4F7WA

Crystal structure of klebsiella pneumoniae pantothenate kinase in complex with n-pentylpantothenamide
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
309
structure length
309
Chain Sequence
b'LMTPYLQFNRHQWAALRDSVPMTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pantothenate kinase
publication title Crystal structures of Klebsiella pneumoniae pantothenate kinase in complex with N-substituted pantothenamides.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase, biosynthetic protein
total genus 109
structure length 309
sequence length 309
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f7wA00
3EWAA 4LY6A 3IIKA 3THXA 3SQXA 2WWFA 1QBKC 2HCBA 3GCGA 3Q7PA 2W6JD 1S3GA 4TMZA 1JPNA 4JL6A 3T06B 5FOTA 1Z63A 4I81A 5JEDA 2DCUA 5AUPB 3EIHA 4YDSA 5SZKB 3FYHA 1ZAKA 4RVCA 2CHVA 4IDHA 1T0HB 2BVNA 3WBKA 2D62A 3C14C 4IVRA 4UKDA 4BFXA 2GK6A 4QBGB 4JSYA 4TQUS 3GJ4A 1DAFA 3NHBA 4PSKA 5J4KA 4NL4H 2ZSAA 4MUAA 4BRWA 1GITA 1ZCBA 4PFSA 3B1VA 1J8MF 2DY1A 3K0SA 1W0KA 2GCNA 1GL7A 1OXXK 1ESMA 4ZDIA 2GCOA 4NCKA 1DVRA 3IQWA 1XWIA 1WXQA 2DBYA 1OHHA 3U60B 1XTIA 2SHKA 1IXRC 1L7VC 1D8TA 2MMCA 1NSTA 5FI1B 4MRNA 4LI0A 4BEJA 4DLSA 4P3YA 2REXB 2ZE7A 4TLAA 1P3JA 1VCNA 2AD5A 5CJ2A 3PJRA 3IKJA 4IDOA 3THOA 1NMZA 4TYPA 4EIWA 4OYHA 4JYBA 3EZ6A 3KQLA 2JLYA 2QQ0A 1GM5A 1CU1A 2ZJ2A 4GT1A 1Z6GA 1IJEA 3FHOA 1F3OA 3IEUA 4B76A 1K5DA 5JMTA 3I5XA 2YV5A 2YJTD 2C2HA 4TT3A 1T3LA 2ZRBA 2VRWA 3KKMA 4RD6A 4WA7A 2JLUA 5AJVB 2J3EA 1QHIA 1TEXA 2N1BA 3FGNA 1MABB 4Q7MB 2ZSEA 4D4JA 2QBYB 1P60A 2VA8A 4F7WA 3OE7D 5CLQA 4C0LA 3R9XA 2AKYA 1N25A 2ZI5A 3EPJA 4MRPA 5E7JA 4EPVA 2FX3A 3HDTA 2R6AA 4TMXA 1V5WA 2R6CA 4PSVA 3CWQA 3I62A 2OAP1 1ETUA 4M1OA 4PQRA 4DCSA 1XP8A 4E03A 2EFGA 1ZM2A 3SFZA 4C9BA 2Q3MA 2W2TA 1S9DA 1IN6A 1G7CA 1KIMA 1OSNA 1CF4A 2QMHA 2WWHA 5DYIA 2OUKA 3W8NA 4A0HA 2H8KA 4LYFA 4KBFA 3GFOA 1KGDA 2ZRDA 3SJBA 3ADCA 2GF9A 4UNNA 2CVHA 2QGZA 1IAQA 2FG5A 2GXAA 2QG6A 4HAYA 4B34A 2W2VA 2FWRA 3KKOA 3CNLA 3W5JA 2VTKA 2OG2A 2OAQ1 3ZGXA 5AUNB 1II9A 4F4CA 1H8HD 4I1SA 1OKKD 1HE8B 3LO5A 2CLSA 5FTNA 2ONKA 4B35A 3P32A 1E2DA 1OV4A 2ZRIA 4M1TA 3UATA 1RRGA 1IN4A 3AVVA 1S4QA 4TZ6A 5CDFA 3BH0A 1KI3A 2GWHA 2G1KA 2NZJA 3MMPA 1QVAA 3CBQA 4QGHA 1MABA 2XITA 4BLSA 2C8VA 3OAAD 3B5JA 4JBXA 4LHZA 1SVKA 2X1VA 1E2QA 2H16A 3UG6A 2ORVA 1G3QA 3U3OA 1KK3A 3AUXA 3QXHA 3DMNA 3CR7A 4AIIA 3QVVA 2ZRPA 1GL9B 3FPAA 4Q18A 1AS2A 2V55B 3FFBA 3RAPR 2BDTA 1UJ2A 4PXAA 2FV8A 1JAIA 5HCNA 1G7RA 2PL3A 4IXNA 4OHXA 4QM6A 5JBQA 2CE7A 1SZPA 4BECA 4M9XA 1E4YA 3GLIB 4JLKA 1NMYA 4PAOA 2BBOA 2G88A 3BC1A 2C98A 4A36A 1N0WA 2PMKA 4E5UA 1PLLA 1E2MA 4U00A 2EVWX 3B7GA 3QUSA 2ZRKA 3U3MA 1X3SA 1G8PA 1Z2AA 4FXPA 4OHZA 1IY0A 1G3UA 2ZE8A 2QAGB 4IDQA 1XTJA 3RRZA 2A5GA 3JVUA 2DB3A 2X2FA 1CRPA 5JWOA 2WTUA 5BWMA 3K9GA 2AXPA 4MKHA 4MRRA 4OHWA 8OHMA 1PV4A 2OLKA 3KJIA 1IXSB 4BLTA 1AJEA 2KJQA 2NIPA 3BFVA 2IUSA 3SS8A 2WJVA 3RRMA 5LB2A 3ADDA 1XPOA 5LD2C 2WJHA 5H1YA 1XZPA 4AD8A 1KNQA 1M7BA 2J0VA 3GEHA 3U4QA 4EPTA 1SHZA 1N6RA 5IK2A 1UBCA 1XCGB 4LYJA 4WW0A 1YRBA 1KI1A 1ZIPA 4BFTA 1N6IA 1MOZA 3PEUA 1TUEA 2WWGA 2XXAB 2V6JA 2RHMA 4V0MA 2NMVA 1Q20A 3GLFA 1EG7A 3DZ8A 1HE1C 4RD3A 2Q9CA 1FX0B 3A1SA 3GLIA 2PMDA 4TWZA 2A2ZA 5A4JA 2ZJ8A 1YJ5A 4HAWA 3RC8A 3QEJA 2H18A 1E2PA 2AX4A 1T5LA 1KKLA 4MRSA 4JJZA 2X19A 4Q21A 1E32A 1XZQA 1OB2A 1K8RA 1TQ6A 2CK3D 2P6NA 4BFSA 1YKSA 3BORA 1UAAA 1E2EA 1FP7A 1YR8A 1MV5A 3AVWA 4YMWA 2GJSA 4CT4B 2P3SA 4IDPA 4P4SA 4JVMA 3CPEA 1RKBA 3O47A 2A78A 2GXSA 1W0JA 5JJLA 4E09A 1ZRHA 4Q9KA 4QHSA 3WRYC 2PX0A 2YOHA 621PA 3WNDA 4XWOA 4N0DA 3V9PA 2QRZA 2CLDX 5DI9A 1VG8A 3U7GA 2XX3A 2GCPA 4V0KA 3WYFA 4EFLA 5FPKA 1GSIA 2GZAA 1E79A 2FFAA 1R8SA 1X86B 3VKGA 3UIEA 2ODWA 1FNNA 2R65A 2J41A 5AUOB 5FPSA 1NP6A 4DHEA 3N2IA 4DLZA 5AJYA 2G3YA 3U5ZB 1UF9A 1ZINA 4RD0A 1VG9B 2XXAA 3A4NA 3DVLA 4AKGA 1CJUC 3AKCA 2RMKA 4C0HA 4HDOB 1NG9A 5G40A 4XD7D 3OF5A 3LH5A 3M0EA 1FX0A 3QKSB 1VG1A 4UNSA 2GTPA 3SR0A 4DEYA 1IN5A 3EZFA 4CVNA 1ZMXA 4EPRA 2VHCA 1XB2A 3RS4A 3C5HA 4LBVA 3AB3A 3EIQA 4MYUA 3SJZA 3O8CA 1Q12A 1IJFA 1E6CA 1JR3E 1KI7A 1LF5A 3LA6A 4G3XA 4B2IA 2Z83A 1U9IC 2FA9A 3KKPA 1G3MA 4NPHA 3IBGA 2GNOA 1EK0A 1XRJA 3I8XA 4XSHA 3VKWA 4DCVA 3U44B 4ZI3A 1VCOA 1XCPA 1P61B 2G83A 1ZU5A 5KUTA 2UKDA 4S35A 1E98A 4FMBB 2QGNA 3CR8A 1RIFA 3VX3A 3ZVMA 2WMOB 1JB1A 4OK5A 1LS1A 4RD1A 5AJWA 4KXFB 4A1FA 2MSEB 4KSCA 2GESA 4B3CA 1Q1ZA 2Z6VA 3GEEA 1G4AE 3ZZ0A 1G6HA 1G291 2WAXA 2CXXA 1ONBA 2VSOA 1DE0A 4LHXA 3AVUA 1T9HA 4A92A 5JI3E 4PZYA 3QKSA 4QGFA 1IHUA 4K46A 2QUZA 4IEIA 5AUQA 3SYNA 3NDBB 3RS0A 1KTVA 2D7CA 1Z0IA 2GILA 5EP2A 1GKUB 1W49A 3K0FB 5FPYA 1PVOA 1AN0A 3FE2A 3BAFA 3F3YA 1AKEA 4OI2A 4AYTA 3K0AB 2GXUA 2H57A 3GLHE 2QU8A 1F5NA 4BZXA 5KNCA 2JDIA 4FWIB 3SOPA 4CEJB 2CDNA 2B92A 4C2UA 1Q3TA 1SXJD 2QPTA 721PA 3CF6R 1ZC4A 4NKRA 4QJ4A 4Q4JB 1OB5A 3EAQA 1IQPA 5A0FA 3RS3A 4JLDA 1DAGA 1NN3A 1ZNXA 4TLBA 2D7DA 4B44A 1A2BA 2IL1A 1M1YE 4LJ7A 2GJAA 4FMCB 2ZI6A 1OXVA 3I1FA 1UM8A 2MSDB 4YXWD 1L8QA 3HJNA 2DHRA 3KXKA 6Q21A 2BBTA 5KHOC 1UDXA 3QNUA 4Q4AB 1HQYE 4DLXA 4F4JA 4W9MC 4M2LA 4US0R 1KDOA 2NQ2C 1JI0A 1ZD8A 3MLEA 5J4HA 4QGAA 