM A;  2HVH A;  1NAQ A;  2K1R A;  3NGK A;  5K14 A;  2BUN A;  3GIK A;  2XLJ A;  2XQC A;  2DGO A;  4JI3 J;  1JLA B;  4EZ6 A;  3JYT A;  1W26 A;  3R1L A;  1N32 F;  4C48 A;  1X4F A;  3MHY A;  2VQF J;  1Q1K A;  5ETM A;  3PR5 B;  4J9O A;  4TLR A;  1RDR A;  1SBR A;  2MPU A;  4I6W A;  3DLE A;  4KBI A;  3FBC A;  5AJ3 F;  3TW0 A;  4YB1 P;  1S72 S;  1YJV A;  4U9R A;  5J1E A;  3PW5 A;  4ZVF A;  5GAE I;  3KLE B;  2OTL S;  3NMR A;  1X4A A;  1FK9 B;  4L3K A;  2FYX A;  4NYP A;  5HVG A;  1DTT B;  1NSQ A;  4DU8 A;  1APS A;  4JBC A;  2KM8 C;  1C1B A;  2N7Y A;  1R8A A;  4H4M A;  1WI8 A;  5E0O A;  4YR3 A;  3CCL S;  3DKD A;  3IBF B;  4F02 A;  3FMW A;  1RA7 A;  3OUY A;  4QYR A;  4A8O A;  3MR5 A;  1PYT A;  1WOS A;  1IKV B;  1ELO A;  3GON A;  4H4M B;  4TXS A;  3JSY A;  2CQC A;  3W5Z A;  2JVO A;  2V2Q A;  1M0S A;  2VJV A;  3BQ0 A;  4BDP A;  2Z58 B;  4E2F B;  1Q82 T;  1T9X A;  1D0E A;  3DYA A;  4WK1 A;  3FEZ A;  2D3O R;  1FKA F;  3DRP B;  2LXF A;  4MK8 A;  1CQN A;  1V3R A;  2ATL A;  1Y5N B;  3IBC B;  4ZVO B;  5IQ6 A;  2DHS A;  4P7V A;  3D3B J;  3MD3 A;  4R8U A;  5A6P A;  4AQY F;  3QGP A;  1WI6 A;  2B6A A;  5IT0 A;  1HLW A;  1FWK A;  1PG5 B;  3HJF A;  1IQZ A;  3L3C A;  4KAI A;  4JI1 J;  2AJ2 A;  1HWJ A;  3CJ3 A;  1OY6 A;  3CCT A;  1FHT A;  4HI2 A;  5ETO A;  3CT9 A;  2DCL A;  2VG6 B;  1KNZ A;  3C66 A;  2BJE A;  5GMK a;  1VBK A;  2KT3 A;  5I3Q A;  4OI2 A;  5DZ7 A;  1FTC A;  3GFZ A;  2VQE F;  5KOX A;  3B82 A;  1E6Y A;  1NDK A;  5I3U A;  2PGC A;  4M5G A;  4ZVU B;  2HLT A;  5J2Q B;  3A8J A;  4F4A A;  4ZA1 A;  2CVE A;  1UFL A;  4CLW A;  4LF7 J;  2Q66 A;  3TAR A;  5CCM A;  1XMO J;  2YX1 A;  1TP7 A;  2E66 A;  2H5J B;  4NLP A;  4ECY A;  1YJW S;  1KN6 A;  1UA1 A;  4ZCK A;  4LBH A;  1S1W A;  1T03 A;  2Y9H A;  3SCK E;  4C8O A;  4TU9 A;  1QD1 A;  2XZW A;  1N88 A;  1XMB A;  4Q45 A;  4Q8F A;  4LFB F;  1SJ1 A;  2W2O P;  5DDP C;  4CLZ A;  1U25 A;  4EGL A;  4GKK F;  2MST A;  1PC4 A;  1FTR A;  4P2X A;  4RW6 A;  1N6Q B;  1EZZ B;  2XMK A;  5U47 A;  4DPW A;  2DGU A;  1FVQ A;  3CDA A;  1IKV A;  2XI2 A;  3IS9 A;  3R6L B;  4JUZ A;  5HJY A;  4IQX A;  4K50 A;  3EM1 A;  1NK9 A;  4JI6 J;  3UN2 A;  1UVL A;  4QU7 A;  2HHW A;  4RW6 B;  1VLY A;  5IT9 U;  2JLE A;  1OYE A;  1WEY A;  3HF5 A;  3L4B C;  1JLB A;  2NLW A;  1ZZN A;  1X4D A;  4XIU A;  1TL5 A;  4ZPV R;  2HBQ B;  3MR2 A;  3K5N A;  1RAC B;  2W2N P;  3LGH A;  2V4R A;  3PVX A;  4DOZ A;  2J0Q D;  3D28 A;  4DL7 A;  4OYO A;  3ZZT A;  2VV5 A;  3PJW A;  2IYG A;  1T9W A;  1FRX A;  2CG8 A;  4NX9 A;  2XMJ A;  3DRX A;  4IDK B;  4WTY A;  4ES2 A;  5LJ5 Y;  3OJS A;  4QWB A;  2C3O A;  3IGV A;  1RTI B;  5A8K A;  2UVR A;  3LW5 C;  1Y7P A;  3C6T B;  2BW7 A;  4WP9 A;  2XI3 A;  3Q24 A;  3KDN A;  4MFB A;  4ZVG A;  5JVH Q;  1J5O A;  3DHW C;  1FFW B;  1RB0 A;  1IUJ A;  2Z2L A;  3MEK A;  1HNW J;  4OV1 A;  4Y2M A;  3H4D A;  1RWN B;  1MW7 A;  3KFW X;  4EBD A;  2OEM A;  1N48 A;  4NXM F;  1RT4 B;  4Y3C A;  4K8R A;  2AIR B;  3GU0 A;  1TUW A;  4QR1 A;  4CT8 A;  4RUH A;  5J2Q A;  4ANC A;  3FBF A;  3MMA B;  5L1L A;  3I4H X;  3MR3 A;  3VAM A;  1N8R T;  1MLA A;  2QL5 B;  3V81 B;  4EO6 A;  4DHV A;  5A2Q U;  3CPW R;  1Y9O A;  2KO1 A;  2VBW A;  5E7O B;  1IBC B;  4CLU A;  4NXM J;  3ZZR A;  3QSY B;  2FHO B;  4M5D B;  1NH8 A;  2Z2M A;  5CAB A;  1BWE A;  