4F8CB

Structure of the cif:nedd8 complex - yersinia pseudotuberculosis cycle inhibiting factor in complex with human nedd8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cycle Inhibiting Factor
publication title The molecular basis of Nedd8 deamidation by the bacterial effector protein Cif
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Cell cycle/protein binding
total genus 22
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4f8cB00
3VUXA 4GDKA 2NBUA 3ZRCA 4AP4C 5CX3A 3MJWA 1M94A 1TZ1A 2L7RA 3WAPA 2LVPA 1H8CA 3K9OB 3Q3FA 4DDGD 1TTNA 4IWQA 5J2RA 3X0WA 4XX5A 4KSKC 4A3OA 2O2VA 2KANA 4NQKE 5D7GA 2KWVB 1WRDB 2LGXA 5JH5C 4MM3A 4MEMA 1V81A 3CMMB 1WGYA 2L00B 3RUIB 1FXTB 3DDCB 4KIKA 3TL5A 3TBLD 3V61A 3OJ3A 3ZNID 1C1YB 2LGDA 4HJKA 3RYTA 1RRBA 3QA8A 4FULA 2KNBA 3ENEA 2FAZA 2KFKA 1P0RA 2KDIA 2AWTA 2N4FA 4HK2A 1IP9A 3IBEA 4GN1A 4JIOU 5G55A 3NHEB 2PE9A 5DPWA 3HK0A 2IO1B 1GJZA 1LM8B 4WAAA 2K25A 4RM9A 3H1UA 4MELA 4WJNA 3U7DA 3SHQA 3P2BA 2BYFA 2NVUI 2EMTA 3GOEA 4ZDVA 4W9DA 4A3PA 5DPSA 1BT0A 2IBIB 3ZW3A 1WFYA 3DVNU 3ZKJC 4N9F4 2QHOA 2YVCA 4MGIE 5J18A 3A9KA 3IHPC 3UINB 3N3KB 1YX6B 2K6DB 2JPHA 4BBNF 4M8NA 2N1VA 2L0TA 5BO4B 3WAOA 3EECA 2KDFB 4KZ0A 4EOYA 3ZNGC 2KVRA 2I1KA 2KJ6A 2BYVE 2WYQA 3T9LA 4FN2A 2RD0A 2R2QA 4HDOA 1NI2A 2DZJA 3APDA 1Y8RC 4HDQA 1YJ1A 3QCAA 3KYCD 3L16A 3TIXA 5IA7A 2GMIC 4WQOB 2C7HA 4MDKE 2LZ6A 3T8MA 2O6VD 1CMXB 3B0AA 3B08A 4E74A 4FA6A 1V86A 1YD8U 2NBWB 1WGGA 2IZVB 2O6VB 5FR6A 1E8WA 3JVZX 4B9KA 4WJOA 2ZVNA 5TR5A 3C0RB 4MH0E 5CHWA 5DPRA 3UF8A 4HLEA 4FADA 4IUMB 1PQSA 1L2NA 4FJZA 4MJSB 4K7SA 2PE6B 1V6EA 1WM2A 4NJ6A 2G45B 2XK5A 1I35A 3PV1A 1LFDA 2KXJA 2LXCA 1WE6A 1VCBA 3AU5A 1E8XA 2V4LA 3IG3A 1SE9A 2KK8A 1WXMA 2C7MB 2DHZA 4X57B 1WF9A 2LVQA 1EO6A 4NY0A 4XC2A 2MW5A 3PGEA 1P3QU 2ZJDA 1NBFC 4DXAB 1J0GA 2LD9A 2JWZA 1E7VA 3R3MA 3TMPB 1UGMA 1WZ0A 2K8CA 4LDTD 5CHVC 4W9IA 2N9EB 3PSEB 3PRZA 4BKTA 4DHJD 3ZNHB 3B1LX 3M62B 2HE7A 4M8MA 4ANUA 4TQ1A 2BGFA 3K9PB 2C9WB 1P98A 2ZCCA 2WDTB 4DHJB 1OTRB 2NBVB 1VD2A 4RM8A 2DZKA 2GOWA 2IY1B 4LCDE 4MSQB 4AJYB 4EUTA 3HIZA 2N1WA 4BVUC 3H6NA 4HCNB 2KDBA 4MGYE 2KKCA 2B3AA 4YL8A 3WAMA 5E6NA 1WGDA 2KJRA 2RR9A 2LRWA 4GIVA 4TQ0A 1E8YA 1AARA 2ZVOA 2O6VA 3A4RA 3X23A 5GMVA 1D3ZA 1TBEA 3VH3B 1YX5B 4BOSC 1UBQA 4OVVA 3WA0A 4NJ7A 4F1SA 4URKA 3KUCB 4W9GA 4GMVA 4IWOA 1Q0WB 4KDLB 4IW0A 3M3JA 1V2YA 3ZNZB 4CYEA 1F9JA 2KWCA 3M63B 2A4ZA 4MJSA 2JZ3B 3VQIA 3V60A 2KN5A 4KV2A 4I6PA 1UD7A 4K7UA 1WXVA 4IM3A 3PLUA 2LVOA 3PLVA 2LGYA 2MQJA 3H7SA 4IG7B 3PHXB 2NCNA 4GU2A 1WX9A 3L08A 4EFOA 1WXAA 1MG8A 2MWSB 3DVGY 4ICUA 2NPTB 4E3CA 4A20A 1EF5A 4BOZB 4DHZB 1KJTA 3QX1A 1A5RA 2KC1A 3A1QB 3M95A 2FCSA 4F8CB 1V80A 2LRUA 3DPDA 4BBNC 2DYOA 2J0MA 1OEYA 4GOCA 4FJVB 4K1RB 3ZLZA 2LASA 3VAWA 2KOXA 3HHMA 3S2AA 1WGRA 1K8RB 1UH6A 2RPQA 2K8HA 3A9JB 3QAQA 2MCNB 2FCNA 4GXBA 2MBQA 1EUVB 2D10A 3W1SA 2M8SA 2DX5B 2L0FA 3PS6A 2KX3A 3SDLC 4DHZE 5DPTA 2L8JA 3VXWA 1V5OA 2JRHA 2DZMA 1WXSA 1RLFA 4J6IA 4KDIC 2CHZA 2ZPYA 2ZPNA 4HXDA 3H7PA 1WR1A 1WE7A 2A5UA 2DAFA 4PS8A 1NDDA 3L54A 2OJRA 3VUWA 3WIMA 2YLMA 3DCGA 1XD3B 2BF8B 2HD5B 3VTUA 2DYBA 4CHKA 4K81A 5D94A 2JY6A 2M4NA 1Z2MA 2NR2A 1QZEA 3ZIMA 4W9HA 4KZCA 1Q5WB 5AZFA 3QJZA 1OEYJ 2BWFA 3UQBA 1S1QB 3SD5A 2N9XA 3JSVB 2GBNA 2LWPA 2ZZPB 4ZYNA 2BPSA 2KJHB 2Y5BB 3OJ4B 5E6PA 1RAXA 3VFKA 4WWNA 4MSMB 2WX1A 1GG3A 1XQQA 1OGWA 2DZIA 1H4RA 1WGHA 1WH3A 2V1YA 2CR5A 4IC7B 4MGZE 3UGBB 3VTWA 5J17A 3V6CB 3DBRI 1Z5SB 2D3GA 2KMCA 3GZNI 2NPTA 2IYDB 3EHVA 1S3SG 2N9PC 1TGZB 3ECIA 4WWOA 1WMHB 2MBBB 4I6LB 3A1QA 1T0YA 2KTFA 5AZHA 3LDZE 2J0JA 3MTNB 5JHBA 2I1JA 4AWJA 2DAJA 2CS4A 3OLMD 3U8ZA 3RCZA 3JYUA 3RZWC 4EKUA 3N30A 3TCAA 3UIPB 5C23A 2AYOB 3DVGX 2XEWA 4ASWC 2M17A 1E90A 1OQYA 3A9JA 3CSTA 2KMAA 2PPHA 4ANVA 4FBJB 1WY8A 2KWUB 3ZUNA 2O2VB 3W1YA 3UQAA 4M0WB 4ANWA 2CHWA 2MBHA 4LJOB 3W1SC 2K6QA 4PS3A 3U30A 3PREA 1ZKHA 4IWPA 4KIKB 1R4MI 3NOBA 4GSWA 1R4NI 4WWPA 5CTRC 4DDID 4GGQA 1P9DU 1EF1A 4NQLB 2KQSA 5L95C 2Z0DB 2NS5A 2VRRB 3UIOB 3ZTCA 3I3TB 1WYWB 1ISNA 2CU1A 2G3QB 3ML8A 3QK0A 2MSED 3PTFC 4EZJA 4BKSD 2KFJA 1KM7A 4II2B 2C5LC 3CSFA 4I6NB 2OOBB 1V49A 2KO3A 3JSVA 4F7ZA 3QC8B 3L13A 2PJHA 2FIDA 2JF5A 1IYFA 1J19A 1HE8A 4W9KA 4AJWA 3HM6X 3DVNV 2REXA 1WM3A 4BKGA 3HM3A 2CKHB 4GDLB 4HPMB 4W9FA 5AZGA 2K8BA 2KTRB 2WWZA 3PRMB 3APCA 1WMHA 4JQWC 2HJ8A 2GBMA 3ZO5B 2JVCA 