4F7WA

Crystal structure of klebsiella pneumoniae pantothenate kinase in complex with n-pentylpantothenamide
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
309
structure length
309
Chain Sequence
LMTPYLQFNRHQWAALRDSVPMTLTEDEITRLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRHVELITTDGFLHPNSVLKERGLMKKKGFPQSYDMHRLVKFVSDLKSGVPQATAPVYSHLIYDVIPDGDKTVAQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEELLKSWYINRFLKFREGAFTDPDSYFHNYAKLSKEEAVDIATSLWNEINLMNLKENILPTRERASLIMTKSANHSVNQVRLRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, biosynthetic protein
molecule keywords Pantothenate kinase
publication title Crystal structures of Klebsiella pneumoniae pantothenate kinase in complex with N-substituted pantothenamides.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 109
structure length 309
sequence length 309
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.1.33: Pantothenate kinase.
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4f7wA00
1CRQA 1OPXA 5EP3A 2OBMA 3K0AA 4M2LA 1HY3A 4WW0A 2CJWB 1FTSA 3P26A 3H1TA 3OFNA 2FG5A 4LYHA 5FOSA 2VSXA 5JBQA 1ZUHA 3ASZA 1G3IA 4YXWA 521PA 4BFUA 1E0KA 1SXJA 2D7DA 5H70A 5K8UA 1X1SA 1DAMA 2QTVB 2V6IA 3LW8A 2B6HA 1R10A 3L0PA 1KK2A 1T0JB 1COWA 2YYZA 4LV8B 4Q66C 4TQUS 1QHHA 1YJ5A 1J7KA 3OHMA 4IVPA 2C98A 1P5ZB 3SYNA 2QSZA 2ZI9A 3M1IA 4KAXA 1W4AA 4NYJQ 4WOPA 2TMKA 1QBKC 3OAAD 2R2AA 3GEHA 3SQXA 3REGA 5EE5B 4Z8XA 2WWYA 2VSOA 2YWFA 4GNKA 2ATVA 4AURA 4LPSA 1TQ2A 2C5LA 1FQJA 4B71A 1T0HB 3KFXA 4KYUA 2R6AA 1NSTA 2RHDA 4YDHB 3SQWA 1BOFA 4XSGA 4N0DA 1FTNA 1RVDA 2BJWA 4MRRA 4M22A 4JKYA 4L15A 4LSGA 4PHGA 1KI7A 3IQWA 4TWZA 1E3MA 4LCBA 1EFRA 3SYKA 2Q3FA 4FWIB 1SKYE 4QNMA 4JLBA 1WBBA 1EFCA 5BYJA 3D6TB 4PZZA 1KDPA 5H8WA 1OH6A 3CRRA 2QMHA 2VA8A 4B48A 1AJEA 3HR8A 4H9GA 2WKRA 1IQPA 2CNWD 4O3MA 3M0EA 4K8OA 1NVUQ 3AF0A 5FPSA 3UKDA 4DLWA 1G41A 2D2EA 3HYTA 1GP2A 1G17A 1L4YA 4V0MA 3UMFA 4G5GA 1CEEA 1II8B 1TPZA 5CIQA 2F43A 1E6CA 4A92A 3BB4A 4X8MA 4M4SA 4UXIA 5AUPB 1ZW6A 4E07A 2O0JA 2QSYA 1A7JA 3EZ7A 1TAGA 2GK6A 4RFVA 1Z0FA 3IIJA 1Z3IX 5FPYA 3ADCA 2H5EA 2SHKA 4U00A 5LB2A 2JJ2D 3RABA 2NZ8A 1V43A 4Q5IA 4AG6A 2IYTA 2ZETA 1EG7A 1P61B 3W8NA 1J70A 1I4LD 1S1MA 2HLDA 1D9XA 2B7BA 2JA1A 1HYQA 1P2UA 4TYYA 5JECA 3ADBA 3GD7A 3TRFA 4Z54A 4EFNA 1NRJB 1ZRHA 1E2GA 5DI3A 2YNMA 1Z6AA 1E94E 4BFSA 2FSHA 5F3WB 4C0SA 2IEYA 1XU4A 2FEMA 5FPHA 1G8PA 4OI0A 1N6IA 4GPTA 4DLZA 3W6OA 3LXXA 4BEBA 1IOZA 2WJHA 2GCOA 5KPDA 1GFIA 1XX6A 3RRNA 3RWOA 3H4MA 3R8FA 2ZRDA 2C9YA 4B34A 3V9PA 3SBEA 2QBYB 1O3YA 3SHWA 3PIRA 4GDFA 3QBVA 4RY2A 2C04A 3LVQE 4Q9KA 5EUQB 3TUIC 3CX6A 2V6JA 3QXJA 4QC2A 2FE4A 5K8IA 1N6LA 1W0KA 4I1SA 1OFUX 2JLVA 3DL0A 5HCIA 1P6XA 3X2SA 1CR2A 1XDBA 2ZU0C 4HB3A 2C99A 3B8HA 2JIZD 1VCMA 2NPIA 1AK2A 4BLSA 1KYIA 2J45A 2BWJA 3TBKA 1SHZA 2P5TB 3EG5A 4Q03A 1TUIA 4DCUA 1ANKA 5JFGA 1WCV1 1BH2A 2HT6A 4P32A 3T1OA 4B3DA 5DI9A 1W36B 1L4UA 1MO3A 3KXIA 3TSOA 5BN3A 4MYUA 2ASEA 2IF2A 4I1UA 5CDFE 4FXPA 1P62B 2QM7A 3QF7A 2QORA 1PZNA 3TSWA 1GILA 2ODNA 3RC3A 1F2UA 2VIIA 2BKUA 3MAAC 4AC9A 2QTHA 2IXFA 4ARZB 1E2NA 2ZPTX 1QHXA 2Q3MA 1KSJA 3FKQA 4GOKA 1W48A 1ZC3A 5DN6D 4XD7D 3THOA 4B2IA 1GNRA 2QMOA 2N1BA 5IHPA 2GVZC 2IF0A 2ZRIA 4EKDA 1SVSA 2YVUA 3D7MA 5AR1A 1LNZA 2IXEA 5JS7A 3FFAA 4KBGA 2AWOA 1RPZA 4AY2A 3Q9LA 4OQLA 3VNVA 2V1UA 2O8DA 3T35A 4LC0A 2PLRA 5AJXA 2CLCX 5F9FA 2JCSA 1NMYA 3BS4A 2FGJA 4XWKA 4OL0A 3REFA 1L8QA 3IBGA 1HA3A 5TY0A 3GLHE 1N6PA 1GOTA 3I73A 4ZI3A 1DG1G 3QXXA 2EWWA 2HF9A 1J8MF 3LDAA 2JJ1A 4OK3A 5CK5A 2KSQA 3SYLA 3TVDA 2GBLA 3T1TA 4RVCA 3CM0A 2PMDA 2P5SA 1R2QA 1RJ9B 3AGQA 3MCAA 3OZXA 1VG9B 3GLFE 2CK3D 3SZRA 3I92A 2PJZA 2GNOA 4JS0A 5HPYB 1OHHD 4LJ8A 1F2TB 2ZI7A 5HE8A 4G1UC 2Z0MA 4PX9A 5JSZA 1DE0A 1KMHA 4ABYA 4JL5A 3K9LA 3T15A 1Z0JA 3UIEA 3UPUA 4BFXA 1KZ7B 3HPQA 1G4AE 1TQDA 2IYRA 4D26A 1EESA 4QL3A 1OF1A 3VQTA 1JPJA 3MWLA 2BHRA 2G1KA 1SGWA 2ZI5A 1D2EA 2RGNC 3WP1B 1AS2A 4WBSA 4HEJA 4JBXA 1CJKC 1FNMA 3CPJB 3ZS9A 3LAWA 1OT3A 4BRUA 2W83A 4H1VA 2R6GA 2FZLA 1BKDR 3PUWA 3R7WA 4C7OA 2ZRAA 4XTCS 4FMDF 2ZRLA 1UDXA 4RFSB 2RGNA 2W6ID 3QG5A 1E2KA 4FCWA 1BO6A 1QZXA 2NQ2C 4TL6A 1MABB 4HB2A 4TSFA 3VAAA 4HSEA 1TEVA 1AZTA 2ZQ5A 4PO8A 4JSTA 2ZJAA 1AGRA 1NVXQ 4KCGA 4BFWA 1VDZA 2NOAA 4JSYA 3B78A 3I32A 4TLBA 4JJZA 3WXMA 1LF5A 2YWEA 4LJ7A 3TW4A 2Q6TA 2QM8A 1D2MA 3QKTA 2ZS9A 4KHZA 4DT1B 1JAHA 2NO9A 5L8VA 4B76A 3NDBB 3OE7A 2BMEA 1SXJE 3QPUA 4GOXA 1E9DA 3KXKA 2FEOA 3PUZA 5FUVA 4BE7B 1NNEA 2OILA 5FOXA 5CITA 5EP1A 1QF9A 4UNNA 1NIPA 2VQSA 4BGDA 1UKZA 4UXJA 1KDTA 1U99A 3OEED 1P2TA 4V02A 5A4JA 1WA5A 5AK0A 4EQ6B 3W34A 2CCKA 2W6JD 1LS1A 1ODFA 3C7KA 1N25A 4Q9IA 4LUCA 4ZDWA 5FI0B 3B1ZA 2WWGA 1WMSA 5C18A 1ZBDA 3NDPA 4JLPA 2YWHA 2W2XA 1D5CA 2QT1A 3B60A 1GL6A 5DYIA 3RRZA 3IHLA 1PJRA 2GEDA 4PZYA 4Q7MB 2WJJA 1P60A 3A1SA 2N42A 1YR8A 2B21A 2VO1A 3QQ5A 3T61A 4Z51A 2GILA 1UPTA 4OJQA 4EFLA 2FFQA 2WJVA 1RC8A 5FBQB 3ECCA 2VL7A 1NVVQ 4TTRA 4NYMQ 1K8RA 2GJ8A 4HLCA 2ZRFA 2ZJ5A 2X19A 2CE2X 3KTAA 1CR0A 2JASA 3GFTA 2OCBA 3BFVA 5FTJA 1IXZA 1KI6A 4AK9A 1Z47A 4HZUB 2ZUBA 1OXTA 2WWXA 2HV8A 5DE3A 4ZO4A 2CNWA 4L9WA 5LD2C 4W5JA 4Q00A 2VSFA 1A5TA 1S3GA 2CLSA 