4F7WA

Crystal structure of klebsiella pneumoniae pantothenate kinase in complex with n-pentylpantothenamide
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
309
structure length
309
Chain Sequence
LMTPYLQFNRHQWAALRDSVPMTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Klebsiella pneumoniae pantothenate kinase in complex with N-substituted pantothenamides.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase, biosynthetic protein
molecule keywords Pantothenate kinase
total genus 109
structure length 309
sequence length 309
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f7wA00
2EQBA 4BLPA 5HZHA 3OIUA 4Q47A 5E7IA 5FBRB 1F48A 2BHRA 3BC1A 3BAFA 4OHWA 1XTIA 1GSIA 2J1LA 5K8LA 1NMXA 2R44A 3TE6A 4L8GA 3WBJA 4I99A 1K8RA 1E9AA 1E9CA 1OIXA 2ERXA 3OEEA 2FA9A 4JT2A 5KPDA 3WNCA 3AF0A 2VBCA 3EA5A 5EP4A 1LS1A 2GILA 1IJFA 3SQWA 4U02A 2VP5A 1NY6A 1SVIA 2A2ZA 2OV2A 4C2TA 1B23P 4GSYA 2JA1A 1OH7A 1B0UA 1T8TA 1Z28A 2VHQA 4ERNA 3U3OA 4JZKA 5CDFE 4NL4H 1COWD 2NG1A 2J7KA 3DHWC 3AVWA 2NIPA 3A1UA 4M1YA 2JIZD 4BEBA 3Q3JB 4P4TA 1P7CA 3EAQA 5DN6D 4F4CA 1L2TA 2NO6A 2ZRBA 4JLJA 4LJ5A 3D8BA 4JMPA 4LJ9A 2AN9A 1T0JB 2PT5A 4IDQA 2CHGA 4FI3C 1ZD9A 2BKUA 1PZNA 2ZXUA 1P5ZB 1GL7A 4KXFB 3IGFA 4UXJA 5GJVC 2GESA 4CZ2A 4EIWA 1II8A 5C2JB 1XXHA 1ZU4A 2QTVB 3THWB 5UKDA 3U60B 1KGDA 2G77B 2ZRLA 2WWYA 1YRAA 1MABA 2QGZA 3AEZA 3F0TA 1XBTA 2AKYA 3P32A 3ZZUA 3IPYA 4D4MA 2CBZA 1JNYA 2X77A 1LF5A 2VHCA 2D7CA 3AF3A 4CGZA 4Q4AB 4ZKDA 5DN6A 1UDXA 1T9HA 1KI8A 2QRZA 5CIWA 3K0CC 2G1JA 3WHLA 4X8MA 1COWA 1O87A 3VQTA 4A0GA 1EFCA 3KQUA 1M6NA 3AVTA 2MSEB 3TJZA 1XJCA 2ZQ5A 2FF7A 3VX4A 2BJVA 4A2WA 4DLWA 4E5UA 2WMNB 3ZH9B 1T0HB 1VG1A 1YU9A 3C15C 3OIYA 2CVHA 4IOKA 2A5JA 5EZ5A 1DVRA 1DEKA 1JJ7A 1NF3A 2BBWA 4GDFA 4GNKA 1FUUA 1KHTA 1NNEA 2RGBA 1E1RA 1E0SA 2PEYA 2FFAA 4MUBA 3VKHA 2AHOA 4KFSA 4CW7A 2BDTA 1Z08A 4NKRA 4BZPA 4EQ6A 1NIPA 2A7QA 1MH1A 4AKGA 4PHHA 2R62A 1DO0A 2YOFA 3GJ5A 3ADCA 1OXUA 1DAGA 4B35A 3GMTA 3OEED 1G3RA 4PC1A 4DEXA 1NMZA 4ABYA 3QG5A 2AK3A 3PUVA 3IIJA 2C99A 2H8KA 1OH5A 4K81B 4OJQA 1E4VA 2WWFA 4GMXA 1EG7A 2IYUA 1U98A 1NP6A 4DT1B 5FBWB 4O25A 2QMOA 5G41A 2ZJAA 3KUDA 4JVMA 3AVPA 4UKDA 1N5IA 2GZHA 1F60A 4L9WA 3IIMA 2QE7A 3WY9A 4DCVA 5FOWA 2P6NA 4RZ2A 3CO5A 5M04A 2ZSDA 3C5HA 2QEQA 3P1JA 2IXEA 4W5HA 3AVUA 1TEXA 1UF9A 2G9NA 5FOSA 2MMGA 4ASUA 4LZZA 3I61A 2O8FB 1JR3A 1GFIA 1CTQA 3W8RA 2GJAA 1YE8A 2A5FA 3QY0A 3I5XA 3CH5A 4QGFA 3CUEF 3NHAA 3PQCA 4M22A 2RAPA 2HLDD 2I4IA 1F5NA 1Q0UA 5J4KA 4DT1A 1IHUA 3RS7A 2EFCB 2EYUA 1OE0A 1AM4D 4V0NA 1OH8A 2WAXA 3UMFA 5IHPA 3QEOA 3K0FA 2HT1A 1IM2A 4TMZA 4PC3A 3THXA 4HDCA 2FGJA 4AC9A 1ZIPA 2D3WA 1AS3A 1AN0A 5DI3A 5J5CA 5FOVA 2Z83A 3MJHA 4AI6A 4OI2A 3A4LA 1TMKA 1WE2A 3QF7A 3R20A 1UJ2A 4AYXA 4YMVA 2ZRHA 5AUNB 2IK8A 3ADDA 1NN1A 1G8HA 1MKYA 2XNDD 1UEIA 2NO7A 1FP7A 1N0VC 4PC7A 5JI2E 1XJQA 5JRZA 3QKRB 2NPIA 3U7FB 1Z63A 2V8OA 2C77A 2ZE7A 3AVYA 4R98A 1Q44A 1DAFA 3NBXX 5KSOA 5L3QA 5EP2A 3B8HA 2A5YB 1NIJA 2ZROA 3R9IA 1W36D 3TLXA 1FL9A 3BH7A 2V1XA 3CR7A 3ZVLA 3W5JA 1RYHA 3RS5A 2NGRA 1EK0A 2FFQA 3C5CA 4ACBA 2VSXA 1X6VA 2LCFA 1TU4A 4LBWA 1KZGB 2A30A 2YWEA 1X1SA 1Q1ZA 221PA 2GJSA 2KBFA 3DO6A 1KI9A 3EWAA 2IYVA 1NSFA 3FDIA 4KSCA 3T35A 1WCV1 1W44A 4CT4B 3FGNA 4LK2A 4F38A 1P72A 1E2JA 5L3SB 3MG9A 4JLMA 5KDLA 3T5DA 1G5TA 3H1TA 4GOKA 4KLNA 3SFVA 5F9FA 2VP0A 2OESA 4B3CA 4ZI2A 3ICQB 2ZVQX 1AJEA 4LBZA 1YQTA 1S0UA 2B7CA 1XB2A 3NTUA 5CLQA 5TARA 2WKRA 4ZV4A 4CIDA 4DWJA 4A2PA 1ZCBA 4R2IA 1F2TA 3VR5A 3H2YA 4ZCIA 2GBLA 2IW3A 3FKSD 2NO9A 2ODEA 4WAUA 1HT1E 1U81A 3MMPA 4MH0R 5B2ZA 2Z4RA 3BFXA 4HDOB 1P4SA 1ANKA 1ZBDA 3B9PA 4Q9HA 4DRZA 1Q3HA 3VNUA 1T5LA 4NH0A 3WP1B 1G7CA 4M4SA 1SULA 5GADl 1KDTA 4OQMA 4UNNA 5CM9C 5AJWA 4Q7LA 3PXGA 4G1UC 4EPRA 4TSFA 1YR6A 2ZR0A 2ZRIA 2VLIA 1AKEA 3A1TA 3QJYA 5FPTA 1ZP6A 1E2EA 2GCNA 2H1LA 5L3RA 3K53A 3LFUA 1LW7A 3W3ZB 1XPOA 1SKYE 4RZUA 3A8TA 5BYKA 5JZVA 1PV4A 5HR5A 2GJ8A 1GAJA 5CYPA 1OKKD 4Q4HA 3RWMB 1A4RA 4KVAA 3KKQA 1OT3A 3CONA 4BLRA 3DZDA 3RLFA 4DSTA 2FEMA 3REGA 2J0VA 4GMDA 3SYKA 1VCIA 4RKFA 5G3ZA 2E1RA 2CE7A 1SVOA 3EZ7A 4D0LB 5JCZA 1OIVA 4Q9IA 3T1OA 4IOJA 2HV8A 5FUXA 4HSEA 4D4KA 2C9OA 2PLFA 3K1JA 4FCWA 3GLFB 2QSYA 2V55B 2H5EA 3UATA 2IBMA 3BE4A 3QXXA 4JLAA 4YC7A 4CRWB 4EJSA 1IN8A 5DO9A 4TLAA 1VCNA 2HXSA 3KQKA 2WJGA 821PA 1OW3B 1BKDR 2NZJA 2HDNB 1Z83A 2W2XA 4HUQB 1XTKA 2CLCX 3IUYA 4NCIA 5FH9A 1DE0A 1U0LA 3B6EA 3K8YA 3REFA 3QIAA 4BFVA 3SC3A 4TYPA 1F2UB 2VYFA 1UBGA 3KX2A 4NYMQ 3ZJYA 1Z0FA 1L4UA 1W47A 3U44A 4PSAA 3VNVA 3EZFA 1FPMA 2JLSA 4ACAA 4YMUA 5LD2B 2C95A 4EDHA 4ESHA 1KO5A 1DOAA 5AUOB 2R6AA 1JXOA 1KI3A 4O3MA 1YR8A 2EU8A 4FXPA 4ZKEA 5BN5A 3ZVRA 4YXWD 2JLYA 4Q4JA 3FHTA 2OG2A 1IONA 1QBKC 1SXJD 2ZPTX 3F8TA 3TVTA 5K8UA 1DO2A 1QG4A 2RGNC 2XNSA 3VR4A 2FV8A 2A5GA 1Z6YA 2Q6TA 3BD9A 4AKIA 2F3RA 3QF4B 1QHXA 3CRRA 2RHMA 4DUGD 3TMKA 2FFBA 1W0KA 4MGYR 1TPZA 2PMKA 4V0LA 4F91B 3IQXA 4DUGA 2BCJQ 4UJ5A 2J7PA 5HCNA 2SHKA 1GL6A 1ZNXA 2JLRA 4AYTA 4RVCA 1KZ7B 2WWWA 5CK5A 5TVKA 2CNWD 4MKHA 1Q3TA 3IEUA 1U9IC 2WICA 2BEKA 1OXSC 5JHHB 4H9GA 2D62A 1U2RA 3RANA 4ZIRB 4NYIQ 4DXAA 2WV9A 1KK0A 