2QT7 A;  3M9M B;  3VQS A;  2RHQ B;  1Q0N A;  4DL3 A;  3UD3 P;  2O3D A;  5BYQ A;  2BZ2 A;  3Q2T C;  1YRT A;  2MZT A;  4X66 F;  2W7O A;  2HNY B;  1NK6 A;  2JFD A;  5AXK A;  4NE9 C;  4WII A;  4ZPB A;  4Q0B A;  3TQE A;  4NA3 A;  1RAE B;  4K4S A;  5L39 A;  4LRD A;  3W60 A;  1RT6 B;  2CPZ A;  2XWX A;  3RAQ A;  1F5A A;  4KO0 B;  5EUH A;  1HL6 A;  1S76 D;  4HL9 A;  3NOG A;  1M5H A;  1Q8I A;  5HMX A;  3EXC X;  5LXR A;  4C97 A;  4F67 A;  2MLY A;  4OJ3 A;  4DV4 F;  2E7X A;  1IBK J;  2JSX A;  3TVZ A;  4UY8 T;  3DU5 A;  1O8B A;  2H3E B;  2H51 B;  3DRR A;  3KUE A;  3VZI A;  3J7Y U;  1YJ9 S;  4O3S A;  5AE1 A;  1YZ6 A;  1RTZ A;  2V8V A;  1RT5 A;  1UJ6 A;  2JLF A;  1NPR A;  3P49 B;  4PAB A;  2GJF A;  3GSI A;  3RW7 A;  2VJU A;  4OJG A;  1VJW A;  3CMA S;  1VQL S;  4C2M A;  2NXU A;  2QJ3 A;  4Q43 A;  4DFP A;  2VPZ B;  3F73 A;  4B3O A;  2VF3 A;  3DDN A;  3EGN A;  2FJW A;  4AUK A;  3W63 A;  2V0N A;  2VOP A;  1G2E A;  1UMJ A;  2ZHO A;  5J2P B;  2E5I A;  3DRS B;  2KM8 B;  4JI8 J;  1FXR A;  4ZS6 A;  1O5J A;  3LP1 B;  4M5D A;  4ECZ A;  2XS7 A;  3AQO A;  2GW8 A;  4HHU A;  1S49 A;  1IKY B;  1LW0 A;  3AT1 B;  3PYF A;  4C0O C;  4HH1 A;  4L3N A;  5F8H A;  2MZ1 A;  2R9L A;  3LAL A;  4M5J A;  1YJT A;  3G6V A;  2JL9 A;  1KVI A;  2C3M A;  1WOO A;  4NCA A;  4NLY A;  2HVZ A;  3ILO A;  1ZM9 A;  3A8I A;  2QL7 B;  5HQM A;  4RNM A;  3IR6 B;  3MCM A;  1JNZ B;  4F4Z A;  2QIF A;  4DPY A;  2YTC A;  2DGW A;  5F8L A;  2KJV A;  3ZC4 A;  4LFA F;  5AE2 A;  2QLJ B;  2IBK A;  2YX7 A;  3V6H A;  4LMZ A;  2CNK B;  4ZIV A;  2PII A;  2B9Y A;  4WYW A;  4RLE A;  3GQC A;  1D9F A;  3KLI B;  4CTA B;  3CF5 Q;  4LFC J;  3PFE A;  2FLN A;  2FJV A;  4EU0 A;  2RJZ A;  3PCO B;  3MEE A;  4DV2 J;  2HFO A;  1IBM J;  4XDD A;  3PV8 A;  3I5A A;  4G1I A;  5DM7 Q;  3KK2 B;  2LQB A;  3RJM B;  1C2P A;  3NNH A;  3MM5 B;  3MEG A;  2ZEJ A;  3QZ7 A;  2FLL A;  4K4U A;  1WHX A;  4LQ3 A;  2BKP A;  5IFM A;  3D0I E;  4DV0 F;  1RLD A;  3IN5 A;  2KH9 A;  2FIU A;  1K1S A;  4DEZ A;  2I0X A;  4B3S F;  3IR5 B;  1ZAW A;  3RBZ A;  3G2X A;  4DSE A;  5K9F A;  1P8G A;  3HVT B;  3EYZ A;  3VAF A;  1SKS A;  1CJT A;  3DM2 A;  3WIU A;  2J6U A;  3NP5 A;  3NNC A;  3RU0 A;  4NLG A;  2LQJ A;  3BBB A;  5FLX Y;  1T3O A;  2IYI A;  3W5Y A;  4FYX B;  2DGT A;  4C98 A;  2J7W A;  2W9B A;  4DV5 J;  3Q22 A;  3HHN B;  1VCT A;  1L3K A;  2AJ0 A;  3MAA B;  3CDU A;  4ZP6 A;  3D54 A;  4QCL A;  1U6B A;  1TMJ A;  1RHK B;  2H5I B;  3DDI A;  2F4V F;  3TAM B;  3SDE B;  1WNE A;  2W2Q P;  2BJD A;  1T02 A;  3CJQ A;  3DXS X;  3IR7 B;  3DC2 A;  4PXD A;  4MYU A;  2CYY A;  1MRO A;  3KLH A;  4CM2 A;  3L9Z A;  1S0N A;  1L3S A;  2FC8 A;  3N5F A;  4QIE A;  4K7Q A;  1NDL A;  4M5L A;  3GII A;  1ZS6 A;  2U2F A;  1WUU A;  4C0B A;  4P10 A;  3M8P B;  2IFX A;  1Y3K A;  1VQM S;  3IG1 A;  2AZ3 A;  4ED0 A;  3FCW A;  3I87 A;  1HWU A;  4GVL A;  4YB5 A;  3VAG A;  1PO6 A;  2YKM A;  4USJ C;  4X4R A;  4USV A;  1HHT P;  2DY1 A;  1EQM A;  2A3J A;  2I8E A;  4CO2 A;  1OS5 A;  4D3H A;  1U1P A;  4O3P A;  4V19 X;  4EUV A;  5HI7 A;  1IBL F;  4NXN F;  4X2B A;  2GX8 A;  5J1E B;  5CXT A;  2JJ4 D;  3MM5 A;  4KPY A;  4AXI A;  4QU6 A;  1MML A;  4Q7A A;  1F9F A;  1Z4U A;  1U4B A;  4DR7 F;  2V8H A;  2W25 A;  1YRU A;  3C14 A;  1WJ9 A;  1UVJ A;  3K2Y A;  1K1Q A;  2UU9 J;  3BKT