4XOIA 1ZM7A 3OEEA 3D6TB 4G5RA 3VR6A 5L3QB 1LTQA 3PXGA 3K0FA 4F38A 3A4MA 4DLRA 2BKEA 5KU1A 1G7TA 4QXAA 2FPKA 3U7FB 4HLUC 5FBVB 1T91A 4KODA 5JWHA 2W6ID 1KAGA 3K0AA 4JLBA 3VR4A 1NBMD 3CKLA 1TAGA 4LZZA 1WF3A 4XH9B 1W2GA 1SHKA 4JS0A 3K70D 2V4ZA 3DM5A 1DO2A 1IONA 4Q02A 2Q0HA 3NHAA 2NO7A 2W6JA 4TTQA 1NNEA 5FH9A 2IYYA 3ASYA 1BOFA 1EWRA 4XWKA 5HCIA 1S1CA 3GJ0A 4I1OA 1XCMA 2E9SA 3A1WA 4LYHA 4ARZA 4CIDA 2J0QA 2QSYA 3WBJA 4BRUA 3BB4A 2ZRLA 4Q4LA 5DGXA 3ZS9A 4KYUA 2QP9X 2BMJA 1QZXA 1XMVA 3NEJA 3UMFA 3TJZA 2A5YB 1IY2A 1E9RA 3TE6A 3W6OA 1UKVY 2XZPA 4HLDA 4I1VA 4QM7A 1W47A 2XNDD 1AZTA 3PIRA 3JZAA 1P73A 2CHGA 3P1JA 2JJ2D 3CRMA 2H92A 4TZ0A 3OEHA 2ZTSA 3T5DA 3K09C 1VYVA 4BEBA 1JEEA 1ZU4A 4PQFA 5L3QA 1CS4C 1NL3A 4UNPA 3RABA 1ZM9A 2ODEA 4IFEA 3W90A 5AWFC 4AYXA 1LB1B 4GOXA 4A0GA 4WVFA 2G6BA 2C78A 3OESA 1R6BX 1N5LA 4DDWA 2XTMA 3D3QA 1UBEA 2OT3B 4PSAA 1ZM4A 4ZPXA 2Q3FA 1XDBA 5FR2A 1S1MA 1RYHA 5FI0B 5FOXA 2RGBA 4Q1EA 2UVQA 1D2EA 1OH7A 5IRCD 1Q1EA 4L15A 4HAZA 4CF7A 3PCRB 5J4VA 3EIEA 4IOMA 3CIOA 1KK1A 1U8ZA 1G20E 3W6PA 2O8BB 4NTZA 3ZS8A 3MUFA 1W1WA 3CLVA 3AKDA 1TF2A 3LD9A 3CPJB 3M1IA 1SKYE 4A2QA 4BLRA 1BMFA 2WBLC 2BMEA 3OFND 4JLOA 1GRRA 4B74A 3UG7A 3R8FA 2I4IA 4A9AA 1CRQA 1KMQA 1EFHA 1KYIA 4DLTA 1W36B 1P2TA 3CRW1 4ILEA 2VEDA 3LVQE 1PUIA 3N70A 1XD8A 2N46A 2VLIA 3GLGB 2RGAA 5F98A 3CF0A 1KSJA 1DBSA 3FKQA 3HU3A 1GDDA 3IO3A 2GZDA 4TMWA 2WSSA 1BO6A 1XXHB 2WJIA 3Q72A 4TL6A 4AURA 4D82A 1GTVA 1N5KA 2CLCX 3HPQA 4MGKR 2ZJBA 5FPHA 3AQ4A 4NCJA 1OXTA 1P9RA 2V7QD 3BB3A 1UKZA 4JLAA 3RRYA 1Z29A 2WWYA 4BASA 3SYLA 3WYAA 4OI0A 4WXRA 3OIWA 1TTTA 1OE0A 5LDDC 4PX9A 2O8BA 4DWJA 2G0TA 1AKYA 1M8PA 4C7OB 4LHWA 2CEAA 5B2ZA 2HYIC 1HURA 4R2IA 1E9SA 5KSYA 5L3SB 4C30A 5SZIA 3WP1B 3KQNA 1SXJC 2WPDD 4TYNA 1VMAA 4ZCMA 3FMPB 4HLCA 3A36A 3SDZA 3FFAA 4URZR 4ZI2A 2R62A 1GNRA 5DHFA 4AKEA 3Q85A 2BOVA 1FL9A 4ABYA 4G1UC 4WAUA 1GVNB 3U7HB 3GD7A 3BK7A 1NLZA 2AWOA 3GLGA 1W46A 4KO8A 3FB4A 3SYKA 1QG2A 5JEEA 5JI2E 4ON9A 4Q48A 3TVDA 2ZROA 4LV8B 1RZ3A 1Y63A 1XXHA 1GNPA 2X2EA 2YC2C 2O0HA 5A5GA 5JCPA 3CWZA 3KDSE 3THXB 3IQXA 1VIYA 3K9HA 4RZ3A 3IEVA 2QI9C 2R6GA 2V1XA 1RVDA 4X8MA 1JQJC 2EWWA 4TLEA 4TMKA 2ZPTX 4HAUA 4A6XA 1G16A 2P67A 1Z2CA 3OIUA 4RSGA 4UXHA 4KJZA 4XVQA 1G9XA 1KI9A 2IWRA 3J81k 1PZNA 4DIDA 5FBRB 5FPTA 5TMPA 1E1RA 4ASUA 1UKEA 2AKAB 2HXSA 5KPJA 4IXMA 4PPQA 2QY9A 2ATXA 4C7OA 3QG5A 1IBRA 3K70C 4OQXA 4TQ9A 3QJYA 3CONA 4FMDB 5L3SA 1BH2A 2B7CA 3NH9A 1HV8A 1Z6XA 2B7BA 2WAYA 4PANA 4GMXA 5F9FA 2CCGA 1TU4A 2O0JA 2KE5A 3FTQA 4MKIA 4NYMR 4O2RA 5ELXA 1ZD1A 2P65A 4GRAA 2V8OA 1DEKA 1HH4A 3IIMA 5JS8A 3MFYA 1P9WA 3ZVNA 3EZ2A 3C7KA 1E9EA 4EFNA 1NN0A 2J59A 1VYTA 3TRFA 4HB0A 1NKSA 4Q1BA 1EX7A 4OQMA 5F2EA 3AP1A 5JHHB 2REBA 4EQ6B 4KBGA 2HUPA 2QM8A 2GJKA 2O8DB 2FEOA 5TB5A 1A82A 3SJCA 1X8LA 3QKRB 3QSYA 1PLJA 1S8FA 3LFUA 3PG5A 5FUVA 2G0NA 1P6XA 4BFVA 2G1JA 5EXXA 3ND9A 1M7GA 4UNQA 1SQ5A 4L5BA 2HLDA 3B6EA 5TY0A 2OCPA 3SC3A 2F43B 2WJYA 2IUUA 5K8UA 4HSEA 1UKYA 3K9LA 4Q4HB 4UJ5A 5JCZA 2BEJA 4TYQA 4FIDA 1SVLA 3PEYA 121PA 3QF7A 2NOAA 2AD1A 3QPUA 2IYUA 3B1WA 3AVTA 4NCIA 1EFTA 1DARA 4NHOA 2IYRA 2RGNC 1QF9A 1ZBDA 4B47A 2FZLA 1KMHB 1XMSA 2HEIA 2JASA 4BFUA 2QAGC 1XTRA 4C3ZA 3R7WB 3DKVA 4NONA 4BLQA 1H8EA 3CW2A 2MMGA 2OCYC 2H7VA 1P2VA 2GA8A 2J45A 4R98A 3SE0A 2WWXA 3FMIA 2FZ4A 3REFA 1NVVR 4LC0A 5J40A 4BE7B 2PX3A 4BFZA 1KI6B 3C41J 5EP3A 4EQ6A 3AP2A 2QZ4A 2O8DA 2XOKD 4FW9A 1LVGA 3X1WA 3QKRA 1NJFA 4LJ8A 3EA0A 4A8JC 4HYYA 2CNWD 1QHHB 4HLQB 4QBIA 4AK9A 3DOEA 4LCBA 3BJIC 4MGIR 5BN4A 3VNVA 2ZSFA 1OH8A 2F43A 3JVVA 3RSLA 3WYGA 3BOSA 4RKFA 4W5WA 5GVSA 2GZHA 1NKTA 3GJ7A 4Q4HA 4ZKEA 4CYMA 3PEWA 5FUXA 3KQHA 1KSGA 3PITA 5BN5A 5HZHA 2XSZD 2OCAA 3NBFA 3PENA 3WXMA 3LV8A 1A4RA 4Z1MA 5DH9A 1I4LD 1EXMA 2DFLA 5FBWB 3TR5A 4BWYA 1HUQA 1KMHA 2BMFA 1JJ7A 4JJKA 3HWSA 2IYZA 3NBXX 1COWA 2Q21A 3R7WA 4YMUA 2Z0MA 3RS2A 1CTQA 2VP6A 1T6NA 5LBIA 4LBZA 3LVRE 4DUGD 2FGJA 3C16C 2F1RA 2A9KA 2C9YA 3ZH9B 3EPKA 2CL7X 4QNMA 2VHUA 3T15A 3SHFA 3DOFA 1DTSA 1JR6A 3KJGA 1OFIA 1DAIA 4YMSA 2NG1A 3TNFA 1VHTA 1KI6A 1XX6A 4KCGA 1W4AA 2J1LA 1Z28A 2EU8A 4KFUA 1KK0A 4HZUB 1E9DA 3MAAC 2VP2A 1QHHA 2VYFA 4C0BA 4POAA 1YZGA 4DLYA 2OZEA 1KJWA 4WZAE 2OFXA 1HT2E 1B0UA 1OYWA 4X8OA 5TDHA 4EKDA 3H86A 3X2SA 5E4FA 1CEEA 3CX8A 5TXGA 1NMXA 5KNDA 2JCSA 4PR0A 4AI6A 2JJ1A 3QXXA 1TUIA 5GVRA 4XJXA 5HKKA 1Z08A 2F9MA 3UWKA 1JECA 3FOZA 4CEHB 1FTSA 2QORA 3ZQJA 3P4YA 1EFRA 4YC7A 3U4QB 2FF7A 4KLNA 3MJHA 2JLXA 1L2TA 5DNYB 4QNRA 3G5UA 4ZIRB 4PC3A 1JPJA 1KZGB 5DN6A 4BFYA 1RE0A 4G5QA 1TMKA 5J5CA 1U2RA 4GPTA 4HDQB 2ZIAA 4HI0E 1IN7A 3IDQA 4FCWA 2CCJA 4DSOA 3QQ5A 3MWYW 2DFKB 2ZRJA 2QE7A 4KFSA 3GLFB 2OSBA 5JJIA 1JALA 2CL6X 2YWEA 1X6VA 2GBLA 5EE9A 4NBSA 4QRHA 2YOGA 2R2AA 1NG1A 5SZJA 1MKYA 4HZUA 2ZJ5A 1AIPA 1BIFA 3PQCA 4PC1A 1KY2A 4QJ3A 2BV3A 1AA9A 3AGQA 1D2NA 1G7SA 3PUVA 3KTAB 5H70A 2EFEB 3HR8A 2GEUA 4P4SB 2ZS9A 2IT1A 821PA 3C4JA 4Q1AA 1CR0A 5GJCA 2VP5A 4M1WA 1CR4A 1SVOA 3MD0A 2ZR7A 4F91B 4O3MA 3C5CA 2VSFA 2AFIE 1SXJE 4XVRA 2KWIA 3MGCA 4CEHA 4EAQA 4EPWA 2WWIA 4LJYA 3LDAA 1YU9A 1E9AA 1TADA 2B8TA 5DLQC 5CM8B 4XSGA 3ZIAD 4DLWA 3FVQA 4ZIRA 1Z07A 