4A4DA 4BZXA 4II7A 4YMTA 3D3QA 3I1FA 1JAHA 1TF7A 1YJ5A 4LYJA 4RD1A 1LTQA 2CJWA 1YRBA 2MMCA 1OIWA 2XOKD 1NKSA 2QT0A 4JJKA 4WBSA 4HLQB 4D81A 2IXFA 2PT7A 1TQ6A 1W48A 4M0LA 4TMXA 3KUCA 3B7GA 2YWGA 2Q3HA 3KXIA 1YZUA 3EG5A 4TL9A 4BQSA 4A6XA 1ZM7A 4M1OA 3S1AA 1E2MA 2JJ8A 5DH9A 2XB2A 1TAGA 5J47A 2WJVA 3LW8A 4DC9A 3QG1A 1N5LA 3KKPA 4F4IA 1YHNA 2G83A 3U6KA 1KI2A 1ZNWA 3X1DA 1ODFA 3L82B 4G5RA 4HUQA 2PMDA 4PHGA 3I5YA 5SZKB 4D6PA 2W00A 4IRUB 1FW6A 3W3AA 1S3GA 4JLOA 2H17A 2F1IA 4PTLA 2Q9CA 3CB4A 4LJ8A 5IRCD 5H8WA 5KTYA 4QOSA 3VU9B 1Z6TA 4M1WA 5L8VA 4M1KA 4JL8A 3LLUA 1KNXA 2OLJA 2R6FA 3HU1A 4QHSA 5FL3A 2EFGA 3TGPA 3BWDD 4OQNA 1VHTA 4DHEA 3AUYA 1IOZA 3CRQA 1J2JA 3MWJA 5LB2A 3TR5A 2ZREA 5L3SA 1RRCA 1Z6XA 1AS0A 2ZUDA 3D31A 2J5XA 4F7WA 2VEDA 3PEWA 1KI4A 2PEZA 3WXMA 2ATVA 4FMCF 4LV6A 1AGRA 3HWSA 3U44B 3C4JA 5DYIA 5K8IA 1A1VA 2WBLC 1EFUA 3JVVA 3K09A 2PH1A 3FFBA 3CF6R 3QPWA 3VAAA 1F2TB 4Z1MA 5JSZA 2F55A 1DAKA 1E79A 1H8ED 2BOVA 2GA8A 2JIZA 3K70B 4RD3A 2ZYTX 1Z0IA 3M0EA 2GAAA 3SBEA 1KDRA 4RD2A 2KI5A 1QHYA 2XXAB 1E2GA 5HKKA 4B44A 1XEWY 4ZDIA 1SXJE 1YZLA 4C0HA 3P26A 4V03A 5B57C 1AKYA 2KSQA 3LX5A 3OEHA 4MKFA 4NDZA 1K5GA 1DG3A 3M1IA 1YKSA 3NEJA 2TMKA 3B9QA 4B2IA 2XJ9A 3TSWA 1G4UR 3GLHB 1SVWA 4EFMA 4OYHA 5KNCA 4S35A 1BYUA 5J4HA 2ZRJA 2GVDC 3ICEA 1A7JA 2RMKA 5DSZA 4QNMA 3B1XA 1JQLB 5FTKA 4BGDA 2ZSBA 1E79D 1FMLA 1H8EA 1FQKA 2P6RA 1XZPA 4FMDF 2GCPA 4YDSA 4C0AC 5FTLA 4JYCA 4UJ3A 3BK7A 5KUTA 4NBSA 4QJ4A 1R0YA 2REXB 1CJMA 2R2AA 2RHDA 3T15A 1P2UA 3GJ7A 2O8DB 3MCAA 5LPNA 1NBME 2ZRAA 1E94E 1XD2B 3QVVA 3QBTA 1Q22A 4LJ7A 1QVRA 3TIFA 2JLXA 4YXWA 1R0XA 5KNBA 3H4MA 1ZM4A 4Z8XA 4IDOA 2WJJA 3AF4A 2XB4A 1DS6A 2JLWA 1FFHA 4V02A 2GEDA 1BIFA 3WYAA 1JI0A 2HEIA 1V43A 2WWIA 2ZITA 1OV4A 5JECA 4D4LA 1PVOA 3B2EA 2GXUA 1G8YA 3QENA 1N0UA 2HJGA 1OPXA 1RZ3A 4LYHA 4Y0AA 4B3FX 4CEIB 4OK3A 3H84A 1IXRC 4JVSB 4LRWA 4B76A 3OZXA 4TWZA 4PAMA 1AA9A 2CK3A 3NBYC 1Y3AA 3RRMA 2VPPA 5FPKA 1L7VC 2D2FA 4RFVA 3KFVA 1G3QA 2ZI3A 3GCGA 3LLMA 4IEIA 4M9SA 4B47A 2Z43A 5BXQC 5J4YA 5E95A 1PLJA 1N6NA 3OIWA 1TTTA 4GOJA 3UIEA 1XD9A 2ASEA 2AD1A 2JDIA 3GD7A 3QE0A 4KHZA 3ZLJA 1VDZA 1XF9A 4G5OA 3PITA 2I1QA 2XTZA 5TB5A 2H18A 1P60A 2ZS8A 3QKUA 4FW9A 4GZLA 4DDWA 2AXNA 1OSNA 2ONJA 4JLVA 3SYLA 1HH4A 4US1R 2AXPA 4TLEA 5EUMA 2YINC 3E70C 2WZQA 3LQQA 2J45A 4PZLA 4XTCS 5EZ6B 3I8SA 2XX3A 2BBSA 3BB1A 2F43A 4Q18A 3C7KA 1CU1A 2RH5A 3CWZA 1OYWA 5KDDA 1ZINA 4B74A 2J0QA 3M6AA 2QBYB 1JPNA 1ZNZA 2IYRA 4DJTA 2JATA 4XD7A 5DNYB 3BBPA 1JAIA 1XMSA 2ZE6A 4FN5A 1XEXB 2OBNA 1OLOA 3LVRE 4XWAA 1JBKA 2XZLA 4I1UA 2PL3A 5P21A 5J40A 4C2UA 2FN4A 2FX3A 1P2SA 1KDOA 1CR1A 4Q02A 2DB3A 3FKSA 4HZIA 4ITRC 5LD2C 4EQ6B 1XD8A 4NTZA 4OK5A 2PX0A 1X8KA 3MWLA 4Q19A 4X8LA 4XSGA 4DLXA 8OHMA 1E2HA 1OJLA 3EC1A 4M1MA 4KFUA 4UQOA 4S2EA 2VL7A 5KOYA 2QMEA 1CJUC 1ZAKA 4Q1DA 2F9LA 3BJIC 1H8HA 2BMJA 4NMMA 4QBIA 4A2QA 1Q21A 3K0AB 4B33A 4IEEA 1CR4A 2FFHA 1S1CA 5FTNA 2IF2A 5B30A 1N5JA 2LKCA 3K0EA 3RC3A 1SZPA 4DLZA 3U61B 1U9IA 2IEZA 4JLBA 5D3MB 3W6PA 2EYQA 2REBA 3LD9A 2RGGA 2BMEA 3BXZA 3KTAA 2FPKA 3H86A 5EUQB 3KB1A 1IY0A 1X8LA 4YMSA 4DSNA 4XVUA 3NBZC 1GTVA 4NU0A 1UAAA 3QKRA 4TLBA 5AJYA 1XMJA 3AM1A 3SFZA 4DBLC 3THWA 1JR3E 3L8ZA 4Q9LA 5G3YA 2W6JA 2XSZD 1I2MA 4QJ5A 1QVAA 3OEHD 4C0JA 2I1VB 1DADA 1RYFA 2OBMA 3LH5A 4FWIB 4HI0E 3THXB 2WHXA 4N0EA 1ZJ6A 4PHTA 3GQBA 4IVPA 4W5WA 3CLVA 3NC0C 4LYAA 1F3OA 1GILA 2OFOA 4TZ0A 1C1YA 4BLOA 1W4AA 2OO7A 3PUXA 4QHYA 1BS1A 3KJGA 5D3MA 1GNRA 4KFRA 5EP1A 3IEVA 3KKOA 2O8CA 3CX6A 4LUCA 1VECA 4XWKA 3IQWA 3TQFA 2EWWA 1GL9B 3SN6A 3B1ZA 4MGZR 1VYVA 3F3YA 2J0SA 2CCGA 1GOTA 3NXSA 2X2EA 4RY2A 3QPUA 3QI2A 3TSZA 2C98A 1WDTA 4A6PA 1D5CA 2HT6A 4N0DA 4HLCA 3BFVA 1G18A 1P2VA 4I1VA 4PQFA 4L9SA 5L3VA 2YHSA 3DOEA 4J0QA 1RVDA 4F93B 1I4LD 1BO6A 1PUJA 1RFLA 4JSTA 3ADKA 1II8B 2Q3FA 4OKSA 721PA 3ZVMA 4Q1CA 5DGXA 4HLDA 2E87A 1AS2A 4U00A 2QL6A 3CPHA 5HE8A 1FUKA 2DWOA 1XJ0A 2J0UB 1DAIA 2EFHB 3RAPR 2IEYA 1HURA 1Z0AA 2BKEA 2WOOA 4B3GA 3CZQA 3NEYA 4KITB 1KAOA 2Q9AA 4US2R 3X2SA 4I1OA 3A1VA 2RGAA 4MA4A 4QFMA 1IY2A 5TMPA 5CJPA 1J7KA 1JR3D 1P9WA 1CULC 3FVQA 2A3RA 2QSZA 3ONWA 1E2DA 1R5BA 3TW4A 4AK9A 3K70D 1OB2A 4B3XA 1I4TD 1OHHD 1XCMA 2W2TA 3AP3A 3MSXA 2N1BA 2JJ1D 4C0LA 3PFIA 1NVVR 4YONB 5GVSA 1XU4A 4A8JC 1UBCA 3KJHA 4C7OB 2GZDA 4ILEA 1UKYA 3SHFA 1YZTA 3DDCA 1Z0KA 3NH9A 4HDQB 2F1HA 2V6IA 3ZD6A 1JPJA 4JBXA 1IN4A 3THYA 3EZ6A 3FKQA 4MKIA 1W49A 1P73A 3PUWA 1VG9B 4JBWA 3TRFA 2WSSA 3KL4A 5HCIA 3H0KA 1GUAA 3TNFA 3PIRA 4OI1A 4CT5A 1G291 1UM8A 2EVWX 1T91A 1KYIA 1XXHE 4IXMA 3A6PC 1XEWX 4RJLA 2DFTA 1FTNA 2HYDA 4JLPA 2WSSD 3CRW1 4GT1A 2ORVA 4Q4AA 2Y8EA 3Q85A 1ZC3A 2Z4SA 1XP8A 3V00A 3SQXA 5JLJA 3K70C 3Q5EA 1JEDA 2B21A 2GBLC 3GLHA 1HY3A 2ANCA 1PLLA 4BLSA 4KYUA 4FMBB 2ZYWX 3KXLA 3TAUA 3WP0A 4GOXA 2C03A 3VKGA 2OXRA 1DAMA 2W58A 3Q5DA 4AG5A 3Q8XB 2ZJ8A 1US8A 4FCTA 3RRYA 5EJEA 1DARA 2KJQA 3KKNA 4DLUA 4PAQA 5FOTA 3U3RA 2FG5A 1R6BX 3N2EA 3AB3A 3SYNA 4O2RA 1SKYB 4LBYA 2J7PD 6Q21A 1QDEA 2YVUA 4XVRA 2OAQ1 2QA5A 5BW8A 1T3HA 1Q20A 4RD6A 1CR0A 1N5KA 1U8ZA 1XTQA 3EIQA 3TSOA 4AD8A 2JLUA 2AKAB 3LA6A 1JALA 2VSOA 4PO1A 1AK2A 1CRPA 2CVFA 