A;  2XYP B;  2HMI B;  2GQ2 A;  2J0W A;  4HTJ A;  3HHL A;  2I38 A;  2ROE A;  4ZVT B;  1NME B;  4ZP8 A;  4ZVH A;  2AQ4 A;  3T1A A;  1KHV A;  1ZAX A;  1E6V A;  2F8E X;  2RF2 B;  3GZ7 A;  2FJE B;  2CQH A;  2VG5 A;  2ROG A;  3OR2 A;  5BR8 F;  4YP3 A;  5DG7 A;  4D3G A;  3C3L A;  2JEJ A;  4DR6 J;  2ZC4 A;  4RW4 A;  3VVU A;  1PCA A;  3VAJ A;  4OI6 A;  2VG5 B;  2GJ2 A;  1X31 C;  3OR2 B;  1JWW A;  3VAH A;  2XZD B;  3UO0 A;  2V2Z A;  1FRM A;  1DBD A;  3L09 A;  2WOM B;  4WFZ A;  2F63 A;  3HO1 A;  3TAM A;  1GTE A;  3ICL A;  5EX3 A;  4DL4 A;  1F3V A;  4ZPD A;  4RU2 A;  1RIS A;  2AYB A;  5ETQ A;  2J9C A;  3EVO A;  4B9M A;  1BQM B;  1S79 A;  3NCP A;  5KFI A;  1FT8 A;  1H7W A;  1X4B A;  3BM7 A;  4KR0 B;  4WE1 B;  1FNM A;  4Z2X A;  2B4O A;  2UUC J;  1WF1 A;  3GPA A;  1UEK A;  2IDE A;  4K59 A;  2ZIT A;  1HYS A;  5C7P A;  1BQM A;  2O01 C;  1RXO B;  1T9V A;  2ZDP A;  3NAH A;  4DQQ A;  2XYG B;  4WFA Q;  4OJH A;  2MYF A;  4EZ9 A;  3I0R A;  5E33 A;  1WTB A;  1CJK B;  3N6N A;  4N76 A;  4WF9 Q;  3B6B A;  3MR7 A;  1NK8 A;  1Q8K A;  4HLB A;  3EPI A;  2D1C A;  1NK4 A;  3VHQ A;  4R0E A;  4GKJ J;  2BKN A;  3OTB A;  4CH1 A;  1P27 B;  3HKZ D;  4LUB A;  2AGO A;  5HMY A;  1RT3 B;  5KG6 A;  1EQ0 A;  3ZZY A;  2RD5 C;  1AB8 A;  3AD9 C;  3VAK A;  3CD6 S;  1S1U A;  5KG4 A;  4A47 A;  2GHW A;  3MM6 B;  2FUG 9;  5ADZ A;  1LW2 A;  3Q8R B;  1X9M A;  2SXL A;  2FZG B;  2D3U A;  3B54 A;  2VFV A;  3UNY A;  3CCU S;  3QT7 A;  2PDA A;  3QGG A;  4DX8 H;  3KHH A;  2QA2 A;  4GRS A;  2BR0 A;  2IVF B;  1ZAV A;  2Z4P A;  3ISN D;  1GNK A;  4CRJ A;  3RB3 A;  1RAH B;  4M5M A;  2OJ3 A;  1ZET A;  2W01 A;  1V6H A;  4GO5 X;  4DXL A;  4X65 F;  4QZV B;  4PG5 A;  4EO8 A;  1RGV A;  2EFQ A;  3QT6 A;  4JI0 J;  2UUA J;  3KXD A;  4Y65 A;  4NI2 A;  4URG A;  5AXN A;  2KN4 A;  3DGP A;  1RQ0 A;  2RAQ A;  1RAF B;  5B08 A;  2Z0G A;  4LF1 A;  2HAI A;  4NA1 A;  2OHD A;  2G0J A;  3H5X A;  4NL5 A;  5FII A;  1KBR A;  1SL2 A;  3C15 A;  3EGZ A;  3KK3 B;  3T19 A;  2J9D E;  2W4P A;  3MPY A;  4L76 A;  5D3G A;  3TA1 A;  1QLN A;  1IKX A;  4O44 B;  3IRX B;  5E3R A;  4Y0F A;  1S99 A;  2HRY A;  2XCP A;  1HWK A;  1U1L A;  2N4D A;  2HHH F;  3FFI B;  2VBZ A;  2HLU A;  4HEA 9;  4ZPW R;  2I1R A;  2BE2 A;  1BMQ B;  1Q53 A;  3CO9 A;  3I0S A;  2L9N A;  2V8G A;  5E3Q A;  4JOU A;  1R0B G;  1VQN S;  1RAA B;  2HGN A;  2JLG A;  3U02 A;  1SH2 A;  2B8Q A;  1VMB A;  3POT B;  1Z1Z A;  3V6D B;  4ICL A;  1GXL A;  4MK7 A;  1VS3 A;  2BV3 A;  4JI2 J;  1WF2 A;  3M30 A;  3UWT A;  2Z2Y B;  2CAD A;  1RU1 A;  2PFD A;  4X62 F;  1L3V A;  1YVF A;  2HNZ B;  2RRA A;  1QDU B;  3ENW A;  2ZH5 A;  3VGU A;  1VRU A;  1T8E A;  3CJ8 A;  4U8V A;  2B5J B;  2GGP B;  2QV6 A;  1BD6 A;  5CHC B;  2HS3 A;  3M9N B;  5FDL B;  1FD2 A;  4KSE B;  3OL6 A;  1DUR A;  2B0G A;  3RZA A;  3S6E A;  3DLB A;  1JKH A;  2LEB A;  4QQB A;  2LU1 A;  2ZD1 A;  3OVS A;  1JLE B;  2XMM A;  3BZQ A;  1D1U A;  4IR9 A;  4ED5 A;  4NLT A;  3I31 A;  2OPQ B;  4RUA A;  4OZJ A;  3CCM S;  4NI2 B;  2L48 A;  4Y28 C;  4Y2A A;  2QA4 G;  5F9N A;  4IDK A;  3U1M A;  5DG8 A;  4OIX A;  4ECW A;  1UW4 A;  2KVQ E;  5HN0 A;  3Q8V A;  2AYE A;  2BJ8 A;  2YNF B;  5C42 A;  2MQQ A;  4F4Y A;  3NBP B;  3TUP A;  3MM9 B;  4MJK A;  3M4X A;  2UVW A;  2R8G A;  4BHQ A;  3HVR A;  3C19 A;  1WHW A;  3M1V A;  