3L0PA 5C2JB 3HR7A 3I32A 2KBFA 5CDFE 2PCJA 4B32A 1XEFA 1FW6A 2IXFA 3AVPA 4GFDA 3ICQB 2DFTA 2F6RA 3PUXA 1RW4A 3GEIA 1MH1A 1E9BA 2IBMA 2YWHA 4URVR 1KY3A 3AVQA 4L8GA 4HATA 3RDPA 2V3CC 2JLQA 4JT4A 1T3HA 3DO6A 3I4LA 3T34A 2H1LA 2QEQA 4BQSA 4G0NA 1KNXA 5EZ6B 4V0OA 1XTQA 2ZJAA 3EG5A 3P20A 2VH5R 3C15C 4JVSB 4PPGA 2REOA 2XTNA 4Z54A 2F9LA 3A37A 4M1MA 1KZ7B 2BBWA 3EXAA 3SU8A 4IJMA 2RB4A 3AF0A 5FL7D 1DELA 4B2LA 3GP8A 1W7AA 1Z47A 2I3BA 2JIZD 1JR3A 2YVUA 1JJVA 2RGDA 3G82C 3KTAA 3R9WA 5KO2A 1NBME 2AHOA 2GF0A 2IEZA 2ZYUX 3AH8A 4B6EA 4RKEA 4GOJA 5DSZA 4NP6A 1Z8FA 2ZRAA 4WZBE 4O0MA 1WDTA 2QN6A 2W0MA 1ZM3A 1GNQA 3VKHA 3CNOA 1E0KA 3CX6A 4TLDA 3VHLB 1J70A 1OFTA 2F7SA 2HDNB 4UXJA 3EC1A 3WNBA 4OJQA 1DAMA 1F60A 3B8HA 4HZIA 2PZGA 4DT1B 1ZW6A 3LBNA 4FD2A 4KSBA 4ERNA 4US2R 3UWOA 4Q1CA 1R0YA 2IS6A 3ZVLA 2LWIA 2J5XA 5BXQC 1U0LA 1W5SA 3WY9A 4CZ2A 3CZPA 2VO1A 2QTVB 2BMDA 5CIQA 2KBEA 4KLZA 1W0KD 3IUYA 4CRWB 3B9PA 4PC7A 5BYKA 4TL8A 3NTUA 4JLPA 5DO9A 2QMEA 3CO5A 2G77B 1OHHD 2Y8EA 1N6LA 1L4UA 3CX7A 4KHZA 4MKGA 4BFWA 1JNYA 2O0KA 3ECCA 3WNCA 3OIYA 4K81B 3L8ZA 2K5UA 1G1MA 2FGKA 3KXIA 5DHAA 2NGRA 5JLJA 2PJRA 2FMXA 2WV9A 1ODFA 1QVRA 2NZ8A 2WHXA 1ZUIA 4KV9A 3VMFA 3QF4B 2OM2A 3GLIE 2WICA 1YRAA 3TQFA 2ERYA 2J0UB 2OXCA 3CB4A 5KDLA 2ZAOA 5D3QA 2OHFA 1RRPA 2QMUA 3LXXA 4Q1FA 2J9RA 2ORWA 2D4HA 2WIAA 1G21E 1ZIOA 2FNAA 4IOJA 1E2NA 4Z8YA 4AYWA 3X1XA 1MO6A 1OIVA 1XJ0A 4DT1A 4JL5A 1OH6A 4TT3D 1RPZA 4EJSC 4D26A 2ZR9A 3SNHA 3CH4B 2XZLA 4QGGA 4DZZA 5DYGA 3RVBA 4QOSA 1P62B 3ICEA 1P4SA 1Z6YA 1R0WA 4TMVA 3THYB 1F2UB 1CR2A 2W58A 4PTLA 1NI3A 3FWYA 3B2EA 2JLWA 5JZVA 5JWRA 2G9NA 4MH0R 2R9VA 2OFOA 3IHLA 2EWVA 3BWDD 2DYKA 3GJ5A 3B60A 3X1YA 1Q1BA 1IN8A 2ZEJA 4V0LA 3S1AB 2ZR0A 4NDZA 2KSQA 2R6FA 3MWJA 1SVSA 4MGYR 2L0XA 1RRFA 3ONWA 1AGRA 4PHFA 3LAWA 2J7KA 2AK3A 4I1UA 2IHYA 2WKPA 3W3ZB 4TSFD 3KQKA 2CCKA 5JFGA 3L0IB 3QF4A 1G5TA 2A5JA 1J7KA 4C0AC 1ZNWA 1GZSA 1DS6A 1OPXA 1ZC3A 3W6NA 1W36C 1TF5A 4NZYA 2J0UA 2V6IA 3HYTA 2WJJA 4LYAA 1OLOA 3FHCB 4XIGS 1YQTA 1DADA 4TL7A 1XTSA 3TSZA 4ARZB 1UFQA 2RGEA 3AEZA 4B3DA 5JHGB 5LD2B 2GJ8A 5L3RA 1YR6A 1NVUQ 3N5CA 3TVTA 4B3BA 1UPTA 5GJVC 3BXZA 5J4YA 1T0JB 1OFHA 3VAAA 4CEIB 2IYSA 5LPNA 3R9IA 2VHJA 3O8DA 3GJ8A 4JLNA 1G8YA 2TMKA 5CYOA 1A5TA 1IM2A 1N6NA 2RHDA 4RY2A 3THYA 1F2UA 4H1VA 4JSTA 4HB3A 1CJKC 4YMVA 1R10A 4WOPA 3AV0B 2J7PA 3TIFA 1KDPA 5KSZA 3RANA 1TL7C 2Z43A 2ZU0C 3LBHA 4LX0A 3S1AA 5EE0A 5AJZA 4DCUA 1EFUA 4M9QA 3T1QA 1E1QA 2C99A 3DHWC 2EFDB 2JA1A 2IS4A 1G64A 1XEWY 2OBLA 1W44A 4JT2A 3NWJA 5G3ZA 1XD2B 4EDHA 1E2KA 1FQKA 1TPZA 1M74A 4RZXA 4O2LA 5KSPA 5CIWA 2RH5A 2DWOA 1D6JA 4KFTA 1G18A 4UQOA 4KVGA 1XMIA 2FFQA 1II0A 3WRXC 2KB0A 5K8LA 2IF0A 3A58B 1C9KA 1MT0A 5KYKA 4CEIA 5J47A 5DIFA 1OIXA 1NN5A 2QMOA 1AS3A 3N2EA 1WQ1R 3SJAA 3JZMA 4IDNA 1WMSA 4PZLA 1R8QA 3R20A 4LJ9A 3SEAA 2IC5A 3SQWA 4DDTA 3FKSD 2VF7A 3K0EA 4P33A 4I4LA 3PFIA 4NE2A 4OL0A 3QOFA 4R7ZA 3BRWD 1U98A 4W7SA 4D2IA 4A4DA 4W5HA 2QTHA 3SFVA 2IYQA 1VIAA 1W5TA 4MDEA 4II7A 1OYYA 3ZVRA 1LW7A 2VP0A 3A8TA 5FTKA 5IK2D 4TMTA 4U7DA 5JS7A 3TW8B 2QTFA 1NLYA 5B58C 2GXQA 1G5RA 5HE9A 2GEVA 3R8CA 3EARA 1TQ2A 4LBYA 1YZQA 1VECA 1S2MA 3AVOA 2GAOA 4D6PA 1WB9A 1W4CA 4JLMA 2BCGY 1G17A 1XD2A 2OLJA 2CL0X 5HPYB 3EA5A 3W3AA 1ESNA 1W4RA 3O8RA 2A5DA 3W8RA 3NC1C 4ESVA 4A2WA 4LHYA 1KOFA 1MRSA 3EX7C 1Z5ZA 5EXPA 1NY5A 3ZD7A 3CM0A 4TN1A 4YQFA 3F8TA 3QBTA 5J4LA 3MSXA 1RFLA 4GL2A 3DKPA 4E07A 2QA5A 3KB2A 3VFDA 2GEDA 1Q44A 3B13B 3BGWA 2DR3A 1M6NA 2ODNA 4MQBA 2NTYC 3QY0A 1E4VA 2ERXA 3L8YA 1G5PA 1W0JD 4KYIB 3OE7A 3I3SR 5EUMA 2FU5C 2FPLA 1NVWQ 4R2HA 3THWB 1U8AA 3T61A 2WKQA 4OHVA 1XEXA 5C1BA 4P32A 4URXR 3EPLA 1DAEA 1S0UA 1AZSC 2B8WA 4UNRA 4IKEA 4LJ5A 5ANRB 1E79D 2O52A 2J0SA 1J2JA 4BZPA 1U0HC 4HDCA 1MR3F 3NH6A 4CT5A 2GDJA 1Q22A 3REGA 4JLVA 1EWQA 2WIBA 1WCV1 4NH0A 1ZUHA 1ZJ6A 2A30A 2OESA 1P7CA 1F6BA 2ZYVX 5FOUA 3BS4A 2I1QA 2E87A 3T1OA 1U9IA 2GAAA 3K0CA 2RCNA 3ASZA 3U6KA 5EXSA 1NIJA 1CR1A 4NCNA 3LRPA 1ZUNB 4OI4A 4LUCA 1NN1A 1SULA 2FE4A 1H8HA 4PPFA 1A1VA 1OKKA 2QT1A 3ZYCA 3T1TA 1U99A 2FPMA 2WOOA 2QAJA 4G5SA 1G4UR 1WRBA 3QI2A 2GK7A 2OCBA 2PEZA 2WM9B 2Q3HA 2C03A 4A0FA 1XD9A 2WOJA 1ELOA 1KAOA 4AG6A 2NO1A 4O25A 3ZJYA 5IHPA 3I92A 3OAAA 5FTLA 2B21A 2P6UA 1LNZA 4DJTA 2XJ4A 3RSOA 2CVFA 3ETLA 3THWA 4R9UC 3E1SA 4M1SA 4AKIA 4YDHB 3ADBA 1Q1QA 4Q9IA 2XB4A 1XEWX 1J99A 1FUUA 1G8HA 1OT3A 3KKQA 4QFMA 2PT7A 5EE3A 3A4LA 3SN6A 1OIWA 1R2QA 1A2KC 1KO5A 2EFCB 3LBIA 4JVNA 3TBKA 4F93B 3ND8A 5FUYA 3QXSA 2IA5A 1T8TA 4RFVA 2OFWA 4URWR 1TF7A 1XJCA 4FMCF 4RZ2A 1WBBA 4YONB 3RRNA 1N5JA 3CF2A 2RKOA 1I4TD 2C95A 1LF0A 1K6MA 3VR3A 2IHBA 2JLRA 1F48A 2ONJA 1U8YA 1VCIA 3LQRA 1A7JA 3SBEA 5C4MA 5KDOA 1N6HA 1NJGA 1ZCAA 3H0KA 4TLCA 3QEOA 3GJXC 4F92B 4ITRC 4C0SA 4U5XA 3B78A 3HPRA 4F4IA 5L8VA 2ANCA 4NYJQ 3U6BA 4UJ3A 2GBLC 1X1RA 2O8CB 4Q47A 2ZVQX 1MO5A 2PZFA 5EJEA 2ZI3A 2JDID 5EQTA 4DSNA 4RFSA 5C46F 1LS6A 4PAQA 1II8B 2ATVA 1E0JA 1M7HA 4EFMA 2PBRA 2ZUBA 4PHGA 1GIAA 2JLZA 5K8TA 1ZP6A 4CGZA 4IOKA 2F3RA 2PZEA 3W34A 2WSMA 2ZRNA 1KI2A 2OEPA 1MO4A 4B43A 4D80A 3GPLA 3TK1A 3AF4A 1E9CA 1RYFA 2ZYTX 5HE8A 2JLSA 1Q21A 2NPFA 5JECA 4KAXA 