5F98A 2OCPA 4B3DA 4FCVA 4P31A 3SHWA 3JZMA 1QHNA 3SU8A 1NN5A 3GJ8A 1L4YA 1G6OA 1S9DA 5FBLB 4V0OA 2VP4A 2ZE8A 4A0FA 2GF9A 5FBQB 3W6NA 3I8XA 1FZQA 2GKSA 1XEXA 1G3MA 1N6LA 5E4FA 5C1BA 4Q7JB 4XOIA 2EW1A 4NCKA 3L0PA 2N42A 3M4YA 1G8PA 2GCOB 2W0SA 2XTMA 3NG1A 4LV5B 5EXPA 4OQXA 3AVVA 3B82A 4HUTA 4F92B 4PO9A 1J90A 3EARA 4A8JA 5SZJA 2J3EA 4P4SB 2HF9A 4ZDJA 3TW8B 2GXAA 3U3JA 4P33A 2GZAA 3NHBA 4NHOA 3TUZC 1OH6A 1G20E 4H1VA 5KO2A 3T5GA 2HCJB 2XZOA 3CX8A 2EFEB 3LXRA 4Q00A 1CEEA 1W0JD 1L8QA 4TQUS 3MLEA 4TL8A 1GRQA 1R10A 2MSDB 3ZS9A 4B6EA 1E2PA 3GLHE 1ZM2A 4BASA 1Q1QA 3EIHA 4K8OA 1CIPA 3Q7PA 2GEVA 1NBMA 2VP9A 1G4AE 2WMOB 3OAAD 5JWHA 4KV9A 4OI0A 5B64A 3AKCA 1AIPA 1NBMD 4DIDA 4EPTA 2QGNA 4DLRA 4BRWA 2FSIA 1N0WA 4IJMA 1G19A 3TH5A 2JGNA 4A92A 4BFTA 3FOZA 1GNQA 3I72A 3AVQA 4CEJA 1BMFD 3EWSA 2IYLD 5FPSA 1VCMA 1Z3IX 4NZYA 2ZRPA 3B60A 4ON9A 1ZW6A 5E7MA 2JJ1A 3PEYA 3IILA 1Z0JA 3TUIC 2OM2A 5JWOA 4Q5IA 3UG6A 1NJFA 4DDUA 2GK7A 1CJVC 3L8YA 3FMIA 2ZR7A 2OHFA 3CIOA 3LBHA 2QMHA 5KSPA 2G0TA 1Z22A 3KQLA 2IYXA 4ZIRA 1KKLA 1UKZA 1P2TA 3GEHA 3UMRA 3VU9A 2C9CA 3CPJB 3ASZA 3CZPA 2C96A 2VRWA 1BH2A 4HATA 4JKYA 5JS7A 4QM7A 3UWOA 1MT0A 4HZUA 2EWVA 2QM8A 5CYOA 3NIBA 3QF4A 1N3BA 1M34E 4PO8A 5A4JA 1N6PA 2W2VA 4G01B 1EWRA 4ASUD 1NN0A 3CRVA 1ESNA 5FI1B 5H1YA 4DIEA 4L4UA 4QGHA 5HZKA 5JJIA 2G88A 4DLTA 4NCHA 1UPTA 2QE7D 1KNQA 3ASYA 3KFXA 1LVGA 1X86B 1MRSA 4JSYA 3DM5A 2DWPA 4KBFA 2DFNA 1A82A 1JR6A 1E96A 1NMYA 4EPVA 1U8AA 3BS4A 4C3ZA 3BIFA 3SZRA 2R9VA 3OFND 2F7SA 3B85A 3K0CA 2W6ID 3CNOA 3K0FB 1QHGA 4R7ZA 1X8JA 3EW9A 1TUIA 1Z47A 2X8AA 4IVRA 4JLKA 4BFXA 1LNZA 2V7QA 3PENA 4QL3A 3I3SR 2PZEA 2IUTA 3BORA 5EE5B 4HZUB 4AKEA 1VKJA 3T34A 1KKMA 4XIGS 3X1YA 4C0BA 2PBRA 4NYJQ 2J0UA 4UNQA 1CF4A 4XH9B 2XGJA 3B1VA 5EE0A 4MRRA 4PC2A 3SEAA 5LDDC 1RC8A 2CEAA 1WF3A 4XVQA 1HV8A 2P65A 4LJYA 4TMTA 5LBIA 3LQRA 3UPUA 2ERYA 2GAOA 5TXGA 3VTKA 3HP1A 3ND9A 2CLSA 5E3HA 1D2MA 4QBGB 2PJZA 2GJKA 4DSUA 2J9RA 2A78A 3LBNA 3Q7QA 5D3QA 5EXXA 3RVBA 3ZYCA 2G0NA 3FMFA 3ZGXA 4QGAA 1RKBA 1V5WA 1FQJA 1FP6A 2UVQA 3SE0A 3IO5A 1G3IA 2FE4A 4BFSA 1OF1A 3TKLA 3UANA 2ZJZA 3QKSB 3R9WA 3VHLB 4EJSB 2UZIR 1G5PA 4B6FA 3UXMA 2VIIA 3ZZ0A 4MRSA 2WOJA 1NL3A 1T5IA 4KI0A 1DG1G 3BH6A 4PHFA 1O3YA 3IHLA 5CITA 1I4DD 1XEFA 2DFKB 1ZD8A 4N1AA 4XD7D 3U4QA 3HPRA 3KXKA 4LBVA 2O8FA 3E1SA 2F1JA 5FI0B 4DLSA 5DIFA 5CB8A 1KSFX 3L2OB 1SHZA 4Q1AA 1CJTC 1XWIA 5FTJA 1M8PA 1KAGA 5F2EA 4B71A 1E2KA 5JEEA 2FMXA 5JMTA 5EXTA 2G3YA 2YNMA 3K9LA 1D6JA 4I4LA 1RRPA 2R6CA 5GVRA 3IPXA 1NVXQ 1XDBA 5JSZB 3KB2A 1E9EA 1M7GA 4JIMA 2WWGA 5FPHA 1NI3A 4QBFA 1M7HA 2NQ2C 2ZAOA 1WA5A 1Z8FA 3I32A 1GITA 4PX9A 2GK6A 1UFQA 4JS0A 3VR6A 2O8EA 4TYQA 4PQRA 3WMFA 2QENA 2O8BB 5KHOC 3GFPA 3V4FA 4IW3B 2FSFA 4BLTA 1NLFA 2ZJBA 4Q48A 4WXPA 1SXJB 1Y63A 3NBFA 2K5UA 5CK4A 3VFDA 2B8TA 3HYRA 1G17A 3QSYA 4Q03A 2J87A 4TL6A 2GEUA 3ZS8A 1OXVA 2YYZA 2FPLA 4GL2A 3UG7A 2KWIA 3KZ1E 4A8JB 4LHZA 2QTHA 2IS2A 1AQYA 3DPUA 2WPDA 3EXAA 1TQ4A 2FOLA 2ZI5A 3K9NA 4QNRA 3ZQ6A 1W4CA 2OXCA 1CKEA 2GXQA 3AGPA 1HE8B 2WJHA 3AQ4A 4PAOA 5KU1A 1N6IA 1TF2A 4GP7A 3FWYA 3CPEA 1RJ9A 3AGQA 1N6KA 4TZ6A 5JFGA 4CEIA 3WBKA 2QM7A 4D25A 1X3SA 1GVNB 2GHIA 4OI4A 4DCSA 4V0ME 2RB4A 1A2KC 3SR0A 4A9AA 5JHGB 4I81A 1KY2A 3O47A 5H68A 2NO1A 4G5GA 2JAQA 4QGGA 2GF0A 3VKWA 3R7WB 1E0AA 1NKTA 2OCBA 2LKDA 2V54A 1W2GA 2Q9BA 3EZ2A 4DCNA 2QN6A 2XZPA 1VG8A 4LHWA 5JWRA 4KU4A 1NN3A 1GRRA 4CVNA 1XFAA 3R8FA 5BQ5A 4Q1EA 4A0HA 1DELA 4KSBA 3RWOA 3PCRB 5J4VA 4GPTA 1E1QA 4K46A 1OFHA 1NLYA 4EFNA 1KSGA 1TADA 2QI9C 1YR9A 3THOA 1VTKA 1SKQA 2ZJ5A 421PA 5AUPB 2IS6A 1E9RA 1WP9A 1E2LA 1SVMA 3S1AB 4EPXA 1KOFA 4WZ6A 1Z5ZA 3K09C 3A4NA 1E99A 1W46A 4TT3A 4M9XA 2IUSA 2OT3B 3O8BA 5EQTA 1YR7A 5L3QB 3CNNA 3BRWD 2ORWA 4TT3D 4Q21A 2ZSEA 5FL7A 3WRYC 1EWQA 4DZZA 2ZRKA 4W5JA 4W9MC 3GJ3A 3OFNA 3KDSE 2QBYA 3LY5A 2ZRNA 4YMWA 4MRNA 4URUR 1E9DA 2QT1A 1MRNA 3B13B 1P61B 4LHVA 5JJLA 2WIBA 4HAUA 2JJ2A 1TQDA 2R8RA 3WNBA 2ZJ2A 2JEOA 3W90A 1GKIA 3U6BA 1JQJC 1J8MF 5FR1A 3E2IA 3SDZA 2Q3MA 2AX4A 2ZI6A 2XNDA 3WYFA 3GEIA 1PJRA 4HB4A 1NRJB 2QAGB 3A4MA 4BFWA 2VP2A 3GLIB 2QP9X 3TBKA 2ZUBA 4JVNA 1I2DA 4DDTA 1R8SA 5FBVB 2ZSAA 3QBVA 1OFIA 4X8HA 1XPUA 1G3UA 2AWNA 3O8DA 1MV5A 5J4LA 4PPFA 3ZIAA 1W0KD 1MO6A 5BYJA 2CHVA 4AY2A 2UZ3A 4M1SA 1TUEA 1ESMA 2FNAA 2IL1A 3B1YA 4PPNA 1E6CA 4IXNA 4DLYA 3SS8A 4M9QA 3GP8A 3VR2A 3QNUA 2O0HA 1G7RA 3HU3A 4TSFD 2H7VA 3NDPA 3QVUA 1XRJA 2D4HA 3VR1A 4D26A 3CNLA 4O2LA 1NSTA 1AQUA 2PLRA 4LHXA 1Z07A 1CBUA 1WQ1R 3SJAA 3MWYW 2CCJA 2ZYUX 4P32A 2FGKA 4BLQA 2XAUA 4LWZA 4RCZA 2JLZA 2VP6A 1XTJA 3GJ6A 4Z51A 1M74A 4BZQA 4N3NA 4Y0VA 5FR2A 3W5IA 3R9XA 5E7JA 4LCBA 1TEVA 5AJVB 4AWXA 3RABA 1CR2A 3CF0A 3CR8A 4FWTA 1FNNA 2KE5A 5FUVA 3A37A 1T4GA 3T1QA 1RW4A 2GDJA 3HJNA 3OE7A 2GNOA 1XCGB 4KCGA 2OILA 2WPDD 2RGCA 3U5ZB 1IAQA 3FHOA 4JVLA 1DPFA 1KI6B 1YZQA 2CL6X 2VQSA 2JLQA 4RFSB 2C2HA 4LC0A 1IXZA 1KO1A 4WXRA 2YKGA 1WBDA 3RSLA 2ZI4A 1EFRA 5FOUA 2RGNA 4YLGA 4BECA 1TX4B 4RZXA 2XITA 1KIMA 3EPJA 1FNMA 1KK3A 3K0AA 4EUNA 1KJWA 4US0R 3HU2A 2OCAA 4BFZA 3T1VA 4KVGA 2Z6VA 4KAXA 2V3CC 2HXYA 1R4AA 3RRZA 2DY1A 1Z2CA 2C78A 3AP2A 4MGIR 4D0GA 