4OFZ A;  4BWM A;  2B51 A;  1SJ3 P;  1IM4 A;  2ZOF A;  1SKW A;  3CJR A;  4BCA A;  1M90 T;  4G3I A;  4KHP F;  2DIV A;  1EHW A;  3MMA A;  2G2Y A;  3KJQ B;  1HIY A;  3L7P A;  1NRK A;  3MAH A;  2HYI B;  2W7A A;  4EI2 A;  1JIH A;  1NSP A;  3EPG A;  1KVJ A;  3G87 A;  4AFF A;  1B7Y B;  1LWE B;  2NXJ A;  2BW2 A;  5F8I A;  4PUO A;  2WK4 A;  3MM7 A;  2YKN B;  4FVC A;  3ZTQ A;  3GJQ B;  4ELT A;  4UQT A;  2WVC A;  3P6Y C;  1JB0 C;  1H0H B;  2DGX A;  1HKA A;  3DRS A;  3ENQ A;  3KDO A;  4Y34 A;  2YVS A;  3GYX B;  1JNR B;  2CZ4 A;  3TZY A;  4ES1 A;  2X1A A;  2LVW A;  1Q86 T;  3MD1 A;  3DLH A;  2I5J A;  4P9S A;  1NHU A;  4CT9 A;  1VRT A;  2AX1 A;  3J7Z 5;  1RP5 A;  3BS9 A;  4PXB A;  2DO4 A;  3RW6 A;  1WC3 A;  3HVW A;  4YDX A;  3BSO A;  2OH2 A;  2OI2 A;  3T5K A;  4B9U A;  4ATN A;  2OGU A;  3DLE B;  2GC8 A;  2J0X A;  2AF6 A;  2ZE2 A;  1U1R A;  8RUC A;  1NKE A;  2O66 A;  5GVQ A;  1L5U A;  2XS2 A;  1FX2 A;  1TAQ A;  2HBY B;  2F8M A;  1HNV A;  2AV5 A;  2ZD1 B;  5KFM A;  4DF8 A;  2RE1 A;  1QSS A;  1H2U X;  2PEH A;  5IWA J;  2GIF A;  4NLD A;  2WVE A;  3CED A;  3GTY X;  4MIA A;  1FK9 A;  3W66 A;  3DRR B;  4OHW A;  1B0T A;  3PG9 A;  2XY6 A;  1TFW A;  4LFA J;  1VIX A;  2HRU A;  2Y1I A;  4LR9 A;  4USM A;  4ZVE A;  1Z2L A;  3C16 A;  3GR1 A;  4LSN A;  3W61 A;  3PEH A;  2CQ1 A;  2R2U A;  3F56 A;  3SSS A;  2CJ9 A;  2FQQ B;  5AJ3 J;  3K5O A;  1M1K T;  2M3D A;  1RHM B;  1QM9 A;  5HLF B;  1QTM A;  3AAW B;  2Y0B B;  2GVZ B;  4CLP A;  5CH7 B;  2CFX A;  5KFT A;  2ASY A;  2DXF A;  3KKF A;  1N5T A;  2DNZ A;  4FS2 A;  4YY3 J;  1T11 A;  3LAK A;  2GVZ A;  4W98 A;  3MAA A;  2HUR A;  3UCU P;  5HAT A;  2XBP A;  2VU5 A;  4ZLL A;  3OT9 A;  1V5V A;  3DRP A;  1B7F A;  2A1B A;  2R2S A;  2BQR A;  4PG6 A;  2C2N A;  3Q2S C;  4DN9 A;  2ASD A;  3I4P A;  2GQC A;  4NCG B;  1HBM B;  1S12 A;  2DB1 A;  2OEJ A;  5AXM A;  4A46 A;  2VKZ G;  2VH7 A;  3EX7 B;  2H65 B;  1MN7 A;  4U7C A;  1XWL A;  1TR0 A;  5CZX A;  3G82 A;  2RQC A;  4CI0 B;  2LQ8 A;  3MM8 B;  3AXK A;  3OLA A;  3SZ2 A;  2EFO A;  1HMV B;  2FLO A;  2AKW B;  1R6V A;  4KE5 A;  5HAN A;  1SPB P;  3W2V B;  2APO A;  2RU3 A;  1U1O A;  4ELV A;  3R2C J;  4DV0 J;  2R42 A;  4G1Q A;  1H38 A;  2B4V A;  1T9U A;  3N0V A;  3R1H A;  1NJX A;  2V63 A;  1RZM A;  3OJU A;  4FXD A;  4ZJO A;  2E1R A;  5IM0 B;  1X8D A;  3PDN A;  5LSO A;  2HFZ A;  2RRB A;  2VQF F;  4I67 A;  2OPR B;  1HBO A;  3N79 A;  3ZZU A;  2NQP A;  4I7F B;  2DNN A;  3BRE A;  2RSQ A;  1GAO A;  4FKX A;  4Q2L A;  2B9W A;  1Q5V A;  4F4W A;  3CCQ S;  2ZKU A;  8AT1 B;  2HWH A;  2YBV A;  4N41 A;  4RR5 A;  4IR1 A;  2OPP A;  3NGS A;  3OTC A;  5GMD A;  4JV2 A;  3GYG A;  4NML A;  5B09 A;  4U67 Q;  2FVC A;  3GIJ A;  2BAB A;  5H9E J;  4J5O A;  1SH0 A;  3KMS A;  1IWG A;  2QLW A;  2RVJ A;  5ETP A;  3W9I A;  3NGR A;  2VFT A;  4DUZ J;  4RBT A;  3KOA A;  1Q78 A;  1BQN B;  1HA1 A;  2IDL A;  1E6V B;  3FBE A;  1HR0 F;  3GJT B;  2YWG A;  4ZCM A;  2LFV A;  4MKY A;  3M2V B;  3E51 A;  5E5N A;  4FF1 A;  2C3Y A;  4WE1 A;  4RUC A;  2UXC F;  5KFR A;  2PE8 A;  1XNR F;  3U27 A;  2ZH8 A;  4B3M F;  2DNG A;  3B4M A;  4TYA A;  1S6P B;  2IAJ B;  1Q8B A;  3CSK A;  3SV4 A;  3FGV A;  2MTL A;  2KHC A;  4NXN J;  2VON A;  2WSE C;  1E6Y B;  4P2F A;  1NND A;  2G1H A;  4WFX A;  4JYA F;  4X4Q A;  3IAS 9;  2QA1 