3TVTA 4FMDB 2WWWA 4TT3D 5F9HA 5EZ5A 1QVAA 3LLMA 2D06A 2PX0A 2WZQA 2VEDA 5FUXA 1NKTA 1XTIA 2WWHA 1C4OA 4C0QC 1OFTA 1KMQA 3TQCA 2BEKA 4Q9JA 2ORWA 2ZRNA 1TNDA 3EA0A 4M1KA 3I5YA 1X8JA 3WYFA 2J9RA 1X8KA 4A4DA 2OXRA 1S9DA 1A2KC 1UKEA 4P4UA 1YZGA 4NPHA 3EIHA 3A8TA 3O8BA 3EWSA 2BM0A 3OIYA 3VU9B 4BWYA 2WM9B 1S96A 2F1HA 3I62A 4LPKA 1U94A 3QXCA 5TB5A 2LKDA 3DKPA 2OE2A 3EIQA 3O47A 5FR2A 4G5OA 3AQ4A 3V4FA 2C96A 2ZE6A 4MGKR 4NE2A 1OIVA 4OQNA 2WSMA 2AD1A 2OFWA 4LZZA 1X86B 3FPAA 4TMZA 3SR0A 1R0XA 3WYGA 1N6KA 4D25A 1FOEB 1HE8B 2V4ZA 2OAQ1 4AKEA 2GJ9A 4NL4H 1P9WA 1KO4A 1KI9A 1UBEA 2VTKA 2IYYA 4TLAA 4CEJB 3KKMA 2XNSA 1H8ED 1DOAA 1M74A 5AUNB 2YKGA 3CW2A 4Z1MD 4R2IA 4CZ2A 5SZHB 3MJRA 4Q4AB 3AKYA 5TMPA 4I1OA 1Z6TA 1R8SA 3SN6A 4NCJA 2N46A 2J7PD 2JIZA 4P33A 1ZM4A 4POAA 5FOUA 3HU2A 3I3SR 4LDJA 3UG6A 1E0AA 2O8EA 3C5HA 5E7MA 2WWFA 4NZYA 4M1TA 4O0MA 1IJFA 1W49A 4D6PA 5JZVA 3GP8A 2MSCB 4PHHA 1G3UA 3FHOA 4JKIA 2QEQA 1E2LA 1OV4A 2X1VA 4I81A 3WMFA 4UNPA 4RZ3A 4E03A 3B13B 4BZXA 1WBDA 3KFVA 5B64A 3C16C 3LQQA 1XD2B 4PPNA 1NBMD 4DLXA 4DB4A 1HT2E 3DOFA 5DN6A 4XD7A 3GLIB 3B9PA 3HYRA 4RKFA 4LYAA 421PA 4OYHA 2F9LA 1Q57A 2CMKA 4A8JB 3RHFA 3RNLA 3GJ5A 5HKKD 2FSIA 5BN5A 2OBLA 5EP2A 3RAPR 2WMNB 1DG3A 2IYSA 2D4HA 2R44A 4QGAA 4AKIA 1N0UA 2BVNA 1RKBA 2H16A 1WQ1R 4ZPXA 5KUTA 1XZPA 1NY6A 3CWQA 1G64A 5JI3E 2X77A 3RDPA 1US8B 3L43A 2ZRBA 1T5LA 1DELA 4PC1A 2G88A 1Z5ZA 1VG0B 3FMOB 3W5JA 4M1WA 3G0HA 2YJTD 5G53C 3AUXA 3IKJA 3FGNA 5K8LA 3NEYA 2DBYA 1Z2CA 1MO5A 2RGCA 1JI0A 3X1XA 2ZJYA 2PCLA 4JZKA 4YDSA 1R5OA 1R7RA 2A9KA 1EX6A 1H8HA 2QGZA 1T5IA 3LY5A 2BBTA 5KOYA 1E1QD 2W0MA 3H86A 1MT0A 3SE0A 1HUQA 4QBIA 3VR5A 1WDTA 1Q20A 4B74A 4D82A 3I4LA 1R8QA 4A2QA 2NMVA 4PTLA 4AKHA 1N2CE 1OE0A 2IK8A 4P4SB 1M34E 1AKYA 4W5WA 2ECKA 2P6RA 2ZJ8A 3TAUA 1DAHA 1IXRC 121PA 1M7GA 4EFMA 3EPJA 1GM5A 2O8FA 1OFHA 1M6NA 1Q12A 3HR7A 3FHCB 3ZIAD 1XMJA 1FMLA 1GG2A 1DS6A 3NBFA 1K5GA 2PL3A 3QUSA 5AUQA 2WAXA 1QHHB 2R6CA 4KI0A 1KSHA 5KTYA 2Q0HA 1YRAA 2XSZA 2V55B 2KBEA 1GL9B 1D8TA 2FGKA 4RKEA 1N3BA 5CJPA 2W58A 3WP0A 2WWIA 1QHYA 1AQYA 1ZD8A 2GAAA 3I1FA 2FMXA 5FTNA 4BLOA 1DO2A 4PPFA 3MFYA 4NYIQ 3GLGB 3NH6A 1GKYA 1G3RA 4LHXA 2XZOA 1GRRA 2O5VA 2JDID 4PAOA 4ZIRA 3KQHA 3C8UA 5LPNA 1PLLA 2PEZA 3VNUA 4TZ6A 2BMJA 3PCRB 1E2MA 2GXSA 5EXSA 3RANA 2AX4A 3UWKA 2A30A 3WNCA 2DFKB 4GL2A 3BERA 3RS5A 4LHVA 2GRJA 5CDFA 1NJGA 1IN5A 4D0LB 1IN4A 1ZCBA 2EVWX 2ZYTX 5FUYA 1U9IC 3AF1A 2VH5R 3C5CA 2BBOA 3VR1A 2F1JA 2QAGA 4EPVA 1ZD9A 2GKSA 4QRHA 5KHOC 4URXR 1Z06A 1E2FA 3OEEA 1P2SA 4XWAA 1SVMA 3Q7QA 5A0FA 4RD2A 4NCIA 1E2DA 1HURA 2A3RA 1LY1A 1W46A 2Z6VA 4TMTA 5GJCA 4GBMA 4BFTA 2NO1A 1ZNWA 4IEEA 5KSPA 3I61A 4PO9A 1ZP6A 4HZIA 3OEHD 2GXQA 3EZFA 1R0WA 4D4JA 5EZ6B 1OJLA 4IOJA 3JVVA 2VHQA 3QPWA 1JECA 1NSFA 2ZEJA 5JEDA 1JXOA 4MKGA 4XVQA 5JJKA 1U8AA 1B0UA 1RW4A 2ZE8A 4F93B 3CZQA 5EE3A 3SI7A 1YKSA 2HXSA 4WZBE 3VKWA 5JRJA 1SVIA 3DMDA 4RCYA 2KI5A 2P6NA 1YQTA 2XTNA 3AP2A 3CONA 1JPNA 4HAYA 4LYFA 3TNFA 1E4VA 2G9NA 2QPTA 2YZ2A 1XCMA 2W2TA 2ZI4A 4DDVA 2GZHA 3RSOA 721PA 1AA9A 4KODA 1G16A 2CHVA 4LBVA 1FZQA 3EWAA 3T06B 2GCOB 1VTKA 4JLNA 2C8VA 2GJKA 3HU3A 2YINC 1TQ4A 3VKGA 1XJQA 2NPFA 3X1WA 1TL7C 2G77B 4AG5A 4DRZA 4PAMA 3CRMA 2EFDB 3PEYA 1T3LA 3RLFA 2FPKA 1GIAA 1UDWA 1OLOA 1Z2AA 1RZ3A 3CKLA 3FB4A 3GJ7A 4TT3A 4US1R 4A6PA 5L3SA 1SVOA 1KJWA 3QVVA 5H68A 1KZGB 3THXB 1J2JA 4HYYA 2CHQA 2ODWA 1YZQA 3DPUA 3QKUA 2ZRJA 2ZS7A 4IOMA 5D3MA 2QP3A 1KDOA 2IT1A 3MWKA 3KKNA 3LLUA 2AD5A 3K0CC 1KI8A 5GJBA 3I8SA 3KUDA 1JBKA 3WHLA 3CWZA 1XXHB 3PJRA 1G7TA 1BIFA 1KJYA 2EFCB 1OKKA 2F3TA 3ADDA 1SXJC 3ZGXA 1NL3A 1RRFA 4OQXA 4KJZA 4EPWA 2GA8A 2RGXA 1DAKA 1D9ZA 1YRBA 2AHOA 4RD4A 1F2UB 5KNBA 2DYKA 5GJWC 4Q1FA 4IVQA 3SFZA 2REXB 3K0CA 5JCZA 1M7HA 1QHSA 1YVDA 2CE7A 4RD1A 1G8YA 2FNAA 3T5DA 4DLVA 5KSOA 4D80A 1WB9A 1NJFA 3ZDQA 4NP6A 3A6PC 3VR6A 1JAIA 2BIFA 1E2HA 3W3ZB 4URVR 3S1AA 4PQRA 3SU8A 1OSNA 5B57C 1YU9A 3WMEA 4PHTA 4C3ZA 1SZPA 3K0SA 1E96A 2GHIA 2EW1A 1L7VC 3WBJA 4KBFA 3AVPA 1P72A 2HXYA 1KY2A 2CEAA 5F2EA 3ZQ6A 3LXRA 1G5RA 4EPTA 4I99A 1JR6A 2D74A 3OESA 4M9SA 1GKUB 2QRNA 1J99A 3LRPA 3KQKA 3QKRA 4IFBA 4IDNA 2J7PA 3U6KA 1AKEA 1TX4B 4B3FX 1Z8FA 5FR1A 2X2EA 2XB4A 2BMDA 1VHLA 2J3EA 3B7GA 1KO7A 1P7CA 1Q1EA 1TF7A 1UBGA 3AV0B 1LW7A 4ZKEA 1UAAA 1KO8A 2BBSA 1VIYA 2CLDX 2GWHA 1W36D 3EZ2A 4E09A 4DCVA 1NMXA 5JSZB 1KI3A 1KMHB 3B1YA 1XEFA 4IFEA 4QHSA 3U44A 1ELOA 3NBYC 4CRWB 4M9QA 2V3CC 2XZLA 2JJ8A 4E22A 4ZDJA 5JLJA 1NBMA 5CYPA 4O2LA 4CF7A 5TXGA 1PLKA 3WBKA 2FFBA 4ASUD 4DDUA 1Q21A 4MA4A 1J90A 2WBLC 3QKSB 3VX3A 3KDSE 4IHQA 2J46A 2J0SA 1OFIA 3CX8A 5HKKA 3JVUA 2QI9C 5CLLA 3AP3A 1FPMA 4KLZA 5G41A 5IK2A 3CZPA 4OQFA 4CEHA 1X6VA 2QNRA 5FBVB 2IS4A 1RIFA 3GEEA 3SEAA 4PPQA 1AIPA 2R65A 2CDNA 4IW3B 1P2VA 3EC2A 1T8TA 4F91B 5AJYA 4V0KA 2X8AA 1PV4A 1XCPA 3W6NA 4OHZA 1Z07A 1LFDB 5CLQA 4GSYA 5G3YA 1R5NA 1XEWX 3LA6A 3QNUA 2JLUA 3MG9A 3THYA 4AYTA 2PX3A 1UFQA 2EFEB 4TN1A 2RHMA 4DLSA 1XMSA 2ZSAA 3EASA 4KLNA 1VHTA 4B73A 5EE1A 1NG9A 3IQXA 3E2IA 4DEYA 3LWNA 3L8YA 2GCPA 4TMXA 3A1UA 2ZRGA 3JZMA 5KSYA 3ZIAA 3J81k 2AKAB 1MR3F 4TMVA 1E99A 1Z63A 3U61B 1H65A 4I1VA 4IKEA 2OLJA 1X8LA 5BQ5A 4FCTA 5E7JA 1XPOA 1JB1A 