1G6JA 2GBRA 3A4SC 1GC7A 3H9DA 3OAWA 2ASQA 2D11A 4ZRJA 5E6OA 3KVFB 3N32A 3QARA 1WJ6A 4TUUA 3MHSD 2KX0A 5LLIA 4JL9A 4FHJA 2UWQA 1YQBA 2JZZA 2EKEC 2RSUA 3KYDD 3PPAA 4TV3A 4NAWB 2FNJB 4WJQA 5LXIB 2LUEA 4E71A 4JLCA 1KOTA 3L0WB 3QIJA 2KD0A 2MBOA 2AL3A 2ZEQA 2R2OA 4FHKA 4WJPA 4HWIB 1LXDA 3KW5B 2AEHA 3PT2B 4NPNA 4G11A 3O65B 2IY0B 1WJ4A 2XK5B 3KUDB 1WZ3A 2N7EA 3ML9A 3PVLA 3ONSA 2MA9B 1XT9B 2FUHB 3DBHI 3AXCA 3VH4B 1P1AA 1V9JA 4PYZA 4ZRIA 3RD2A 5AEKB 2L05A 4DK5A 2Z0EB 3ALBA 5KHOA 2C7NB 2GBJA 2MX2A 3AU4A 3BY4B 4FJYA 3VHTC 4AUQC 2DYMA 2G4SA 2IO0B 4ICVA 2WX0A 3DBSA 1E5WA 3EC8A 4OVUA 4RMAA 5L83A 2Z59B 2D2QA 2MLBA 1L7YA 3JW0X 1WR6E 2FCQA 5LXHA 4BKSA 4G50A 4EZKA 2MBEA 3VTVA 2LXAA 2JT4B 1C3TA 1UZXB 2HTHA 4EEWA 5C1ZA 3QWZB 1X1MA 1I42A 2MP2B 3KH0A 3LJ3A 1JRUA 2L76A 3QQ8B 4GDLA 4ANXA 3IFWB 2KTRA 2N7DA 1GUAB 3BINA 3V6EB 1WJNA 2KC2A 4FLHA 3CF6E 2G4DB 2K39A 5JZEB 3ZTDA 3D32A 1SIFA 4K7WA 4GB9A 2LI5A 1J8CA 2W9NA 2IO2B 5G2NA 1E7UA 4AOFA 2J0KA 3RZFA 2C60A 4NNJB 5JHAA 2L3ZA 5D2MB 3VUYA 1WX7A 2UYZB 2ZCBA 2CHXA 1E8ZA 3NZUA 3QHTA 3R66C 3NY5A 3APFA 1WX8A 2DENB 3RT3B 1WI0A 1ZW7A 3VDZA 2FCMA 4GDKB 3DQVA 4KSLC 4NAWA 4HVBA 2JXXA 2K1FA 2RGFA 5HKHA 2AL6A 1YIWA 3L17A 1KLVA 3ZVVA 2KZRA 1U4AA 4HPLB 1RFAA 3KUZA 2IO3B 5CHFA 3PZDA 2PEAA 3R7RA 2V3SA 2BKFA 2BYEA 3TJPA 4B6WA 1V5TA 3WANA 1IPGA 2JUOA 4W9CA 2M0XA 3Q3JA 2KLGA 4LJPB 4CO7A 3NS8A 5KHQA 4TKNA 4G3XB 3RULA 3DBLI 4W9EA 2KFKB 2BKRB 3NZSA 3VVWB 3WALA 4JGHB 2JRIB 2LJ5A 1LQBA 4IM0A 1GNUA 4PYUA 3L10B 4IM2A 4DBGA 3DOWA 4B95A 3AULA 2FIFA 2GBKA 3ZDMC 2MP2A 4DWFA 1UELA 5DCNA 1WJUA 4EZLA 4W9JA 1GC6A 3PRPB 2BWES 1ZGUB 4LDTB 4XZ4A 3A33B 2KDEB 3SU8X 3AI5A 4MGKE 3EFUA 3A9KB 4BFRA 1UBIA 2D07B 4G0NB 2MRPA 2M1MA 2XBBC 4ZRKA 3V62A 4PS7A 2ZNVC 1Q1OA 2EMSA 2J7QB 2KLCA 3H7PB 4HCPB 4II3B 2KHWB 5IAAC 3ZRFA 5EDSA 5D6JB 1SGHA 1WIAA 2KQ7A 2ZNVB 3PHWB 3R7QA 4P7IA 4KVGB 4W9LA 3ZDTA 3IVFA
chains in the Genus database with same CATH superfamily
4KGTA 2NBUA 3MJWA 3TUOA 3WAPA 2LVPA 3Q3FA 4DDGD 1TTNA 4IWQA 3Q3MC 1JRPA 3P1MA 2OJWA 4MM3A 4MEMA 1F0ZA 2L00B 4ZYSA 4KIKA 3V61A 3U7ZA 3TBLD 1C1YB 4HJKA 4RFBA 2WU5B 4L2YA 1SF0A 2AWTA 4HK2A 1L4DB 1IP9A 4GN1A 3AECB 4JIOU 5DPWA 3HK0A 4WAAA 4RGNA 1QOFA 3AE8B 4YSXB 3U7DA 4ZDVA 4W9DA 3VRAB 2Z8LA 1I4QA 4S0RA 2HTME 4N9F4 2QHOA 5I4DA 4USAA 3A9KA 3IHPC 4WURA 3N3KB 1YX6B 5BO4B 4KZ0A 1EWCA 2LUMA 2BBCA 2KJ6A 2WYQA 2RD0A 2R2QA 4HDOA 1NI2A 4HDQA 1YJ1A 3QCAA 4WQOB 2NTTA 4YWGG 1OFFA 1WGGA 1ZE3D 2QEJC 1NYRA 1E8WA 1ZXIA 2ZVNA 1DOXA 1PYWD 4K7SA 2UU7A 2GB1A 1OQQA 1I35A 4RGOS 4L1BA 1AYFA 3BYTB 4LNOA 1FPYA 3AE3B 3B2FA 3IG3A 5BMIA 1SE9A 2DHZA 3BK1A 2LD9A 2JWZA 1BMLC 3R3MA 4LDTD 2LGIA 3PSEB 2I2YA 3ZNHB 3B1LX 4M8MA 1PGXA 4XGAB 5HFYA 2ZCCA 2WDTB 1E9MA 4RM8A 4AJYB 4LCDE 1YQ3B 4YL8A 3WAMA 1AARA 3A4RA 3X23A 2SAKA 3MC8A 3VH3B 1YX5B 2M19A 5IOIA 4NJ7A 4F1SA 4IWOA 4IW0A 2KWCA 4MJSA 2BT6A 3V60A 3E9SA 4KV2A 2Y5PA 1MI0A 1VJKA 1TS2A 3DWMA 5EE0A 3DVGY 2N0SB 4E3CA 4BOZB 1KJTA 1QOBA 1V80A 3DPDA 4BBNC 4YXDB 1K50A 1AWDA 2LGSA 3NS1A 4OHJA 3GE3C 2WQYB 2WXOA 1T3QA 4GXBA 2WU2B 4DHZE 3P4SB 4P6VF 3NJTA 4J6IA 1L6UA 4KDIC 2CHZA 2ZPNA 2BB6A 4RCOA 4RGMA 5FKAC 3I57A 4HRSA 2OEDA 1UWXA 1XD3B 3Q14C 2LHEA 2HD5B 2DYBA 1B9RA 4K81A 5JXVA 2GLSA 3ZIMA 4W9HA 1Q5WB 3QJZA 1S1QB 4M01A 3W5UB 1I4PA 2KJHB 2Y5BB 1RAXA 2WX1A 4IC7B 2V1YA 2CR5A 5J17A 1V97A 3V6CB 2KMCA 3GZNI 1VLBA 1SIJA 2IYDB 3EHVA 3P63A 2TSSA 2RDGA 1WMHB 3P42A 2KDMA 3Q8AA 4C00A 2DBYA 4US9A 2CS4A 3RCZA 3JYUA 3TCAA 3RNFC 3CWIA 2PPHA 2L52A 2WGSA 1TKEA 3W1YA 4HROA 5AUKA 4ANWA 1IBXA 2MBHA 3W1SC 1C9FA 4M00A 4PS3A 2L1AA 4IWPA 4KIKB 4NAMA 4GSWA 4GGQA 2Z0DB 1F77A 5C3JB 3VR8B 3ZTCA 3I3TB 1RFKA 1D4BA 2G3QB 3RN9C 2FBWB 4II2B 1YJIA 3CSFA 5H92C 3QC8B 3L13A 5IKCM 2WXKA 2J52A 2WLBA 4L23A 2CKHB 3DHGC 4W9FA 5AZGA 2K8BA 1WWTA 2KTRB 3PRMB 4WQMA 1OQRA 2GBRA 1ZOYB 1XLOA 5E6OA 3PZ7A 1B1ZA 3ZYYX 2SEBD 3NUHB 3NVZA 4YTMB 1SSNA 2RSUA 3KYDD 3PPAA 2LUEA 4E71A 1NI3A 2K9XA 2D3CA 2ZEQA 4HWIB 1LXDA 1V1PB 3KW5B 3PT2B 4G11A 3ML9A 2N7EA 2BS3B 2MA9B 1XT9B 3AXCA 1V9JA 1YNTE 3RD2A 2L05A 3MC9A 4AUQC 5G5GA 1N5WA 2G4SA 2WX0A 2BS4B 1EU4A 2Z59B 1T6BX 4A6QA 5D3DA 3VTVA 2JT4B 2HTHA 5C1ZA 3QWZB 3KH0A 1HTOA 4ANXA 3IFWB 3BINA 1GUAB 3V6EB 3N9YC 3DHIC 1J8CA 4AOFA 3RZFA 3LXFA 5JHAA 3NG0A 4A9AA 3VUYA 2UYZB 1QF6A 2HJ1A 2I38A 2ZCBA 2CHXA 4KGRA 1ROEA 3MJ5A 3NY5A 2WXHA 2DENB 3RT3B 