A;  3CD5 A;  5KFS A;  3MFI A;  4ED6 A;  3GG1 A;  3GV7 B;  2X3G A;  3ITH B;  3BBC A;  1KEK A;  3H5S A;  1XNR J;  3H40 A;  1QE1 A;  5F8J A;  1KON A;  4USU A;  4KH0 B;  2NS1 B;  3SFG A;  2A2D A;  1X60 A;  2FHK A;  5CA5 A;  3HM9 A;  3VTI A;  2HKE A;  1IJE B;  3OVB A;  4CLF A;  1KLM A;  3PEJ A;  5KAK A;  1HD1 A;  4PG7 A;  4OYZ A;  1QE1 B;  3PO5 A;  4DSI A;  2R7X A;  4DUZ F;  4DR6 F;  3KNG A;  4PQA A;  2OPP B;  2D41 A;  1VYA A;  2OTJ S;  2C2K B;  3IBW A;  3LH2 S;  4LRB A;  4J90 A;  1S1T A;  2DEI A;  2QMX A;  2UV8 A;  2W4C A;  3C14 B;  3HSZ A;  2YKA A;  3MED A;  1WHV A;  1U09 A;  4KKO B;  1X5S A;  5D0R A;  2ZZM A;  2OD6 A;  3CJ0 A;  5DLG A;  1ICE B;  4UZB A;  3BO4 A;  2IRU A;  1P1L A;  2ZC3 A;  3KWM A;  3X3U A;  2IVM A;  4NZ0 A;  3M05 A;  2HVD A;  2HWI A;  1RHR B;  5BYS A;  3IWN C;  3R5C A;  4I56 A;  1QAY A;  2NSC A;  3CB4 A;  1Y3J A;  5G0R B;  4EFA C;  3PIO Q;  1M5K C;  2OKQ A;  4HDH A;  1S57 A;  4MH8 A;  1SIZ A;  3H42 A;  1UPM B;  5C25 A;  4OQJ A;  4WXO A;  1N36 F;  2MLX A;  2R7S A;  3FQL A;  2V4J B;  1WD6 A;  3BGR B;  4RJV A;  4JI5 J;  2MKJ A;  3ISZ A;  1CJU A;  2KI2 A;  3UNG C;  1U1M A;  4CO0 A;  1VQ7 S;  4DSL A;  3DOK B;  1U0H B;  1X4H A;  1B4S A;  1RUS A;  4G1P A;  4DR2 J;  4CZC A;  1VK3 A;  3EIC A;  5EDW A;  2Y1J A;  3M32 B;  2D9O A;  1U0H A;  2A6M A;  1RBL A;  3BR8 A;  2V9K A;  4M94 A;  1FVS A;  1RU2 A;  2KG1 A;  1LFW A;  2BAC A;  4ID8 A;  2MDA A;  3UN3 A;  2YWF A;  4ED4 A;  2G2O A;  1S59 A;  3G96 A;  1RYR A;  2XO7 A;  1HQU B;  3DMJ B;  4DG1 B;  2HGL A;  4KJI A;  4FYV B;  2OD4 A;  4USW A;  5B0D A;  1OYD A;  1KP6 A;  2CNL B;  2ADC A;  5LSR A;  4DMZ A;  4H4O A;  4K4T A;  1HQU A;  1RT6 A;  2KXF A;  4USK A;  1NB2 A;  5HL7 Q;  1FFS B;  4NLU A;  4C3K A;  1XQI A;  1YIT S;  2IA0 A;  4LF5 J;  2HQD A;  1KLN A;  5DDR C;  3BKF A;  1ZPV A;  2M5Y A;  1DLO B;  4IFV A;  1I6J A;  2AYG A;  1HNW F;  4LT6 A;  3IMQ J;  4ENO A;  4Y2I A;  4DN0 A;  4NEY A;  3KLI A;  3UDE A;  3KLF B;  4FXW A;  4FZV A;  4FYD A;  1TQL A;  1RT5 B;  1XBW A;  1DLO A;  2CQ2 A;  4FYW B;  1CS4 A;  2CDQ A;  2W2P P;  3FMB A;  3GG0 A;  3BQ2 A;  1DHM A;  1PJ5 A;  1SXL A;  3PJX A;  2VA2 A;  1X9S A;  1X5T A;  3TUJ C;  2Q6C A;  4PPZ A;  4Q8E A;  1X5O A;  5B0E A;  2J7U A;  2BE7 D;  1T94 A;  1HWL A;  2DPI A;  1B70 B;  5KFY A;  2WSF C;  4DV4 J;  3MMC A;  2YXL A;  4B3R F;  2DNQ A;  2QYG A;  1JMT A;  5D3G B;  4B3T J;  1IKW B;  1S10 A;  2DNR A;  4PWU A;  3WBZ A;  5F0U A;  1G1X A;  3NAI A;  1KFD A;  2JC1 A;  4IG0 A;  4IH6 A;  3UI3 A;  1NK7 A;  3T5L A;  4WZQ A;  3RRG A;  1WHY A;  1N5Y B;  3HLU A;  3PX4 A;  4KHM A;  2E5L F;  3HCX A;  4ED7 A;  3I0S B;  3KLV A;  2QO3 A;  1VQS A;  4ZVS B;  3KJV A;  4J9Q A;  1S0V A;  4A8S A;  4ZPC A;  3BYR A;  2HFV A;  5KFE A;  1B64 A;  1UVI A;  3V2U C;  2ZH1 A;  2CQP A;  3UW1 A;  1FRH A;  2HFN A;  2QL9 B;  1PYO B;  4HHH A;  3AXM A;  2VFS A;  3EDR B;  1BUX A;  4RWW A;  4URQ U;  3JS9 A;  4DPO A;  3LPE A;  3H5Y A;  3T5J A;  4U96 A;  1U49 A;  1F1B B;  2K1R B;  2J76 E;  2MKC A;  3DDK A;  3MM7 B;  3GV5 B;  2BQU A;  1S9G A;  4K2X A;  1S97 A;  3B8H A;  2N3O A;  2RT3 A;  4ZHR A;  1U6F A;  2KJW A;  3M6X A;  2B5J A;  2GGP A;  3OTD A;  2J9D A;  2PI4 A;  2YH1 A;  2LLZ A;  2IRY A;  1NO8 A;  4NWB A;  1BXN A;  1OMS A;  2PMZ D;  5KFL A;  2FGO A;  2XZT B;  