1G7SA 5GJVC 4CIDA 3IIKA 4Q7JB 4PSAA 1E9SA 4DUGD 2WOOA 1CS4C 3A1VA 2BCJQ 3UK6A 1N5LA 3CNNA 3LX5A 3FHTA 2W0SA 3A4NA 2PZFA 3AF2A 4QXAA 2V7QD 1IY2A 2JDIA 4A2PA 4RZUA 1TMKA 1TUEA 5JWRA 1HV8A 3KZ1E 4Q19A 3UANA 5C4MA 2HYDA 3I8XA 4UKDA 4EJSB 2ZYVX 2O52A 1T3HA 1IXSB 1PLJA 2A7QA 1ZNZA 3NTUA 1X3SA 1KI6B 1W0JD 2RAPA 2FV8A 4WAUA 3U4QA 3W90A 4XSHA 3BD9A 4Y0VA 2J41A 5TDHA 3X1ZA 1MO4A 3KJEA 3KUCA 5IF9A 4WVFA 3BH7A 5J4VA 3W8RA 4DLRA 1GNPA 2E9SA 1VIAA 2GBLC 4ZI2A 4LK2A 1T3SA 2FDCA 1CP2A 2CJWA 3AGPA 2J0UB 2PT7A 3SJAA 2GCNA 5DYGA 4F4JA 4XVUA 1OB5A 2QENA 4M1YA 1CJTC 4PXAA 2ZSFA 4V0NA 5LD2B 2ZRHA 1CR1A 4NDZA 4OI1A 1KIMA 2G3YA 3U3OA 3K70B 2ZXUA 3W5IA 2ATXA 4HDCA 1XEXB 2JLZA 3FVQA 3B85A 3PUYA 1JALA 2AN9A 3FTQA 3K0FB 1YR9A 1R5BA 1W5SA 2KJQA 4JIMA 4M1OA 3VMFA 2O0HA 3PUVA 3RS2A 2G1JA 221PA 2FSGA 2H17A 4ACAA 3QSYA 4LX0A 3E5HA 3MRSA 1GNQA 2OZEA 4ON9A 2E87A 5C2JB 1W2HA 3L2OB 2VYFA 4LHZA 1K6MA 1YZUA 4QGGA 2FJUA 1Q1ZA 4BLQA 3DO6A 4M1SA 3TR5A 1MRNA 1SULA 1ZM2A 1FP6A 3HDTA 3QE0A 3I72A 4OI4A 3SJCA 3GFPA 4Q4HB 3EPHA 3V00A 4I4LA 4D4KA 1XEWY 2XITA 3CIOA 1Q44A 3Q72A 1W5TA 4NH0A 4UJ5A 3K0EA 4MDEA 2IUTA 1CJVC 1N5KA 2ZRCA 3AF3A 3DKVA 4TLCA 3UG7A 4RD3A 3Q8XB 3TAHA 2HDNB 1LF0A 5HZKA 5JRZA 1II8A 3SNHA 3KQUA 3BBPA 4WXRA 4IJMA 4KFRA 2GJAA 3NG1A 2IL1A 2IBMA 3M6AA 4C2TA 4JBYA 2REOA 2OG2A 1VYUA 2PEYA 2C77A 3RRYA 4KU4A 1C9KA 1EFUA 3LNCA 3PV0A 4UXHA 1TEXA 4OHYA 1EWRA 1EGAA 3TK1A 1AGPA 2VLIA 2BV3A 2J1LA 4ZCMA 4URZR 1W7AA 1KTVA 1R4AA 4K81B 1WXQA 2GK7A 1SKYB 4D4LA 4H1UA 3QI2A 2JLQA 5CIWA 1VECA 4GFDA 4IOLA 1KOFA 2ZITA 4KV9A 1A2BA 2BKEA 3TUJC 3ZD7A 1YR6A 2OLKA 3B5JA 1J8YF 4TQ9A 1ZD1A 3EZ6A 3VR3A 4JLDA 2PZEA 4M8NE 1KI4A 2NG1A 2HJGA 1VCNA 2DFLA 2ZU6A 4C2UA 1F6BA 3UATA 4DDWA 4AIIA 3DM9B 2J87A 4YMWA 4TYWA 2OEPA 2LWIA 3OAAA 3W3AA 2VP4A 2QBYA 2PMKA 2GETA 2IC5A 1GUAA 4DEXA 2QP4A 2RMKA 3U7GA 3AVOA 1G20E 5CB6A 4P4TA 4GP7A 5C46F 2XOKD 2DFTA 2XXAB 1SHKA 3MWJA 1XJ0A 4CEIB 1ESMA 4F7WA 5L3RA 5JEEA 3BOSA 3X1DA 1XTKA 4GZMA 2XZPA 5HCNA 2K5UA 5DHAA 2YHSA 4BQSA 3EA5A 4R7ZA 6Q21A 1Q0UA 2BDTA 3THWA 1NBME 1AS0A 2P3SA 1WE2A 1KO5A 1MH1A 2WJIA 3ZLJA 2F55A 3NIBA 3Q7PA 4R71A 1VKJA 2CCJA 3PENA 1SVKA 2F7SA 2WPDD 3DZDA 3A58B 4JYBA 2VP9A 1ZM3A 1TF2A 5EP4A 5KDDA 3BK7A 4IVRA 1Z08A 2A2ZA 4M9ZA 3U7EB 4MGIR 1OYWA 1R0ZA 3F8TA 4S35A 4GMDA 2XTZA 2IYVA 1CR4A 1XTJA 2GAOA 1NG1A 4BUJA 4MDFA 3SJZA 2QMUA 4Q4JB 3U3MA 1Z0IA 3IDQA 621PA 1Q1BA 1S1CA 2JJ2A 3KJGA 1D2NA 1DPFA 2QY9A 3M4YA 3LD9A 3MMPA 5HTKA 5FOWA 1UF9A 4UJ3A 1HQCA 1OYYA 3CNOA 4AYWA 4PPGA 2ZE7A 3TLXA 4DIEA 4AWXA 1W1WA 4AYXA 4D4MA 3D8BA 1Q3TA 3IHWA 4DZZA 3LV8A 1N6NA 2HYIC 4CT5A 2JLYA 1CKEA 3ND8A 4HAZA 1SVLA 3U7FB 1P75A 3L82B 3KKQA 4QNRA 1GAJA 3VKHA 1GZSA 1XFAA 4GI7A 3TR0A 3BC1A 1BMFD 4TTPA 1RJ9A 4TLEA 4KYIB 4X8HA 4A2WA 1S4QA 4WXPA 3N2IA 1NVWQ 2JEOA 1XNJA 4HAWA 3T1QA 4TZ0A 3GCGA 1F2TA 2EFGA 4D81A 1HE1C 3OFND 4IOKA 4DKXA 4LC1A 2JLXA 4XJXA 3GJ3A 4V03A 3VX4A 5BN4A 1GDDA 2G0NA 3TQFA 4JVNA 1G21E 3RS0A 2C9OA 1OIWA 2NZJA 1COWD 4ESVA 2C03A 3CF2A 5KO2A 3ICQB 4DUGA 4HAVA 1KSFX 5FUWA 5CM9C 2GZAA 2CCGA 1MV5A 3TIFA 1N6OA 1OH8A 2ZUDA 4MRSA 4RJLA 2AR7A 3GLHB 5TARA 2V7QA 3AKDA 4Q1EA 5E7IA 5BWMA 1GITA 4N1AA 4IDPA 3NVAA 4QJ3A 4LI0A 4BFZA 2RGAA 1KDRA 2FU5C 3ZS8A 1UJ2A 2BM1A 3QOFA 3T1VA 1E2IA 1MABA 2HEIA 4BZQA 3ZVLA 2ONKA 1CU1A 4B3CA 3B6EA 4JL6A 3GLFB 2VBCA 4JLKA 4UQOA 3CR8A 3FOZA 4LJAA 3GQBA 3LBIA 4LBYA 3LX8A 5J4YA 4AI6A 4DT1A 2IHBA 5GVSA 2H8KA 4P3YA 3UXMA 5G40A 3ZYCA 1CJUC 1DADA 3FYHA 2G6BA 2X2FA 3C15C 1G7CA 4F4IA 1OXXK 3B1XA 4FMBB 2RGBA 4GT1A 3AUYA 3KB2A 4K46A 3WMGA 4BPBA 1S2MA 2ZSDA 4DSTA 3AVTA 1YZTA 5BXQC 2QG6A 4EQ6A 5D3MB 5AWFC 2BC9A 4HUQB 4BLPA 1R0YA 3FFBA 5IT5A 3Q85A 3SOPA 3LH5A 4CDGA 3VR4A 4GRAA 2Y8EA 3WNBA 3GJ4A 2XGJA 1RRGA 4HDOB 2QQEA 4HUTA 1DAGA 4DLUA 4MRVA 2WICA 4PHFA 5FL3A 3U3KA 3BB1A 2CK3A 4XOIA 2HLDD 1OHHA 2NO7A 3L0IB 1EFTA 3K0AB 3IEUA 4URYR 1HEIA 4IDHA 3OIWA 2AXPA 1ZNYA 2YV5A 2ZRMA 4MRNA 2MSDB 2WMOB 2DR3A 3FMPB 3P32A 2QP9X 5B2ZA 2A5JA 1SXJB 3QF4A 1XZQA 2J7KA 3TGPA 4FMCF 1KK0A 1MOZA 4EDHA 1DBSA 1IJEA 1EFHA 2NTYC 3S1AB 2H92A 3UWOA 5FTLA 3AVUA 4W9MC 3TMKA 4HZUA 1MKYA 1TU4A 2F1RA 2IYUA 3WRYC 3BFXA 1KY3A 5J47A 1W2GA 1XF9A 1E2PA 2WIAA 2WTUA 4G5QA 1A4RA 2ZAOA 3KQLA 4LGMA 2ZRPA 4CW7A 4HB0A 4IXMA 2IUSA 2W6IA 2XX3A 1U81A 3QKRB 3SJBA 1KJZA 5JWOA 2QAGC 1FNNA 1HTWA 1ZYUA 2Z4RA 2A5GA 5AJZA 2V8OA 2ZJ2A 4B43A 3IILA 2QA5A 4WZ6A 4DJTA 4IDQA 1NLYA 4OHVA 5KSZA 1AS3A 3HU1A 3R9XA 1ZU5A 2FPLA 1JR3D 2WJYA 3AVWA 4OHXA 5CJ2A 4FINA 5L3QA 1QHIA 5DHFA 4DHEA 1UEIA 3NEJA 5KPJA 1RRPA 1I4DD 4AKGA 4BRWA 2I1VB 2Z5FA 5G3ZA 1FP7A 1F5NA 4QM6A 2W6JA 2Q9AA 2F43B 4ERNA 3I5XA 4KVGA 4TYPA 4F92B 3KJHA 1OXVA 5K8TA 4YLGA 1M7BA 2YOHA 1N5JA 5KU1A 3B82A 4GP6A 3AKEA 2GVDC 1QG2A 4CEHB 2Z4SA 4B3XA 1DARA 1BYUA 3CUEF 3IO5A 1X1RA 1AM4D 5C4GB 2XOKA 4Q4AA 2VP0A 4U02A 3A36A 3R9WA 3P4XA 5DI3B 4ILEA 4Z8YA 1GWNA 2P65A 4G5SA 3T5GA 2VHCA 4FMCB 4YQFA 2QUZA 3LBHA 1N0VC 5TVKA 2GEUA 2I3BA 1NN1A 3K09C 2ZJBA 2PJRA 1KK3A 5KNCA 3H2YA 1KO1A 2XB2A 2PBRA 3EPLA 3KL4A 3PUXA 2AWNA 2WPDA 5F98A 4BEJA 2KE5A 4Q7LA 2ORVA 3DM5A 2O8CA 4ESHA 4MQBA 4A8JC 3ZD6A 2J0VA 2AFHE 4DCTA 3FKSD 2A78A 1G9XA 1E9EA 1U98A 3K09A 3MWYW 