1ZW7A 3HUIA 3VDZA 3T3OA 3URYA 2KN4A 2MEKA 1I7HA 2AL6A 1KLVA 3PO0A 4MH8A 1XEEA 4RGTA 4J3OD 3R7RA 1XLNA 4LNIA 1P7FA 4C7ZA 5TSSA 2KFKB 1M4VA 3WALA 4RF1A 1SE2A 1MJDA 2GBKA 2MP2A 4DWFA 1WJUA 4W9JA 4LDTB 2KDEB 4NJCA 2KT7A 2V3NA 3V62A 4PS7A 2ON8A 2ZNVC 4II3B 2KLCA 2KHWB 5D6JB 2DNFA 3IVFA 3VUXA 1L5PA 1M94A 1TZ1A 2INNE 2L7RA 4K3CA 3NVYA 1QQRA 2JWUA 2ZW0A 1QILA 1N62A 5J2RA 3X0WA 2CU3A 4A3OA 5D7GA 1WRDB 3N20C 3CMMB 1STEA 3ZNID 2LGDA 1JCKB 1XCQL 2KNBA 3ENEA 2N4FA 3DBHB 2WXQA 3ETRA 1HXYD 1K53A 1EWYC 2VH1A 5G55A 1KTKA 2IO1B 2K25A 1BUIC 2VZKD 1K52A 5DPSA 3RPFC 4P16A 3DVNU 5J18A 1WRIA 2JPHA 2K6DB 1FNWA 4LTUA 3EECA 2KDFB 3ZNGC 2I1KA 3T9LA 1TIFA 3ABVB 3BWUD 1JWMD 1J7CA 2GMIC 3ZGZA 4P1CC 1CMXB 3B08A 2V9HA 2NBWB 2M0AA 2IZVB 1FEHA 2O6VB 4MT5A 5FR6A 2PKOA 3JVZX 3IAS1 4B9KA 5IO9A 1ZXHA 3C0RB 4HLEA 3IT6B 4FJZA 4NJ6A 1WM2A 2G45B 2KXJA 1R4MB 3V05A 1PFDA 2W54A 2KK8A 3IT4B 1WF9A 2LVQA 4NY0A 2MHJA 2MW5A 2ZJDA 3GB1A 3P4PB 1F2RC 1UGMA 5CHVC 4W9IA 3NRZA 2N9EB 2VH2A 1JWBD 3C8YA 4RNAA 1P98A 4DHJB 2NBVB 1VD2A 3Q8FA 2DZKA 2E6XA 3H6NA 2KKCA 2B3AA 2W3SA 4GIVA 1E8YA 2ZVOA 5GMVA 2GRIA 4DXFA 1UBQA 1ET9A 1XO3A 1ZP0B 4OVVA 3WA0A 1MG4A 1PGBA 1ET6A 1Q0WB 4KDLB 3TEZA 3ZNZB 1V2YA 4CYEA 1F9JA 2KN5A 3R8BA 1UD7A 4K7UA 3ZQ4A 2LVOA 2LGYA 2MQJA 4IG7B 3RNGC 2LJIA 1WX9A 1MG8A 2NPTB 3Q3OC 1QKZA 2KC1A 3M95A 3HRDD 2FCSA 4F8CB 2J0MA 2RPVA 4N6EB 1E6EB 3AEBB 1CZPA 2LASA 3HHMA 3S2AA 5IN7A 2Q5WD 3MP9A 2WP9B 2MBQA 1EUVB 2D10A 3Q69A 2DX5B 3SDLC 3VXWA 1VDVA 1C4AA 3Q3NC 2QDFA 1T0QC 2WXRA 2A5UA 3GP7A 4HKZE 1NDDA 3WIMA 3ZXRA 3RFZB 3DCGA 2FE8A 1FFVA 2BF8B 3VTUA 1VRAB 5G5HA 3AB5A 5D94A 2HDEA 3B9JA 5AZFA 3N1YC 3SD5A 3JSVB 2LWPA 3AE4B 5E6PA 4WWNA 1GG3A 2DZIA 1WGHA 1XLQA 3VTWA 4PK1A 1FRDA 1Z5SB 2D3GA 3AE5B 3ZXVA 3KLSX 1TGZB 4XWTA 2MBBB 3A1QA 5AZHA 3LDZE 4AWJA 3OLMD 3U8ZA 3AEFB 1KFYB 2AYOB 4ASWC 5EE9A 3A9JA 2QSDA 3ZUNA 1D5XC 1MHHE 4M0WB 2WXPA 1JW9D 2CHWA 4GLSC 1UUPA 3PREA 1ZKHA 1R4MI 4AQ7A 1R4NI 4WWPA 5CTRC 4AS1A 3NVVA 5L95C 3SR6A 2VRRB 3UIOB 1WYWB 1ISNA 3QK0A 4BKSD 3OWEB 2OOBB 4F7ZA 2PJHA 1D5ZC 1ENFA 1T5XD 2JF5A 1J19A 4XDDA 3DVNV 2DLBA 2REXA 4BKGA 4HPMB 2WWZA 3NZ3A 4KX6B 3KVFB 2LFIA 2KX0A 1WXQA 5LLIA 1TT5B 4FHJA 3U2SC 2EKEC 5LXIB 2KD0A 1L0XB 2MBOA 2R2OA 4WJPA 4IOIE 2AEHA 1EM7A 1XLPA 3FILB 3PVLA 2JU6X 1BXTA 1D5MC 2B76B 3FC4A 3ALBA 2MX2A 3BY4B 4FJYA 3VHTC 2DYMA 2WXFA 1K51A 4N58A 1E5WA 5L83A 2D2QA 3KQ4A 1WR6E 3OG5A 4BKSA 5LXHA 2LXAA 4YTPB 1J7BA 2LEKA 4EEWA 3MFGA 1JRUA 3QQ8B 4GDLA 3I5JC 2N7DA 2R61A 1FRRA 2WXJA 1TJEA 1TS4A 3ZTDA 1SIFA 4K7WA 3DBRB 2IO2B 3Q2AC 1E7UA 4C7YA 1KLUD 4NNJB 3FAHA 1Y56A 1E8ZA 2BVCA 3QHTA 3APFA 2INCC 1AW7A 2FCMA 4NAWA 3DQVA 2RGFA 4REZA 3CIRB 1YIWA 2WXLA 1U4AA 1IGDA 1RFAA 3KUZA 3PZDA 1YN3A 4OW0A 2BKFA 3NVWA 1YJJA 4MM3B 3WANA 2M0XA 4BZAA 1TZOA 4CO7A 5KHQA 4TKNA 4W9EA 2BKRB 3AE2B 3NZSA 2D3AA 4JGHB 2K22A 3L10B 3IAM1 1ACCA 3ZDMC 2L83A 1GC6A 2BWES 4XZ4A 3A33B 3W9CB 3AI5A 3GE8C 1RWSA 3A9KB 1UBIA 4G0NB 2MRPA 3P4RB 5IAAC 5EDSA 2AX5A 2MJ3A 1IUEA 2N9LA 2ZNVB 3ZDTA 1SXTA 4W9LA 2K5PA 3HVZA 1SJED 4GDKA 4AP4C 5CX3A 1H8CA 1V8CA 2PLPA 4JWSC 4H2AA 1NEKB 2ZW1A 4XX5A 4KSKC 2O2VA 3H8HA 2KANA 4HEA1 4YSYB 2KWVB 1DGJA 5JH5C 1V81A 1C78A 3RUIB 3DDCB 1KLGD 3TL5A 1YOVB 3OJ3A 3QA8A 3KWLA 1P0RA 4D2KA 3NHEB 4S17A 1GJZA 1LM8B 4RM9A 4DQOC 2BYFA 2NVUI 2EMTA 1UNSA 3GOEA 1BT0A 2IBIB 2BYTA 3R2TA 3UINB 4BBNF 3SFDB 4M8NA 2N1VA 2AQ1B 2KVRA 2BYVE 2Y3AA 4ZHPA 4LNFA 3N1XC 1Q10A 2DZJA 1QOAA 1C76A 3ZJTA 3KYCD 3L16A 3T8MA 1QLBB 2C7HA 2LZ6A 4FA6A 3DWGC 3EUB2 1HZ6A 2EELA 1KF6B 1FNVA 4WJOA 5CHWA 3UF8A 4FADA 4IUMB 1L2NA 4MJSB 4LK0M 2INPE 1V6EA 2WHIA 1FD6A 4ARIA 1FCCC 2ICIA 1LFDA 1WE6A 2X38A 1VR9A 3FKYA 1FIQA 1RYJA 4X57B 1GAQB 3RI7C 1EO6A 4XC2A 1WYGA 1YN5A 4OZAA 3AN1A 4DXAB 1J0GA 4XYCA 3TMPB 2RDBC 2HE7A 1FFUA 4TQ1A 2BGFA 2IJ0A 1OTRB 4O1NA 3U52E 4JPSA 4EUTA 3HIZA 2N1WA 4BVUC 5FK9C 4HCNB 2KDBA 4MGYE 1QOGA 2INDC 5E6NA 2LRWA 1D3ZA 1TBEA 4BOSC 4URKA 3M3JA 3Q6BA 1TKYA 2A4ZA 3VQIA 4ZHOA 3V3XA 4C4VA 4I6PA 1WXVA 3H7SA 1EU3A 3L08A 3W2DA 2LHDA 2MWSB 4ICUA 4A20A 2G1EA 1HZ5A 3QX1A 4TSSA 2DYOA 1JROA 4GOCA 4FJVB 3VAWA 5HG2A 1WGRA 1UH6A 2RPQA 2K8HA 3QAQA 2FCNA 3W1SA 3VR9B 3PS6A 2KX3A 5DPTA 5EE3A 1N60A 1IBXB 1WXSA 4HXDA 1WR1A 3O13A 1P7EA 4PS8A 1FXAA 2PW9A 2YLMA 2WDVB 5HI1A 4CHKA 3AE9B 2M4NA 2NR2A 1QZEA 4OZCA 4ARCA 4KZCA 3UQBA 1TKGA 2GBNA 1DYQA 2ZZPB 4ZYNA 3VFKA 