2X1G A;  3PAC A;  3H25 A;  2W7P A;  3R7S B;  3H2L A;  1XJW B;  1NJZ A;  2PI5 A;  3LTO A;  2ZH4 A;  5EX0 A;  2EFV A;  4DV6 J;  4J9V A;  4GVB B;  4FBT A;  3LWM A;  2W1B A;  1FJG F;  2HS0 A;  2M8D B;  1RAI B;  2BYC A;  1DFD A;  1FDD A;  4I2P A;  2KG0 A;  2C28 A;  1D9D A;  3H2V E;  1N5Q A;  2YNF A;  2VPW B;  4LIW A;  4QPT A;  5IQQ A;  4NPO A;  3S01 A;  1HW8 A;  2L9D A;  3PRV A;  4TQR A;  2W9C B;  3K57 A;  1IKW A;  3AA8 A;  1NK0 A;  2UXD F;  2DRD A;  2RHS B;  1SCJ B;  4ER8 A;  3RR8 A;  5KFG A;  4C6A A;  3WC0 A;  4B9T A;  1SH3 A;  2XMV A;  4YQW A;  2CJQ A;  3KHG A;  4JI4 F;  3NY0 A;  3G86 A;  1JLF B;  3P8B B;  1SJF A;  1TUV A;  4WBF A;  1CUL A;  1Z2Z A;  1Y5L B;  3WDO A;  1IKY A;  1RTJ A;  2YPZ A;  5C24 B;  5MLC V;  2ZNY A;  3KK1 A;  4ZN1 A;  1S9E B;  3NWG A;  3J80 U;  1KOH A;  3RAM A;  3LWL A;  5KFB A;  1YGY A;  4F8R A;  2QLX A;  1S6P A;  1SVD A;  1R8P A;  2F65 A;  3HD1 A;  1MMN A;  3HDS A;  4QIG A;  4ZPA A;  2YQ1 A;  3WIV A;  3M9O B;  4EYH B;  2JNJ A;  4ED1 A;  3IWL A;  3RBX A;  1D3W A;  2VPY B;  1TKX A;  4NRT A;  1D8Y A;  1R8B A;  2CQ3 A;  3C46 A;  5KFX A;  4DL2 A;  1MG7 A;  5L1K A;  1Q81 T;  4KHR A;  4FF3 A;  1HNZ J;  1PGZ A;  3BDP A;  1GH8 A;  5HQ8 A;  3K58 A;  4ECT A;  2R2R A;  1U0S A;  4P7T A;  4CCH A;  4WU2 A;  1N32 J;  1VJQ A;  3M8Q A;  1RAD B;  1RAB B;  2HHX A;  1JLC A;  1FRK A;  4RZR A;  3QNW B;  3Q8P B;  4DV1 F;  2DNK A;  1WKJ A;  2VAS A;  3Q83 A;  3DOM B;  2EI5 A;  1KQG B;  4RPF A;  1EET A;  1PIE A;  2YNH B;  4OYP A;  1DTT A;  2DNY A;  2BJ1 A;  4NLV A;  1TKZ B;  3BH7 B;  1GTH A;  3D67 A;  3IS9 B;  2AYM A;  2VPX B;  3E3X A;  3IO1 A;  4IO1 A;  3OFG A;  5E3A A;  5JVG Q;  1H2V Z;  3RAX A;  4PXC A;  5F3T A;  5IS2 A;  1REV B;  1U1Q A;  3W3S A;  2PSZ A;  4GKJ F;  4IO9 Q;  3Q23 A;  3BPS P;  4EEY A;  1RA6 A;  2MKY A;  2P2C B;  1SJ4 P;  2HHH J;  2LEA A;  4NLO A;  1W7W A;  2E5J A;  3QRR A;  5I4M A;  2MQL A;  4KGX B;  3IWX A;  1SC6 A;  1T9T A;  2ZM6 F;  3CD7 A;  3BSN A;  3FQK A;  4FNH A;  2VG6 A;  2IBO A;  3QO9 A;  3E01 B;  1VIS A;  2F9D A;  3MUV P;  2FJD B;  4LSL B;  4JI6 F;  1QAI A;  3CO0 P;  1R0A B;  1WOP A;  3VZH A;  4BS2 A;  2MHN A;  4L6V 3;  4R8U B;  2CZV C;  2WOM A;  1LK5 A;  4X4S A;  3DHX A;  3BYP A;  5HP1 A;  1QVG R;  4F3M A;  2K7K A;  1G6B A;  2UVV A;  3J81 j;  2I9S A;  4X65 J;  1KS2 A;  2YNG B;  3A12 A;  4LFB J;  1R7I A;  4JI1 F;  2FB0 A;  1T03 B;  1I3O B;  3AA9 A;  4OYX A;  4DZ6 A;  2W8K A;  3D2W A;  2UXB J;  4ZKA A;  2PT0 A;  4ZN3 A;  1NLK L;  4N77 A;  4G65 A;  1FF2 A;  4QWA A;  3NEK A;  2RUG A;  3NRB A;  4ZVQ B;  3QWU A;  3A4T A;  3EUN A;  4PR6 A;  4TU7 A;  3F0N A;  2XO6 A;  3OV7 A;  1NKB A;  2RQK A;  2HSE B;  4WPA A;  4JV0 A;  5J2M B;  3QGI A;  1DJ0 A;  1OSD A;  2J8A A;  3DFE A;  1MWQ A;  3MUR P;  4NLX A;  7FD1 A;  2UXB F;  1IVZ A;  2NPF A;  3CCR S;  3D0H E;  4M5K A;  4KYZ A;  5IC6 B;  2V94 A;  1OY9 A;  2OAU A;  1CJV A;  1NHV A;  4DSJ A;  2UXC J;  2VDH A;  2VG7 A;  3OW2 R;  1CG2 A;  1K44 A;  3QIP A;  1TL1 B;  2C2E A;  3CC7 S;  2CPI A;  2HND B;  3MM6 A;  3QQC D;  5B0C A;  2RF2 A;  2OPS A;  4TKT A;  4O3R A;  3HHD A;  5IT4 A;  1REV A;  2YNI A;  2ZBC A;  4OYA A;  3K8W A;  4UZC A;  5ETR A;  2VG7 B;  1DAR A;  5GAG I;  5E41 A;  4IOB A;  2CPX A;  1M5O C;  1LKZ A;  2P9E A;  3R2D J;  5BJR A;  2YWW A;  3NS5 