2FEMA 1BYUA 1XPRA 3IO5A 3QXCA 4HLUA 1WP9A 2FN4A 2V1UA 1CLUA 3RLFA 3VQTA 1QHSA 1YZNA 3L0SA 5B30A 3EW9A 1S9HA 2QPAA 4J0QA 3VHXA 1K5GA 1MO3A 1N5IA 3Q8XB 1LY1A 3OEED 1R7RA 2ZRHA 3B85A 3VU9B 2OBNA 3GLGE 2CK3A 2A3RA 1W48A 2R8RA 5L3VA 1P9NA 4NYIQ 3I72A 4LRWA 2WMNB 4FN5A 4D0NA 4LSGA 1G19A 1XXHE 3EASA 1GL6A 2VPPA 3LLUA 4HB4A 4XWAA 1YR9A 3VX4A 2O8CA 2ZE6A 2BJWA 2DPXA 4GOKA 5FOSA 3QKTA 4P4TA 3WHKA 1E99A 3NVAA 3TUZC 5UKDA 3L2OB 3PVSA 5E7MA 1II8A 2ZANA 4DLVA 1KO4A 2JJ8A 4H9GA 2CE2X 2ODBA 3EC2A 4EUNA 4RZUA 1VTKA 1Z0FA 1D9XA 3K09A 3PUYA 1YVDA 4FINA 5CLLA 4D0GA 4DKXA 1SGWA 4LJAA 2ZXUA 2P6RA 1XMJA 4PHTA 2BWJA 5D3MA 2F1HA 2KI5A 3DMDA 4OK3A 3V4FA 3FDIA 1DG3A 3B1ZA 3ZQ6A 4BUJA 1JBKA 5P21A 1XTKA 4AY2A 1P2UA 2C96A 2P5TB 1O87A 2IYLD 2Q9AA 4W5JA 1OH5A 4XD7A 1Z0KA 1SVMA 2IK8A 1JEDA 3KFXA 1C4OA 3W5IA 3OEHD 2QSZA 1XFAA 2PH1A 521PA 1FPMA 1FTNA 4KI0A 4GI7A 5KSOA 3VR5A 3VU9A 1Q3HA 1J90A 1KK2A 1KO7A 3KL4A 2ZI9A 3CRRA 3LY5A 5F3WB 1VPLA 5K8IA 3NBZC 2R6DA 3VR1A 4JVLA 5E7IA 2QL6A 2BIFA 2IX3A 2BM0A 4MYCA 4WXPA 2RGCA 1N3BA 3RWMB 2UZIR 2VQSA 2PCLA 2BM1A 2LCFA 1N2CE 3OZXA 4DB4A 5BN3A 1SXJB 3M4YA 4FCVA 1GFIA 2H5EA 2Q6TA 2VHQA 2BC9A 4N1AA 4OKSA 2IYWA 2YKGA 2LKDA 3TH5A 3FMOB 4JYCA 2VP4A 1KO8A 5FUWA 2HJVA 4ZDKA 4AKHA 2OBMA 2HT6A 3L82B 1CBUA 1DAKA 4PO8A 4A15A 1FMLA 1PUJA 5H8WA 2BCJQ 1ZNZA 5AK0A 1QHGA 3IPXA 1GUAA 2VBCA 4PO9A 3KUDA 4PC2A 4DB2A 1BMFD 2BBSA 2D3WA 3IHWA 3RYTC 2PLFA 3GFTA 4C4PA 1QG4A 2FSFA 4Q01A 2AN9A 3RC3A 1RJ9B 4JKYA 2FFBA 1XJQA 3KUCA 1E0SA 4DDUA 1CXZA 1HT1E 1YR7A 1T4GA 1W2HA 3GJ3A 2F1JA 1GKIA 1HQCA 2W83A 4TTPA 2WSSD 2ZU6A 1T3SA 2IUTA 1R5NA 4MYTA 1VHLA 4TSFA 1GOTA 1IY1A 3IGFA 2NO9A 4DC9A 3K70B 2X8AA 4D25A 4Z8XA 2CHQA 3E5HA 4Y0AA 4DRZA 1ZNYA 4GMDA 4YMTA 1SXJA 3ZD6A 4B71A 4ZKDA 2DWQA 3UKDA 3A1UA 2N42A 4JLJA 1HTWA 3QIAA 3P26A 1FMJA 1I2MA 4XTCS 2HCJB 5JRZA 1GP2A 5FR1A 4NCHA 1IXZA 4GP7A 3LXRA 4OBEA 2O8FB 4LPSA 5DI3B 3D31A 3NKVA 3IILA 3I61A 4YXWA 5M04A 4YLGA 1DG1G 4LBWA 5CJPA 2QBYA 4FMDF 2MSCB 5AJXA 5KTYA 4JBWA 2HJGA 5HR5A 3LX5A 1VCMA 1R4AA 2J46A 1RJ9A 1US8B 4RJLA 3UXMA 1W36D 2EYUA 4GBMA 1KI8A 3T1VA 3ZZUA 1U90A 5G53C 4QL3A 3GQBA 4LV5B 4OQNA 1E96A 1AS0A 4K8OA 4U02A 2A5FA 2DWPA 3IPYA 4URYR 1E2LA 2Q9BA 3MCAA 2W6IA 4MITA 1NBMA 4DDVA 1BS1A 2B6HA 4G5GA 4L9SA 4Q19A 3TR0A 2FSGA 5FTJA 3AM1A 3VR2A 4D4KA 3O8BA 4QJ5A 3TKLA 2A7QA 4RCZA 1HY3A 3EZ9A 2C77A 4Q7KA 5IDVA 2J87A 5GJWC 3ZZTA 1E1RD 2ZS8A 4ASUD 1KHTA 3PUWA 4AWXA 2O8FA 1OXSC 4RCYA 1AGPA 4OJKA 5DI3A 3EPHA 5EP4A 3RWOA 3RHFA 2IW3A 2F3TA 2XNDA 2ZRGA 2OE2A 3HYRA 4LPKA 1L4YA 4Q66C 1U94A 3TW4A 1TEVA 2ECKA 2JJ2A 2ZJYA 1B23P 3FKSA 2FSHA 5E3HA 2QM7A 4Q9HA 1QRAA 2ZITA 5FL3A 1T5IA 4TL9A 1IOZA 1US8A 2CJWB 4MRVA 3BH6A 5EUQB 2OILA 3QG1A 4A6PA 4A8JB 3DL0A 3P4XA 4QBFA 4B48A 4DIEA 5FOWA 2IF2A 5EXTA 2GVDC 3GLHB 3U3JA 1LV7A 1LFDB 2UZ3A 2HYDA 4X8HA 3H1TA 1XBTA 1GAJA 4QG7A 1V43A 1EGAA 3WMFA 1OJLA 3GMTA 2JAQA 3BB1A 2NPIA 5CK4A 3MRSA 4IFBA 2ZRFA 1DPFA 1Y3AA 4OQFA 4B3XA 2HT1A 1Z0JA 5KOYA 4Q9JA 2RGNA 1BKDR 1YZUA 3KKNA 2JEOA 4WBSA 5H68A 1UADA 3GJ6A 2QAGA 1P75A 2HLDD 1UEJA 2ZYWX 2WZQA 2QROA 4JMPA 4GZMA 2JATA 1KSHA 3KQUA 4NYMQ 3WHLA 2RAPA 1N0VC 1WA5A 3W9YA 1I4DD 1QHNA 2BJVA 2HV8A 2NO0A 3CNNA 4XTRA 5JJKA 1TNDA 2XNSA 3AGPA 3OFNA 2EQBA 2XTZA 3Q3JB 2ZVPX 1N0UA 2OO7A 1DAHA 4Q5IA 5BQ5A 3PR1A 4CDGA 4M8NE 3RNLA 1VDZA 2ZI4A 3B82A 3Q5DA 2ZJZA 3MJRA 4MUBA 1D2MA 2CJWA 2P0EA 5GADl 2F55A 1GG2A 3UMSA 1H8ED 4R71A 3AVXA 1XF9A 4PC6A 4BPBA 4KVAA 2FH5B 1Z0AA 3LQQA 4A8JA 1NRJB 4DEXA 2EFHB 2IS1A 2Z5FA 2QRNA 3PV0A 3L43A 1RRCA 4V0ME 3A1VA 3GLFE 3AP3A 4MKFA 4ZCLA 3GLHA 1Q57A 5KDDA 4IOLA 2C9OA 5G41A 1Z83A 2QPOA 3VNUA 3OHMA 4ACBA 3KX2A 2V7QA 4MGZR 4B6FA 4DSUA 1E2JA 5KPDA 2XJ9A 1X8KA 4C0KA 2IYTA 5CYPA 2Z4RA 2GVZC 4OQLA 5LB4A 3ZDQA 4ZDWA 1N6KA 2E1RA 5TARA 4WZ6A 3K0CC 2DFNA 2ZQ5A 4LJ6A 3B1YA 4Q03A 4L4UA 3A6PC 1EESA 2WPDA 2FJUA 4IVPA 3V4RA 4PZZA 1R0XA 2ANBA 4DBLC 3LWNA 3MWLA 3BFKA 2IEYA 4NYJR 4PQYA 3T35A 1GKYA 4Z1MD 5HTKA 2PEYA 3UK6A 1JQLB 1H65A 1AK2A 2HXYA 3TSOA 4N3NA 3MG9A 3Q9LA 4L16A 1UBGA 5SZHB 3CH5A 1UEIA 4B3FX 3I8SA 1COWD 5CM9C 2IXGA 1NVVQ 4M0LA 1HA3A 1O3YA 3DPUA 1Z22A 1NF3A 4OK6A 5B57C 2XB2A 2VF8A 5FFMA 4B73A 2ZETA 1Z0DA 1U81A 3AVYA 2BHRA 1CJMA 221PA 1PJRA 3K8YA 1M2OB 3FHTA 4TQAA 1YZLA 1KSFX 2HF9A 3SHWA 1E9FA 3SI7A 4DLUA 2F1IA 5BYJA 1FOEB 1S96A 1AQYA 4Q7LA 3LX8A 1E3MA 1Z3IX 1D5CA 1YZKA 4M1YA 3U7EB 4OHYA 5JRJA 3QXJA 4IEEA 2PT5A 3TQCA 1FUKA 3TUJC 4US1R 4C2TA 2ZS7A 4PO1A 3WMGA 4JL8A 1HYQA 1U0JA 5HZKA 4B2PA 2V54A 1TX4B 4URUR 3TMKA 3QBVA 3CRVA 1JXOA 5FBQB 4LOAA 5FTMA 5JSZB 1SKYB 4ZDJA 5F9HA 4M4SA 2ZAMA 2JJ1D 4NYIR 2RGGA 5HKKD 1S3SA 3U44A 2H17A 1XPUA 3X1DA 1BYIA 3CUEF 1EFRD 4M22A 5IF9A 4GP6A 1GWNA 4M1KA 3QPVA 1NSFA 4RD2A 1CJTC 1CJVC 4JBYA 4N0EA 3BD9A 1P5ZB 5C18A 3KB1A 5TVKA 5DN6D 2QNRA 1GRQA 1KO1A 1QHXA 3IIJA 1J8YF 4GDFA 2XZOA 4BLOA 1ANKA 1E94E 2QE7D 1E69A 2C5LA 3F0TA 1SKQA 2VP9A 1Q0UA 5DE3A 5EE5B 5TV2A 1C1YA 5CK5A 2O8EB 4P31A 1G3IA 4NU0A 4FWTA 4V0NA 2IYVA 1TU3A 1OFUX 1MRNA 1WE2A 4JIMA 2R44A 4LJ4A 5CB8A 1G6OA 3VTKA 2D74A 2ASEA 2WKRA 1F2TB 2FOLA 421PA 1SVIA 3T5GA 3LW7A 2ZRMA 1NIPA 1FP6A 1R5BA 