1XQQA 1LGRA 1WH3A 4MGZE 3UGBB 2G9HD 5AUIA 3BK2A 4XDCA 2N9PC 4WWOA 3J9CA 1D6EC 5T8IA 1WSPA 2KTFA 2QCZA 1E7PB 2J0JA 5JHBA 3TEWA 4ZRQA 2CJNA 2DAJA 2ONQA 3RZWC 3N30A 3DHHC 5C23A 3DVGX 2M17A 5HHDG 1OQYA 3N1ZC 2KMAA 3EA6A 1WY8A 2KWUB 2O2VB 3UQAA 1CJEA 4LJOB 1N63A 1SBBB 2K6QA 3U30A 5MPOA 2OHFA 2IPKD 1P9DU 4NQLB 2BS2B 2KYWA 2NS5A 2V0GA 2QIEB 2MSED 3U4EG 2KFJA 1KM7A 2C5LC 1N6ZA 4I6NB 1F2RI 1V49A 2KO3A 3E56A 2FIDA 3EFCA 2L32A 1HE8A 4AJWA 1RM6C 1JWSD 1WM3A 1A70A 3APCA 1WMHA 4JQWC 3TSSA 3ZO5B 2GBMA 2JVCA 3AE1B 3A4SC 3OAWA 2N7JA 1HEZE 3BZDB 5BMHA 4LLGM 3N32A 3QARA 1I4RA 5BMGA 3MHSD 4JL9A 1ZUD2 2UWQA 1YQBA 4TV3A 4YT0B 2FNJB 1KOTA 4FHKA 3AE6B 4KKIA 1SE3A 4NPNA 3W5VB 3O65B 5H8YE 1WZ3A 2KWDA 4TMAB 4QAYA 2FUHB 1MPEA 3DBHI 1P1AA 3BYYB 4ZRIA 4DK5A 2Z0EB 5KHOA 2C7NB 3AU4A 2IO0B 4ICVA 2WXIA 1JQ4A 4RMAA 4ITKA 2MLBA 1L7YA 3JW0X 4ZOHC 1YN4A 1UZXB 2W3RA 2MP2B 3LJ3A 4ZRPA 2JYEA 2KTRA 4WWMA 2WXMA 2K39A 2JXTA 3D32A 2JQRB 1VZ7A 2W9NA 2ACZB 3GZNB 1L0YB 4EE2A 1NENB 4CQNA 2L3ZA 5D2MB 2N9KA 3NZUA 5E6JA 1WX8A 1VZ8A 2JSVX 3I63C 4KSLC 4HVBA 2K1FA 1MVKA 1JALA 3L17A 4HPLB 1R7SA 2IDYA 1V1PA 1JMLA 4XWWA 4XE0A 4C4VB 1CQVA 4FXCA 2BYEA 4HPPA 3TJPA 2JZPA 4B6WA 1IPGA 1DOYA 2WDQB 3KWVA 1E0ZA 3Q3JA 2KLGA 3AE7B 4LJPB 4C80A 4JE3B 4IKGA 1UGJA 4G3XB 3RULA 1KRHA 1VZ6A 3VVWB 2QMTA 2JRIB 2LJ5A 1SE4A 1LQBA 4IM0A 1GNUA 4A90A 4DBGA 4IM2A 3DOWA 4B95A 3AULA 1PGAA 2V3PA 1HA5A 1UELA 1PUTA 5DCNA 4JWUC 4MGKE 3EFUA 2YEPB 2D07B 2M1MA 2K3UA 2XBBC 3BVMA 4B0EA 2EMSA 1GPXA 4HCPB 5BYSA 1C4PA 1WIAA 3R7QA 4P7IA 3ZRCA 2WXNA 2WXGA 3K9OB 2PVOD 4WIPA 1FCLA 4NQKE 2BW2A 2W55A 2LGXA 1YMHE 1WGYA 1FXTB 3RYTA 1RRBA 1FM0D 4FULA 2FAZA 2KFKA 2KDIA 2NTSA 3IBEA 2PE9A 3H1UA 3Q8EA 4MELA 4WJNA 5LNK1 3SHQA 3P2BA 2Y5CA 1NVID 4A3PA 4HJGE 3VRBB 4MACA 3ZW3A 1WFYA 4N59A 2VZKB 3ZKJC 2YVCA 4OZBA 4MGIE 1FMAD 2WDRB 1XCTL 3AEEB 1SEBD 3WAOA 2L0TA 4C56C 4EOYA 2IGGA 2PMVA 4FN2A 3APDA 1Y8RC 1TYGB 3TIXA 1SB3C 5IA7A 1GB4A 4MDKE 1E10A 3IXSA 2O6VD 4E74A 3B0AA 1V86A 1YD8U 2KMMA 5D3IB 1IGCA 2E3TA 3TEYA 5C2TB 5TR5A 4MH0E 5DPRA 3C19A 1HTQA 1PQSA 1ZPSA 3RNCC 2PE6B 1NYQA 2XK5A 3PV1A 2LXCA 2PTLA 1VCBA 3AU5A 1E8XA 2V4LA 4DXGA 4WH4A 2KACA 1WXMA 2C7MB 2QC8A 1UF0A 3B2GA 2KVZA 5BYQA 3PGEA 1P3QU 1NBFC 1T0RC 1E7VA 1WZ0A 2K8CA 2BB5A 3PRZA 4BKTA 2NMQA 4DHJD 3M62B 4ANUA 3AEDB 3K9PB 2C9WB 2GOWA 2IY1B 4MSQB 2XNAC 3R2IA 1KH0A 1WGDA 2KJRA 2RR9A 4TQ0A 2BTEA 2O6VA 2CJOA 4ACFA 1C79A 1C77A 3KUCB 4W9GA 4GMVA 1T0SC 2H88B 1GOZA 3M63B 2JZ3B 4RF0A 3L4PA 4PT5A 3Q8CA 4IM3A 3PLUA 3PLVA 4R3DA 3PHXB 2NCNA 2V4IB 4GU2A 3BVGA 3AEGB 4RH6A 4EFOA 1WXAA 1EF5A 3MC0B 4LNNA 4DHZB 1A5RA 2WS3B 1ESFA 2KQ4X 3A1QB 2JYTA 2LRUA 4Q2JA 1OEYA 2MJEA 1GB1A 1AN8A 4K1RB 3ZLZA 2KOXA 3AV8A 1K8RB 1XF5L 3A9JB 2MCNB 2QILA 2M8SA 2L0FA 2J4XA 1DOIA 2L8JA 1V5OA 2JRHA 1F1HA 2DZMA 1RLFA 3SFEB 2ZPYA 1QT9A 3H7PA 1WE7A 2PVGC 2DAFA 3L54A 2KAJA 2OJRA 1LO5D 3VUWA 4A55A 1TY2A 2D5GA 3BIID 2JY6A 1V1OA 1I4HA 1Z2MA 1PDXA 3WCQA 1XXGA 1ZDVA 1OEYJ 2BWFA 2N9XA 2D3BA 2BPSA 3OJ4B 3AEAB 2J53A 4MSMB 4LNKA 1OGWA 1H4RA 4K3BA 3DBRI 2NPTA 1S3SG 3ECIA 4I6LB 1T0YA 2MH7A 2JX5A 3MTNB 1FO4A 2I1JA 4HKQA 2IGDA 3P4QB 4EKUA 1I4XA 3DBLB 3UIPB 1TY0A 2XEWA 1E90A 4WAFA 1MHXA 3AM9A 3CSTA 3BVZA 5FR3A 4ANVA 4FBJB 1JWAD 3TEXA 3RNBC 3NOBA 4A8XC 4DDID 1EF1A 2KQSA 3UI3A 1ZDXA 2CU1A 3ML8A 4BAXA 3PTFC 4EZJA 2WNMA 1JWUD 3JSVA 2AQ2B 1IYFA 1HQRD 3LYYA 4W9KA 4YSZB 3HM6X 1L4ZB 1SJHD 3HM3A 4GDLB 4NZLB 2HJ8A 1G6JA 1GC7A 3H9DA 4KGSA 3Q8BA 2YEPF 2ASQA 2D11A 2XN9C 4ZRJA 2H89B 3I9V1 1FNUA 1F52A 1MFWA 1WJ6A 4TUUA 2IGHA 3SEBA 1N5XA 3RNAC 2JZZA 4NAWB 4WJQA 4M0WA 4JLCA 1CK1A 2RDHA 5BYRA 3L0WB 3QIJA 2AL3A 1UWMA 2IY0B 1WJ4A 2XK5B 3KUDB 4IDIA 2M56B 3ONSA 4B0MA 3VH4B 4KKJA 4PYZA 5AEKB 1TS5A 2GBJA 4M02A 2PIAA 3DBSA 2FUG1 3AMZA 3EC8A 4OVUA 2RMMA 3ZJUA 4YTNB 2FCQA 4G50A 4EZKA 2MBEA 1C3TA 1X1MA 1I42A 2L76A 4OVZA 1WJNA 2KC2A 2GI9A 4FLHA 3CF6E 2G4DB 5JZEB 4GB9A 2LI5A 5G2NA 5EE1A 2J0KA 2C60A 3PZ8A 2MJDA 1WX7A 3R66C 1WI0A 4GDKB 1FXIA 2JXXA 1I4GA 5HKHA 2W82A 2EKIA 2KZRA 3ZVVA 4P1BC 2LMCA 2IO3B 5CHFA 2PEAA 4US8A 3FILA 1N61A 3T3NA 3MHZA 2V3SA 1YQ4B 1V5TA 2JUOA 4W9CA 3EGRA 3NS8A 1R4NB 3HVDA 3AH7A 4UDUC 3DBLI 1WGKA 4PYUA 3LB8C 4JX1C 3RNEC 2FIFA 4EZLA 2X8XX 1L0VB 2AQ3B 3PRPB 1ZGUB 2BQQA 2DWQA 3RMKC 2K0PA 3GS2A 3SU8X 3ZJVA 2QJLA 4BFRA 4ZRKA 1J7AA 1TS3A 1Q1OA 2J7QB 3H7PB 3ZRFA 1L6VA 1SGHA 5IP4D 2J42A 2KQ7A 3PHWB 5GXGB 1C4CA 4KVGB