A;  4RKU C;  3W62 A;  2RUS A;  1LNQ A;  2IM0 A;  3C6T A;  1NKC A;  4X4T A;  3MPV A;  1PSD A;  1GMU A;  2R7O A;  3ZFV A;  2VBX A;  5CAA A;  5KFJ A;  1XMO F;  1WC5 A;  3R5D A;  1N5V A;  2IC3 B;  1LQ9 A;  3OHB A;  4K4X A;  1Q7Y T;  3RB6 A;  1NSA A;  4G6V B;  4YDD B;  3QT8 A;  2DR7 A;  3FFI A;  2Q3P A;  1RT2 B;  3MMJ A;  5KT6 A;  3CJ2 A;  4DF4 A;  1L3T A;  4WFY A;  3TR5 A;  1U02 A;  3JTP A;  1FEE A;  1FRJ A;  2KZZ A;  2DPJ A;  2VC0 A;  3EE3 A;  1VBZ A;  5F9L A;  1DZ5 A;  1HNX J;  4DG1 A;  3U7J A;  2NXN A;  3FCV A;  4LRC A;  1F5B A;  2JRS A;  4FKY A;  3GB0 A;  5F3Z A;  2RS2 A;  3PX6 A;  3T6J A;  3GIL A;  2JOQ A;  1RT3 A;  4MIB A;  5H9F J;  7FDR A;  3GCW P;  1PKU A;  4CQ1 A;  2GMJ A;  3MED B;  5JXS A;  4DSF A;  2PA8 D;  1LWF A;  3AB4 B;  4Q2M A;  3SMZ A;  4DR5 F;  2HHT A;  5EN1 A;  1LV5 A;  2YWE A;  1GMW A;  2R7Q A;  3QLH B;  2VOD A;  1WDT A;  1KQK A;  2HQG A;  1PBU A;  2GFF A;  4CM0 A;  2DD8 S;  3GFH A;  2YNI B;  3JAM U;  1XR7 A;  4LF6 F;  2ALY B;  4DR4 J;  4JI7 F;  1XEZ A;  2M4M A;  5LJ3 Y;  5G0R A;  3M2U A;  4B3R J;  5KFH A;  1T0T V;  3NS6 A;  3D6H B;  4QWE A;  2R7W A;  5C42 B;  4KGZ B;  4JV1 A;  2GAH C;  2XGP A;  3IM9 A;  1MWZ A;  2OML A;  4FS1 A;  1NK5 A;  2H4W B;  2EFN A;  4CNZ A;  2DTJ A;  4KGK A;  4AD6 A;  2MZJ A;  2MQM A;  3TAP A;  4JB8 B;  3GE9 A;  3UR3 C;  1MU2 A;  4LF9 J;  1YWX A;  1N5Y A;  3CDB A;  1TMM A;  4JI8 F;  5A76 A;  1CQM A;  5GAD U;  1VDH A;  3ENV A;  3UD4 P;  2V8P A;  1YTY A;  3KNA A;  2B9E A;  1R0C B;  2F1F A;  3MWB A;  5F0W A;  5IWA F;  4DV2 F;  2DK2 A;  4LBI A;  2WVF A;  1CJT B;  3CC2 S;  3W2W B;  4Y6I A;  1OY8 A;  4LVN P;  3W9J A;  2H4Y B;  2X1B A;  1ZA2 B;  1C0U A;  4MTP A;  2DNO A;  1KD1 T;  2R3V A;  5CQG A;  1RTJ B;  2HHP A;  4M95 A;  2QRR A;  1G4C A;  1S7H A;  3M8S A;  3KJN B;  3HSJ A;  3M30 B;  3M8Y A;  1M5P C;  2E5L J;  3G6X A;  4PUO B;  2QMW A;  2GZO A;  3LGM A;  1RTD B;  2ZE2 B;  3C8Y A;  3UPF A;  3J7Z T;  1Y5I B;  2KT5 A;  4QJV A;  1OSC A;  3MM8 A;  1RWK B;  5ETK A;  4ERD A;  1NCL A;  4K0K F;  4YY3 F;  4J9M A;  1YBA A;  2CQ4 A;  4MYT A;  3KTQ A;  1QUV A;  3B4D A;  4OYM A;  1FE0 A;  2OUG A;  2I5J B;  2NPI A;  3ZO7 A;  5D6G A;  1S9G B;  3L7O A;  4QW8 A;  4F04 B;  1YX2 A;  4KO0 A;  6FDR A;  3LP0 B;  2CJY B;  2OSR A;  3DXB A;  3T41 A;  3G8S A;  4ECV A;  4EYI B;  3BN4 A;  5IM0 A;  1FKO B;  2FJX A;  2HHV A;  2KFN A;  1FDA A;  4R25 A;  1VK8 A;  4C7Q A;  2BVZ A;  4KPC A;  3UVJ B;  2V6A A;  2C2M B;  2JX2 A;  2XMW A;  1VOM A;  2V8D A;  3NMA A;  2ZH7 A;  4C11 B;  4DDF A;  1RLC L;  5A8R B;  3B78 A;  2OFG X;  4J9L A;  4CH0 S;  5M2R A;  1C0T A;  4AL6 A;  5HSP A;  2AJF E;  4GVB A;  1XR6 A;  2C3P A;  2Y0S D;  1HPZ A;  2YQ3 A;  1EB0 A;  3TO8 A;  3TUI C;  3OXL A;  3QZ8 A;  3OFH A;  1BGX T;  2GHP A;  4YR2 A;  2OLW A;  1UW9 A;  2BRL A;  1ZPW X;  2CQ0 A;  2ALZ A;  5IXU A;  2EFG A;  5LMN F;  4PG4 A;  1TAU A;  2BM1 A;  3CCJ S;  3H7H B;  4F36 A;  1N33 F;  1BQX A;  1RBO B;  5LT5 A;  4UTG A;  2Y1L B;  1T9Y A;  3CJT A;  4DV7 J;  1FEH A;  1KTQ A;  3M6U A;  5KG2 A;  2DNM A;  3MOJ B;  1TKX B;  3L95 X;  4RWX A;  1UPP A;  1YDL A;  1XNQ F;  3FJ2 A;  1FCA A;  5T7L A;  1HHS A;  5A8W A;  1FES A;  2XUL A;  1DTQ B;  3ADA C;  3HFV A;  3QSI A;  5CYJ A;  2MQO A;  5DM6 Q;  3D7S B;  3OL9 A;  4QWD A;  2EKY A;  5HVF A;  