1FX0A 3NHBA 1VG1A 2FPMA 1E4YA 5E95A 1S9HA 1M1YE 1XD2A 3FMIA 4KFUA 2OT3B 3O8CA 2A5YB 2OXCA 5FBRB 4RD0A 4TMKA 5CK4A 1VPLA 3GLIA 5DH9A 3D3QA 4QKQA 1A1VA 4B6EA 4D0GA 2A5DA 3CNLA 1JQJC 3CRVA 1T91A 5J5CA 1G4UR 4WZAE 4A8JA 1ZCAA 4PQFA 1JXMA 1TQ6A 3AVYA 1UM8A 4TMWA 4LJ4A 4LJ5A 3U60B 1P9RA 1Z22A 3CRW1 3TW8B 3R9IA 3GJXC 5C1BA 1KAGA 3Q5DA 4C0LA 1US8A 1FFHA 1E2EA 4U7DA 1LB1B 4HDQB 4TL7A 4RD6A 4Q9LA 4A0FA 3W6PA 2RH5A 4QGHA 1Q22A 2CVFA 4JLMA 3U3RA 3HWSA 3BGWA 4JJKA 4S2EA 3PFIA 4PR0A 1BMFA 3BJIC 1PVOA 4GMXA 2F3RA 2NIPA 3OE7D 4TLDA 1E2QA 2B92A 1XD9A 4BECA 2IYXA 5E4FA 1H8EA 4JLAA 4LHWA 2O8DB 1JNYA 4Z1MA 3RS3A 2AK3A 4P4SA 1NN5A 3CH4B 5CB8A 2WHXA 4MGZR 1TTTA 1XBTA 2FOLA 4ZKDA 2J0QA 4YC7A 1E9AA 2QPOA 3FDIA 3L0OA 2GZDA 3CF0A 2ZAMA 2VPPA 5FBLB 1Z29A 4MKHA 3VR2A 4F4CA 3NWJA 1JQLB 1T9HA 3L8ZA 5DIFA 4NYJR 4B75A 2WSSD 4TYQA 2DHRA 2YWGA 2P0EA 2O8BA 2WKPA 3NXSA 4JMPA 3TKLA 4HAUA 3BH0A 4DDTA 3B1VA 1QRAA 3QG1A 4WA7A 3GLGA 3EZ9A 1GRQA 2O0KA 2B8TA 3KKPA 5ANRB 2FFAA 2FSFA 3G5UA 3P1JA 4TL8A 1ZJ6A 3BXZA 2IHYA 4F38A 2LKCA 3N70A 4B2PA 3IIMA 4MYCA 2AXNA 2GXUA 5FBWB 1UKYA 1KKLA 5JS8A 2RB4A 1JEEA 3LFUA 4MUAA 2QGNA 3B2EA 4W7SA 3U5ZB 1XRJA 3P27A 4JL8A 1U0LA 5DISB 1XPUA 2FF7A 2P6UA 3R7WB 5A5GA 4QGFA 2ZR0A 4B3BA 4C7OB 4RSGA 2UVQA 2ODEA 3K1JA 1QHGA 4KO8A 2KWIA 4PSVA 5IRCD 3RC8A 1G19A 2QE7D 3ZQJA 5B58C 4W5HA 4B33A 1XPRA 2IW3A 3VTKA 1YE8A 4PQYA 2OM2A 5B30A 4LHYA 1AQUA 3F0TA 5LBIA 3PEVA 3RS4A 2NO0A 3K70D 1UKVY 1XTQA 1K5DA 2EYQA 4N3NA 1E1QA 1RRCA 2XAUA 5FTMA 5L3VA 1G8HA 4B47A 1V5WA 2GF0A 4EPXA 2JGNA 3AEZA 4YMTA 2GXAA 3BB3A 4V0OA 4PC6A 3D31A 1E1RD 2OFXA 2AFIE 2C2HA 2DWPA 4OHWA 1NLZA 3QBTA 2ZSBA 4C0JA 3QENA 4G01B 2R62A 4L16A 4MKIA 1KKMA 1G5PA 2W00A 1ZVQA 3IBYA 5HE9A 2I4IA 4B2LA 4Y0AA 5AUOB 5HR5A 1ZC4A 4TYNA 1O87A 1W4BA 4LY6A 1G3QA 1EXMA 2VP5A 5DNYB 1DEKA 1VYVA 2ZJZA 3GJ6A 4Q1AA 4X8LA 2ONJA 1NN0A 1QVRA 1ZU4A 4C0AC 1IAQA 2HUPA 4NCHA 4OJKA 4QFMA 3WYAA 4HI0E 3DZ8A 1WP9A 4U5XA 4A0GA 1IY0A 1G3MA 5J4LA 4MGYR 2HCJB 1U8YA 2VF7A 1E9FA 3BFKA 3P20A 4IDOA 4HLUC 3THXA 1E32A 4PC3A 3U7HB 4Q02A 3SC3A 2XTMA 1VCIA 1CLUA 2WVJA 1YZKA 3KTAB 3ZZTA 3THWB 4FD2A 5M04A 1KI2A 3C41J 3VHLB 3B9QA 1JR3A 1DO0A 1XXHA 2OCPA 4Q21A 4HLUA 3PEUA 4DWJA 2VHUA 3PXGA 2AK2A 2G83A 4GZLA 4FCVA 4YMUA 2JLSA 3Q3JB 2MMCA 5AJVB 3WRXC 1E9CA 4MITA 4DCSA 5J4KA 2P2LA 2YC4C 3QY0A 4E5UA 3MSXA 1VCOA 1T4GA 2BJVA 3U3JA 5JCPA 5AJWA 4YMVA 2NO6A 2HCBA 3OEHA 3AB3A 4YONB 5J4HA 2ORIA 2OESA 4PZLA 5DGXA 3KKOA 4IRUB 3WNDA 3A37A 1OIXA 2QQ0A 2QL6A 2BEJA 4RCZA 2DB3A 3WY9A 3EIEA 1XTRA 1XMVA 1P4SA 3SDZA 2D7CA 4G0NA 4O25A 2IS6A 1U0JA 5FOTA 3BWDD 4EPRA 4M53A 5CM8B 2H1LA 1XMIA 2ZYUX 2XEXA 1XTSA 3ZJYA 1NKSA 4LV6A 3ZVRA 3GJ0A 2GESA 3HJNA 1KI1A 2IEZA 2ANCA 4LBWA 4XWOA 3QEJA 4PSKA 1CJMA 1S8FA 2QROA 5BW8A 2ZTSA 5FI1B 2YC2C 2H7VA 4BLTA 2R9VA 5LDDC 3N2EA 1LV7A 2JLRA 4XH9B 4A82A 3A4LA 1KK1A 1H8HD 4C0KA 3DHWC 2UZ3A 2C78A 4ZDIA 4XTRA 1NY5A 3HPRA 4KXFB 1QG4A 1XB2A 2DY1A 3PVSA 4D0NA 3U6BA 3GLIE 1NF3A 2V54A 4IXNA 3SBDA 4ZV4A 1U8ZA 1NP6A 3FKSA 2WAYA 2PH1A 4TTQA 2IA5A 3GFOA 1T6NA 4P0TA 5JJIA 2OUKA 3H0KA 3QEOA 3O8RA 1GSIA 5BYKA 1ZINA 1IM2A 1G18A 1ZUNB 1Q1QA 3QKSA 2O8EB 1T8UA 1SVWA 5FL7D 3PITA 1E98A 2REBA 2XSZD 4IEIA 4FWTA 5GADl 4JVMA 1I2MA 4OI2A 4PANA 1MRSA 5FOVA 2DCUA 1UADA 3GPLA 4HLQB 3AM1A 1A82A 1IN8A 2ERYA 4DLTA 2FFHA 5JI2E 3RS7A 1NI3A 2P67A 3IGFA 2ZS8A 1CXZA 1S3SA 2OFOA 1OXSC 1P9NA 1FQKA 2MSEB 3PQCA 5DO9A 4J0QA 1LTQA 1C1YA 1KNQA 1FUKA 2OSBA 4DB2A 4WIAA 1ESNA 3DOEA 4NCNA 5J40A 5KYKA 4DIDA 1QDEA 1E9RA 4II7A 2IX3A 3W9YA 2CL0X 4N0EA 4URUR 2VRWA 2ZR9A 1DAEA 2BMFA 3AVXA 2OAP1 3GJ8A 2WJGA 5SZKB 1YR7A 1GTVA 4UNSA 4MRPA 3CPEA 3Q5EA 3TH5A 2EWVA 4CVNA 3KX2A 2CXXA 2IYLD 1TU3A 2D3WA 1KGDA 4A36A 5GVRA 1FUUA 2ZROA 5JWHA 2QRZA 2EFHB 2FZ4A 1W36C 5FTKA 2YOFA 4LJYA 4R2HA 3WHKA 3GLGE 1Z0KA 3ETLA 4BFYA 1OH7A 1NN3A 3CR7A 2CHGA 2WSSA 1GKIA 2ZSEA 4R9UC 3OF5A 4EJSC 4MYTA 3QVUA 1F60A 3CH5A 3DVLA 4MH0R 2HT1A 4TL9A 1EK0A 3AVVA 5JHGB 2XNDD 3MGCA 2D2FA 5KDOA 1DAIA 2JAQA 1U2RA 1XD8A 5ELXA 2GF9A 4OQMA 1D6JA 1VG8A 4EPYA 4RZXA 1XWIA 4A6XA 3IEVA 3UMRA 3HP1A 2O8FB 3C4JA 4B35A 2XJ9A 3RWMB 1NVVR 4Q1DA 4NYMR 3RVBA 3QF4B 2DWQA 4FW9A 4FI3C 5EE0A 4EJSA 4GOJA 2A5FA 1II0A 2QN6A 3K53A 4NCKA 4ASUA 4JVSB 4ARZA 4V0ME 1Z6YA 3GMTA 4MYHA 2ZI6A 2BCGY 2KBFA 4HATA 3UMSA 2FA9A 1AN0A 3PR1A 4AD8A 1IN7A 3QXSA 1WRBA 2J59A 2NGRA 4M1MA 8OHMA 3K70C 1JJVA 3ZZUA 2ZJOA 4OK6A 3RYTC 2ERXA 3A1WA 1ZIOA 2H57A 4HAXA 2DFNA 1E79D 4FN5A 4DVGA 4ZIRB 1G7RA 2QE7A 3EC1A 4B6FA 2OO7A 2RGDA 3RSLA 4CT4B 4DCNA 2J0UA 2CVHA 1RYFA 1E9BA 3K9NA 1Z6GA 4Q1BA 4RZ2A 3F3YA 3FMFA 1IONA 3EXAA 5JJLA 5EXXA 4Q01A 1Y63A 4JT4A 5HZHA 2QTFA 1E69A 2CL6X 4LWZA 1QHNA 2PCJA 2HF8A 2LCFA 1OKKD 4NHOA 1XEXA 1RE0A 1Z83A 1U0HC 1Z6XA 2QAGB 3K8YA 3TSZA 2AL7A 5L3QB 3K0FA 4PC2A 3AF4A 3NBXX 4A9AA 4JLVA 2UKDA 1E1RA 4NMMA 4Q9HA 1KSGA 4DLYA 3A1TA 2Q21A 2AKYA 1ZM7A 2OBNA 4PFSA 3DMNA 1UBFA 4US2R 4YXWD 3KQNA 2QT0A 1SXJD 1W47A 3KJIA 4NTZA 1OXUA 3CO5A 3TJZA 4LV5B 1CRPA 1KNXA 4NKRA 4Q48A 4XIGS 4Q4HA 2OV2A 4FIDA 3C14C 2ZVPX 4A15A 4O2RA 4HB4A 1LVGA 1BS1A 1IHUA 2DPXA 2YOGA 2R6DA 4M9XA 4QM7A 5UKDA 4L5BA 4OBEA 2C9CA 1JR3E 1XXHE 1TADA 3ADKA 4C0HA 4M0LA 3BE4A 