chains in the Genus database with same CATH topology
3VUXA 4GDKA 2NBUA 3ZRCA 4AP4C 5CX3A 3MJWA 1M94A 1TZ1A 2L7RA 3WAPA 2LVPA 1H8CA 3K9OB 3Q3FA 4DDGD 1TTNA 4IWQA 5J2RA 3X0WA 4XX5A 4KSKC 4A3OA 2O2VA 2KANA 4NQKE 5D7GA 2KWVB 1WRDB 2LGXA 5JH5C 4MM3A 4MEMA 1V81A 3CMMB 1WGYA 2L00B 3RUIB 1FXTB 3DDCB 4KIKA 3TL5A 3TBLD 3V61A 3OJ3A 3ZNID 1C1YB 2LGDA 4HJKA 3RYTA 1RRBA 3QA8A 4FULA 2KNBA 3ENEA 2FAZA 2KFKA 1P0RA 2KDIA 2AWTA 2N4FA 4HK2A 1IP9A 3IBEA 4GN1A 4JIOU 5G55A 3NHEB 2PE9A 5DPWA 3HK0A 2IO1B 1GJZA 1LM8B 4WAAA 2K25A 4RM9A 3H1UA 4MELA 4WJNA 3U7DA 3SHQA 3P2BA 2BYFA 2NVUI 2EMTA 3GOEA 4ZDVA 4W9DA 4A3PA 5DPSA 1BT0A 2IBIB 3ZW3A 1WFYA 3DVNU 3ZKJC 4N9F4 2QHOA 2YVCA 4MGIE 5J18A 3A9KA 3IHPC 3UINB 3N3KB 1YX6B 2K6DB 2JPHA 4BBNF 4M8NA 2N1VA 2L0TA 5BO4B 3WAOA 3EECA 2KDFB 4KZ0A 4EOYA 3ZNGC 2KVRA 2I1KA 2KJ6A 2BYVE 2WYQA 3T9LA 4FN2A 2RD0A 2R2QA 4HDOA 1NI2A 2DZJA 3APDA 1Y8RC 4HDQA 1YJ1A 3QCAA 3KYCD 3L16A 3TIXA 5IA7A 2GMIC 4WQOB 2C7HA 4MDKE 2LZ6A 3T8MA 2O6VD 1CMXB 3B0AA 3B08A 4E74A 4FA6A 1V86A 1YD8U 2NBWB 1WGGA 2IZVB 2O6VB 5FR6A 1E8WA 3JVZX 4B9KA 4WJOA 2ZVNA 5TR5A 3C0RB 4MH0E 5CHWA 5DPRA 3UF8A 4HLEA 4FADA 4IUMB 1PQSA 1L2NA 4FJZA 4MJSB 4K7SA 2PE6B 1V6EA 1WM2A 4NJ6A 2G45B 2XK5A 1I35A 3PV1A 1LFDA 2KXJA 2LXCA 1WE6A 1VCBA 3AU5A 1E8XA 2V4LA 3IG3A 1SE9A 2KK8A 1WXMA 2C7MB 2DHZA 4X57B 1WF9A 2LVQA 1EO6A 4NY0A 4XC2A 2MW5A 3PGEA 1P3QU 2ZJDA 1NBFC 4DXAB 1J0GA 2LD9A 2JWZA 1E7VA 3R3MA 3TMPB 1UGMA 1WZ0A 2K8CA 4LDTD 5CHVC 4W9IA 2N9EB 3PSEB 3PRZA 4BKTA 4DHJD 3ZNHB 3B1LX 3M62B 2HE7A 4M8MA 4ANUA 4TQ1A 2BGFA 3K9PB 2C9WB 1P98A 2ZCCA 2WDTB 4DHJB 1OTRB 2NBVB 1VD2A 4RM8A 2DZKA 2GOWA 2IY1B 4LCDE 4MSQB 4AJYB 4EUTA 3HIZA 2N1WA 4BVUC 3H6NA 4HCNB 2KDBA 4MGYE 2KKCA 2B3AA 4YL8A 3WAMA 5E6NA 1WGDA 2KJRA 2RR9A 2LRWA 4GIVA 4TQ0A 1E8YA 1AARA 2ZVOA 2O6VA 3A4RA 3X23A 5GMVA 1D3ZA 1TBEA 3VH3B 1YX5B 4BOSC 1UBQA 4OVVA 3WA0A 4NJ7A 4F1SA 4URKA 3KUCB 4W9GA 4GMVA 4IWOA 1Q0WB 4KDLB 4IW0A 3M3JA 1V2YA 3ZNZB 4CYEA 1F9JA 2KWCA 3M63B 2A4ZA 4MJSA 2JZ3B 3VQIA 3V60A 2KN5A 4KV2A 4I6PA 1UD7A 4K7UA 1WXVA 4IM3A 3PLUA 2LVOA 3PLVA 2LGYA 2MQJA 3H7SA 4IG7B 3PHXB 2NCNA 4GU2A 1WX9A 3L08A 4EFOA 1WXAA 1MG8A 2MWSB 3DVGY 4ICUA 2NPTB 4E3CA 4A20A 1EF5A 4BOZB 4DHZB 1KJTA 3QX1A 1A5RA 2KC1A 3A1QB 3M95A 2FCSA 4F8CB 1V80A 2LRUA 3DPDA 4BBNC 2DYOA 2J0MA 1OEYA 4GOCA 4FJVB 4K1RB 3ZLZA 2LASA 3VAWA 2KOXA 3HHMA 3S2AA 1WGRA 1K8RB 1UH6A 2RPQA 2K8HA 3A9JB 3QAQA 2MCNB 2FCNA 4GXBA 2MBQA 1EUVB 2D10A 3W1SA 2M8SA 2DX5B 2L0FA 3PS6A 2KX3A 3SDLC 4DHZE 5DPTA 2L8JA 3VXWA 1V5OA 2JRHA 2DZMA 1WXSA 1RLFA 4J6IA 4KDIC 2CHZA 2ZPYA 2ZPNA 4HXDA 3H7PA 1WR1A 1WE7A 2A5UA 2DAFA 4PS8A 1NDDA 3L54A 2OJRA 3VUWA 3WIMA 2YLMA 3DCGA 1XD3B 2BF8B 2HD5B 3VTUA 2DYBA 4CHKA 4K81A 5D94A 2JY6A 2M4NA 1Z2MA 2NR2A 1QZEA 3ZIMA 4W9HA 4KZCA 1Q5WB 5AZFA 3QJZA 1OEYJ 2BWFA 3UQBA 1S1QB 3SD5A 2N9XA 3JSVB 2GBNA 2LWPA 2ZZPB 4ZYNA 2BPSA 2KJHB 2Y5BB 3OJ4B 5E6PA 1RAXA 3VFKA 4WWNA 4MSMB 2WX1A 1GG3A 1XQQA 1OGWA 2DZIA 1H4RA 1WGHA 1WH3A 2V1YA 2CR5A 4IC7B 4MGZE 3UGBB 3VTWA 5J17A 3V6CB 3DBRI 1Z5SB 2D3GA 2KMCA 3GZNI 2NPTA 2IYDB 3EHVA 1S3SG 2N9PC 1TGZB 3ECIA 4WWOA 1WMHB 2MBBB 4I6LB 3A1QA 1T0YA 2KTFA 5AZHA 3LDZE 2J0JA 3MTNB 5JHBA 2I1JA 4AWJA 2DAJA 2CS4A 3OLMD 3U8ZA 3RCZA 3JYUA 3RZWC 4EKUA 3N30A 3TCAA 3UIPB 5C23A 2AYOB 3DVGX 2XEWA 4ASWC 2M17A 1E90A 1OQYA 3A9JA 3CSTA 2KMAA 2PPHA 4ANVA 4FBJB 1WY8A 2KWUB 3ZUNA 2O2VB 3W1YA 3UQAA 4M0WB 4ANWA 2CHWA 2MBHA 4LJOB 3W1SC 2K6QA 4PS3A 3U30A 3PREA 1ZKHA 4IWPA 4KIKB 1R4MI 3NOBA 4GSWA 1R4NI 4WWPA 5CTRC 4DDID 4GGQA 1P9DU 1EF1A 4NQLB 2KQSA 5L95C 2Z0DB 2NS5A 2VRRB 3UIOB 3ZTCA 3I3TB 1WYWB 1ISNA 2CU1A 2G3QB 3ML8A 3QK0A 2MSED 3PTFC 4EZJA 4BKSD 2KFJA 1KM7A 4II2B 2C5LC 3CSFA 4I6NB 2OOBB 1V49A 2KO3A 3JSVA 4F7ZA 3QC8B 3L13A 2PJHA 2FIDA 2JF5A 1IYFA 1J19A 1HE8A 4W9KA 4AJWA 3HM6X 3DVNV 2REXA 1WM3A 4BKGA 3HM3A 2CKHB 4GDLB 4HPMB 4W9FA 5AZGA 2K8BA 2KTRB 2WWZA 3PRMB 3APCA 1WMHA 4JQWC 2HJ8A 2GBMA 3ZO5B 2JVCA 1G6JA 2GBRA 3A4SC 1GC7A 3H9DA 3OAWA 2ASQA 2D11A 4ZRJA 5E6OA 3KVFB 3N32A 3QARA 1WJ6A 4TUUA 3MHSD 2KX0A 5LLIA 4JL9A 4FHJA 2UWQA 1YQBA 2JZZA 2EKEC 2RSUA 3KYDD 3PPAA 4TV3A 4NAWB 2FNJB 4WJQA 5LXIB 2LUEA 4E71A 4JLCA 1KOTA 3L0WB 3QIJA 2KD0A 2MBOA 2AL3A 2ZEQA 2R2OA 4FHKA 4WJPA 4HWIB 1LXDA 3KW5B 2AEHA 3PT2B 4NPNA 4G11A 3O65B 2IY0B 1WJ4A 2XK5B 3KUDB 1WZ3A 2N7EA 3ML9A 