3WQP A;  3BO2 A;  4UF4 A;  2AMC B;  3MI7 X;  2B4P A;  4PZV A;  5A8W B;  2HIY A;  1GK8 A;  2HFU A;  2GIQ A;  1UWA A;  1TL7 A;  2E1A A;  1BWV A;  1RKI A;  1IJF B;  4ZLJ A;  5KT3 A;  2MKI A;  3PZP A;  2A6O A;  3BDE A;  2FVS A;  3JSB A;  3I82 A;  5KT2 A;  3BBF A;  2KFZ A;  1A6L A;  3JQK A;  3UVJ A;  3IRW P;  1W2B R;  2J7K A;  4NAS A;  2IJN A;  1URN A;  4C11 A;  3THT A;  2EKN A;  2XYH B;  1U8W A;  1H6K X;  1N33 J;  2OPR A;  1I94 J;  2Q6B A;  1U26 A;  3R6G B;  4BWJ A;  5CYQ B;  2C2D A;  4I7F A;  2HMI A;  2UUB F;  1Y10 A;  2EK1 A;  3KG1 A;  4O4G B;  2N4C A;  1V3S A;  3MTJ A;  3SCJ E;  3EZO A;  3M7V A;  3FEX B;  5K8N A;  5D4L A;  1NBE B;  5HLF A;  4X4N A;  3QJL A;  4IH7 A;  2AEM A;  1S9F A;  1LXJ A;  5DET A;  2CDR B;  1QTN B;  2QLB B;  3HVT A;  2DCU B;  4I64 A;  5HBM B;  4Q44 A;  1UCN A;  3DLJ A;  1KRP A;  2OPS B;  2QEX S;  5D4O A;  2CJX B;  2FY8 A;  5A6W A;  1RWP B;  4DWI A;  3OHA A;  3TVK A;  1T95 A;  1VGY A;  2E1P A;  4IFY B;  4RO0 A;  4DFM A;  4NCG A;  4NLS A;  2M8H A;  3N6M A;  2KXN B;  2HQC A;  3LF0 A;  2V34 A;  1RCX B;  5E2Q A;  4N56 A;  3QWP A;  4ZK7 M;  5BR8 J;  2P5V A;  4WXW A;  3R7B B;  2VQE J;  4J9P A;  3OL8 A;  2H5E A;  2XM3 A;  1RTI A;  4K4Y A;  3JTO A;  2A2C A;  4C8M A;  4CDI A;  4MFB B;  1KC8 T;  1J5O B;  5IV3 A;  1UFK A;  3Q0A A;  4F4X A;  1MMD A;  4YR0 A;  1NHK L;  3K17 A;  3M2R A;  4S0M A;  5B0B A;  1JJC B;  2EFP A;  2X51 A;  4CNY A;  4LQ9 A;  1HHQ A;  2CJA A;  3ONQ A;  4MK9 A;  5JMN A;  4O44 A;  1SQE A;  4N8N A;  2BOP A;  3M32 A;  3EZ5 A;  2EG1 A;  2LKZ A;  1NJI T;  4PG8 A;  1ZYQ A;  2MKK A;  2LDY A;  2VC1 A;  3AH6 A;  3CMQ A;  2F7V A;  2ZJR Q;  1ACM B;  1VQO S;  4FP9 A;  4HHJ A;  2U1A A;  1PJ7 A;  5L46 A;  2IY5 B;  5IT9 Y;  4CLL A;  1VHI A;  1FD8 A;  3GFY A;  2UUC F;  4OZ0 A;  1UWB A;  2GJI A;  4QOT A;  2DIS A;  3WC2 A;  1CJV B;  1AUD A;  1U2C A;  1TV6 A;  2C3U A;  3A3N B;  3CE8 A;  4IKA A;  2BX6 A;  1FA0 A;  4ZPT R;  1YHQ S;  1RSC A;  2AEJ A;  2DGS A;  3PHT A;  5J1N A;  1RI7 A;  2D74 B;  1ZA1 B;  2XY5 A;  1FDN A;  2WB4 A;  3H90 A;  2A0F B;  4NZ7 A;  5J2M A;  1TKZ A;  4OZ5 A;  5DGA A;  1A7G E;  2VKR A;  4UOG A;  4I68 A;  4WJB A;  3H98 A;  4DL0 C;  2R8J A;  1P6T A;  2GVD B;  4WP8 A;  1ITP A;  4NZ6 A;  3PXG a;  2R8I A;  3LQV A;  2PN6 A;  3US5 A;  4IFV B;  2BBE A;  1VR6 A;  4ZP7 A;  4CYU A;  3HD2 A;  5L9X A;  3TWZ A;  5J1P A;  4NLR A;  5C25 B;  2GVD A;  1HFE L;  3MOZ A;  1KVK A;  2XWY A;  1ULR A;  3CCV S;  4UOF A;  5GAG U;  2B43 A;  4QR2 A;  1CPZ A; 
#chains in the Genus database with same CATH homology
 1DY3 A;  3MCM A;  4M5N A;  4AD6 A;  1EX8 A;  1RAO A;  2CG8 A;  1RU1 A;  1Q0N A;  3QBC A;  1TMM A;  3ILI A;  3ILL A;  5ETS A;  5ETT A;  1EQM A;  1EQ0 A;  4M5I A;  1KBR A;  2F63 A;  1RB0 A;  3HSZ A;  3KUG A;  4M5K A;  1HQ2 A;  3UDV A;  3HCX A;  5ETL A;  5ETV A;  3ILJ A;  5ETQ A;  4CYU B;  5ETO A;  1TMJ A;  1F9H A;  4CWB A;  2BMB A;  3UDE A;  2QX0 A;  5ETK A;  3MCN A;  3IP0 A;  3HT0 A;  3UD5 A;  2F65 A;  5ETN A;  3HD1 A;  4CYU A;  5ETR A;  1RU2 A;  1G4C A;  4CRJ A;  1IM6 A;  3HSG A;  3HD2 A;  1HKA A;  3KUE A;  4M5J A;  3HSJ A;  3KUH A;  4M5M A;  5ETM A;  4M5G A;  1RTZ A;  4M5L A;  3HSD A;  3ILO A;  5ETP A;  3MCO A;  1CBK A;  4F7V A;  4M5H A;  4PZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...