2HF8A 2IXEA 1XU4A 2OV2A 2P2LA 3PEVA 2NO6A 3TLXA 1AQUA 3KFVA 4QKQA 5JSZA 5CB6A 4NMMA 2D06A 3TSWA 3TAUA 5B64A 3UMRA 4CEJA 4G01B 3DDCA 1I2DA 3NEYA 4Z51A 2QENA 4G5OA 3U3KA 5FOVA 1XEXB 4E22A 5E95A 4Q4JA 5DISB 4DCTA 4HAVA 3CRQA 3ADKA 4QHYA 3U3RA 2GJ9A 1EX6A 2C9CA 1AM4D 1N6OA 2VSXA 4UXIA 2QT0A 2XGJA 2VL7A 1Z6TA 3G0HA 5EZ5A 4PPNA 2IS2A 4GSYA 3DZDA 4PHHA 2O8EA 4Q4AA 2Z4SA 1VG0B 3BE4A 2XOKA 2EW1A 1CIPA 4V02A 3AF3A 3HU1A 4D0LB 4M53A 2CNWA 3U61B 1RC8A 2W00A 1F2TA 4P4UA 1DO0A 4TYWA 4OI1A 3M6AA 5GJBA 3BERA 4MDFA 4D4MA 1WBDA 1R5OA 1JR3D 1CULC 3KZ1E 3NC0C 3X1ZA 3Q7QA 4EPXA 1M34E 1KDRA 4EJSB 4LK2A 3TGPA 1KJZA 4Y0VA 1FZQA 1NVXQ 1XNJA 2ZI7A 4Q1DA 4X8LA 4IRUB 2XSZA 4DXAA 2VHTA 2RGXA 2ZREA 4A0RA 1NY6A 1QDEA 3WP0A 4TTRA 1SVWA 4S2EA 4D81A 2YWFA 2C04A 4CW7A 1PLKA 3H4MA 3HP1A 2XEXA 1P72A 2CMKA 4KU4A 4DUGA 1GILA 3GFPA 3NXSA 3BIFA 4MA4A 3TUIC 2YZ2A 5EP1A 1ZYUA 2AK2A 1E2IA 4B75A 3QE0A 1CKEA 4C0JA 2AFHE 2I1VB 1NLFA 3QENA 2IWHA 1X1SA 3Q5EA 2GRJA 1E0AA 2CBZA 4LGMA 4M9SA 5BW8A 3H2YA 3T12A 2D2FA 5EE1A 3BBPA 4DVGA 4HUQB 2YWGA 2W0SA 4B33A 1UDWA 4LHVA 3K1JA 3PUZA 2GHIA 2QQEA 2AWNA 4QBHA 4HUTA 2D2EA 4HAXA 4FI3C 2JGNA 3K53A 3P27A 4AC9A 1JAHA 4EJSA 5C4GB 1KI4A 2AXNA 3QKUA 3B1XA 4TYYA 4RFSB 2JLVA 2ORIA 1KJYA 3I73A 3AKYA 3TAHA 4DSTA 2P5SA 4I99A 1G41A 3I5YA 1T8UA 2YNMA 1YHNA 2ZE5A 3UANA 3BH7A 3AKEA 3OIVA 1Z6AA 1ZD9A 5AR1A 3KXLA 3D8BA 3AUYA 3ZLJA 4Q00A 3FMFA 3LLMA 3RS7A 1GRNA 3QPWA 4L9WA 3C8UA 4HB2A 1YZTA 2V9PA 4PAMA 5IT5A 4KFRA 5G3YA 2QP3A 4Q9LA 3SBDA 1P2SA 4IHQA 4IW3B 2FSIA 4C0QC 3V00A 3F5FA 2FDCA 2LKCA 4P0TA 3DEFA 3L0OA 2BKUA 1EFCA 1E2FA 4LWZA 4QC2A 3LW8A 2AR7A 4GZLA 4M21A 3H84A 4M9ZA 4WIAA 1D9ZA 2OXRA 2W2XA 1TQ4A 3D7MA 3HU2A 2ZSBA 5CITA 3CPHA 1N6PA 2PLRA 3SZRA 1R0ZA 1UBFA 3U2QA 1HEIA 4DCNA 2AL7A 4HUQA 1OW3B 4LDJA 4ZV4A 2FFHA 3WMEA 1JXMA 3EZ7A 3KJHA 4D4LA 1G3RA 2WJGA 1DOAA 2WVJA 3AF2A 1G8GA 1E2HA 4JKIA 2XAUA 4AG5A 1VKJA 1KKMA 1Z06A 2YOFA 3QVUA 4H1UA 1G8FA 4ZO4A 3EWSA 2ZRCA 4MYHA 2GETA 1YE8A 2PJZA 2YC4C 3NG1A 4XVUA 2X77A 1FNMA 4LV6A 3KJEA 3MWKA 1W4BA 3ZIAA 4BLPA 4B3GA 2BEKA 2QP4A 2ZM5A 1FQJA 2YYZA 5FBLB 4GNKA 3E70C 3LNCA 4LC1A 5D3MB 4A82A 4A2PA 4FCTA 4KITB 2YHSA 4ZCIA 1CP2A 2YINC 1VYUA 5KNBA 2WWWA 1OXUA 4V03A 3NIBA 4ACAA 4EPYA 2VIIA 2O5VA 4HEJA 4RD4A 3CZQA 4IVQA 3B9QA 4ESHA 1ZVQA 2GCOB 2J7PD 3IBYA 3UPUA 2ZUCA 3A1TA 3DM9B 4JZKA 1X8JA 3NBYC 4BGDA 2ZUDA 1QHYA 4Q7JB 1E2GA 5FL7A 2ZJOA 3RS5A 4BZQA 3AF1A 2JIZA 1E1QD 2GKSA 2IYXA 2EYQA 2ZSDA 4QHTA 3K9NA 3NDPA 1KDTA 3BFXA 1TQDA 3E2IA 1OF1A 1FFHA
chains in the Genus database with same CATH superfamily
4UM7A 2WWFA 1QBKC 2HCBA 2XADA 1PWZA 1J09A 3BZWA 3EPPA 3QUAA 5FBHA 3WA7A 5K3SA 3ABQB 1UBOS 2IIQA 1JPNA 3T06B 3ED5A 4BU1A 5CXQA 3MTEA 1Z63A 3ELDA 1TC2A 1JQ3A 2HW8A 2C88A 2W6NA 4B6JA 4P53A 5SZKB 3BWBA 3ZE1B 1AO3A 1K6XA 4MXDA 1ZAKA 2AOTB 3KQYA 4OUDA 5CIYA 1BGVA 1FA9A 4S0XA 1SK9A 4NRDA 1BCSA 3BULA 4DXHA 3AEQA 3N2GB 1L1EA 4QT0A 4UBJA 1WXIA 3CXRA 4EY3A 2H1WA 2RKWA 1BXZA 2PX5A 5CMLA 4QBGB 4JSYA 2FR8A 2JAPA 1WKVA 3JRNA 1DAFA 1QE0A 1UKCA 2QQFA 1L7BA 3CURA 3NHBA 2IX9A 3NALA 2CZGA 5K3AA 3OOYA 3SFTA 3VZPA 2XCUA 4AS1A 1GITA 1GQRA 4MV8A 3KVOA 3U9SA 5INTA 1CDDA 1IE3A 3LC2O 3ET5A 1NUQA 3R9XB 3U7QA 1U4NA 2ONCA 4YA6A 4EA6A 3UWPA 1VRWA 1QF6A 3HJCA 1Y1PA 4DS3A 3E9MA 4AZ3A 2FPGB 5ICCA 2HJHA 3BQMB 4I9NA 3REQB 1W5EA 3ZEAA 2Q0QA 2FW6A 3QELA 4WKOA 4HXYA 3ZXXA 1IXRC 2BE9A 1XKLA 1SIWA 3KYDB 4HH0A 2ONZA 1U3TA 3LKBA 1KXJA 5CLIA 1D07A 1HLPA 3QA9A 4MRNA 4L5IA 4BEJA 2RI0A 3CLRD 4CL2A 2XZDA 4LGYA 3ZDXB 4IIGA 5F33A 4DLSA 3QE3A 1ZK2A 1R37A 1NRXA 3SMQA 5CJ2A 4XQ0A 1NMZA 2J6IA 3PFWO 4JYBA 4E1VA 2P41A 3IP3A 5DNVA 1NC3A 3SZLA 2BH2A 5BR7A 3KQLA 2J9FB 4U2DA 4OJYA 2M2IA 4R8KA 3WBFA 1PYDA 2OO3A 4GT1A 1MDFA 1NXVA 5G1NA 5CFLA 5KINB 4LF5B 2IHUA 2XVMA 3FHOA 4ADSG 5ALJA 2YV1A 3D6NB 4MW2A 4Y2HA 4B76A 1XRQA 1QH9A 3MTIA 3WFZA 3I5XA 2VSYA 3Q6IA 1YJCA 4JBIA 1P0IA 2WIJA 3CN7A 5C7YA 1HQDA 3W2TA 3EIXA 3KKMA 4FYJA 2JLUA 4C6TA 1QHIA 3FGNA 3G8YA 2YN0A 4Q7MB 2FUKA 2I55A 1P0FA 4TUYB 1VKHA 2WF8A 5EWMB 3X1JA 3ZE0B 1PU2A 3OA0A 2SECE 1JHVA 2V98A 1YRYE 3QHAA 1B00A 3OE7D 1XDZA 5CLQA 4EX7A 4GHWA 5DNEA 3G8CA 1SIOA 1I01A 3KEOA 3VR6H 3R9XA 1N25A 4N5DA 1J42A 4EMBA 1MGPA 3SLRA 2FX3A 3HDTA 1CFZA 4E15A 1MHPA 1N2XA 5JAMA 4CTNA 2FPGA 2TECE 4CHTA 2PZJA 3REQA 2HWUA 2O8NA 3E7WA 1XP8A 2B99A 3IV9A 1TK3A 3QOYA 4OLBA 3B70A 3QFFA 4QQNA 4JXKA 4HTFB 4RJKA 4C9BA 2Q3MA 3CU5A 3GAAA 4CL8A 4HVLA 3GUUA 4WXEA 1H93A 5C5IA 5PNTA 3VSAA 4GVXA 1Y8AA 2QMHA 2WWHA 2PSEA 4HFNA 3W8NA 4A0HA 3CZAA 3UJAA 2MOKA 1ECJA 3GFOA 1KGDA 3PNYA 4OHUA 5LZ8A 3UK1A 2J6CA 4BFCA 2FCAA 3SSOA 1BAPA 1IAQA 1LLFA 3OP1A 1ZHHA 2O50A 3PGJA 2QZPA 4HAYA 1R27A 4AKSA 4N7JA 5AW6A 2J9FA 2VTKA 2I33A 2OAQ1 5AOBA 3ZGXA 1LSOA 4F4CA 2B8NA 2FMUA 2WKWA 1OKKD 2V3WA 1XJ5A 3BSSA 1HE8B 3LO5A 4FNMA 2P2NA 4IYRA 1LSSA 1N8SA 1W35A 2OCLA 4YUZA 5IJ0B 1OV4A 2XE4A 2CJFA 4AJOA 1IN4A 1GKLA 2GSDA 2YMQA 1S4QA 3K94A 3QLJA 3NJ8A 1GR0A 2AXEA 1UH5A 2C2OA 1GO2A 2AJLI 2NZJA 3M3HA 3MMPA 3ZDYB 3THWA 2XITA 2X8JB 4NAHA 4TUYA 5JJCA 3F6PA 3RTBA 3N0XA 4LHZA 4I4IA 5EWMA 5LQNA 3KETA 1RLUA 3UV6A 4G0ZA 2ORVA 3IUJA 1SBZA 3U3OA 