3PVLA 3ONSA 2MA9B 1XT9B 2FUHB 3DBHI 3AXCA 3VH4B 1P1AA 1V9JA 4PYZA 4ZRIA 3RD2A 5AEKB 2L05A 4DK5A 2Z0EB 3ALBA 5KHOA 2C7NB 2GBJA 2MX2A 3AU4A 3BY4B 4FJYA 3VHTC 4AUQC 2DYMA 2G4SA 2IO0B 4ICVA 2WX0A 3DBSA 1E5WA 3EC8A 4OVUA 4RMAA 5L83A 2Z59B 2D2QA 2MLBA 1L7YA 3JW0X 1WR6E 2FCQA 5LXHA 4BKSA 4G50A 4EZKA 2MBEA 3VTVA 2LXAA 2JT4B 1C3TA 1UZXB 2HTHA 4EEWA 5C1ZA 3QWZB 1X1MA 1I42A 2MP2B 3KH0A 3LJ3A 1JRUA 2L76A 3QQ8B 4GDLA 4ANXA 3IFWB 2KTRA 2N7DA 1GUAB 3BINA 3V6EB 1WJNA 2KC2A 4FLHA 3CF6E 2G4DB 2K39A 5JZEB 3ZTDA 3D32A 1SIFA 4K7WA 4GB9A 2LI5A 1J8CA 2W9NA 2IO2B 5G2NA 1E7UA 4AOFA 2J0KA 3RZFA 2C60A 4NNJB 5JHAA 2L3ZA 5D2MB 3VUYA 1WX7A 2UYZB 2ZCBA 2CHXA 1E8ZA 3NZUA 3QHTA 3R66C 3NY5A 3APFA 1WX8A 2DENB 3RT3B 1WI0A 1ZW7A 3VDZA 2FCMA 4GDKB 3DQVA 4KSLC 4NAWA 4HVBA 2JXXA 2K1FA 2RGFA 5HKHA 2AL6A 1YIWA 3L17A 1KLVA 3ZVVA 2KZRA 1U4AA 4HPLB 1RFAA 3KUZA 2IO3B 5CHFA 3PZDA 2PEAA 3R7RA 2V3SA 2BKFA 2BYEA 3TJPA 4B6WA 1V5TA 3WANA 1IPGA 2JUOA 4W9CA 2M0XA 3Q3JA 2KLGA 4LJPB 4CO7A 3NS8A 5KHQA 4TKNA 4G3XB 3RULA 3DBLI 4W9EA 2KFKB 2BKRB 3NZSA 3VVWB 3WALA 4JGHB 2JRIB 2LJ5A 1LQBA 4IM0A 1GNUA 4PYUA 3L10B 4IM2A 4DBGA 3DOWA 4B95A 3AULA 2FIFA 2GBKA 3ZDMC 2MP2A 4DWFA 1UELA 5DCNA 1WJUA 4EZLA 4W9JA 1GC6A 3PRPB 2BWES 1ZGUB 4LDTB 4XZ4A 3A33B 2KDEB 3SU8X 3AI5A 4MGKE 3EFUA 3A9KB 4BFRA 1UBIA 2D07B 4G0NB 2MRPA 2M1MA 2XBBC 4ZRKA 3V62A 4PS7A 2ZNVC 1Q1OA 2EMSA 2J7QB 2KLCA 3H7PB 4HCPB 4II3B 2KHWB 5IAAC 3ZRFA 5EDSA 5D6JB 1SGHA 1WIAA 2KQ7A 2ZNVB 3PHWB 3R7QA 4P7IA 4KVGB 4W9LA 3ZDTA 3IVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUX A;  4GDK A;  2NBU A;  3ZRC A;  4AP4 C;  5CX3 A;  3MJW A;  1M94 A;  1TZ1 A;  2L7R A;  3WAP A;  2LVP A;  1H8C A;  3K9O B;  3Q3F A;  4DDG D;  1TTN A;  4IWQ A;  5J2R A;  3X0W A;  4XX5 A;  4KSK C;  4A3O A;  2O2V A;  2KAN A;  4NQK E;  5D7G A;  2KWV B;  1WRD B;  2LGX A;  5JH5 C;  4MM3 A;  4MEM A;  1V81 A;  3CMM B;  1WGY A;  2L00 B;  3RUI B;  1FXT B;  3DDC B;  4KIK A;  3TL5 A;  3TBL D;  3V61 A;  3OJ3 A;  3ZNI D;  1C1Y B;  2LGD A;  4HJK A;  3RYT A;  1RRB A;  3QA8 A;  4FUL A;  2KNB A;  3ENE A;  2FAZ A;  2KFK A;  1P0R A;  2KDI A;  2AWT A;  2N4F A;  4HK2 A;  1IP9 A;  3IBE A;  4GN1 A;  4JIO U;  5G55 A;  3NHE B;  2PE9 A;  5DPW A;  3HK0 A;  2IO1 B;  1GJZ A;  1LM8 B;  4WAA A;  2K25 A;  4RM9 A;  3H1U A;  4MEL A;  4WJN A;  3U7D A;  3SHQ A;  3P2B A;  2BYF A;  2NVU I;  2EMT A;  3GOE A;  4ZDV A;  4W9D A;  4A3P A;  5DPS A;  1BT0 A;  2IBI B;  3ZW3 A;  1WFY A;  3DVN U;  3ZKJ C;  4N9F 4;  2QHO A;  2YVC A;  4MGI E;  5J18 A;  3A9K A;  3IHP C;  3UIN B;  3N3K B;  1YX6 B;  2K6D B;  2JPH A;  4BBN F;  4M8N A;  2N1V A;  2L0T A;  5BO4 B;  3WAO A;  3EEC A;  2KDF B;  4KZ0 A;  4EOY A;  3ZNG C;  2KVR A;  2I1K A;  2KJ6 A;  2BYV E;  2WYQ A;  3T9L A;  4FN2 A;  2RD0 A;  2R2Q A;  4HDO A;  1NI2 A;  2DZJ A;  3APD A;  1Y8R C;  4HDQ A;  1YJ1 A;  3QCA A;  3KYC D;  3L16 A;  3TIX A;  5IA7 A;  2GMI C;  4WQO B;  2C7H A;  4MDK E;  2LZ6 A;  3T8M A;  2O6V D;  1CMX B;  3B0A A;  3B08 A;  4E74 A;  4FA6 A;  1V86 A;  1YD8 U;  2NBW B;  1WGG A;  2IZV B;  2O6V B;  5FR6 A;  1E8W A;  3JVZ X;  4B9K A;  4WJO A;  2ZVN A;  5TR5 A;  3C0R B;  4MH0 E;  5CHW A;  5DPR A;  3UF8 A;  4HLE A;  4FAD A;  4IUM B;  1PQS A;  1L2N A;  4FJZ A;  4MJS B;  4K7S A;  2PE6 B;  1V6E A;  1WM2 A;  4NJ6 A;  2G45 B;  2XK5 A;  1I35 A;  3PV1 A;  1LFD A;  2KXJ A;  2LXC A;  1WE6 A;  1VCB A;  3AU5 A;  1E8X A;  2V4L A;  3IG3 A;  1SE9 A;  2KK8 A;  1WXM A;  2C7M B;  2DHZ A;  4X57 B;  1WF9 A;  2LVQ A;  1EO6 A;  4NY0 A;  4XC2 A;  2MW5 A;  3PGE A;  1P3Q U;  2ZJD A;  1NBF C;  4DXA B;  1J0G A;  2LD9 A;  2JWZ A;  1E7V A;  3R3M A;  3TMP B;  1UGM A;  1WZ0 A;  2K8C A;  4LDT D;  5CHV C;  4W9I A;  2N9E B;  3PSE B;  3PRZ A;  4BKT A;  4DHJ D;  3ZNH B;  3B1L X;  3M62 B;  2HE7 A;  4M8M A;  4ANU A;  4TQ1 A;  2BGF A;  3K9P B;  2C9W B;  1P98 A;  2ZCC A;  2WDT B;  4DHJ B;  1OTR B;  2NBV B;  1VD2 A;  4RM8 A;  2DZK A;  2GOW A;  2IY1 B;  4LCD E;  4MSQ B;  4AJY B;  4EUT A;  3HIZ A;  2N1W A;  4BVU C;  3H6N A;  4HCN B;  2KDB A;  4MGY E;  2KKC A;  2B3A A;  4YL8 A;  3WAM A;  5E6N A;  1WGD A;  2KJR A;  2RR9 A;  2LRW A;  4GIV A;  4TQ0 A;  1E8Y A;  1AAR A;  2ZVO A;  2O6V A;  3A4R A;  3X23 A;  5GMV A;  1D3Z A;  1TBE A;  3VH3 B;  1YX5 B;  4BOS C;  1UBQ A;  4OVV A;  3WA0 A;  4NJ7 A;  4F1S A;  4URK A;  3KUC