1RYHA 2RGGA 1G8FA 4RFSA 5CYOA 4EIWA 1Z0DA 2Z83A 5KNDA 2J5XA 2C95A 4LJ6A 1EX7A 4US0R 2ZREA 3BORA 1EFRD 2Q9BA 4JBWA 3T34A 1W0JA 3PG5A 4BFVA 5FPKA 3KB1A 1OB2A 3K9HA 2Q3HA 3DDCA 1G6HA 1E0JA 4DSOA 1NMZA 4BZPA 4PC7A 4LRWA 4PO1A 4C4PA 1OH5A 2O8CB 1VMAA 4L8GA 4ITRC 5LB4A 5L3SB 2IS2A 4Q7KA 1DVRA 4QG7A 4QBGB 3N5CA 4KITB 4JYCA 1XJCA 1DTSA 1Z28A 3K9GA 1EWQA 1FX0B 3SHFA 2IXGA 2B7CA 3AKCA 3R8CA 1M8PA 1E2JA 3GEIA 2IYWA 5EJEA 1ETUA 3CPHA 3CRQA 4NBSA 3ZH9B 2DWOA 2KB0A 2F6RA 1E0SA 1ZM9A 2VF8A 1GRNA 1PUIA 2BOVA 1JEDA 3G82C 1XP8A 2F1IA 4PAQA 2G0TA 2BBWA 4Q18A 5FFMA 1B23P 3NC1C 3MUFA 5EUMA 1YZLA 2EU8A 2ZRKA 2PLFA 1N0WA 5IK2D 3B1WA 4YMSA 4C30A 2XJ4A 4UNRA 3EW9A 3P4YA 2PT5A 5DLQC 2JLWA 2ZYWX 3BRWD 4LYJA 1LS6A 3ZVMA 4C0BA 2XXAA 1WF3A 1FMJA 1FW6A 2H18A 3R20A 4CEIA 4ZDKA 4ZCLA 1CULC 4A0HA 4JT2A 3NKVA 4A1FA 3EAQA 4CYMA 4QJ5A 4CGZA 1NLFA 1G5TA 5FPTA 4G3XA 3CB4A 1G8GA 2R6FA 1VYTA 2QU8A 1ZUIA 2FX3A 2IYZA 5EE9A 3KXLA 5TV2A 1DAFA 2OHFA 1RFLA 2QMEA 1F3OA 2OCAA 3CX7A 4BLRA 1Q3HA 1IBRA 2CBZA 2GEVA 2L0XA 1W0KD 2GTPA 3OIUA 2GJSA 1HQYE 3QPVA 4D2IA 4DSNA 1KHTA 2WIBA 3ASYA 1TF5A 1U90A 5FL7A 3H84A 1P3JA 1GL7A 3FWYA 5P21A 4LOAA 2IUUA 4XVRA 2O8BB 1IY1A 1P73A 4Q4JA 1CF4A 2V1XA 2GDJA 4NYIR 1ZAKA 2RCNA 1XCGB 1PUJA 4QOSA 2HJVA 4MUBA 1BYIA 2MMGA 3OIVA 5H1YA 1CTQA 1G291 1W44A 3VU9A 1L2TA 3U2QA 2F9MA 2FWRA 3U44B 1OW3B 3CBQA 3IO3A 4KVAA 3ICEA 1Y3AA 2OCYC 4KFSA 3LW7A 1CIPA 2QAJA 3F5FA 1Z0AA 1HT1E 2RKOA 4L9SA 2EQBA 3SS8A 4EAQA 3SFVA 4QBHA 3LBNA 4QBFA 2ZANA 1G1MA 2QZ4A 1CBUA 2ANBA 5JHHB 3RRMA 3DEFA 3MD0A 821PA 1FL9A 2IYQA 3FE2A 3V4RA 4URWR 3NBZC 4HLDA 4CEJA 1R6BX 3ND9A 1MO6A 1YHNA 4KFTA 4LJ9A 4JLOA 4M21A 1W4RA 4TQAA 3NHAA 3TUZC 3PEWA 4DSUA 3NC0C 2ZIAA 2VP2A 3ZVNA 5EXPA 2WKQA 4R98A 4L4UA 2D62A 1UEJA 3LO5A 1HH4A 1IN6A 3IPXA 4DBLC 1U9IA 2EYUA 3L0SA 3BAFA 1SQ5A 3THYB 4QHYA 4X8OA 5DSZA 4JLJA 3JZAA 2IWHA 2JJ1D 2IS1A 1KAOA 2FH5B 2ZUCA 1JJ7A 2XNDA 5EQTA 3BIFA 3QJYA 5E3HA 4UNQA 2R8RA 5FH9A 2ZE5A 3T12A 3MLEA 1YZNA 2ZVQX 2JATA 1N6RA 3GLHA 3O8DA 4NONA 5SZJA 1N6HA 3CF6R 4JVLA 2RGEA 3AH8A 2Z43A 4B44A 1I4TD 3IUYA 2B8WA 2ODBA 2VHTA 3QIAA 2V9PA 1UBCA 4OK5A 3GLFA 3QXHA 2W2VA 5SZIA 4P31A 4NU0A 2QPAA 3IPYA 4QHTA 3VHXA 4QJ4A 2CL7X 3NH9A 5IDVA 2PZGA 3A4MA 3VFDA 4B3GA 4ZCIA 1ZNXA 3LVRE 3ONWA 2IWRA 1ONBA 4Q4LA 1AZSC 4DC9A 2ZM5A 5D3QA 3TE6A 1E79A 1NIJA 4A0RA 1M2OB 2ZI3A 4KSBA 4ACBA 4LBZA 3EX7C 3AP1A 2VP6A 1I2DA 3AVQA 4C9BA 3MJHA 1ZIPA 4Q47A 3X1YA 1GVNB 2E1RA 4TSFD 3ZZ0A 3LQRA 3CLVA 4DXAA 1SKQA 4HUQA 4G5RA 1ZMXA 5EXTA 3EPKA 5KDLA 2I1QA 4OKSA 1N5IA 1II9A 2VHJA 2WV9A 5JMTA 1S0UA 4B32A 2WOJA 3BH6A 4EUNA 3U4QB 2ZR7A 1F48A 2FN4A 4MKFA 4KSCA 4V0LA 2UZIR 3EARA 4BASA 4Q1CA 1G6OA 3E70C 1W4CA 3E1SA 2Q9CA
chains in the Genus database with same CATH superfamily
3OCWA 5AMXA 2FEXA 4KL8S 3E05A 5E9QA 3U7RA 1OPXA 1VL1A 2WQZA 1HWYA 2XCQA 3IUSA 3P9KA 1HY3A 4INZA 4WCFB 2LXNA 3CFYA 1FTSA 2RARA 3I09A 3OFSA 3R3HA 3OFNA 5DASA 1SCJA 4GOMD 4N0QA 4EF5A 1CQXA 2I7XA 3ASZA 1RZUA 4MVJI 4UHHA 521PA 1XEAA 2ZDHA 1YTLA 4YXWA 3HXTA 1DAMA 2IYNA 2QYSA 4MCJA 4IX9A 4Y18A 4ZVLA 1JMYA 1COWA 4WNAB 4LTMA 3SMQA 5I3ZA 2WF8A 1QHHA 5K3CA 1YJ5A 1M2HA 4NK4A 4P53A 3R5FA 4IVPA 4H3VA 3RYCB 5D86A 3EQ7A 1FFWA 2LE0A 2QSZA 3OJCA 4JD5A 4WA8A 5DNWA 1RYMA 1TPYA 3HB0A 1QBKC 3G7SA 3FOWA 4M6WA 3SS9X 3SQXA 3EVAA 3EVFA 4JP8A 5CJJA 1FYXA 1TA9A 4Z8XA 4LNHA 4WVLA 1XKXA 5C7IO 4BRZA 2VSOA 3CO0S 2XZDA 4RPCA 3ENNA 1TQ2A 4LPSA 2CF6A 4AURA 3BDVA 1IZYA 1T0HB 3HXLA 4KYUA 4O2AF 4AS2A 1BDJA 3DUWA 1UWLA 2XVMA 4AM8A 5BMVA 1HORA 2HUNA 3ZW9A 1E1NA 3H9GA 3NETA 1CJCA 3O3OB 4RK7A 3HJRA 1EFRA 4K88A 4LCBA 5F5NA 4OYLA 3E9NA 2Q3FA 4HS4A 4O4LB 1WBBA 3CHYA 4RULA 2IOYA 3I9NA 4JNKA 2BKVA 4KO4S 5C1DA 5H8WA 1OH6A 1YV9A 1WVGA 1KAQA 1MENA 4XQ0A 3J7AC 4OU4A 3MB5A 4YJFB 1JJAA 2ZPUA 1AJEA 3SM3A 1YRLA 2CNWD 1ZH8A 3IOCA 4O3MA 1JAYA 2WY2D 4U6SA 1BG6A 3SWWA 3AF0A 1GADO 2Z8ZA 4OFXA 1IDN1 1KVTA 2J3KA 1JIIA 3ZNPA 4B7XA 5K0ZA 4G5GA 2JAOA 4JV5B 1II8B 4EI2A 5JIBA 4E46A 4XPIB 1H4VB 4LW8A 3BXEA 3E53A 2JAXA 3QP9A 1A9SA 1QPBA 1T24A 4Q3KA 2CFIA 1BD3A 4UXIA 4M54A 1ZW6A 3F7TA 4E07A 1A7JA 2EDAA 4XX1A 3W5HA 4F9TA 5EKDA 2GK6A 4RFVA 3IIJA 2A92A 4Y67A 2GN9A 2H5EA 4LRQA 5LUAA 1FE8A 4U00A 2NWQA 1U0RA 1LSSA 2JJ2D 2NZ8A 4XCQA 4AG6A 1WDWB 2BF4A 2ZBGA 2ZETA 5FWNA 3PGA1 2B4TO 3W8NA 2ZCUA 4K0RA 3WLHA 2JAHA 3BE5A 2OO5C 5D5QA 2C61A 3A6EA 1IUKA 1KEZA 4J0EA 2WIDA 4PSCA 2WFLB 5JECA 1CFZA 1X87A 1B43A 1DKUA 2ZQZA 4RIHA 1CZLA 3LDGA 5TQ2B 3WQQA 1H2EA 1RMYA 1GQFA 1YUBA 4YFYA 4INJA 5GGXA 1NRJB 4EFNA 5AM3A 1AQJA 3LLVA 1L1RA 4LF9B 4NOJA 5JY1A 2L19A 2IEYA 3DYVA 3F9RA 5FPHA 1G8PA 3N76A 3QOXA 3K71B 3M6WA 4OI0A 4LWPA 5ALZA 5ESDA 3V34A 1IOZA 2A0WA 3PRHA 4XQEA 4Z7QB 3ZCUA 2XYGA 3RRNA 3L4BC 1BVRA 4IJ5A 4MHSA 4XWYA 3H4MA 3OBIA 2BTQA 2ZRDA 4K3UA 2WHPA 3TPFA 4B34A 3T3NA 3COVA 2Z57A 3SHWA 4OGFA 2HWUA 4IIUA 3PJDA 2ZTHA 2C04A 3OJOA 4I19A 2VNAA 4Z49A 3WRWA 1CUSA 3Q2OA 3UWPA 4KIJA 2VJCA 5BN1A 1N6LA 4I1SA 4BQQA 3IKTA 1ESZA 4OOEA 4CIYA 4TPKA 3CJRA 5FCDA 2IKQA 4CM5A 4BEWA 2G70A 1ZPDA 4XJSA 3TAXA 1NBEA 4ISCA 2AC2A 3MCUA 4CG0A 3B8HA 3JQ8B 3CS3A 4R2LA 3MEQA 3P9SA 2EW2A 1AK2A 4E70A 1TJPB 2BWJA 3TBKA 4DR6B 5IX8A 1IEXA 3IVRA 4KGXA 