3RC8A 1QG2A 2I3BA 4LYFA 4UNPA 4E07A 4WW0A 3CWQA 4JKIA 2O52A 1R0ZA 1AZTA 3JVUA 3ZZTA 3K9GA 4G5SA 4DVGA 3RYTC 1R0WA 1IN6A 1ZD1A 2OUKA 1A2BA 1MO4A 4TL7A 3W34A 3ZDQA 2VHTA 1UADA 4NCJA 3QKSA 1ZCAA 1ZMXA 2FJUA 5B58C 3TUJC 1TQ2A 2D06A 3GLGE 5CLLA 2WSMA 1G6HA 4LPKA 3B78A 2AK2A 3AKYA 4EJSC 1HQCA 5EE9A 3EIEA 2H16A 1D8TA 1UEJA 5CDFA 1RRGA 4KO8A 5JI3E 3FPAA 1E9BA 1P3JA 4Q4LA 4A36A 4WZBE 3GLGB 4URXR 1K6MA 3MRSA 5KDOA 2O8DA 2F43B 1DAHA 3NC1C 3DEFA 3IBYA 4EFLA 3G0HA 1Z6GA 1CJKC 2G1KA 1U99A 2DFLA 4ZI3A 2UKDA 4RCYA 2WM9B 3CKLA 4C7OA 4AIIA 3IBGA 5DYGA 5JBQA 3SI7A 1M7BA 1ZRHA 3CBQA 4D0NA 1NG9A 2ZVPX 5IT5A 3AKDA 3QOFA 4TMKA 3LV8A 1EFTA 4PPGA 5BN4A 3IKJA 2ZI9A 2C04A 3ECCA 2KBEA 3AF1A 1WXQA 5KNDA 4C30A 2JCSA 1P6XA 2CL7X 3PR1A 3R7WA 2GJ9A 4UNSA 4POAA 5DHAA 5HTKA 4EPYA 5FPYA 4PXAA 4URYR 1G8GA 2WJYA 2V7QD 2ZIAA 4DDVA 4B43A 2RGEA 5F3WB 4NYMR 5K8TA 1ELOA 1IJEA 1RJ9B 3RS4A 1KSJA 1HT2E 1VYUA 2V4ZA 3W6OA 4NCNA 1M1YE 2IT1A 2ZJOA 4YQFA 3WNDA 2P0EA 3DKVA 3DMDA 5JCPA 4KJZA 1G1MA 2CLDX 2WWHA 4A0RA 1W36B 1E1QD 1XTRA 1R2QA 2ZRDA 5H70A 2CNWA 2QUZA 1NY5A 1D9ZA 1PLKA 4BUJA 5IK2A 2WVJA 5TV2A 3TVDA 3MUFA 2ONKA 2QZ4A 1XCPA 1LS6A 3ZVNA 3DKPA 4Q4JB 2P5TB 4Q7MB 4AYWA 5KPJA 2BBTA 2FZ4A 2J41A 1D9XA 3FTQA 1FX0B 2GETA 1DTSA 1G64A 3VMFA 4BWYA 1KJYA 5BN3A 3I4LA 4OQFA 3D6TB 1BMFA 3HPQA 1HYQA 1EGAA 2P2LA 3RSOA 1LFDB 2PCLA 2R6DA 4YDHB 4P3YA 3K9HA 1N6OA 3ZQJA 4U7DA 3MGCA 1UBFA 5JEDA 3U7GA 3QPVA 1KK2A 1AGPA 3FFAA 3OIVA 3A36A 1QHIA 1HQYE 4PANA 5FTMA 4IKEA 1T3SA 4LPSA 2IWRA 1II0A 5FOXA 3T12A 1R7RA 621PA 2X1VA 4XTRA 4PR0A 4BE7B 4F4JA 2ZRMA 4TTRA 1RE0A 1CRQA 2QMUA 1G7TA 2ZUCA 1Z29A 3OF5A 5IDVA 2JLVA 1QHSA 3LWNA 2QNRA 5CIQA 4O0MA 4PQYA 4Q9JA 3T61A 4C0SA 3E5HA 2WAYA 4LOAA 2V6JA 4TYYA 1KI1A 5LB4A 2R65A 3D7MA 4JLDA 4DB2A 4D82A 5HKKD 3EX7C 2ZTSA 3U3KA 3DOFA 2IHYA 4Z1MD 2LWIA 3QQ5A 2VO1A 4QHTA 1SVLA 1KO7A 4Q1BA 4HB2A 4QRHA 4TLDA 5AJZA 1KI6A 1MO5A 2J59A 5EP3A 1CXZA 4XWOA 1E0JA 2IC5A 4URZR 4HAXA 1S4QA 1VYTA 1N6HA 1KMQA 2ZJYA 3AP1A 3CF2A 4QKQA 3JZAA 4U5XA 1W0JA 1F6BA 1E9FA 5JS8A 1US8B 3FMPB 3SOPA 4QC2A 3BERA 1E0KA 4JL5A 4LGMA 4QJ3A 1EXMA 3GJXC 3L0OA 4JLNA 4DSOA 2L0XA 1E9SA 1EFHA 2MSCB 4DCUA 5IK2D 2HJVA 3KKMA 3FE2A 4HAZA 1W1WA 2BBOA 1BYIA 1Z0DA 2OAP1 3O8CA 3FMOB 4I1SA 2FDCA 1P62B 2CL0X 4DB4A 5G40A 2QAJA 4PZYA 2X19A 3P4YA 4CF7A 2BJWA 5EXSA 3AF2A 4BPBA 3PEVA 1VIYA 2GRJA 1GRNA 3SJBA 1XX6A 3ND8A 4P0TA 1R8QA 1WB9A 2IF0A 3PUYA 4B32A 4WVFA 2ANBA 1HEIA 2E9SA 3RS3A 2OCYC 2NZ8A 4A1FA 1K5DA 2GXSA 4H1UA 2PX3A 2C8VA 1EX7A 4RSGA 2WIAA 3TK1A 4URWR 4AURA 2IA5A 2QTFA 2RGDA 2GVZC 1W5SA 2DCUA 4A82A 3I62A 4PSVA 1U90A 1IXSB 1NVWQ 1Q12A 1E3MA 3EPKA 2KB0A 3BB3A 2YWHA 1IY1A 2HF8A 2VA8A 1UDWA 3PVSA 3LBIA 2WJIA 1DBSA 3RS0A 2QP4A 1FMJA 2W6IA 4IHQA 4KBGA 3QXSA 1GZSA 2NTYC 4LX0A 3EPLA 1RRFA 3SJCA 1OXXK 4EPWA 4ZDKA 4OHXA 3R8CA 3U3MA 5FL7D 2F1RA 1KY3A 4TQ9A 4RD4A 5DI3B 1E2NA 1EESA 2ODNA 2P3SA 4LC1A 4NP6A 4Z54A 2BVNA 2CMKA 2B8WA 2O0KA 3GEEA 5SZHB 3AVXA 4OBEA 2PCJA 3PEUA 4CYMA 3P27A 4PPQA 5DLQC 4TQAA 1QRAA 2OEPA 1N25A 2QQ0A 2WKQA 5A0FA 4V0MA 5SZIA 2QORA 3BOSA 3NVAA 2G6BA 2IYTA 4Q66C 5ANRB 3V9PA 5C46F 1U0HC 2BC9A 2ZRGA 4TMWA 3QXCA 4ZCLA 3ADBA 2AFIE 3MFYA 2IX3A 1F2UA 4B75A 4QG7A 2ZE5A 3A1SA 1MR3F 2QU8A 2PZGA 2VF7A 3X1XA 1E69A 3GJ0A 3GLGA 2IYZA 1CS4C 3NWJA 1KI7A 2W0MA 2NOAA 1W2HA 2YOGA 4GRAA 1J8YF 2HLDA 4LV8B 3P20A 2QROA 2DR3A 3UK6A 4LI0A 5DI9A 2OFWA 3EZ9A 4M8NE 3WHKA 2OSBA 4TTPA 1W7AA 3VX3A 4IDNA 3NKVA 3Q72A 2FWRA 2YZ2A 1S9HA 2PJRA 5AK0A 2D2EA 4C0QC 1SHKA 4C9BA 2P6UA 5CJ2A 4ZPXA 1MO3A 1N6RA 2ODBA 5GJBA 3LRPA 1WMSA 2CDNA 2ATXA 3NDBB 5FUYA 3BGWA 4Q01A 2XTNA 4MITA 3IDQA 2VHJA 4MYTA 2H92A 3CH4B 3WRXC 2AFHE 3T06B 3BFKA 3PUZA 3A1WA 4OL0A 3C14C 2AL7A 4OHVA 2WWXA 4C4PA 4E03A 2IYWA 1VG0B 3HYTA 1VHLA 1GDDA 1YZKA 2DYKA 1JB1A 3L0IB 4Z8YA 4BFUA 3C8UA 2ZEJA 1VIAA 2IYQA 3FHCB 4ESVA 1UKEA 3AV0B 3QEJA 1S3SA 3Q9LA 1KO4A 2W6JD 2XSZA 2NPFA 4JBYA 2F9MA 4L15A 2CHQA 1G9XA 4MDFA 1BOFA 521PA 1S1MA 2ZU0C 3C41J 4WA7A 2ZR9A 2EFDB 1E1RD 1KTVA 3PJRA 2JASA 4OK6A 1KK1A 2O8CB 1SQ5A 4Q4HB 1S2MA 1G41A 1X1RA 4TYNA 1LF0A 1ZIOA 1XZQA 3K0SA 1R5NA 3ETLA 4V0KA 5AUQA 2QY9A 2D7DA 5BWMA 2YOHA 5ELXA 2O8BA 4URVR 1E2QA 3CW2A 3N2IA 4OJKA 1KSHA 4BEJA 3GLFA 4IOMA 3UWKA 1T8UA 4NPHA 4XJXA 5FFMA 2WTUA 3KTAB 4NONA 4LY6A 4LDJA 1IN5A 1Z06A 2QQEA 2ZAMA 3B5JA 3CX7A 1U8YA 1H8HD 3CRMA 4HYYA 1E2IA 3WYGA 3AH8A 4XSHA 1NJGA 1PUIA 4UXHA 4Q7KA 2YC2C 4G0NA 1WRBA 3BH0A 2CE2X 4GBMA 1Q57A 3GJ4A 5DHFA 5GJWC 3HR7A 3SJZA 1II9A 2OFXA 2HUPA 3SNHA 1VCOA 5JRJA 1P9NA 4PFSA 1VPLA 2IHBA 3EC2A 2AWOA 1TU3A 1LB1B 3MAAC 1Q1EA 4RD0A 4Q1FA 4X8OA 2NMVA 1Z2AA 2B7BA 4IFEA 2VHUA 2QPOA 3EASA 4IVQA 3LXXA 4MGKR 4B73A 4E22A 4RZ3A 1GM5A 2A5DA 3OHMA 1ZUIA 2R6GA 2AR7A 2Q21A 3HDTA 4GZMA 4A15A 3L0SA 2B92A 3GLFE 2HCBA 3X1WA 4HAYA 2QAGA 2QPAA 3RHFA 3WMGA 4GP6A 1EFRD 2JDID 4AG6A 3GFOA 4WIAA 1C4OA 1JECA 2JJ2D 1CLUA 2BM1A 1G16A 1S96A 3IHWA 4M53A 4KODA 5EE1A 3O8RA 1QZXA 4TMVA 4MYUA 5FUWA 3SBDA 4OHYA 2RKOA 4B3BA 4MQBA 2O5VA 2VSFA 4ARZB 2B6HA 4IDPA 1NG1A 1U0JA 2BEJA 5F9HA 2IXGA 3PG5A 5A5GA 4UXIA 4B48A 5JJKA 3N70A 4HB3A 2FH5B 4CEHB 2V9PA 4QXAA 1GWNA 