4AULA 3QBEA 3AUXA 3WS7A 4IMPA 3DMNA 3WGOA 1B93A 3CR7A 5HF6A 1UJMA 1KKUA 3HCWA 3PC4A 3A31A 4NOMA 3B6MA 3EMBA 2Z2XA 3K71B 3PICA 4Q18A 4HTFA 2V55B 3OBBA 1BGXT 4QD3A 2QX7A 2GEKA 4NNOA 3EEFA 3M3PA 1ZXBA 1JAIA 4I5DA 2I78A 4FSDA 4QU8A 1E5XA 4IXNA 1E59A 3AT1A 2FN7A 5GZ6A 4RPIA 4YXFA 3UUWA 2CE7A 5BY2A 1SQ6A 1SZPA 3ETNA 5MFPA 1LBSA 3QOXA 4PAOA 1CQIA 2BBOA 3FNBA 5JCOC 5LOVF 3AF5A 1I2AA 3MGKA 2PMKA 4M55A 4Q0MA 4RHFA 1J1IA 1J22A 1V35A 1VE9A 2YZ7A 2HF7A 3IOCA 3PKIA 1R8XA 5TPZD 1YH3A 3F67A 3IKVA 3MLAA 4FILA 4YJFA 3I2YX 2WYWA 3ECSA 2FQYA 3QUSA 5L40A 1X3SA 4UBOA 2ROQA 1IY0A 4RXTA 2JBWA 2QNBA 1SU4A 4EO4A 5HP4A 1ESEA 2JHCA 3B1KA 3JVUA 1E5TA 2X2FA 1FFDA 4ENRA 2WTUA 3MBOA 4FFNA 4WCFC 5C0OE 3K9GA 2JCGA 4HYEA 4MRRA 4J16A 4HOYA 3R74A 2X8JA 2XOEA 3W5SA 1JH9A 2GHRA 3LCJA 3KJIA 2Y2VA 3UAGA 2ZWOA 3F5QA 4G65A 3R0JA 3HXMA 4LZLA 5T8KC 4YYEA 1LDNA 1VHWA 3KELA 3WB1A 3ZVKA 3OLVA 4ZOAA 1KJ8A 4Z3OA 3ADDA 4BO0A 2X8WA 1HDIA 1XZPA 4AD8A 4Y6QA 3AIOA 4OHMA 5ALXA 3RVNA 4QPPA 1JEQA 3GNQA 4JJAA 2XUIA 4P0QB 5DX1A 3CXUA 4EPTA 3E3OA 1SHZA 3U9LA 1FY2A 5CXUA 3OQVA 1B0PA 2FSPA 3IEIA 4LYJA 1V47A 1YRBA 2KLHA 2F59A 4WW0A 1KI1A 1QLHA 3RSSA 1E1KA 1MOZA 3PEUA 4WJLA 1LD3A 5C52B 5DW0A 1JKMA 4BN4A 2C8LA 3GLFA 3RC1A 4HWSA 4DADA 2ZTMA 5HIIA 3RFUA 4LNUB 2YWRA 8ADHA 3KXDA 2PMEA 4EZBA 3HA5A 2Q9CA 1FX0B 4HYTA 1Y1SA 4GLLA 1JLSA 2PMDA 2P75A 4NU5A 1RI4A 1I4EB 4QDKA 5LZ9A 3QEJA 1FMTA 4IBOA 2I7XA 1LC3A 1KIAA 2AX4A 3DQZA 2XA9A 3WKCA 1I33A 2QSJA 1IH8A 5KREA 1WDLA 5JDCC 2FUG6 1Z6QA 2O6HA 4O8CA 1YKSA 4AROA 1O4WA 1JJBA 2MT9A 3CTPA 1MV5A 4KGXA 4YMWA 1K92A 2HCRA 2YWBA 3ANXA 3H1FA 1Y1QA 5E1MA 3DNPA 3CPEA 3WHPA 3NYIA 1UT8A 2A78A 2X58A 4RLQA 3R9KA 4ND4A 2GXSA 1W0JA 4LVUA 4RIFA 5JJLA 1X1BA 3R0XA 1ZRHA 4FFMA 1I5EA 1IDOA 2PX0A 2YOHA 2YXDA 3LG2A 4JEMA 3RT9A 2QRZA 5MFZA 3RAEC 1T1EA 3U7GA 4M0MA 2XX3A 4V0KA 4DMLA 3QY9A 2QLMA 3I09A 2GZAA 3JQ7B 2Q4EA 2SKCA 2FFAA 5EUBA 5BSEA 3QX9A 1SN7A 3IMFA 3RV3A 3HKBB 2R65A 5KTSA 1P1IA 2ZK7A 2I6SA 5AJYA 2DWCA 3DONA 2G3YA 2IOQA 3RYFB 1GTJ1 5CD9A 2Y6VA 1EM6A 4KIUA 2OXIA 3A4NA 3AFNA 2B94A 2DR0A 4XGNA 4AKGA 4C0HA 4RWEA 3FCUB 3EEBA 5CRIA 4IILA 4RPCA 3QYJA 3QFTA 5DSTA 2PV0A 4JY7A 1QJ4A 1FX0A 1Q6ZA 1JYEA 3QKSB 1YULA 1XNRB 2O3JA 3OUTA 4DEYA 1MHTA 2C4WA 2L17A 1TO2E 3V8NA 4CG3A 4B3RB 5DNWA 2WW8A 4YPVA 4JUIA 5AM2A 2AV6A 1PCXA 3C5HA 4LRSB 1RYYA 4MYUA 5D5HA 5LDGA 4WY5A 3SJZA 2FDRA 1Q12A 3NBQA 1OZGA 2QR2A 3N8NA 4IR7A 1QGED 5JNVA 1XWFA 3CX4A 1IK6A 1QANA 4RV5A 2B1JA 3KEQA 1MNAA 4MK4A 1VCOA 1XP5A 5HXAA 3ESQA 4LX8A 3AEXA 1ZU5A 5KUTA 3C7TA 3VJKA 1GCAA 4LOHA 4FMBB 2GUGA 2IW1A 1FXUA 3EQ8A 3JQ7A 4F12A 2JI9A 1CUCA 3U9TA 1DEAA 2WMOB 3HKBA 1UEXC 2YJ6A 4RD1A 2Q1WA 5KKAA 2XMSA 1ISGA 4UAUA 5HGJA 5HWSA 2R8ZA 3ZHSA 8LDHA 1W88B 1YS9A 1G4AE 4ARAA 3ZZ0A 1G6HA 4Q05A 1KEEB 1WSBA 1RAEA 2IVZA 1ONBA 3FOFC 4PRLA 2VSOA 3DT8A 2GPAA 5DT2A 2H1SA 4HJRA 4JJ7A 2XUDA 4PZYA 1JHDA 3QKSA 3OM0A 1INLA 4KGDA 5TEVA 4EZEA 1IHUA 3NDBB 4IEIA 4DW8A 2BJHA 3OE5A 4LC9A 5EP2A 3RU7A 1GKUB 4EAAA 2D0DA 2JFBA 3FE2A 1H4SA 4Y8VA 2VJYA 3JRWA 4OXIA 1DBWA 3D7RA 2XI4A 4AYTA 5AKXA 1UODA 2Z9DA 1S2IA 3S70A 1GZ7A 4FFSA 1FFSA 2JDIA 3CR3C 3QJGA 4I36A 2BFAA 5BSRA 5BUQA 2CDNA 4J91A 2WQ6A 4KB5A 2ID9A 4M8LA 4CEJB 3EVDA 4FZ3A 1LBHA 1ZC4A 3CF6R 4NKRA 3LUBA 1W30A 2NU6B 4P98A 2W2LD 3HM9A 3QLUA 5H02A 1RXUA 1OB5A 4PX3A 5DNDA 3G6WA 2K6GA 1IQPA 2NO5A 2RONA 3I61A 1J5EB 5IKEA 4QA9A 1WEHA 4JLDA 1DAGA 4FK8A 1NN3A 4TLBA 4JJIA 4WMLA 5T6MA 5EKTA 4BJ3A 5AD1A 2D7DA 1IWOA 4KL8S 3ZWMA 2EP5A 4KZKA 2IL1A 1M1YE 3UWDA 4FMCB 1OXVA 2P5YA 2G67A 1W88A 1KQOA 3MLBA 2N9UA 5BSMA 1WJGA 4LDPA 3VYRB 2RGRA 5KX5B 5AK4A 1KARA 4HR7A 3RVMA 1KEEA 3ZNQA 1KOGA 2H63A 2WTMA 5KHOC 1MQAA 3QNUA 3TM4A 2VJNA 3IALA 5K3EA 1HQYE 3HCNA 2ABWA 1PBNA 3GA5A 4WY8A 4C5BA 1B0ZA 5HK8A 5EKDA 4MA5A 1S8NA 2EDAA 4RCVA 1L5GB 3VR6A 3HP7A 3PNQA 1ULHA 3EN0A 1NYLA 1GLGA 2LRHA 2I3AA 4A7PA 2FPKA 1Y1LA 2PKRA 2X3YA 3O4FA 2BGRA 3AJAA 3PGLA 5IBQA 4YUAA 3OKFA 4CUZA 1TLFA 1J0DA 5CGZA 1T91A 2W6ID 3CT6A 5I3ZA 2J3DA 3SVZA 5B3JC 5HOEA 4MPRA 2E85A 4OVKA 4YJDA 2Q0HA 3CSUA 2QYOA 3TMYA 4OOFA 3IDFA 1S1CA 2BTEA 4LYHA 2E9SA 3A1WA 5AOVA 2JF0A 5EESA 2NU6A 4TYMA 1A2OA 4CIDA 2PKXA 2QSYA 1YZFA 2ZRLA 4Q4LA 5DGXA 4BJ1A 4DANA 4BQNA 2AMJA 4KR3A 5I9IA 1JHUA 3U80A 1P74A 3P0HA 4K6FA 3I28A 3TJZA 5FOQA 2A5YB 4I4TF 4B7AA 5IU6A 1E9RA 5D01A 1N3IA 2IHZA 3TE6A 1DC4A 3W6OA 5JBIA 4G2TA 1JHAA 4AXBA 4QM7A 4PYNA 1AZTA 2C2BA 3OE4A 5JBNA 5KX5A 4X3OA 3P1JA 2JJ2D 1T34A 3E9ZA 4Q9DA 4ARSA 2CFSA 2XDWA 1ND5A 2PH5A 1B2RA 2V58A 2ZTSA 3F5MA 4OP3A 3RW9A 1KA9H 5C34B 3FG9A 3LFTA 1SMKA 4R05A 3O74A 2W48A 4L6IA 5AW0A 5JJ5A 2FOXA 2WUGA 4FEGA 1CIVA 1E1DA 5B7PA 3T0GA 4D8WA 3OT1B 1TA0A 1W6UA 3IAAA 4IFEA 4X85A 2I8AA 2AW3A 4AQDA 3QHPA 1LB1B 1FB5A 3O91A 4FHFA 1N5LA 3WK6A 4DDWA 3ROQA 2PT9A 3ZC3A 1P6UA 1UBEA 2OT3B 3D3QA 3CGGA 4LZAA 3P52A 3C3BA 3HY6A 1PAUA 2CV2A 3LLSA 3U37A 2ZLBA 5DRTA 1DJLA 1Q1EA 4G9EA 4C6RA 1IEVA 3OCZA 2YVKA 4CF7A 1ZKDA 3SEQA 2F17A 2VEOA 4ARBA 4ZI5A 3ED1A 1D2CA 1G20E 1YQGA 4UM8B 5DHQA 3ZS8A 5IS2A 2VA9A 3RRXA 1FP4B 2E6KA 2W2QA 3B1FA 4I9GA 3MVEA 5AICA 3W9SA 1TI7A 3FSRA 3UT6A 2WB4A 1RCTE 3CPJB 4QJBA 