2JD2A 4DCUA 5T41A 1ANKA 3C1AA 4FGKA 5FT9A 1GO2A 3MUNA 5K8JB 5DV9A 1NULA 1BH2A 1WCV1 2VHEA 3JQ6A 1SUEA 5DI9A 2H1IA 4JFAA 1W36B 3KYJB 1PF7E 4MYUA 5EKUA 2H4WA 1Z4IA 3PD1A 2WJ3A 2O5RA 1IBMB 3G5MA 4EABA 1P62B 2YCBA 4UTNA 2VBIA 3TSWA 2ODNA 3KJZA 3MMZA 2Z3VA 2BDEA 1JZQA 5JO9A 1TM2A 4AC9A 1Q74A 4CN9A 1LSUA 4ARZB 4FD3A 3WMRA 3IP3A 2EL9A 2H31A 2ZPTX 3M9XA 5ICCA 3U9SA 4EVRA 3RVQA 1W48A 5CURA 5DN6D 4XD7D 3UAVA 4PLTA 4XWWA 3WGZA 1CJBA 2LDBA 4B2IA 1FBNA 2H51A 1X7GA 5A3RA 1L5VA 2AFHB 1B42A 3U4GA 2X5KO 2Z09A 4GSKA 4KGVA 1KP2A 4G8CA 5AR1A 4Q37A 4AO8A 1LNZA 2W4IA 3EWIA 1RC1A 3EXFB 4FGLA 3JQ9C 4W6QA 3S99A 5BSUA 5C5CA 4Z4CA 1FEZA 4Z3KA 3NONA 1BU5A 4GLOA 2B1QA 4OQLA 2V1UA 2G5CA 2O8DA 4HWTA 3T35A 3VOTA 3EIXA 1ECFA 2V0NA 5FA5A 4H7IA 3RFFA 4B5KA 1PNOA 5LQDA 4I5DA 3W2HA 5K45A 4RO0A 4XWKA 4OL0A 3L3BA 2EOAA 4J94A 1L8QA 4PNEA 1DV2A 4XOUA 5TY0A 4BMNA 1IHYA 1GOTA 3VO1A 3L8GA 2YJNA 2JJ1A 3VR4D 4OK3A 5CK5A 2NSDA 1H6DA 2KSQA 3ANTA 2M9MA 1MGOA 3TVDA 4BQPA 2RD2A 4RVCA 3TTVA 3CM0A 2R1TB 3VSAA 1YCDA 1NASA 3V7FA 4HJXA 3NHJA 5DT9A 1JR2A 3FTNA 3BD6A 5EOVA 1ULZA 3I92A 4CODB 3NCTA 5AVRA 2GNOA 5B58T 4YIKA 1YFLA 2B20A 1EGMB 1IPHA 1Q1AA 3U9TA 5IAOA 4DLBA 4ZGWA 4FZRA 4G4SO 2ECFA 4EITA 1HDGO 1W1IA 1K5HA 4JL5A 4RM2A 2YVAA 1Z0JA 4ABYA 4Z7OB 3UPUA 5L95A 3ZWMA 4BFXA 4IINA 1QAQA 2IYRA 3L0CA 2H65A 3OQMA 4LZPA 3ZWYA 1IULA 5EWLA 2EC5A 4H7EA 4DMLA 1SGWA 2ZI5A 2ZBFA 3SSMA 1CZHA 1D2EA 2RGNC 2X8JB 2G25A 2R96A 3ETJA 3OOHA 4L6AA 4X94A 4YMIA 3WLEA 3PDWA 4HMPA 2JGDA 5JARA 1CJKC 4TTJA 4ZXFA 1FNMA 4I2NA 2X6RA 1ZR4A 1OT3A 3ROXA 3FN4A 1L5ZA 3JAMA 3EIFA 2R6GA 3HCRA 4GO1A 1VZ3A 1WDLA 2FZLA 3KYIB 5JNWA 1BKDR 5BOSA 2H7CA 4X6YA 2ZRAA 2O3QA 4FMDF 4XFJA 2ZRLA 1P8AA 4LNUA 1UDXA 4UMEA 5DHRA 5C9ZA 1U0GA 3IHTA 4HVCA 4MHOA 4TSFA 4HB2A 1EQ2A 3VAAA 2PWPA 1WDKA 2ZQ5A 3PPVA 2ZJAA 1AGRA 4JSTA 2V7XA 4DANA 2ZYAA 3PWTA 4RV4A 4C2BA 1E77A 3DHYA 1K8ZB 1O94C 1U7PA 2W71A 3DFZA 3GQBB 3S2SA 2WILA 3PS9A 1O5IA 1NX9A 4BGIA 5IJ9A 3O9MA 4DT1B 1JAHA 2NO9A 1RM0A 1COZA 4B76A 4ZMSA 3OE7A 3HB4X 2BMEA 3KXKA 5F1KA 3L6UA 1SXQA 5IBQA 4RXUA 5CITA 4UNNA 4FJ0A 2X15A 3O0DA 4HX2A 3RSHA 1KDTA 3CX3A 3OEED 4ZYUA 2CWDA 1XLWA 4BRSA 3MJSA 2AUMA 3LKBA 3DE5X 3W34A 3D4IA 2W6JD 2XWJI 1K7FB 1NTOA 4HUJA 3G02A 1IEVA 1ODFA 1FRFS 4WOBA 3R74A 1QVVA 3ZY5A 1VRCA 4YJ2A 2OZLB 5AW5A 1CSEE 5JYDA 1YQQA 2PKRA 2NYAA 2C3OA 2WWGA 4G9EA 4OQYA 4LHEA 3V1MA 1DIHA 1H6CA 4JLPA 2PHZA 2W2XA 2WYVA 2RSLA 3B60A 5DYIA 4AO7A 3O4HA 4HNTA 3DXYA 4E5PA 3ECAA 1PJRA 2GEBA 2GEDA 2ORYA 4PZYA 4Q7MB 4IDCA 3A1SA 1FTQA 5IBPA 2N42A 2IH4A 2HO4A 1T13A 1I5EA 5FO0A 2VO1A 2DPHA 3T61A 3GEBA 1QG6A 3SJ7A 2GILA 3IAHA 1TCUA 5L51A 1H4TA 4OJQA 1T34A 1SCQA 1J8FA 3GRFA 5ARDA 1TKBA 1XA3A 2R1VB 4JASB 3WK4A 5IBCA 2QRGA 2XRFA 3DBVO 3L02A 1CDZA 5KYXB 1XLUA 1QTNA 2OXTA 5C80A 4UEQA 1KJ9A 5A2QA 2PZBA 2CFRA 3H17A 2X19A 2QLLA 2CE2X 3LUKA 5TX7A 2VQFB 2JASA 2BFCB 3BFVA 5T6BA 5FTJA 1GLVA 3R0VA 4LI3X 4AK9A 1Z47A 2BEUA 1D1QA 5JCJA 2ZUBA 3AUTA 4MVJF 2WWXA 2AFIB 4F84A 4ZOQI 5LOVB 5LD2C 2FCAA 5CA0B 4X85A 2H29A 3N8IA 3IAM1 1KPGA 1U11A 2ZW9A 2EBFX 2VSFA 1A5TA 2CLSA 1MA3A 3TVTA 3FPHA 4GRDA 3VSDA 4TT3D 4HN9A 1M2NA 5EZ5A 3K2BA 1T5HX 4CQNA 2D06A 1E5XA 4IHKA 4ENRA 3MSCA 2NTEA 3HQ4O 4IQGA 1NKTA 2WWHA 5GONB 1JG3A 4C0QC 1OFTA 1W30A 1K08A 1NR5A 4C3OB 1J21A 2ONYA 2BEKA 2PT9A 3MS2A 3SBDA 4ZODA 1M2GA 1C8KA 3I5YA 4ZVQA 2ISSD 5JCOA 1EWVA 1D4OA 2ZB8A 2HMYB 1SPBS 3DV2A 4M49A 1IVSA 1D5WA 2OXRA 2WNSA 3H6HA 4BDSA 1L4EA 3JZIA 1RI3A 2J31A 2H07A 3DNMA 3A8TA 5HWSA 4TWJA 3F46A 1U4SA 3QVLA 5CVDA 5MF6A 4Q6BA 1PTJA 4H7JA 1U94A 4R54A 1TYEB 3HKDA 5CDTA 2X0JA 3DZCA 1P81A 4BC0A 2GASA 3EIQA 2GD1O 1AQIA 3O47A 2PQMA 4G5OA 5CMLA 5LZ5A 4Q7QA 4UBMA 1USWA 4GVPA 4MTCA 4BHTA 4MHTA 3KRTA 1L5WA 3OLCX 5C1IA 1X86B 4TMZA 1DQZA 4LX8A 3A1FA 3JRNA 3GCDA 2OHOA 1N6KA 1O7JA 3HV2A 1I2BA 3MXTA 4X7RA 1OCEA 2RG1A 4R6WA 5IVKA 1ODSA 3E23A 1NVFA 1V5GA 1EK6A 1SO8A 3AJEA 2GJ9A 3N6RA 3W79A 3PDIB 1D03A 3VH1A 1T29A 4HQLA 4TLAA 2IYYA 1ECBA 4Y98A 5ALTA 4CEJB 3PA6A 3O84A 3KKMA 3QRWA 4LRXA 4WKOA 3HCNA 4PYLA 4X91A 1CIVA 2YHIB 4DG9A 3CW2A 3DMTC 3SSNA 3P9ZA 2FP4A 5SICE 5U4XA 5SZHB 4DNQA 3C3WA 4Q4AB 4Z1MD 1UJNA 3EQ8A 2UYGA 2CMFA 4MIYA 5A2GA 2DE0X 3E5MA 1R8SA 5E9JA 3SN6A 3JQDA 4KQHA 2AJTA 3FTCA 3NVDA 3TE7A 3L04A 2JIZA 2GTHA 4G85A 4P2BA 4POAA 3I3SR 4LDJA 3UG6A 4RA9A 5AOCA 3VR2D 5E7MA 1QQAA 4O0MA 4QTYA 4BWFB 5HP4A 5JZVA 1W49A 4U5QA 4D6PA 1RSZA 5IABA 5FLYA 2Y93A 4KXQA 5HS6A 3GJTA 2A0KA 1V0JA 3BSSA 4DLNA 3MT8A 3HWX1 2JVIA 3EEBA 2PM8A 3GZNB 4RDCA 5JASA 3WLAA 2TMYA 4NENA 2PL9A 5ES3A 4A0SA 3F6YA 2WB2A 4GGPA 2Q6KA 1AB5A 1XKQA 3KFVA 2B35A 3VC1A 4C29A 2AI2A 3N5KA 4MV1A 1Q95A 3B89A 5TMEA 5ECGC 1MJHA 1NBMD 1HBJA 4JUIA 3SR4A 4OV6B 2I65A 4ALIA 1HT2E 3DOFA 2IU3A 4MS3A 3GLIB 3GN1A 1C0LA 4GMKA 4FLFA 4HLCA 3HYRA 3K2EA 4U1RA 2WYUA 3S4YA 5HUJA 3HXOA 3B7WA 8ABPA 3B5IA 4G97A 4NJMA 4A8JB 1B7GO 2Q5FA 3RNLA 4D9KA 3HJFA 4MROA 3O6VA 2FSIA 5BN5A 1SG9A 1U8FO 2HU7A 1G98A 1KMIY 3HC7A 4RYLA 5EP2A 4DRXA 3GBVA 2GPSA 2D4HA 3FZEA 1NXVA 1PAUA 4ZPXA 3ZNOA 2FXVA 2H5LA 2BFEB 1AUOA 1G64A 3CWQA 4NDNE 4PQGA 2CHFA 3QLUC 2TECE 2YWCA 3RDPA 2ZRBA 3L7DA 4CKZA 3FMOB 1J2EA 1YC2A 3KZOA 3MELA 3MOIA 3LXUX 