B;  4W9G A;  4GMV A;  4IWO A;  1Q0W B;  4KDL B;  4IW0 A;  3M3J A;  1V2Y A;  3ZNZ B;  4CYE A;  1F9J A;  2KWC A;  3M63 B;  2A4Z A;  4MJS A;  2JZ3 B;  3VQI A;  3V60 A;  2KN5 A;  4KV2 A;  4I6P A;  1UD7 A;  4K7U A;  1WXV A;  4IM3 A;  3PLU A;  2LVO A;  3PLV A;  2LGY A;  2MQJ A;  3H7S A;  4IG7 B;  3PHX B;  2NCN A;  4GU2 A;  1WX9 A;  3L08 A;  4EFO A;  1WXA A;  1MG8 A;  2MWS B;  3DVG Y;  4ICU A;  2NPT B;  4E3C A;  4A20 A;  1EF5 A;  4BOZ B;  4DHZ B;  1KJT A;  3QX1 A;  1A5R A;  2KC1 A;  3A1Q B;  3M95 A;  2FCS A;  4F8C B;  1V80 A;  2LRU A;  3DPD A;  4BBN C;  2DYO A;  2J0M A;  1OEY A;  4GOC A;  4FJV B;  4K1R B;  3ZLZ A;  2LAS A;  3VAW A;  2KOX A;  3HHM A;  3S2A A;  1WGR A;  1K8R B;  1UH6 A;  2RPQ A;  2K8H A;  3A9J B;  3QAQ A;  2MCN B;  2FCN A;  4GXB A;  2MBQ A;  1EUV B;  2D10 A;  3W1S A;  2M8S A;  2DX5 B;  2L0F A;  3PS6 A;  2KX3 A;  3SDL C;  4DHZ E;  5DPT A;  2L8J A;  3VXW A;  1V5O A;  2JRH A;  2DZM A;  1WXS A;  1RLF A;  4J6I A;  4KDI C;  2CHZ A;  2ZPY A;  2ZPN A;  4HXD A;  3H7P A;  1WR1 A;  1WE7 A;  2A5U A;  2DAF A;  4PS8 A;  1NDD A;  3L54 A;  2OJR A;  3VUW A;  3WIM A;  2YLM A;  3DCG A;  1XD3 B;  2BF8 B;  2HD5 B;  3VTU A;  2DYB A;  4CHK A;  4K81 A;  5D94 A;  2JY6 A;  2M4N A;  1Z2M A;  2NR2 A;  1QZE A;  3ZIM A;  4W9H A;  4KZC A;  1Q5W B;  5AZF A;  3QJZ A;  1OEY J;  2BWF A;  3UQB A;  1S1Q B;  3SD5 A;  2N9X A;  3JSV B;  2GBN A;  2LWP A;  2ZZP B;  4ZYN A;  2BPS A;  2KJH B;  2Y5B B;  3OJ4 B;  5E6P A;  1RAX A;  3VFK A;  4WWN A;  4MSM B;  2WX1 A;  1GG3 A;  1XQQ A;  1OGW A;  2DZI A;  1H4R A;  1WGH A;  1WH3 A;  2V1Y A;  2CR5 A;  4IC7 B;  4MGZ E;  3UGB B;  3VTW A;  5J17 A;  3V6C B;  3DBR I;  1Z5S B;  2D3G A;  2KMC A;  3GZN I;  2NPT A;  2IYD B;  3EHV A;  1S3S G;  2N9P C;  1TGZ B;  3ECI A;  4WWO A;  1WMH B;  2MBB B;  4I6L B;  3A1Q A;  1T0Y A;  2KTF A;  5AZH A;  3LDZ E;  2J0J A;  3MTN B;  5JHB A;  2I1J A;  4AWJ A;  2DAJ A;  2CS4 A;  3OLM D;  3U8Z A;  3RCZ A;  3JYU A;  3RZW C;  4EKU A;  3N30 A;  3TCA A;  3UIP B;  5C23 A;  2AYO B;  3DVG X;  2XEW A;  4ASW C;  2M17 A;  1E90 A;  1OQY A;  3A9J A;  3CST A;  2KMA A;  2PPH A;  4ANV A;  4FBJ B;  1WY8 A;  2KWU B;  3ZUN A;  2O2V B;  3W1Y A;  3UQA A;  4M0W B;  4ANW A;  2CHW A;  2MBH A;  4LJO B;  3W1S C;  2K6Q A;  4PS3 A;  3U30 A;  3PRE A;  1ZKH A;  4IWP A;  4KIK B;  1R4M I;  3NOB A;  4GSW A;  1R4N I;  4WWP A;  5CTR C;  4DDI D;  4GGQ A;  1P9D U;  1EF1 A;  4NQL B;  2KQS A;  5L95 C;  2Z0D B;  2NS5 A;  2VRR B;  3UIO B;  3ZTC A;  3I3T B;  1WYW B;  1ISN A;  2CU1 A;  2G3Q B;  3ML8 A;  3QK0 A;  2MSE D;  3PTF C;  4EZJ A;  4BKS D;  2KFJ A;  1KM7 A;  4II2 B;  2C5L C;  3CSF A;  4I6N B;  2OOB B;  1V49 A;  2KO3 A;  3JSV A;  4F7Z A;  3QC8 B;  3L13 A;  2PJH A;  2FID A;  2JF5 A;  1IYF A;  1J19 A;  1HE8 A;  4W9K A;  4AJW A;  3HM6 X;  3DVN V;  2REX A;  1WM3 A;  4BKG A;  3HM3 A;  2CKH B;  4GDL B;  4HPM B;  4W9F A;  5AZG A;  2K8B A;  2KTR B;  2WWZ A;  3PRM B;  3APC A;  1WMH A;  4JQW C;  2HJ8 A;  2GBM A;  3ZO5 B;  2JVC A;  1G6J A;  2GBR A;  3A4S C;  1GC7 A;  3H9D A;  3OAW A;  2ASQ A;  2D11 A;  4ZRJ A;  5E6O A;  3KVF B;  3N32 A;  3QAR A;  1WJ6 A;  4TUU A;  3MHS D;  2KX0 A;  5LLI A;  4JL9 A;  4FHJ A;  2UWQ A;  1YQB A;  2JZZ A;  2EKE C;  2RSU A;  3KYD D;  3PPA A;  4TV3 A;  4NAW B;  2FNJ B;  4WJQ A;  5LXI B;  2LUE A;  4E71 A;  4JLC A;  1KOT A;  3L0W B;  3QIJ A;  2KD0 A;  2MBO A;  2AL3 A;  2ZEQ A;  2R2O A;  4FHK A;  4WJP A;  4HWI B;  1LXD A;  3KW5 B;  2AEH A;  3PT2 B;  4NPN A;  4G11 A;  3O65 B;  2IY0 B;  1WJ4 A;  2XK5 B;  3KUD B;  1WZ3 A;  2N7E A;  3ML9 A;  3PVL A;  3ONS A;  2MA9 B;  1XT9 B;  2FUH B;  3DBH I;  3AXC A;  3VH4 B;  1P1A A;  1V9J A;  4PYZ A;  4ZRI A;  3RD2 A;  5AEK B;  2L05 A;  4DK5 A;  2Z0E B;  3ALB A;  5KHO A;  2C7N B;  2GBJ A;  2MX2 A;  3AU4 A;  3BY4 B;  4FJY A;  3VHT C;  4AUQ C;  2DYM A;  2G4S A;  2IO0 B;  4ICV A;  2WX0 A;  3DBS A;  1E5W A;  3EC8 A;  4OVU A;  4RMA A;  5L83 A;  2Z59 B;  2D2Q A;  2MLB A;  1L7Y A;  3JW0 X;  1WR6 E;  2FCQ A;  5LXH A;  4BKS A;  4G50 A;  4EZK A;  2MBE A;  3VTV A;  2LXA A;  2JT4 B;  1C3T A;  1UZX B;  2HTH A;  4EEW A;  5C1Z A;  3QWZ B;  1X1M A;  1I42 A;  2MP2 B;  3KH0 A;  3LJ3 A;  1JRU A;  2L76 A;  3QQ8 B;  4GDL A;  4ANX A;  3IFW B;  2KTR A;  2N7D A;  1GUA B;  3BIN A;  3V6E B;  1WJN A;  2KC2 A;  4FLH A;  3CF6 