3WMEA 4WZAE 4FD2A 3J81k 1OHHA 1EX6A 1J70A 3LX8A 5AR1A 1CP2A 2H57A 2DBYA 3MWKA 5IF9A 5C18A 1ZC4A 4LJ6A 2D74A 4KLZA 3RRNA 4P4UA 2OZEA 4PSKA 1KJZA 4TTQA 5TDHA 2ZRCA 3I92A 3MD0A 4FMDB 4HLUA 4CEJB 4TYWA 3HR8A 4FIDA 3X1ZA 5CB6A 2DWQA 1ZYUA 1U94A 2QPTA 2IUUA 1SXJA 4LJAA 3THYB 2IS4A 4ZCMA 1JEEA 3U7EB 4B2LA 1WBBA 3GPLA 2WKPA 2YJTD 4D2IA 1TL7C 2PZFA 3IO3A 4JT4A 4LJ4A 1XTSA 3QXHA 3LAWA 2X2FA 4G5QA 1MABB 2YV5A 3ZIAD 5AJXA 2QP3A 2DPXA 1IN7A 3W8NA 4E09A 2QG6A 1N2CE 4ZO4A 4HAWA 1KMHA 1TF5A 3RNLA 4M2LA 1P9RA 3AUXA 2ODWA 3RS2A 4DKXA 3DMNA 4QBHA 3LO5A 4JYBA 4B2PA 3AKEA 1HTWA 2C9YA 1G8FA 5EE3A 3MJRA 4UNRA 5KYKA 4JL6A 1OYYA 4AKHA 4M1TA 4MDEA 4W7SA 2GTPA 2Z5FA 2FEOA 4LHYA 1T6NA 1ZU5A 2QRNA 3IIKA 1E98A 1YZGA 5C4GB 3TR0A 2ZM5A 1SXJC 1XD2A 2AD5A 2Q0HA 1OFTA 3FB4A 1SVKA 2F6RA 3L43A 1UBEA 4HAVA 4ZDWA 3FYHA 3KQNA 4NE2A 4HLUC 4MKGA 1LY1A 5G53C 4D80A 3KQHA 1GG2A 2ZRFA 3OAAA 2IYYA 1XMIA 4RFSA 3W9YA 1M2OB 3OE7D 3TAHA 2ZS9A 3CM0A 1ZNYA 4TN1A 1JJVA 2ZYVX 2XXAA 1IQPA 2O8EB 1NVVQ 1XXHB 1ZUHA 5DISB 2BIFA 1E32A 2BM0A 3EPHA 2A9KA 3EA0A 1Q1BA 1KO8A 3N5CA 2FSGA 4KFTA 1OB5A 3G82C 3LNCA 5HPYB 2GWHA 4DEYA 5TY0A 1ETUA 1HA3A 3VHXA 1RPZA 1ZVQA 2BMFA 2YC4C 5HE9A 1OKKA 1YZNA 1W36C 2OLKA 1QF9A 4GI7A 4OHZA 1C9KA 1ZUNB 3G5UA 1IBRA 1D2NA 3P4XA 1VMAA 4M9ZA 4OQLA 2CCKA 4IOLA 5AWFC 2FPMA 1RIFA 2ZI7A 3NH6A 1KDPA 4MRVA 1W4RA 3BB4A 2YWFA 4EAQA 1GP2A 2BWJA 1GKYA 2QAGC 2ZETA 4FMCB 5GJCA 4B34A 3KJEA 4BRUA 3OESA 4JJZA 2C5LA 2OBLA 3U2QA 4FINA 1SVSA 2BCGY 4RKEA 1D2EA 3A58B 3GLIE 2O0JA 3I73A 2IWHA 4NYIR 1HUQA 5CM8B 4DLVA 1H65A 3F5FA 1HE1C 2W83A 3LDAA 4CDGA 2GCOA 1ONBA 3QKTA 5DE3A 2FU5C 2CJWB 3T1TA 1XNJA 3VR3A 4PZZA 3UKDA 1OFUX 4MUAA 3DL0A 2ORIA 4NYJR 1G5RA 3DZ8A 2IYSA 3DM9B 4L5BA 3C16C 3RDPA 1JXMA 1AZSC 2F3TA 4GFDA 4MYCA 1E4YA 1FTSA 1G7SA 4Q9KA 4M21A 4LSGA 4WOPA 4QM6A 2ZANA 1E2FA 3GFTA 2RCNA 2V1UA 2VTKA 4PC6A 4P4SA 2CK3D 2HYIC 4TLCA 1T3LA 1LV7A 1UKVY 1Z6AA 1KMHB 2XOKA 5KSZA 4HEJA 1OXTA 1S8FA 2RGXA 2ZS7A 4BFYA 4DCTA 4IFBA 1FOEB 3QXJA 3UMSA 3U4QB 1QHHB 3U7HB 4CEHA 1W5TA 1TNDA 4G3XA 4R2HA 4R71A 5KSYA 4MRPA 1SGWA 1G21E 1NLZA 3DVLA 2ECKA 1FX0A 2ZU6A 1W4BA 2NO0A 2P67A 1A5TA 3LVQE 2CXXA 3ZD7A 3QUSA 1XMVA 4R9UC 2REOA 3B1WA 4L16A 2FSHA 2J46A 2BMDA 2ZSFA 1J99A 3AVOA 4D4JA 1P75A 2DHRA 1DAEA 2Z0MA 1NVUQ 1R5OA 1ZM3A 121PA 3GLIA 2VH5R 4ARZA 3LW7A 4IDHA 4EKDA 5C4MA 2XEXA 3PV0A 2N46A 3V4RA 2VF8A 2XJ4A 2OE2A 2IS1A 2FZLA 3KJIA 1QHHA 4MYHA 1GKUB 1YVDA 2P5SA 4KYIB 4C0KA 2BV3A 4HB0A 1XPRA 1GIAA 3TQCA 1GNPA 1ZM9A 1MOZA
chains in the Genus database with same CATH superfamily
1XNGA 2Q3CA 4K1XA 3VISA 3HEAA 4BLPA 2WKSA 2YBDA 3SX4A 1C30B 1Y1LA 1YJCA 3OIUA 2JFQA 5HZHA 3IPAA 3DE1X 1HDCA 2YQ4A 1F48A 3TDKA 2VJQA 5T57A 3FDZB 2HMSA 1ISFA 4KQXA 5A05A 1D2GA 4GICA 3Q10A 4AIRA 1JXQA 2I6XA 5CDGA 2J1LA 2AA3A 4RWEA 5GGXA 2R44A 3EH2A 1U6IA 2WD7A 4PWZA 3WV5A 3F73A 3Q4GA 4L8GA 1SXQA 3KAJA 1NVBA 1E9AA 1E9CA 3I1IA 3DGFC 2D0DA 3NAMA 2IUYA 4OHCA 3WNCA 3ZNQA 1NX6A 1CFZA 1QO0D 3EA5A 5K3DA 4AF8A 4E15A 3T5AA 3VGJA 1P33A 1NY6A 2HO4A 4LIPD 1HNWB 2OV2A 1RZRA 1B23P 3FYTA 1S7GA 1JV2B 2AJ8A 3OTGA 4HGQA 2JA1A 1DKRA 2VHQA 2NZWA 4KUHA 3G9QA 2J7KA 4EW1A 3DMTA 2NIPA 3A1UA 3DOJA 3AVWA 1ABFA 1MX5A 2RJOA 3Q3JB 2PBLA 5B1IA 4B4WA 2NO6A 1TK2A 4PGMA 2YL2A 3L1JA 4UEQA 1YCHA 3B6KA 3HXLA 4JMPA 3QPAA 3GGDA 2PT5A 1HDRA 4G1CA 2XV1A 3H04A 3FPFA 1DKUA 1LBHA 2HDOA 4C4OA 1RTKA 1CC1S 1T29A 2DTEA 5E9WA 2WQ6A 1KR5A 4MS3B 2H0AA 4L6CA 3IGFA 3WZ2A 4UXJA 2OZLA 2GESA 5C2JB 3ICOA 4UATA 1XXHA 5CNMA 2QTVB 3THWB 5UKDA 4PYRA 2G77B 1K8QA 3GRVA 1YRAA 4QXPA 3PEFA 4YBZA 3AEZA 3F0TA 2PA0A 2G1PA 4Y7CA 1W35A 5ALKA 2XQJA 3IPYA 2FW7A 3FLEA 3MXOA 4M7OA 1CYDA 1MN6A 4URHA 2NU9B 2M6KA 5K3SA 5CFLA 3IAAA 4XD2A 2VHCA 2D7CA 3L0BA 1AG9A 3RASA 4KREA 5DN6A 1C1HA 1UDXA 3GH3A 2WHPB 1KI8A 2M1ZA 2SKDA 3P9KA 4RHFA 3K0CC 4TVOA 1GUZA 5CIWA 2WC1A 2NQ8A 2G1JA 5ALWA 5JAPA 3VQTA 1V5FA 4A0GA 4RTLA 5T7BA 3KQUA 4JI0B 3LRTA 3PGMA 4RANA 3TJZA 3UY4A 1XJCA 1ZJZA 3MIZA 4IUYA 4LXHA 4KMSA 1D5WA 2WMNB 4M8SA 4E5UA 3AUSA 5KKCA 1EZ4A 4IOKA 1X80B 2CVHA 2FXIA 5K0FA 1NF3A 1J23A 1BE8A 4RCVA 1SUSA 1FFYA 4PLHA 2CLOB 1FUUA 1NNEA 4LF9B 2RGBA 2PEYA 3IJRA 2C5FA 1Q0ZA 2C2ZA 2VNAA 3DOUA 3NBUA 2JH8A 2WIKA 4KFSA 1GZ4A 3SHQA 3TRKA 3U48A 4L95C 3AY7A 5FBZA 3HG7A 1HDYA 3NRBA 4DLBA 3AM3A 1QPZA 4FONA 4M76B 4LDQA 3E48A 3FSJX 1OXUA 2XVYA 3S1LA 3GMTA 3BSSA 3C3CA 2Q2NA 2I4TA 1T2VA 2AK3A 1L4BA 4DA0A 1PBTA 5BWNA 4LZOA 3TSCA 1R74A 1KC1A 2PQ2A 3P52A 1OH5A 3FKJA 4GMXA 1EG7A 1B76A 3A9CA 3AILA 3M1LA 4S24A 1XLVA 5K0TA 4YRNA 1LSOA 3HJBA 4I1IA 3ZNPA 1EVEA 5G41A 4TMYA 2X0KA 3KUDA 3MUNA 3C5WP 3AX6A 3ODPA 1NJ1A 4YB8A 5AM3A 3N1UA 4BNVA 4DN6A 3NV9A 1SXGA 2P6NA 4EJ2A 5M04A 1TZMA 3C5HA 1BRMA 2QEQA 2WJ4A 2ZWIA 2B2XA 4JC0A 4H08A 4ZQFA 1DEXA 4I46A 5FOSA 4OLAA 4LZZA 2FQQA 2IOYA 1KVRA 5EFZA 2BYTA 1JR3A 1CTQA 1U5BB 3PA8A 1RI1A 4TYMA 3VH2A 2DJ5A 1LLQA 1MJFA 3L6OO 1RAAA 3DDSA 3NTOA 5EIOA 4UMFA 3I5XA 4FYIA 4QGFA 4X1KB 1EE1A 2P2NA 3H13A 3CUEF 2R7NA 3MGGA 2FWAA 3TXYA 3PQCA 1F9EA 3L04A 2RAPA 3CZ4A 2I4IA 3A0UA 1F5NA 3GK3A 3HDQA 1R4ZA 2C54A 4UARA 1EHIA 1IHUA 5F1OA 5I45A 2EFCB 3FVRA 2EYUA 2VQEB 1OE0A 