1YULA 2P78A 4KYVA 4CQJA 3DAFA 4D9FA 5K8LA 2RBKA 1N2IA 4UE2A 2QLTA 2KPOA 4X3OA 5EZYF 3SZGA 1J2TA 2ZJYA 2PCLA 1HDOA 4O4JF 1NDUA 3NT5A 3UC5A 4C7XA 1QRRA 1ECLA 1TEZA 4KR7A 1BXRB 2IE0A 4JWTA 3FYUA 4JHLA 1H8HA 1KBZA 2HFJA 3VMMA 2CBXA 3MWFA 2FF5A 2WDPA 1E1QD 3L1KA 5JS6A 2ZZMA 2A35A 3GMIA 2HIGA 1HUQA 3SVZA 3VR5A 4D9EA 1X39A 1CRLA 1Q20A 4EP1A 4FYXA 2PQ6A 2XDWA 2WQ7A 5BQOA 1K0FA 1M34E 4W5WA 5I9LA 4PVCA 5DDIP 1DEAA 2PKXA 3UXYA 3E35A 3TAUA 2D8AA 1GM5A 4MGHA 2W7TA 1M6NA 1N4DA 2EQ5A 3HR7A 4IKPA 1Z0UA 2NV2B 4LGYA 3ZIAD 4MTLA 1XMJA 1FMLA 1DS6A 1EIZA 4U2BA 3QUSA 2BLLA 3TIVA 5CLJA 3M34A 2CFOA 1JHOA 3M5WA 2KYRA 1YRAA 4FWBA 1H2YA 2Z2ZA 3CMMA 3RVKA 2FGKA 3RROA 5LZ9A 4AXBA 2JAWA 2W58A 3W9UA 3T38A 2FMXA 5FTNA 3E82A 4BLOA 1NBOA 1DO2A 1RWVA 1TI7A 1YCGA 3HA2A 4LY6A 4PPFA 4S0ZA 5FNVF 4BO4A 4ZI7A 1QLWA 4K9KA 1K7SN 4JB8A 5L7TA 3NM5A 1ZHFA 2O3SA 5F7JA 1GRRA 2O5VA 2JDID 3IP5A 4ZIRA 2XZOA 3KQHA 2PH3A 3CCCA 1WX1A 1UH5A 3CG0A 3CLTC 2BZSA 1PLLA 4Y2YA 1GCUA 3P9PA 3VNUA 5IYZB 5BPHA 2BMJA 5LDHA 2H7XA 4CM4A 2ES4A 4H17A 5EXSA 3UUEA 4YP6A 3MT7A 1OXKB 1E5DA 2R5WA 1LKZA 2BI7A 3H11A 4JUCA 4DRYA 1MEJA 2NZXA 2ZUUA 5EHZA 4MQEB 4GL2A 4AMUA 2P79A 3D0RA 4MW6A 3OTOB 1IM5A 3BDIA 4D0LB 4EELA 1RWMA 1ADJA 1JYFA 2FPPB 1XVVA 3AF1A 2VH5R 3VR1A 2F1JA 4BU0A 2GPWA 4URXR 4JXZA 1Z06A 4OYRA 5I7VA 3LC2O 4TKZA 1SVMA 3BQMB 4XWAA 2JRLA 1OZGA 1JDTA 2C8KA 2O4UX 2R85A 4JCOA 5BWNA 1HURA 1Y8QA 2Y0DA 2KLHA 3K9BA 4GLBA 1U28A 2B61A 2Z6VA 1ISGA 4ZO9A 1Q2UA 3ZIDA 4MQFB 1MAVA 2B4QA 2E6UX 1ZI8A 3FDJA 4HZIA 3ELUA 3OEHD 4YGXB 3WZMA 2GXQA 3EZFA 2IZ7A 5ALGA 2ST1A 2NAPA 2IOHA 5EZ6B 5LSAA 2XGSA 3OT1A 3QPWA 1VIDA 2V74B 3EFHA 1FLNA 2VDQB 4I5FA 5JEDA 4XVQA 5JJKA 3PX3A 1QMPA 1B0UA 4X3PA 1ZSVA 3AW9A 2ZE8A 5E4JA 3CZQA 1WMAA 5EE3A 1YBMA 3SI7A 3D4OA 4L1KA 2YS6A 1YKSA 4RZHA 2HXSA 3SE7A 4F4FA 1I36A 3QXGA 4WZBE 5JRJA 1KH2A 1SVIA 1NC1A 1GSHA 1P5FA 1TJ5A 5G4KB 5BYBA 2DHDA 2KI5A 4RCYA 1YQTA 2PV7A 3PNPA 1JU4A 1JPNA 4NY1A 3OUTA 4DCSA 1E4VA 3OZDA 2ETXA 5I4BA 5FI5A 2GD6A 1I6WA 5B3JC 4DCPA 4L8YA 1O97C 1AA9A 2NT4A 3M1AA 3W5AA 3C7TA 4E7PA 1FZQA 1M66A 2X2PA 5IAGA 4J7AA 3H9CA 1X7HA 3Q8MA 2GJKA 3HU3A 4DXHA 3BXXA 1S4MA 1XJQA 4DABA 1GHTA 1HXHA 5EERA 1TL7C 3H5IA 1ESCA 1IHDA 2G77B 2Y1LA 2YWDA 4BAGA 4DRZA 1YH3A 5IKMA 1U6JA 1C2TA 4FDMA 1T3LA 4R7GA 3PEYA 3WGIA 2IH2A 3BK1A 4AP6A 1K06A 3D8NA 1BA2A 1ZD2P 3UKJA 3UJHA 4P5PA 3EIWA 2G6TA 3ZDYB 2I71A 2I2CA 2VQ6A 4QTZA 1RBZA 1NPYA 3AUJB 3DPUA 1DC8A 1UT5A 3H83A 4K40A 2ZRJA 2ZS7A 5IXSA 3OHPA 3NHFA 1KDOA 3I0NA 4XDGA 5ALIA 5LMUB 3LY7A 2AD5A 3P19A 1POWA 3K0CC 1KI8A 1R16A 5D85A 3KLMX 1DOZA 1N7JA 2EFYA 2DECA 3HCAA 3UXHA 1M54A 1KJYA 2I66A 2QUAA 4YS6A 3FLBA 1J49A 4FS3A 2XIQA 2IELA 3ITNA 5JD3A 4I08A 4OH1A 1PFVA 1YRBA 1JLRA 2DYKA 5GJWC 5KQPA 1I1QB 1I1OA 1H6AA 3GMDA 1NE2A 5A7HA 1E1MA 1DMSA 1NW6A 1WSAA 2AC4A 2A0UA 1H05A 1YVDA 1N7IA 3MYYA 4Z9YA 1REQB 3ZTWA 4AW9A 3ZWKA 3ZDQA 2J4CA 1LBSA 3JQEA 4ZTBA 1E2HA 5DVZA 3W3ZB 7MHTA 1GQRA 3WI7A 4EGJA 1TZJA 3SU8A 4DC0A 4PTZA 3T5MA 3E7DA 4Y1EA 5KTMA 3RUIA 4PHTA 1U8TA 3I53A 3K4HA 2E5FA 4HFMA 3AEKB 4X71A 4H16A 3V7NA 3WWPA 3HH8A 3P4UA 3S81A 1P72A 3W3AD 3ZQ6A 2JW5A 3ICPA 4QRDA 2BH2A 4EPTA 2WW8A 1Z82A 2R00A 3W6ZA 4I99A 1K6JA 1RWOA 2D74A 3OESA 1GFWA 4JJIA 1T1IA 3RC7A 1JR6A 2B2NA 1SA0B 1L7DA 1QXSA 4RQBA 1QO9A 2V7BA 4X54A 2PS9A 2QRNA 3LRPA 3RSZA 4G37A 2R5NA 4CE6A 4J7CA 3GUCA 1VBKA 3IMGA 4IFBA 1N7HA 1Q91A 4Z4HA 4MO2A 3MINA 1BVUA 4GM1A 2QVLA 5JTTA 1VHLA 4KE9A 3RU7A 2EKDA 4FC7A 3I6MA 1NOIA 1N75A 1GGJA 1P7PA 5DFAA 1WHSA 2PO7A 3L41A 4Y6OA 3AV0B 4EEKA 1LW7A 1SUCA 2UZ0A 5AVTA 1SBNE 2WU0A 1EAMA 1VIYA 1T9AA 3DTYA 3R0XA 4U3JB 4DCVA 4L2IA 3W5DA 5JSZB 3BIWA 3GPIA 3TLMA 1KTIA 4IFEA 5IVIA 1ELOA 1F7UA 1VL2A 2WU3A 3ZWAA 3FHLA 2C1XA 4M9QA 5JLJA 4F1WA 5CYPA 3S68A 5TXGA 2GM9A 4N3AA 4G2NA 2PFSA 4ASUD 2NP7A 1QK4A 1S2LA 1JTEA 1XQVA 3L9WA 3KVNA 4RS4A 4D5GA 1T15A 3F78A 3A3PA 3EHEA 1CZKA 4M36A 4ND2A 1IQ0A 2MSLA 3OOJA 3MB8A 4K6FA 2J0SA 1EXVA 4I7EA 4QLOA 5HKKA 2YUTA 1QO0D 2D0OB 4OHUA 4WHMA 1CUIA 4L76A 2X23A 3NDRA 4KLZA 3CLSC 3REQA 3KXPA 5IK2A 1KAMA 2HHAA 3MFQA 3PPYA 3QOYA 4FI3F 3UV7A 2QNRA 2NW6A 2OR3A 2GPNA 4N3CA 1KYTA 4UTXA 4ZCQA 3RK0A 1RIFA 1LNSA 1QIFA 5ICMA 2IS4A 1E7RA 2QL7A 3VGPA 3LGSA 3LT1A 2CDNA 1P2VA 4LFAB 1NAIA 3EC2A 1XAHA 2QRQA 5T64A 5E9AA 3V1TC 4FYKA 2X8AA 1PV4A 1JWLA 1XCPA 3W6NA 1U1IA 5AHWA 4OHZA 3E22A 4J3JA 1L5RA 3G2QA 1RQPA 3HE3A 1XEWX 3QNUA 2JLUA 4YJHA 4AYTA 1VOTA 3MPUA 2QRHA 4IS3A 3ITDA 2A4KA 2PX3A 1BN6A 2I55A 2EFEB 4JLWA 5B1EA 1K63A 4CV1A 2FE1A 4NH4A 4EA9A 2FCRA 1GG9A 5IF3A 4PCAA 2ZSAA 3H1FA 1ZGZA 2GM5A 4KN9S 3SBXA 2OP0A 1C3JA 3L5OA 4H60A 1D07A 2ZJ6A 2WWRA 3I01A 2I8AA 4DEYA 2VHVA 1ND6A 3BSFA 5G1PA 1RQXA 1JHMA 2ZRGA 3N2GB 5JXWA 4DV2B 3SFTA 1H93A 3PQFA 4Z4QA 2HHLA 4MAFA 5LQCA 1P2FA 4TMVA 4YR9A 1H65A 3U61B 2DBRA 2J9YB 2W2OA 4JJ8A 1K92A 1XPOA 2BFFB 4RQTA 5CW1A 5KWVA 5BVHA 2HB6A 2Z95A 3MTBA 4QLBA 4GNRA 4Q7JB 2QS9A 3D3WB 3RIHA 1E9SA 1ORTA 2WF7A 2YASA 2YDXA 2O59A 2XPCA 2V7GA 3MJDA 1PS9A 1AV6A 3FHTA 4QQKA 1QOPB 1F4VA 4RTMA 2W0SA 3AF2A 2V7QD 2DTDA 4A2PA 1MFPA 1ITZA 2O2CA 1M2OA 1UWCA 2WYOA 4QDKA 4U63A 1WS6A 2FI1A 3S8YA 1KYVA 2VTVA 4G4IA 4EJSB 3INGA 3BJZA 4UVGA 2CD9A 