3ZCXA 1BMFA 2UXDB 2WBLC 2BMEA 3OFND 1EVEA 3AUKA 1GRRA 5BNTA 3RGWS 3ONVA 4B40A 3R8FA 4A9AA 1YI0A 1CRQA 3VH1A 4P82A 2GVNA 3KTFA 4QTTB 4HN2A 5DHPA 4R40A 1IC6A 1ZNQO 3LVQE 1PT7A 3OCCA 1OWNA 1PUIA 2DY0A 3I1YA 3GLGB 2VLIA 1TT5B 2WHRA 4JK3A 2EEZA 3R7SA 2GK4A 2RGAA 2QGFA 4LZWA 3TOCA 1KSJA 3OEWA 3WTBA 5EAIA 3X2EA 5F98A 1QWSA 4TMWA 3OT1A 1Z16A 4E1BA 4OIMA 2HKIA 3EE6A 4YMGA 3VU3A 1MAUA 4XZ3A 2BL4A 2QL9A 4CCAA 3JYHA 3DMRA 5IBRA 3DFZA 4U7WA 1GTVA 2CLCX 3HPQA 4YDRA 4O2BB 4I55F 3AR9A 1GRVA 1FJ2A 1F0PA 1WWKA 3V6MA 5K03A 2R7KA 1HPLA 3HJAA 4HXGA 3DDNA 1DC5A 3RRYA 1WO8A 3A3YA 3M1AA 2WWYA 3VPHA 4OI0A 3WYAA 2BEWB 2VAWA 2P4EA 4II7A 1UBTS 2G5CA 3K4QA 3EPRA 5D6OA 2FPIA 1AKYA 2G0TA 3DCYA 4DREA 4DWJA 5CPBA 1LDYA 2CEAA 3LTEA 4DCGA 2W98A 2HMAA 1A8PA 4R2IA 1DIRA 3QPBA 4JXZA 2R96A 4C30A 4XIYA 1NQWA 4KYVA 5GIPE 2P7IA 1QQAA 1TAQA 3CWCA 4ZCMA 5JSKA 5IM4F 3FYUC 2JIDA 4ZI2A 3TIGA 1H94A 2QQGA 2WU1A 3K6JA 1L7NA 4FDTA 3PX2A 4DGQA 2CB0A 4ABYA 1M3SA 2IEDA 4IDFA 1KAQA 2OPHA 4KOEC 3ZHRA 1IATA 3U7HB 2Q7XA 3BK7A 3NATA 3GLGA 3QTBA 1PJ8A 2XRZA 1X1AA 4RK6A 1W46A 1HNNA 3SYKA 1R9GA 4QYMA 3BN3A 2RG7A 4BLWA 4J0KA 4ZOCA 4CF4A 2LP4Y 3A3PA 2XBMA 3G1UA 1ZI6A 5E0KB 5A5GA 5MN5A 3T3DA 5BMVB 2ZTVA 2FN9A 4NBTA 1U65A 2R6GA 2PKQP 1ADYA 2V1XA 4KQGA 3KVRA 4O2BA 5C1OA 2JFUA 1AKMA 1RLIA 2ZPTX 4GC9A 5CT4A 4D1YA 2V3VA 1RCUA 4BNVA 3IVAA 4RSGA 3PI7A 4KJZA 2IWRA 5DTQA 1L4HA 1LDEA 4DARA 1PZNA 1X94A 3O73A 2EZTA 2ZCUA 2Q9UA 3TIIA 5LIRA 4INJA 5DNAA 2BEWA 4I46A 1L7OA 5LQUA 1UKEA 5HZGA 1IQ0A 2AKAB 3G6KA 4GYYA 2HXSA 3FVRA 3P9PA 4AICA 3NWPA 2ATXA 2ALJA 3QG5A 5BSTA 1FJGB 1RAIA 3TLKA 1PJ2A 1ECPA 1L8XA 1V2HE 5JRDS 4FMDB 3TZKA 3NH9A 1E2BA 1PX0A 1HV8A 1MQSA 2R1VB 3WLJA 1UZMA 2GEJA 1VLZA 2J31A 4UUAA 2ZWIA 5ADVA 5JFTA 1P1KA 1WMEA 4K9OA 2R6R1 5ELXA 4MKIA 4O2RA 3DKKA 3TFWA 3DMTA 1AZWA 1SBNE 3RARA 4DLKA 4K9RA 4ECEA 5K0SA 2IHNA 2DC1A 1U0GA 3ML1A 1DEKA 3O0DA 4HN4B 2JCYA 3T9BA 5JS8A 4DV1B 4QVKA 3KT3A 4PG5A 1RQLA 2LW7A 4KE6A 4M87A 4R81A 2FW7A 4ZU1X 3UNXA 4UHFA 1PR6A 2J59A 1NUAA 1WW3A 2JVKA 1VYTA 5EGSA 5DF1A 1PUXA 3ITNA 3OPQA 4WA8A 1U8FO 4Y9SA 5C3MA 3SSAA 3F4KA 4N0MA 5BMVA 1ZSVA 3OTOB 2REBA 4N8DA 4K9NA 2OD7A 2BTQA 1L7EA 5JV5A 1YRLA 3CF4A 2ZBQA 4OOEA 3VNAA 3ONFA 1LZLA 3GNTA 1YVRA 3SJCA 3EIOA 2AVDA 4Z0TA 2G0NA 5E9WA 2JH9A 4ESEA 4RZHA 4BKMA 2G1JA 3CV3A 1ST3A 3JYNA 5EXXA 1IJBA 1M7GA 4JYMA 4ZCTA 3E03A 1YQ9A 3D7NA 5BN4B 1E3EA 4M0EA 3WGTA 1HSOA 2F43B 4NXMB 1TOAA 1IN1A 5JCZA 3T7CA 4UBLA 5H9WA 2ZT5A 5A71A 3H5WA 3FBWA 2HTFA 4F06A 4F96A 1A8SA 1C7QA 5BN5B 1RJFA 2NOAA 1M8GA 2AD1A 2R1VA 2ZIGA 3QPUA 1GJRA 4K9SA 4MR8B 3C7CB 3HI6A 3VKVA 1I10A 2XDYA 4UUMA 2BZSA 1DARA 2YBEA 3DCIA 2UXBB 1XF1A 1ZBDA 1JL3A 2AEFA 4WCVA 2FZLA 1KMHB 2ONYA 1XTRA 2QAGC 4EG6A 2X9NA 2JHAA 3EGOA 4MPJA 1IB6A 3DKVA 3FLEA 1IIBA 2FJ0A 4KQWA 1S4MA 3N6RA 3SJUA 4XB6B 1RYNA 2H7VA 3CJQA 2KW5A 3CMCO 3DHNA 1FLAA 3LBYA 3R6DA 4GDMA 1HORA 1CQWA 1NW5A 4H4CA 3HV0A 2WWXA 3SE0A 1SC1A 3I9MA 3REFA 5FWNA 3T7IA 2PL9A 2ZJ1A 2PX3A 3UFXB 2UDPA 2O2SA 1YC5A 2ZWPA 3CE9A 1JU9A 1AXGA 2HH9A 1JKXA 3L7BA 3MK31 4QG3A 2IBTA 1LQUA 2XOKD 1M2EA 4FW9A 3SX0A 2F1OA 4P92A 4D3YA 3QBDA 1I7SB 3AJDA 3PX3A 1NBAA 3L7YA 4PZUA 1JFTA 2CNWD 1MFZA 2JKVA 4NE9A 3WLKX 1WXHA 1RE1A 4GGPA 1DJOA 1NBEA 1ACLA 1FRQA 1VMDA 2UVDA 3AUTA 1DV2A 3O0TA 5BN4A 1GZ6A 2F43A 3RSLA 3KALA 1DKLA 4R01A 5AVKA 3P19A 4ZKEA 5JXIA 2OXTA 3PR3A 4MVJA 5ENDA 5FUXA 4YB8A 3TIVA 2P6OA 3KQHA 3STYA 2HB6A 4A2CA 13PKA 4DFDA 1HFEL 2BKAA 4MR8A 5BN5A 5HZHA 3NBFA 4PR3A 2I6TA 3QA3E 3WJAA 1ID1A 3S28A 4LXTA 2WG0A 5AIBA 5KQGA 1FTWA 3PSHA 2GI4A 3R3SA 5DH9A 1F9AA 4BWYA 1KMHA 2BMFA 1HI9A 2WP0A 3HWSA 2J5KA 3ODGA 1YBAA 3DZFA 3ZI0A 1COWA 4ZN6A 1AV6A 4D8UA 4YMUA 3CVXA 3RS2A 3BWCA 3Q9NA 5LBIA 5GP1A 3E9EA 4DUGD 3H5IA 1SCDA 3C16C 1PVDA 2XODA 3AR5A 1UMCB 2C9YA 1PZFA 3ZH9B 1GUDA 3WGKA 2V97A 4PS1A 1GGMA 3SHFA 1A9YA 1CQZA 3BA1A 1V4BA 3DP7A 1LX7A 3ILSA 4C76A 1NVKA 1A5AB 1T9CA 1XRPA 5EIBD 4QX6A 4FYMA 3WOVA 5JZMA 4KCGA 2RDMA 2AR9A 1W29A 2W93A 3C24A 5LNK6 4RTJA 5CX1B 4FJ2A 1Z28A 4OSEA 3PR2B 4XQ9A 2VSNA 4YECA 3T7KA 4DG8A 4HZUB 3SYMA 1E9DA 3OZRA 4BGUA 3MAAC 2OA0A 2VP2A 2DLNA 4MW5A 1V25A 5LLSA 1N2HA 3WLAA 2JFVA 1YZGA 5F1OA 5CFRA 4PQEA 1B0UA 1WF6A 3OFKA 5TDHA 5IVDA 4ES6A 3U7RA 2DRIA 4FEAA 2H9AA 2JHPA 1CEEA 3VV2A 2XKJE 1A27A 5KWJA 1NMXA 2JCSA 2G17A 4KXLA 1Z4MA 3F49S 3NCTA 2WUFA 4FQ5A 5C7IO 2GA9A 1TUIA 1GPNA 3LL4A 4K28A 4XJXA 3G8DA 3UWKA 3FOZA 1WV1A 1AKRA 4HH3C 1M2WA 3M6UA 3WE7A 1FTSA 3D9QX 3F8WA 2QORA 3ZIDA 3P4YA 1EFRA 2VDOB 2YCLA 3LE8A 4RTQA 3KJQA 4BYMA 4D3SA 4J9UE 2JLXA 3CJRA 2PBZA 1T0UA 1L2TA 2YZGA 3FPFA 3G5UA 4PC3A 5DN6A 1YKGA 1RE0A 1I6MA 4MB2A 1TMKA 3KYBA 5FWAA 4WUTA 2ZIAA 2EZ4A 2H59A 1UMCA 2XLCA 3QQ5A 2R7AA 4I2VA 4KO2S 4TKUB 1QZ3A 3ZCUA 2QMQA 2V0GA 4DG5A 1LA2A 5JJIA 3OLZA 1C3VA 1X6VA 1U2GA 4NBSA 5EE9A 4F5DA 2YOGA 1FBNA 4XEHA 3PPWA 1NG1A 4UE6A 1PS9A 5TMDA 3VBEA 4FT4A 5CX1A 3M81A 4CI9A 3L8DA 4MUHA 1CV2A 2JH8A 3FFXA 3KSDO 4HZUA 3PQCA 4OH1A 4PC1A 1AKTA 2HZBA 3MCTA 5LBUA 4RVNA 4QJ3A 3O4VA 2K87A 4C87A 1E3DA 3EW7A 1G7SA 4BE9A 5EIXA 4F0JA 5H70A 2EFEB 3HR8A 5D00A 2H0QA 3RJTA 3AYXB 2N3ZA 2D6FA 1P39A 1POWA 4H1WA 