3MXTA 3V7FA 1GXSA 1UANA 4E30A 5FEUA 2O59A 5DGTA 3QEOA 3DAHA 4DANA 1GQRA 4MXDA 2HT1A 3ESXA 2EJTA 3W9BA 3U09A 2CFSA 2Q5HA 4LYGA 3G3EA 1TW2A 4AC9A 4O59O 1FYVA 3QWFA 4JI2B 1AS3A 1AN0A 3MJHA 1A4XA 1ENOA 3WR5A 1YUBA 2CEKA 5ENDA 2C88A 4LF5B 2X6QA 3AL2A 1XA3A 2ZRHA 4FHZA 5CLFA 4E88A 1N3LA 2CZCA 3KYIB 1TKCA 1A7KA 3H1EA 2PDAA 4RK0A 3HM9A 1W8DA 1G9SA 2IHJA 5JI2E 1XJQA 3F4BA 3EVFA 3L7DA 2CVPA 1RM5A 3NDRA 4XYMA 1Z7EA 1SRQA 4GZ5A 3AVYA 4RABA 3MBOA 4PRYA 4E1AA 1UBHS 1A95A 4TVKA 3DE7X 4MV6A 5EP2A 4QELA 2CSXA 5JZBA 2Y71A 3R9IA 2JI6A 4MPDA 1W36D 4BO2A 2NX2A 4F4FA 3BH7A 3CNBA 2CLMB 2RHWA 4DM3A 2GM4A 2NGRA 4ACBA 3C5CA 1X9HA 2VSXA 1X6VA 3RAFC 1QP7A 4ARSA 4GPBA 2A30A 5ERXA 1RKUA 4C4RA 1JPUA 2JS7A 1ODCA 1KI9A 3G85A 3RHSA 1NSFA 5LQRA 3AXSA 4KSCA 3AERB 3L84A 1WCV1 1N8NA 5H3CA 4C6RA 4OA5A 2NTEA 2DWCA 4I8IA 4F38A 1E2JA 1SELA 4AX8A 5KDLA 1H2HA 5HOQA 4HQ0A 3D2BA 3H1TA 2FZKA 1NP3A 3SFVA 4WY2A 3MOIA 4KWTA 3NHFA 1PZHA 3KKZA 4I14A 4Z0PA 2VHZA 2JA2A 2NVOA 4XYLA 1RQLA 4ZI2A 3ICQB 2ERCA 1N3IA 1NAIA 4YYEA 1X1TA 1YAJA 4QDTA 3JQPA 1KS9A 4HMQA 4P9NA 1DC4A 4RC9A 4Y2RA 5CLQA 5JS2A 3VZDA 4NXMB 3OCVA 1BTOA 1TKBA 4A2PA 3QLEA 5EVCA 3EGVA 3FYSA 1N92A 4DIMA 2GBLA 1VL5A 5LA6F 5JNUA 4H3KB 4PLWA 1GG8A 1KFKB 2HQSA 3PICA 1QZ3A 4FNAA 5TVGA 1B0ZA 1HT1E 4YMGA 3S8EA 1J2UA 5B5SA 1S5PA 3MTBA 3O8QA 2ONZA 1NATA 5A6SA 2DVMA 2XGOA 1J0AA 2D5IA 3NHYA 4NH0A 1KYWA 2YWXA 1WY7A 3INRA 1Z3CA 4M4SA 4QULA 4WLEA 1WTAA 4A26A 5AW5A 4EF6A 5IJ0A 2A5LA 1BCRB 4EPRA 2WMYA 3P7MA 4G1UC 3FDFA 1NZFA 3PHIA 1MF7A 2JBWA 2VLIA 1AKEA 2OD7A 1G8SA 3SQLA 5L3RA 4O2AF 2F8SA 2V5UA 1O57A 1BHSA 1XN4A 3D4LA 1RWXA 1RYYA 4Z3KA 5BVHB 5HR5A 1Z6ZA 2GJ8A 2YRWA 4CT0A 1HLFA 4ZFNA 2PMCA 1Z13A 2RE8A 3VR4H 2C8KA 2WHPA 3MS7A 1GAJA 2HGZA 2X3FA 1OKKD 1JDUA 3NOOA 1A4RA 2BH9A 3DO8A 4KVAA 4YCMA 1VE1A 1OT3A 2A88A 1I1OA 3UCFA 3VNAA 1A76A 2GPSA 3SX2A 3REGA 3JQEA 4GMDA 2FUG1 3LT0A 4DC0A 3WGVA 4EKNB 1PDWA 3G6KA 4AJ1A 4LDNA 2V7XA 2QR3A 2ZYHA 5G3ZA 4KTVE 4B80A 1Q7EA 2E1RA 3L6CA 3L7BA 1QQBA 2RHCA 4H1WA 1OIVA 4Q9IA 4BKUA 2HPVA 4OOEA 5FUXA 1APBA 4D4KA 1CY1A 4EA6A 1QX4A 1ABEA 4YPVA 2XT0A 3JRWA 2GZSA 4G8BA 3BE4A 4PX3A 4JLAA 1E6WA 2TMGA 3KJQA 4YC7A 1PK7A 3LT5A 4EJSA 4ZK2A 1QGZA 1BEUB 2IVZA 3DF7A 4ND5A 1WX1A 4RF2A 1QRRA 4WLNA 1NVFA 4XPIB 5AK4A 1NMEA 1PTKA 1V1RA 1YDFA 4RTJA 3ZQKA 4PFQA 1JHXA 3EEYA 2VNIA 4K9NA 3CGWA 1UIRA 2Y1LA 4HUQB 3ZR4B 1UQTA 2B3TA 1LQTA 2R6R1 2R00A 5ICGA 2PQ0A 4GVLA 4I9NA 2Z95A 1U0LA 2JFXA 3ZLTA 4CHTA 4X3CA 3ENZA 3MT8A 1WUTA 4UOQA 1T8PA 1A8SA 3N8NA 5EMNA 4TYPA 1F2UB 3SC3A 1UBGA 4CFSA 3IUBA 4NYMQ 5AVTA 3D0KA 1I2BA 4I4CA 1JU4A 3KV3O 2AMJA 1R37A 4QOGA 5F76A 3WK4A 4CQMD 3EPPA 2MINA 4OPMA 4NDNE 4DUPA 5SYAA 5LD2B 2P2SA 1QZTA 4BV3A 1BS9A 3FZEA 5AO9A 3C7TA 5AUOB 1ZY2A 1J9EA 2YWRA 1I2AA 3HB9A 4HN4B 5HWSA 3ZVRA 2BTQB 1EFKA 5AXCA 1JW9B 1O8CA 1Y6RA 1ZICA 4Q4JA 1QM5A 4TRNA 3NO4A 1WPXA 2C7GA 4H17A 4ITUA 3SG0A 3FHTA 1QBKC 2JFOA 3WL5A 3P45A 4DA6A 4CMEC 4MRMA 3VR4A 2RGNC 4RU1A 1ADBA 1M2VB 3IP9A 5FD8A 3QF4B 4X24A 5CH3A 5EHNA 2XDYA 5DHUA 3NJ4A 4AVYA 4CCWA 1TZBA 3ZY6A 3L1IA 3HWX1 2FFBA 2O2YA 1SXPA 4UDOA 3VKUA 5ED4A 2ZTUA 4CQLA 1U7XA 2OXEA 3VDXA 2BI4A 4DUGA 4WA8A 4F91B 3EEQA 5A3JA 4QRIA 1D4OA 1FXWF 2SHKA 1GL6A 2OECA 1ZNXA 3NYRA 2GPNA 5T8KA 2JLRA 4MV4A 3EUWA 5EUCA 1RD4A 2DT8A 2G28A 4XVHA 1NQAO 2B4YA 2W2MA 1KZ7B 2XTAA 1Q3TA 2XWSA 4LXTA 5JAHA 1C1DB 2GYVA 3H2BA 4L4XA 5TQ0A 5HK8A 2D62A 3E03A 4ZC8A 5JXHA 1JKXA 1GY8A 2WV9A 2Q62A 3ABZA 3KVYA 3O3OB 4DHWA 3QW2A 2PH3A 1MQ9A 3DWEX 2C29D 4OLBA 4CBVA 1U5CA 1IZ8A 3B3FA 4II7A 3U7JA 3I1FA 3NFYA 2DU8A 3DQPA 4YV1A 1V4NA 3S8YA 4YFVA 2XOKD 4EHFA 3DBIA 1NKSA 2Z8XA 4JJKA 3VVMA 2YN2A 1BAPA 3OZGA 4J7AA 2OHVA 2PT7A 5JOQA 1TQ6A 1W48A 3RVNA 1E3EA 2I65A 1YSCA 2CUTA 4GEKA 1UXHA 4K6FA 3T4PA 3VHQA 3TECE 1NHWA 3ZK8A 1UBJS 2Q3HA 2GEKA 3KXIA 5A0TA 1A9QA 3EG5A 4YX9A 2C0CA 4QUIA 1D2AA 4N9WA 4A6XA 1ZM7A 1E2MA 2JJ8A 4G67A 3JY6A 5DBIA 5IABA 3OCCA 1WPRA 1AO0A 3TI9A 2WJVA 2P5YA 5A9TA 2CY0A 1GCGA 1N5LA 4E5KA 1ULTA 2NU6A 4KAFA 5EWMB 1DX6A 3OX3A 1PJ3A 1C81A 1YHNA 2JC3A 4UEJA 4D6XA 5LXTF 2VG8A 1SCAA 3LWZA 4Z86A 3L82B 3QXGA 2XVMA 3X1DA 3ELWA 5JH7A 5AKZA 2XWQA 1IVSA 1WIWA 2VHEA 2W00A 1X7XB 4EB0A 3ES9A 4IRUB 4PSUA 2XUHA 5BUZA 3RT1A 3VPBA 5ALMA 1YACA 5T4FA 2ADFA 5JZ9A 1D4AA 2AJLI 4ZVNA 2RI6A 4PTLA 4XIYA 1RVV1 5IT9A 2Q9CA 3CB4A 3E7PA 1B15A 3ANMA 4B4VA 4MDYA 4ND8B 1EIZA 3VU9B 4CKEA 4M1QA 3LDHA 4NK4A 1GZVA 4B7XA 4M1WA 1XAHA 2ZWPA 3A1EA 4HL6A 4I6EA 3ZH2A 3O4VA 3ED1A 3GROA 2ZLBA 1L5OA 2OV4A 2HH9A 4ZOBA 2ZXEA 2V7VA 3TGPA 3TZHA 3O26A 1SBIA 2Z3ZA 3T94A 4MUIA 1S8OA 1F8GA 3NKLA 4NBKA 1IOZA 1YCDA 4DQUA 1W52X 4IGFA 1Z6XA 5DOVA 4JT8A 4JELA 1M1YB 3D31A 3PEWA 1JG4A 1KI4A 5HMLA 2VK1A 2RB5A 1OI3A 4FMCF 1EK2A 2QZZA 3HWSA 1N7JA 4QUDA 5EIFA 4EMTA 3OJFA 4LZNA 3VO9A 1ZISA 2R66A 3AB7A 5KTRA 4AQ7A 3JVVA 1FSSA 1Q3KA 1BU8A 2PH1A 5K0NA 4AXXA 3CF6R 2VJLA 1F2TB 4AZ3B 2IIVA 4QUEA 4X5OA 3WL4A 1DAKA 1E79A 1PZEA 1NPTO 2BOVA 5THQA 5CURA 3IUPA 1D4ZA 2ROQA 3W4KA 1VB5A 2JIZA 4CM4A 1Z0IA 4PIVA 1TCCA 3M0EA 4QTYA 1H2AS 2WUFA 4I7EA 4IQ4A 3SBEA 3IQFA 4HGYA 1NT2A 1W30A 1X7DA 1FP1D 2FSSA 3F74A 3HGQA 1R9GA 4TVBA 