4C43A 4JITA 5FWDA 4KXNA 2WE8A 1PLJA 5HJEA 5HMLA 3NTUA 1KI6B 4TVKA 1W0JD 5HTOA 4BE9A 4L50A 1Z5WA 2ROQA 4L4RA 3IT2A 4YBZA 2XMGA 3ZHVA 1A2OA 1F3LA 1TQHA 4MVXA 3W90A 1IZZA 1RQ7A 1YAHA 5EIEA 1B8NA 4XSHA 3BD9A 4Y0VA 2A88A 3D2CA 2J41A 5CLIA 5TDHA 1MO4A 2AZMA 4TTVA 4QQ8A 2Q4DA 3ZWVA 4GPAA 2J3IA 2PDAA 3GHHA 2PLWA 2PTGA 4XYGA 2VRNA 3ZWBA 1QV9A 4GD3Q 2BD0A 1T3SA 4LK2A 2FDCA 4WZZA 1GGHA 2OO3A 4BKQA 3AGPA 2J0UB 1DIAA 4F4JA 2GCNA 3BGIA 3L7CA 4YX9A 1OB5A 2VZLA 1P4GA 1WTCA 1HYHA 3SXPA 1YBFA 2ZRHA 5LD2B 1CR1A 1VKZA 4ZQHA 3COJA 5B5SA 2W5UA 1IJKA 4NDZA 1KIMA 4OI1A 4BNNA 3LHFA 1KS9A 2ZXUA 3K70B 2IRWA 5IW8A 1IXKA 2OKGA 4QEZA 1WCWA 1ZMRA 4OHFA 3WRXA 3WDSA 4DPKA 2QTWB 5AVJA 4H7HA 1DEXA 2F2TA 3GRCA 3W5IA 4OM8A 3EXEA 4ZVKA 5KC8A 4FGWA 5AKGA 4C7JA 2VWQA 2AN9A 1X7YA 4PINA 2AE1A 1YR9A 1FQWA 3OH8A 3RE1A 3FOFC 2WMYA 1OX6A 3EF1A 3HP7A 4JIMA 3FWPA 3PUVA 3RS2A 2G1JA 3FNFA 5ENZA 1LV8A 3OE1A 3AUUA 2WQ6A 1GNQA 4MWEA 4ENTA 1RYYA 1A5ZA 3A14A 2E87A 4PZ9A 2WLTA 5C2JB 3ZG6A 1U7HA 2VYCA 1LDGA 4RELA 3EXG2 4D42A 3QPBA 1YZUA 3PC6A 5HS4A 2OHVA 3PNQA 4DJAA 2R751 4FC6A 4ZOAA 3HKBB 2GJ4A 2BEWB 1PFKA 3TIXB 1MRNA 3UN1A 3RC2A 2TMGA 4OI4A 5JAUA 1Y8RB 4Q4HB 4A2CA 1FFDA 5M5BA 3SLGA 1QYWA 4TUYA 2XITA 4PG7A 3HB9A 3AI3A 1M34A 3E81A 3EUEA 4ZC8A 1V48A 2D5IA 3K0EA 1XAJA 4N5IX 1N5KA 1BRMA 5YASA 2NPOA 2WWVD 5F1YA 3TAHA 3EZNA 3T6KA 4E21A 3MM4A 1S01A 2MIIA 1PJTA 3IQGX 1TAQA 1WMFA 3LQ4A 4BUCA 3QKIA 4EMBA 4IJMA 3OKFA 2E3JA 4EB0A 2WUVA 4HVAA 5BR1A 4JBYA 4I5GA 2OWEA 1ZMOA 1ZG3A 1JTFA 1C9KA 1EFUA 2I22A 3PV0A 1K75A 4FJ2A 4WN9B 1PQPA 1RCTE 3TW6A 4NBRA 3N07A 2VLIA 1F4LA 3D3NA 1B14A 4ZCMA 5LLSA 2C7GA 1OV6A 3M5CA 1R4AA 1ULBA 5HDBB 2GK7A 4H7FA 3SOZA 4OJYA 4D4LA 2A9PA 1C8LA 2GZ2A 5CIWA 3UGTA 4UARA 1VECA 4HV4A 3DFFA 2UVPB 1WCXA 4KV9A 1V8OA 3DE1X 5ALXA 3TKYA 2NSYA 3ZD7A 1V8BA 3TUJC 3IE1A 2OLKA 3B5JA 4BNFA 3C3PA 1SNYA 3E3OA 4HGPA 5IH7A 4OGKA 4RCVA 3DMFA 4AJIA 2C0CA 2NG1A 3BXPA 5FKJA 4C3UA 1J42A 3LUCA 2ZU6A 4ER7A 4D97A 3UOAB 1J1IA 3SP1A 3WV5A 5C7LO 3QLJA 4D9MA 2J87A 4YMWA 1G2PA 1JL3A 2O54A 4XQ9A 1B73A 4P7KA 1UMDA 3JRXA 3GROA 4U7TB 1VM6A 5CX1B 2IC5A 4C4SA 2QP4A 1ADBA 1NLMA 4RUKA 4DXDA 4OOFA 5F1OA 5AK3A 2X9LA 4Q24A 5C46F 2JGFA 2XOKD 2DFTA 3M1LA 1FNBA 1SHKA 4O2AA 1XQ6A 4E2YA 1XJ0A 3A0RB 3IJPA 3TGLA 4JI0B 4FGUA 2BP7A 4G0YA 1SUAA 4LVCA 5KOIA 1TOAA 1GT6A 1XTKA 4GZMA 2XZPA 5HCNA 5JSUA 3RTDA 1QIJA 1RKUA 3RVMA 1B1CA 3OZGA 2X40A 1VSTA 3JVEA 4R7ZA 1Q0UA 4GEKA 3FFWA 4WZBA 2BDTA 4UEJA 4RA6B 3K1YA 1USGA 1IMJA 3PFKA 1CHNA 1VE1A 1PSZA 1QGUA 3H6GA 3ND7A 4EHLA 1KO5A 5KNCD 2GA9A 4X45A 1MH1A 3UXEA 1YUMA 3QBEA 3PENA 1SVKA 1ZVMA 2BJHA 2XNCA 3DZDA 1S6YA 1RP1A 5IARA 2HJRA 5C4MA 5JCOC 1TF2A 3HUFA 4UAUA 4LZAA 3BK7A 1QQTA 3T94A 3ZWPA 4BNDA 4F3KA 4J16A 1XYYA 4C05A 2O19A 2QHXA 1Z08A 5COBA 1K7XB 4RKRA 1KR5A 3V3KA 3SVTA 2J5BA 4LJKA 3T0FA 3WB9A 4B3SB 3ZHZA 3ZCQA 4GMDA 1BXGA 1PTJC 1BW9B 2XTZA 2IYVA 1BCRB 2ZJFA 3GNLA 1NJ6A 3H9JA 4MVJM 3TRJA 3ACDA 3JWJA 1NG1A 4J6FA 1VHDA 5LDGA 4ZGBA 5EJFA 4PR3A 2EG5A 2AF3C 2VF5X 3NOXA 4YQZA 1QCZA 2GPBA 1S1CA 3KJGA 4RE5A 1D2NA 4DA9A 3W3AH 2NVOA 3HGQA 1UK9A 1UF9A 1FDSA 4PN3A 1NR1A 4S2UA 5FQOA 2PWYA 3LCUA 4RTQA 1HQCA 1EBFA 3CNOA 1T2AA 1SIUA 3AZPA 1LDMA 3BF8A 3GT4A 1UT6A 4JUBA 4AWXA 4EMSA 1W1WA 1CQPA 3D8BA 4A03A 4MUNA 4KNYA 3GVPA 5GZ3A 4QQRA 4DZZA 1YI0A 1A98A 1SUBA 2B1IA 1JGTA 4HAZA 5LA6F 5EGNA 5GWXA 3X0DA 3ZNNA 2YRFA 3B2NA 1JH8A 4CKBA 1FYEA 3H65A 3U7FB 3CEPB 3FCOA 1YS9A 4YJDA 3E9ZA 3L82B 4CKCA 1U0BB 2JHCA 4IDFA 1J4AA 2CKDA 3LC0A 3AW8A 3OKAA 1Z2PX 3N8GA 4J1SA 2NAFA 4MPRA 3ZE6A 4KYIB 3DBLB 3L6CA 4NESA 3IKMB 4TKVB 3ELYA 3BD7A 4TZ0A 3GCGA 1F2TA 1E7SA 1O96A 2EFGA 3RR2A 1EXWA 4DA4A 4D81A 1AKNA 1HE1C 3OFND 1LDYA 2AE2A 3KKLA 3O90A 1TQ8A 2Z1MA 4X62B 4GKJB 2V03A 4XJXA 3SHOA 3GJ3A 3K5PA 1MT3A 4FHEA 1JPVA 5D1HA 4FT2A 1G21E 3COYA 4CMGA 4KIFA 1ZONA 4G5XA 5CT5A 2HSZA 4LCJA 3ZEIA 10MHA 1COWD 3M4NA 3FYCA 5KO2A 3F97A 4DUGA 4QXPA 1WEHA 1F2DA 2HSEA 2X5XA 1JIUA 1UAYA 2RFLA 3U7QB 1N6OA 1RNLA 3DKRA 4W8HA 3VH3A 4FGZA 2JFFA 5TARA 1MB3A 1AKUA 5BWMA 3ASVA 4WK2B 2G28A 4PGAA 5FWXB 4N1AA 1G42A 3KPUA 4WJKB 3EY9A 3KKZA 3NVAA 2PL1A 2AX3A 3N2KB 1U3FA 5HBGA 2O2IA 2XODA 1OAOA 2RGAA 1LD3A 2V9CA 3E9YA 4F8EA 5IT9A 1MABA 4B84A 5I9TA 3ZVLA 1VPWA 4KAJA 1VRVA 2AOXA 3M33A 2JGLA 3B6EA 4KNVA 5CT6A 4JLKA 1ZX1A 3W9SA 4B3CA 1TFUA 2YXLA 4J0JA 5LNK6 2WNHA 3IQZA 3LBIA 1L5GB 4N6OA 3D7NA 5EUBA 1GYQA 3UXMA 4HXYA 3ZYCA 4CFSA 1DADA 1UXJA 3FYHA 5H81A 2G6BA 1L7MA 4CV3A 2O3TA 2JIPA 3C15C 3T3DA 2C42A 3B1XA 4MB2A 2JIMA 1F8GA 1H5UA 1O9BA 3NP9A 4FZ5A 4GT1A 4Y2RA 1XR3A 1Y6QA 2EZ8A 2C94A 3JQGA 2E4UA 4OB6A 2R7NA 3AVTA 1MTOA 4NJOA 4PG4A 1UBLS 1YQUA 2QG6A 5DOZA 1AKQA 2C3YA 4QOGA 1ZITA 3DG9A 4J91A 5D3MB 3T3EA 2BC9A 4E1AA 4W5OA 4HUQB 2MINA 3QK7A 4FKBA 1R0YA 4ZO8A 3JYHA 1AGXA 1LX7A 3MK31 1FUYB 2DKNA 4I55B 1X74A 4KVZA 2ZZNA 3LVFO 4E5KA 1OT5A 3OKPA 5IPFA 5CEEA 2Y8EA 3GJ4A 2XGJA 1DJOA 4HDOB 4F5EA 5BVGB 2OORA 1YRWA 1Z4MA 3PQ4A 3BB1A 5E6SB 4KW7A 4P3PA 2XCRB 2UYHA 1MH9A 2CK3A 5H3CA 5EJ4A 5HW0A 2CV0A 3GVXA 3L79A 2VPZA 5LIPA 1C3EA 3A3KA 4G1EB 5CIYA 1NBHA 2JEYA 5HQTA 3Q9NA 4JIGA 2KX7A 1PVDA 1INLA 2Q3JA 3GQVA 4BB6A 4RMIA 4IICA 3OIWA 3P32A 4BMZA 5EINA 3ZHUA