4CMGA 1CUVA 2PL1A 4M1WA 3VUFA 4XFKA 4P7FA 3THOA 4M38A 4PZ0A 4CHGA 3C3PA 2ZR7A 3MD0A 3C5CA 5CTJA 3WKEA 1SXJE 4I5IA 3HEMA 1LJ8A 3FNEA 1U3GA 4MS3B 3N2ZB 1Q19A 3DFMA 1SB8A 4NAVA 4YAFA 1QIKA 1QIGA 10MHA 3GJTA 4DR2B 5DLQC 1QXSA 1SBIA 4XSGA 1DG9A 3ZIAD 4JB3A 4Y2UA 1WVMA 3L0PA 3PBKA 2PCJA 4X20A 1W87A 3I39X 1FW6A 4PVDA 3NX4A 3FDZB 1H2EA 3OQMA 2VRNA 1MT3A 3GEIA 1GA6A 2SCUB 1VL0A 3FOAA 5IHXA 4TKUA 4OX9B 1EWKA 1VE5A 2Y1LA 3MJTA 4OFXA 1VPVA 2C2ZA 5KTRA 2VAVA 1IEWA 1VSVA 3DDHA 3QP9A 4ZVPA 1S3IA 3BMNA 4EYEA 2G7ZA 3I4LA 4JNKA 3G5AA 2IZ7A 4IHKA 3OQIB 3H2BA 3AG5A 1UKBA 1J97A 3EG5A 4PPGA 1N5OX 1EA5A 1EWVA 1NF2A 2XYHA 4IGEA 4W1RA 2PT6A 3F97A 3LZDA 4CCYA 5EHZA 3Q8MA 4Y9DA 5IULC 1WOMA 4ODIA 3A37A 1GGEA 2J3IA 3D6VA 3F2IA 4W8HA 2NYUA 3HDVA 4FNOA 1KZ7B 4CQLB 3OIDA 1VE7A 3DD1A 3EXAA 4EGJA 5AM3A 2XCTB 1N9GB 4WLFA 3UMMA 1DELA 1T3TA 1U9YA 1Z36A 2JIZD 4GXNA 2YVUA 3G59A 3G82C 4ZV9A 2OK8A 1R16A 4BZWA 1ML3A 3EIFA 4DQDA 2PFGA 3FDFA 4YQYA 4RE5A 1B73A 2VYVA 3ZGOA 3I6IA 2ARKA 4BCCA 3Q7RA 3AH8A 4B6EA 2JAOA 2ST1A 1HKUA 3IQZA 1M66A 3T4PA 2ZRAA 3I2IA 4WZBE 2A9FA 4I9HA 1WDTA 1Y6JA 4K3VA 1Y98A 3TD6A 2H3EA 4MS3A 2WFMA 1QJCA 1E0KA 3CX6A 3ENQA 3HMKA 4RMJA 4BOYA 3QEAZ 4J3NA 1BWSA 1I1HA 4HRXA 4XR4A 4HZIA 4JJEA 5EWLB 3MERA 2QQ5A 1UJCA 4NFSA 4RAQA 4FD2A 2GBFA 1KHHA 3LX6A 3K35A 1H9CA 2X40A 4Q1CA 2RSLA 2EJBA 3FDZA 1DWQA 1XCLA 3ZVLA 2J5XA 3FBTA 3PGA1 3V1KA 3E5MA 1F0NA 4TUYF 3N39C 1QGZA 3B6IA 1XMPA 3R1IA 4MVJP 2KBEA 4BWFB 3IUYA 5IZ4A 1G6KA 1H23A 3HNOA 1MAHA 3JWEA 2OTCA 4QWMA 4YGXB 4DLBA 3DLTA 5JS7A 2P2CA 3D5QA 3GP5A 3VJRA 2H1FA 4TKZA 3ESBA 5D5QA 2FRDA 2QI9F 3M2PA 4MKGA 4BFWA 3KU1A 2GN0A 4CQLA 2XYRA 3WNCA 4K81B 3ZU3A 1N9GA 1G1MA 1GPBA 3HFRA 3BIXA 3KXIA 4R9VA 1TYZA 1V1MA 1RR6A 3Q3CA 3RR2A 3HK2A 1QVRA 1WMAA 2TMGA 2EBWA 1POXA 4BX3A 1WD5A 3NHZA 2OM2A 4LI3X 2X0EA 7ABPA 4KWIA 2BGJA 3L4BC 1LX6A 1XIVA 1YRAA 2H4HA 5KDLA 3CB4A 5DBEX 4C2BA 1FSZA 1SVUA 2ADMA 1ZITA 2ACEA 3OPNA 4ND7A 2QMUA 4F9FA 1UXHA 1JSLA 2ORWA 3H5NA 3HBLA 1G21E 1A77A 3ZGVA 3MS7A 4C0XA 1IMOA 1Z4QA 3IJRA 3Q11A 1OZFA 1HFWA 4Y2YA 4Z9YA 4XYEA 1OIVA 5HBGA 2I6GA 3T1NA 3W8DA 1WSWA 4JL5A 1CY4A 5AW4A 3IT3A 1OH6A 1THGA 4N4AA 1YHZA 4D26A 5DTMA 3SNHA 1W4ZA 1ORIA 3RIHA 3N86A 3IAUA 4F2PA 5DYGA 2PD4A 1IRIA 1GPLA 1NSYA 4BE4A 1P4SA 4GIBA 4QUEA 4PQGA 1JVBA 3THYB 4EMUA 1XZDA 3GGGA 3U0BA 2BGWA 4BDSA 3DF9A 1VJ5A 4X7BA 5JZVA 4JC4A 5JWRA 2G9NA 2VCHA 3O1JC 4MH0R 2R9VA 1QU3A 1Z8NA 4Q93A 2OFOA 2PGDA 4XIFA 2ZPAA 4HY3A 5L6LB 2DYKA 1U5BB 2XIQA 3R23A 3T8YA 2F3UA 2O8VA 3X1YA 3QUTA 4TVKA 3F6CA 3PQ2A 5ELLA 1Q1BA 4DTCA 3D6HA 2P4HX 4W8GA 3KR1A 1U7OA 1P33A 1L6RA 4RK4A 4BATA 1SVSA 2WYUA 4IIEA 4L8YA 3M70A 2PWPA 1SC9A 4KGVA 1OU0A 3LAWA 2J7KA 3WI7A 1RXCA 3ZX4A 1ZVKA 2WKPA 4HKTA 3QW2A 5FRDA 4R9SA 3W3ZB 4KV7A 2CCKA 1QO7A 5JFGA 5KNLA 3KQKA 1B1AA 3OIFA 1ZNWA 1GZSA 4RGQA 2PR2A 3TFOA 1W36C 4KR2A 1TQ8A 5L7YA 1UZNA 1DOZA 1WXXA 2O4UX 4IWNA 2WJJA 1YR2A 2LPMA 1DIBA 1S6YA 4XIGS 3RBAA 5B6PA 1Z15A 5GTDA 4Q24A 5JHGB 1UFQA 2RGEA 4MCJA 1OYVA 3G02A 3IFSA 5EIHA 3IELA 5GJVC 1N3LA 3E1KA 5SYAA 3NNSA 2NZYA 2HMTA 5CB4B 4CEIB 2PYDA 3DUFB 2WFAA 3O8DA 2AKEA 4JLNA 3TTUA 3HSYA 1SU8A 3FJ1A 3THYA 1CDEA 3W5CA 4H1VA 4LOJA 2RAUA 1TD9A 3OSUA 5F21A 1CJKC 1DIGA 5DX0A 5TR9A 3VR5H 1TTPB 3V8MA 2PSSA 4H7FA 4N3AA 1L7MA 4R8SA 1U5BA 5JY1A 5EHNA 2ZU0C 5DVZA 3SC2B 5BV8A 1UK7A 3ONEA 2P4SA 4BTEA 4YRSA 2Q0SA 3COWA 4P7BA 5LLTA 2HN9A 2B4TO 2CNBA 5GV7A 1EIWA 1P0MA 1KQPA 1W76A 1E1QA 2C99A 1Z2NX 3DG9A 2EFDB 1L5WA 1QIIA 1U7XA 4IXTA 4RY9A 1GVHA 1XVIA 2B6NA 2GX6A 3G2QA 1HFJA 2AFVA 2OBLA 4JT2A 2X3FA 1H0HA 3VPDA 5G3ZA 3DH0A 4E5KA 5M34A 1FQKA 3S8MA 3DZKA 3F78A 2ZTLA 4ZU6X 4A0SA 3LPCA 1QGAA 2Q8PA 4H7KA 3B3QA 3JQAB 4YCBA 1QCYA 5CIWA 3UM9A 2XYVA 3JX9A 1OTXA 3A6LA 4UFPA 4KFTA 1G18A 6YASA 1QTRA 4ZEWA 1TMOA 3PUKA 2DPHA 3CLKA 1XG5A 1RZRA 4UCXA 5DYNA 3KO8A 2YWDA 3W6ZA 3CEPB 1FFBA 5CB4A 3PFGA 1Z25A 2Y68A 3QFCA 1LI7A 4P4NA 2VDQB 3DUFA 5DIFA 2OGWA 1OIXA 3E9RA 1AKVA 1AS3A 1NUTA 4D57A 2O20A 5IYZA 3WXBA 3AONB 1QNLA 4PZLA 4Y3UA 1PS0A 3SEAA 1K8ZB 2FQQA 1E8DA 2B36A 3NTOA 4YQEA 3WIUA 4DDTA 2VF7A 4P33A 3OPYB 4I4LA 2YN4A 3PFIA 4BMCA 1Q5PA 1T1IA 3R5FA 1YNSA 4G1VA 4Y2VA 4JI3B 4W7SA 3GFFA 2Z1DA 1J0EA 3M83A 1I1QB 3K3PA 1SG0A 2ZT8A 3SFVA 3SC2A 1VIAA 2IXAA 2WILA 5D3ZA 5TJ9A 2Z95A 4W63A 3ZVRA 2FR8C 3A8TA 3FN4A 4D4HA 4EO9A 2BDEA 4FHZA 4R2XA 2BMVA 2QTFA 2RJNA 1YK0A 2FP3A 3BXHA 3L84A 1G5RA 3M4ZA 4LY0A 4YALA 5HE9A 5H9VA 1TQ2A 1W85A 4QFDA 4X9XA 5DCYA 1YZQA 1VJCA 1VECA 4MRAA 4AO6A 5HZMA 4S04A 2UYHA 3W04A 5AXAA 4K2AA 1UQTA 1GPH1 2BCGY 1PEYA 2OLJA 1Z7EA 3RFXA 2CL0X 3V48A 1JPVA 1ESNA 3R5KA 2ZZKA 3UQYS 1T6YA 2PKWA 2VQEB 1MRSA 3AO0B 4KO1S 5EZYB 3WRYA 4LYDA 1GU1A 5I7EA 4C5CA 1KU0A 4NQZA 4YP9A 4MJXA 4IDAA 4HNQA 1HWYA 3MCWA 1L7RA 1IY9A 2WE7A 1NI4B 4PGHA 5JTTA 1RFLA 4E07A 2JFGA 1DRVA 4FHDA 2HADA 4PSDA 4X7PA 3V9AA 3B13B 3BGWA 3HVKA 4TTSA 3TPZA 3L1JA 3EQ2A 3VPAA 1M6NA 2ODNA 3CLTD 1VHJA 3JWPA 3PJFA 4H08A 4KE8A 1QKJA 3VC2A 4F1JA 3CLSD 3E7XA 5GAJA 1G5PA 1W0JD 1YFKA 1K5HA 5EJIA 3KCQA 4MV5A 1NTOA 5HM6A 3T61A 3OPYA 2POQX 5A0VA 1KRHA 4OHVA 3Q7EA 2VG8A 3UKJA 1D0VA 3Q12A 1H3NA 4G0PA 1AURA 3VVCA