3FTEA 2B5VA 2O2IA 1XEWY 4W4TA 5T4HA 3BEDA 4GXRA 3Q3HA 4ZDIA 1SB9A 3WLIA 3P26A 1JDSA 5DM70 5B57C 5CXQA 4NDZA 3TZQA 4JWKA 3M1IA 4BO6A 3UJPA 4O4IA 4KFCA 4R41A 2OD9A 3RUIA 3E9QA 3H5IA 2VXYA 3GLHB 5D84A 2OAEA 1DAOA 4EFMA 2W2LA 4WJKB 2GB4A 1DKPA 1VA4A 1B00A 2OO3A 4UMVA 3K1AA 3O8OB 1ZVJA 3K35A 4IXWA 5JQGB 2HMWA 4MI3A 3GQVA 4RH3A 3B38A 3QEBZ 2RMKA 5B3LA 1BVUA 4DV4B 2QSJA 1SC1A 5KYUB 1KQNA 4MAFA 3K0BA 2ZSBA 4HYTA 1E79D 5JSYA 5KQSA 1FQKA 4LZLA 5JXGA 2Y1XA 1IBCA 1GPWB 1KJQA 4FMDF 2GCPA 5FTLA 4GBED 4DPMA 2CWDA 3BK7A 1XL1A 4JCCA 4LGVA 1GZ6A 4NBSA 1IMJA 1FS5A 2VJMA 3RTAA 3G5TA 3OE4A 1DPGA 3K31A 4BATA 1FBTA 1OZAA 5BW5A 5HJ5A 2GKOA 3GJ7A 3NP7A 4UHJA 3BJMA 3RVSA 2O8DB 1NBME 3MCTA 2WFLB 2CC2A 2W6MA 4AO8A 1JBEA 2JLXA 5JD6A 4C6TB 5JZOA 3SXPA 4NS1A 2H07A 1RWMA 3HZZA 1HDIA 4R16A 3AF4A 4JXZA 2XB4A 4WKBA 3UJ6A 4IO1A 2JLWA 2JD1A 4D98A 1V2HE 1MZPA 3M2TA 4LJSA 1X2BA 4OFZA 3D6MA 1NOIA 3I9MA 2FR8A 3RV3A 4FFBA 1YUMA 4D8YA 1QJCA 2ZITA 4PRZA 5CXUA 2GXUA 1Y1SA 2ZIVB 4H1TA 3RUPA 1Z2OX 4QD3A 4EHDA 2ZVDA 2C2KA 1KZYC 4FHFA 5T64A 1XL0A 3A1CA 1SNYA 1N0UA 4X1OA 4LYHA 3TCNA 1T5SA 2XDQA 5MGNA 2C7RA 5LUBA 3OX4A 4OK3A 1Y8RB 1YQXA 2JCXA 2ATEA 4B76A 2AEJA 3E8SA 4Q4DA 1F7VA 4PAMA 4WTOA 1Y3AA 3RRMA 4U8GA 2D2FA 3G59A 4YRCA 2IV7A 2AEEA 2YASA 4PGFA 4H1HA 3CNHA 4MRMB 4YASA 2EL7A 2Z43A 3KCQA 5BXQC 1TEZA 5E95A 1ZONA 3LUFA 4RGVA 4C01A 1TOAA 3OIWA 3LVFO 2XUPA 3D7LA 2SKCA 3MAJA 4YO7A 3VSBA 5KYXB 4RTPA 1Z88A 1ATZA 2HSWA 4G56A 2JH3A 2AD1A 3GD7A 2QL7A 1DG9A 4KHZA 5KI6A 4X65B 3C24A 3ZZNA 5FI3A 4IKOA 3C0KA 4TKZA 1T9DA 2I1QA 2WAAA 1GPYA 2ZS8A 4GZLA 4A8PA 1WETA 4CQMB 5A62A 1YULA 2AXNA 4KACA 1Q11A 3AI3A 5TJ9A 1J2TA 1WHTB 2H0QA 5B55A 3KKKA 5CB4F 4CLOA 4MVWA 5JBIA 1XLTC 2X40A 4YRZA 3E70C 4IJ6A 4ZJPA 1U7HA 3O8NA 3I8SA 2XX3A 3PT5A 1K27A 3PK0A 3BB1A 1VC2A 1ZZEA 3PTZA 4LQDA 1T2FA 2OYSA 2RH5A 3I6QA 3IIEA 3U9LA 3UJ3X 4BMZA 5I9IA 4WGFA 3CWZA 1FK8A 3G88A 1H22A 1T1RA 1WP4A 3I5UA 4L6IA 3VJKA 1T8WA 4B74A 2W5UA 5KMGB 3PNYA 2FPIB 3BL6A 1NJ6A 5EYPA 2Y9MB 5GY7A 1XE3A 3GJZA 2QBYB 1WVIA 3VOBA 1ORHA 2JATA 5DNYB 4KDRA 1EUDB 4RDIA 3MD9A 4WE3A 4FN5A 4ZTZB 5AW6A 2IH4A 1C41A 3T38A 2I2CA 4RELA 1XEXB 1Y1TA 2PT9A 3AY3A 3PRHA 4C4YA 1DFHA 4E1VA 1JBKA 2KQUA 1NR1A 4I1UA 1RP7A 2B4QA 3BMCA 3OWXA 4P4LA 4YV7A 4C2UA 5ADHA 1SN7A 4YP6A 2OD2A 3CU5A 2DB3A 4RLFA 3FKSA 5ALXA 3UHOA 3ORFA 3NQ41 4WADA 1Q77A 2YZKA 4GPD1 1NYLA 1KVSA 1XTZA 2JIBA 3F7TA 3ID6C 4NTZA 5JSKA 2NW6A 4DLXA 4KGDA 3AHGA 4Q19A 1ECCA 2C92A 2CLKB 4X8LA 4GF5A 4OXYA 4I55A 1FDSA 4M1MA 1OILA 4KFUA 4UQOA 1HDGO 1I0ZA 3GUUA 5KOYA 1ZAKA 3BJIC 4IRXA 2BMJA 3DZKA 4NMMA 4QRDA 4PYIA 1U04A 1T5HX 4HRXA 4XFDA 5LQAA 4UAGA 4B33A 2P2ZA 2BFFB 5FTNA 5J2UF 1N5JA 5DTQA 2PD3A 4LS3A 3W6PA 4JLBA 4JI3B 5B2FA 2EYQA 2REBA 3DH0A 1Z25A 4YLYA 4JKOA 4MYDA 2ZUFA 2A1TS 2B61A 4G0OA 5F12A 4DSNA 3EC7A 1IY0A 3KB1A 3CGGA 1MOQA 1NU8A 3B1FA 4NU0A 1GTVA 3T95A 3AM5A 1UAAA 3V8VA 4DWOA 1ZN9A 3AG5A 1FFBA 2O3JA 3OCZA 1U2PA 1OAOA 3AM1A 4ZVTA 4TZTA 1CQWA 3OO0A 4I55F 1IUPA 1B3RA 2WE8A 2J32A 2PSFA 5IMSA 1QVAA 2H4FA 5E4JA 2IRWA 3BMNA 2XCQA 3KSMA 4ZCSA 4I2VA 1YCFA 3WGQA 5BRNA 4DCCA 5KC8A 3WSVA 2V6FA 5TE9A 4YAGA 3ZDBA 4N0EA 1YK1A 1GD1O 2ZDHA 3GQBA 2SECE 1J7JA 4LOIA 3WB1A 3LVBA 3EAGA 4LYAA 3TGWA 1GILA 1X2EA 3A10A 2H1CA 4EA8A 4ER7A 2XCIA 1AO3A 3GPBA 4PYMA 3HJCA 3M4NA 3LUGA 5D3MA 3R7LA 3UYLA 3KKOA 1KYYA 1OA0A 3NONA 2YHAA 2V7TA 3R76A 2WG1A 3EBOA 5L95A 1USUA 2HM7A 1IB0A 2EWWA 2G9ZA 3G1UA 3GEBA 3GNQA 3IEXA 3PHLA 4IHAA 4B0OA 1KPGA 4G07A 1TIBA 2FVXA 4DM4A 1SVUA 4IWYA 3ZNOA 1O5IA 4QQFA 2N47A 4FDTA 1MB0A 1VYVA 3F3YA 2GFIA 2J0SA 2CCGA 1GOTA 2HMAA 2OHXA 4PAGA 4RY2A 4TT8A 5JCOC 1WDTA 1ZJJA 3BGIA 4PQFA 3BFVA 4I1VA 1PR6A 3JD3A 1R8YA 3QJ5A 4J03A 2EIXA 3JTMA 3A9VA 4ZT5A 1N0HA 4IX9A 1RFLA 4TVSA 2F8LA 4OKSA 3PFHA 721PA 3ZVMA 4BNHA 4U00A 4OLJA 2JZCA 2QL6A 3PDJA 4F0JA 1FUKA 3O7MA 4COOA 4DNQA 2P1ZA 4U3JA 1XJ0A 4IYJA 4CTJA 1L8OA 3N58A 2EJCA 4FGLA 2WOOA 2IHKA 3NNNA 4E5MA 3NEYA 4B3GA 3L4BA 3AXTA 4L0CA 2LPMA 2NV2B 4I1OA 4Q6WA 3A1VA 3DB2A 5TMPA 1J7KA 3PYLA 5I3CA 4RY8A 3LUAA 2W6ZA 1OB2A 1YZVA 1CUIA 3PHJA 2GERA 5D8DA 3H75A 4WLVA 3CURA 3OJCA 4HQRA 4CUKA 2N1BA 1WCWA 1ZESA 2JJ1D 2FLWA 4D5EA 2H5JA 1NVVR 4TTVA 4C1BA 1JEYA 3EBPA 5GVSA 5EWLA 2V6GA 1NJ2A 4A8JC 4A73A 5LQCA 4JFAA 3T52A 1U5BA 1M2FA 1ULUA 1YZTA 4GKBA 2EP5A 3GO4A 4JUAA 1PFKA 1TZ2A 2V6IA 1JDVA 3IAXA 3OJ0A 4CV0A 2I33A 4EENA 2NUBA 3FJ1A 3DEAA 3FKQA 4ZP1A 1P73A 4CXMA 1FS6A 1NUHA 3QTTA 4Q3NA 3KL4A 3TNFA 3K2BA 4QUHA 4CU5A 1NDQA 1ZK3A 5BQPA 4KWHA 4L6AA 1G291 5AIBA 3WS7A 1XXHE 1ONPA 3G89A 2ZJ7A 1CJSA 4NE7A 4NLLA 1FTNA 2HYDA 4DY6A 2CB9A 1H0HA 1QS0B 2WSSD 3CRW1 4WBXC 3KQMA 1ZC3A 4O4JF 1PR0A 1XP8A 1I33A 2XZDA 1VFPA 1CUUA 3NI2A 5D6OA 3OE5A 5JLJA 1VE6A 1MU0A 1ORVA 3M89A 1RXEA 3DLIA 3DJYA 1FSFA 3SKXA 4DR2B 1PLLA 2H3EA 2ZB2A 4BLSA 3TAUA 2Y27A 3KXLA 4YYZA 4GOXA 3L02A 3VKGA 3OCYA 4BTLA 3EXFB 1PX2A 1Z39A 4DPKA 4V1CB 1XDWA 3A9UA 2G82A 2VSQA 4W9RA 3U40A 4C0WA 1KH1A 1SIUA 3K6RA 4MUKA 2FLKA 5F35A 3RRYA 1DARA 1RPJA 3TIGA 2P9EA 1H1DA 3GVXA 1PJLA 3N6VA 3PFGA 5FOTA 1EFVB 1E7WA 2FG5A 2X4IA 3G8BA 3JASA 3R3SA 1R6BX 3N2EA 3JQGB 1R88A 4WY8A 5BV1A 4P0QB 4P3OA 1UZLA 2ZBRA 4LBYA 5IUJC 6Q21A 3N3BC 4QWWA 5KQLA 2Z3WA 1IQ0A 1Q20A 1RWNA 2HF2A 4M0KA 1MHTA 1CR0A 1XTQA 1M8GA 1HOTA 1R3UA 1ZI8A 1AK2A 3PUJA 2CVFA 4EFDA 4MQ5A 2P0YA 4I2NA 1QIGA 3K6SA 2D0PB 2YJZA 5L4SA 3SHWA 5CBPA 3ECSA 2YUIA 1AU9A 4EGSA 5REQB 4WVLA 1S9DA 2NYUA 4OUKX 3H18A 1VP9A 2VP4A 3SIPA 3AFNA 4BQRA 1XQXA 2GKSA 1XEXA 3CG4A 1G3MA 3KU1A 1PDVA 3KE8A 4OH7A 4TUYB 2EW1A 1UK6A 2IV3A 3RWBA 3M4YA 3B9RA 4WINA 5AM4A 4JJAA 4LV5B 4OGKA 5EXPA 3AHJA 5GPBA 3AVVA 4G8DA 4PO9A 4WSOA 1IEQA 4JEHA 5SZJA 2J3EA 5CA1A 2HF9A 3BWEA 5MHTA 1TC1A 4YJKA 1D2HA 1YJXA 3U3JA 3GT3A 3NHBA 4NHOA 4S1PA 4MI6A 1VE3A 3L9WA 5LN1A 2HCJB 2XZOA 1CHDA 2YVLA 2DHDA 5DHSA 3KT8A 1NF8A 4MQ6A 1JDZA 4QUKA 4Z7NB 1L5HB 2UU9B 2O57A 4GI3A 1A9RA 2DSTA 1XZLA 1BCRA 1H4TA 2QIPA 3H2ZA 3OD1A 4UE6A 4EEZA 4F2WA 1U1EA 4UTOA 4D56A 4NU8X 2PO5A 1UT8A 3AUAA 5BSUA 3EIHA 2Q5CA 3HYLA 5CVUA 2GEVA 1H1LA 1E7MA 1G4AE 5KJEA 1FXWA 1XU9A 4OM8A 5D1HA 1VRCA 3AKCA 4ND6A 1AIPA 1CDZA 2YQZA 3FAZA 2VAXA 3R0XA 4ZT2A 4EPTA 1YFJA 4BRWA 3G2MA 4RXTA 4GQAA 2PM8A 1IK4A 1NONA 2ZQZA 3FOZA 2A9QA 1CERA 1IZYA 3AVQA 5AI9A 2WT8A 4C3UA 3AQIA 3AIIA 1BMFD 3SYMA 4YUZA 4M7WA 2XUQA 2IYLD 4M9CA 1Z3IX 4Q3CA 1Z5NA 2EEZA 3B60A 3GYGA 3MTEA 5E7MA 3OZCA 3HKDB 8GPBA 5MDHA 5TT1A 5IVKA 1EVIA 1Z4MA 1T9CA 3IILA 1Z0JA 4JD5A 2OM2A 3CJRA 2Q7DA 2X9NA 5KQPA 2W48A 2F3PA 5LXTA 2YZMA 3N2KA 1NJFA 4ZU1X 1ZAYA 2GK7A 2DPHA 4RY0A 4XSVA 3S99A 1PVDA 1VLMA 4RM3A 2XMDA 1QSGA 3SWWA 1ZUNA 1SCQA 3EK2A 1V96A 1AGNA 2QQGA 2XDWA 2G0TA 3W9SA 3VPXA 3DEHA 4XOUA 1CEXA 5IMBA 1KWKA 3I4CA 3KQLA 1A2QA 1KKLA 1AUOA 2C9CA 1NRWA 2WFZA 4CIXA 5IDXA 2GPJA 2IY7A 2FCAA 5M34A 1BH2A 2D5BA 3B1JA 4HATA 1KPIA 4ZHQB 4CIAA 1MT0A 5JS7A 4QM7A 4HZUA 2EWVA 2YRFA 3NIBA 3QF4A 1N3BA 1W96A 2EIHA 1RPTA 5ICFA 4NXNB 1CY2A 3WGNA 1EWRA 3CRVA 2BSAA 2VJNA 4K6GA 5J2UB 2JF0A 3P5SA 5FI1B 3F7NA 1TUGA 5AOCA 3ON5A 4HLNA 5H1YA 3D1VA 4DIEA 2EKLA 1XZMA 1Z4JA 2C2YA 1HLGA 4G1BA 3I6MA 4GH5A 3OJWA 5TNXA 3UOGA 3CLUD 5CW2A 4DLTA 1FYDA 1X86B 2WEKA 3GGCA 3I76A 1V5EA 4JX8A 3SYTA 2DFNA 1JR6A 3TG8A 4ETNA 1BQ4A 2ZVJA 3GA7A 4DMGA 1MQ8B 4XYBA 3P19A 1QRUA 3DCJA 4H0FA 2TSYB 1QS0A 2ISSD 1NWCA 3DVSX 2EC5A 3CNOA 3STHA 3F7MA 3PT9A 4JB3A 3DZJA 3WK6A 4EEKA 5HIKA 4MK4A 3RNOA 3GA0A 4J29A 4FUQA 3LA8A 3UGTA 4J91A 3PENA 1JVBA 2WNIA 5ERYA 1HYHA 4E5DA 5EE5B 3T9CA 5KVAA 1GPH1 4FYWA 4JR1A 4C0BA 4K8RB 3FSGA 4H4DA 1G20B 2F1OA 2I4MA 2K7ZA 2J0UA 3H8WA 3NOQA 3RODA 1CF4A 4PC2A 5LDDC 2HSEA 4RIHA 4RO0A 2YVQA 2P65A 2HPAA 2YUTA 5ABPA 2A57A 1I3KA 3R0QA 5CU7A 4MVCA 5LBIA 3LQRA 3UZUA 1JFVA 1GA4A 1GGVA 2ERYA 5LMUB 2BSXA 1C3XA 5TXGA 4DPLA 2Q4RA 4DDKA 5TMEA 3HP1A 1PGOA 2H2HA 3N2GB 2ACKA 2A0FA 1OU4A 1SZCA 1IBMB 1O94A 4R2MA 1P0PA 3QFRA 4ZAFA 3QYJA 5F33A 4HH1A 3Q7QA 3UTDA 4BC0A 1E77A 2JKYA 2G0NA 2OENG 2WILA 4HMPA 1KJ9A 2VAWA 5K8JB 4DR1B 1V5WA 1WU7A 3P0IA 1P80A 1WW2A 1G3IA 2FE4A 2GGSA 3TLGB 1OF1A 3UENA 2XRYA 4KIWA 3KWFA 4PLYA 3E18A 3KUUA 1QFZA 4ARVA 3AI1A 4KPGA 3QKSB 5GMOA 1V3VA 1V26A 1V8PA 3LP8A 1OLXA 3PCXA 4MHOA 2G4VA 3D0OA 4Q34A 3RSCA 3TOZA 3U7QB 1PS0A 4TWRA 5IPFA 3MILA 5EEGA 4B83A 1E0DA 3L7OA 2WOJA 1D1QA 1SC4A 1DG1G 1I36A 2EKPA 2WZDA 3N2LA 4DLNA 5IDWA 2BZGA 2Z1MA 3LUKA 1L7NA 5CITA 1N1MA 1XEFA 3DL7A 1FYEA 2XCUA 2NU9A 3OJOA 1ILEA 1HORA 2PRSA 2YJGA 2F1JA 1DX9A 1EWVA 2HWUA 3DFMA 4JUDX 4DR3B 2W71A 3ZXIA 4ETWA 1ZCZA 4IL5A 2PRIA 3L2OB 1XCLA 5A4DA 1CJTC 4TPKA 1T0IA 3KBOA 5AVJA 1DSSG 3S7ZA 1KAGA 1ST2A 3I0MA 4QTZA 1E2KA 2RHLA 5F2EA 1SC3A 4B71A 4D74A 6AT1A 5JEEA 1QZUA 2J3DA 4KVZA 4U2DA 5EXTA 4N5LA 1CZHA 2QTWB 1D6JA 1G0NA 5CT4A 2A8YA 2ZAIA 4NICA 3ROXA 1Z5GA 4AKSA 3KB2A 1E9EA 1M7GA 5SYMA 1F38A 2HQRA 3MRTA 5FPHA 4Z7QB 4DR7B 2ZAOA 1RWKA 1WA5A 4QQKA 3DPIA 5AKIA 2X5OA 4L4RA 1Z4KA 1GITA 2XNJA 3I32A 3UW3A 1UFQA 3VR6A 3FI0A 3H16A 3A1FA 3SQOA 3WMFA 2O8BB 5JIBA 1VJTA 1W94A 4HTFB 1LPBB 3IHTA 4JB2A 2WSYB 4BLTA 2PXCA 2JGEA 2EF1A 3M1AA 4IO0A 5ALTA 3BDAA 1YQWA 4WXPA 1SBHA 5HF8A 2OHIA 4B4DA 3NBFA 4EHBA 1V9CA 3E4CA 3ORHA 5D86A 3VFDA 4OAQA 3RC9A 3HYRA 2RG7A 4OP3A 2G5GX 3NT5A 1WCIA 2YH2A 2J87A 4JLSA 3KEOA 3O1JC 4BS9A 2PVPA 4W1QA 1OXVA 2YYZA 2FPLA 3E9NA 3AIOA 3S2ZA 3WMXA 3MUOA 2KWIA 4AO7A 3KXDA 5J1TB 1R0SA 3S4YA 2CZQA 2Q4BA 2R1VA 1AQYA 2BF4A 4E94A 1YI0A 2Y6UA 4X94A 2Q4OA 1A2OA 1VIVA 3L7AA 3QYFA 4AJNA 1N8KA 4YCDA 4C89A 5A06A 1TQ4A 2ZI5A 3K9NA 4QNRA 3IOBA 5IJZA 1G6KA 2XCRB 2PWYA 4FGSA 2OXCA 1CKEA 4DCGA 1HE8B 1DJNA 3AQ4A 4R81A 3HUEA 3PSAA 4CMBA 2GD0A 2VYQA 2B1QA 2F48A 1YB4A 3BMOB 4F9EA 3UV3A 4WNIA 3DDOA 1RJ9A 4JI6B 1PR9A 4F9FA 1YJAA 4MVJF 4LVCA 4YVFA 3TLKA 1PL6A 3IPRA 4HV4A 1REQB 1EUDA 1GJRA 4OI4A 4DCSA 1HETA 1U8UA 1NVKA 3SR0A 1TAQA 3MLBA 2R7MA 3FZNA 5JHGB 1KY2A 3T7KA 5BN3B 1SKMA 1B26A 3E3MA 1LSJA 4JOCA 1JMKC 3AHHA 4D7AA 2JAQA 1TRKA 1XALA 2QD4A 4QGGA 2DUJA 1IWOA 1NKTA 3QFFA 4DCNA 3ESAA 2YW2A 2XZPA 4LHWA 3OM8A 4KU4A 1FCJA 1NN3A 3EGIA 1LQUA 2QNIA 1M3SA 1XEAA 1ZLXA 3G68A 3ONDA 4R83A 3I5AA 4QTTB 5BQ5A 2O7QA 4A0HA 3ZVKA 3LWDA 5HRCA 1JE0A 4OYRA 4W8OA 2WM3A 1P7VA 1F6WA 5DYTA 2H0RA 2PYIA 2EX0A 1KSGA 4IV5A 4EFNA 1G98A 3LECA 3THOA 2A1TR 4BUCA 421PA 2ZJ5A 2X0EA 1J22A 2YY5A 4CQMA 5AUPB 1WP9A 2NZYA 3KKEA 1LJ8A