E;  2G4D B;  2K39 A;  5JZE B;  3ZTD A;  3D32 A;  1SIF A;  4K7W A;  4GB9 A;  2LI5 A;  1J8C A;  2W9N A;  2IO2 B;  5G2N A;  1E7U A;  4AOF A;  2J0K A;  3RZF A;  2C60 A;  4NNJ B;  5JHA A;  2L3Z A;  5D2M B;  3VUY A;  1WX7 A;  2UYZ B;  2ZCB A;  2CHX A;  1E8Z A;  3NZU A;  3QHT A;  3R66 C;  3NY5 A;  3APF A;  1WX8 A;  2DEN B;  3RT3 B;  1WI0 A;  1ZW7 A;  3VDZ A;  2FCM A;  4GDK B;  3DQV A;  4KSL C;  4NAW A;  4HVB A;  2JXX A;  2K1F A;  2RGF A;  5HKH A;  2AL6 A;  1YIW A;  3L17 A;  1KLV A;  3ZVV A;  2KZR A;  1U4A A;  4HPL B;  1RFA A;  3KUZ A;  2IO3 B;  5CHF A;  3PZD A;  2PEA A;  3R7R A;  2V3S A;  2BKF A;  2BYE A;  3TJP A;  4B6W A;  1V5T A;  3WAN A;  1IPG A;  2JUO A;  4W9C A;  2M0X A;  3Q3J A;  2KLG A;  4LJP B;  4CO7 A;  3NS8 A;  5KHQ A;  4TKN A;  4G3X B;  3RUL A;  3DBL I;  4W9E A;  2KFK B;  2BKR B;  3NZS A;  3VVW B;  3WAL A;  4JGH B;  2JRI B;  2LJ5 A;  1LQB A;  4IM0 A;  1GNU A;  4PYU A;  3L10 B;  4IM2 A;  4DBG A;  3DOW A;  4B95 A;  3AUL A;  2FIF A;  2GBK A;  3ZDM C;  2MP2 A;  4DWF A;  1UEL A;  5DCN A;  1WJU A;  4EZL A;  4W9J A;  1GC6 A;  3PRP B;  2BWE S;  1ZGU B;  4LDT B;  4XZ4 A;  3A33 B;  2KDE B;  3SU8 X;  3AI5 A;  4MGK E;  3EFU A;  3A9K B;  4BFR A;  1UBI A;  2D07 B;  4G0N B;  2MRP A;  2M1M A;  2XBB C;  4ZRK A;  3V62 A;  4PS7 A;  2ZNV C;  1Q1O A;  2EMS A;  2J7Q B;  2KLC A;  3H7P B;  4HCP B;  4II3 B;  2KHW B;  5IAA C;  3ZRF A;  5EDS A;  5D6J B;  1SGH A;  1WIA A;  2KQ7 A;  2ZNV B;  3PHW B;  3R7Q A;  4P7I A;  4KVG B;  4W9L A;  3ZDT A;  3IVF A; 
#chains in the Genus database with same CATH topology
 4KGT A;  2NBU A;  3MJW A;  3TUO A;  3WAP A;  2LVP A;  3Q3F A;  4DDG D;  1TTN A;  4IWQ A;  3Q3M C;  1JRP A;  3P1M A;  2OJW A;  4MM3 A;  4MEM A;  1F0Z A;  2L00 B;  4ZYS A;  4KIK A;  3V61 A;  3U7Z A;  3TBL D;  1C1Y B;  4HJK A;  4RFB A;  2WU5 B;  4L2Y A;  1SF0 A;  2AWT A;  4HK2 A;  1L4D B;  1IP9 A;  4GN1 A;  3AEC B;  4JIO U;  5DPW A;  3HK0 A;  4WAA A;  4RGN A;  1QOF A;  3AE8 B;  4YSX B;  3U7D A;  4ZDV A;  4W9D A;  3VRA B;  2Z8L A;  1I4Q A;  4S0R A;  2HTM E;  4N9F 4;  2QHO A;  5I4D A;  4USA A;  3A9K A;  3IHP C;  4WUR A;  3N3K B;  1YX6 B;  5BO4 B;  4KZ0 A;  1EWC A;  2LUM A;  2BBC A;  2KJ6 A;  2WYQ A;  2RD0 A;  2R2Q A;  4HDO A;  1NI2 A;  4HDQ A;  1YJ1 A;  3QCA A;  4WQO B;  2NTT A;  4YWG G;  1OFF A;  1WGG A;  1ZE3 D;  2QEJ C;  1NYR A;  1E8W A;  1ZXI A;  2ZVN A;  1DOX A;  1PYW D;  4K7S A;  2UU7 A;  2GB1 A;  1OQQ A;  1I35 A;  4RGO S;  4L1B A;  1AYF A;  3BYT B;  4LNO A;  1FPY A;  3AE3 B;  3B2F A;  3IG3 A;  5BMI A;  1SE9 A;  2DHZ A;  3BK1 A;  2LD9 A;  2JWZ A;  1BML C;  3R3M A;  4LDT D;  2LGI A;  3PSE B;  2I2Y A;  3ZNH B;  3B1L X;  4M8M A;  1PGX A;  4XGA B;  5HFY A;  2ZCC A;  2WDT B;  1E9M A;  4RM8 A;  4AJY B;  4LCD E;  1YQ3 B;  4YL8 A;  3WAM A;  1AAR A;  3A4R A;  3X23 A;  2SAK A;  3MC8 A;  3VH3 B;  1YX5 B;  2M19 A;  5IOI A;  4NJ7 A;  4F1S A;  4IWO A;  4IW0 A;  2KWC A;  4MJS A;  2BT6 A;  3V60 A;  3E9S A;  4KV2 A;  2Y5P A;  1MI0 A;  1VJK A;  1TS2 A;  3DWM A;  5EE0 A;  3DVG Y;  2N0S B;  4E3C A;  4BOZ B;  1KJT A;  1QOB A;  1V80 A;  3DPD A;  4BBN C;  4YXD B;  1K50 A;  1AWD A;  2LGS A;  3NS1 A;  4OHJ A;  3GE3 C;  2WQY B;  2WXO A;  1T3Q A;  4GXB A;  2WU2 B;  4DHZ E;  3P4S B;  4P6V F;  3NJT A;  4J6I A;  1L6U A;  4KDI C;  2CHZ A;  2ZPN A;  2BB6 A;  4RCO A;  4RGM A;  5FKA C;  3I57 A;  4HRS A;  2OED A;  1UWX A;  1XD3 B;  3Q14 C;  2LHE A;  2HD5 B;  2DYB A;  1B9R A;  4K81 A;  5JXV A;  2GLS A;  3ZIM A;  4W9H A;  1Q5W B;  3QJZ A;  1S1Q B;  4M01 A;  3W5U B;  1I4P A;  2KJH B;  2Y5B B;  1RAX A;  2WX1 A;  4IC7 B;  2V1Y A;  2CR5 A;  5J17 A;  1V97 A;  3V6C B;  2KMC A;  3GZN I;  1VLB A;  1SIJ A;  2IYD B;  3EHV A;  3P63 A;  2TSS A;  2RDG A;  1WMH B;  3P42 A;  2KDM A;  3Q8A A;  4C00 A;  2DBY A;  4US9 A;  2CS4 A;  3RCZ A;  3JYU A;  3TCA A;  3RNF C;  3CWI A;  2PPH A;  2L52 A;  2WGS A;  1TKE A;  3W1Y A;  4HRO A;  5AUK A;  4ANW A;  1IBX A;  2MBH A;  3W1S C;  1C9F A;  4M00 A;  4PS3 A;  2L1A A;  4IWP A;  4KIK B;  4NAM A;  4GSW A;  4GGQ A;  2Z0D B;  1F77 A;  5C3J B;  3VR8 B;  3ZTC A;  3I3T B;  1RFK A;  1D4B A;  2G3Q B;  3RN9 C;  2FBW B;  4II2 B;  1YJI A;  3CSF A;  5H92 C;  3QC8 B;  3L13 A;  5IKC M;  2WXK A;  2J52 A;  2WLB A;  4L23 A;  2CKH B;  3DHG C;  4W9F A;  5AZG A;  2K8B A;  1WWT A;  2KTR B;  3PRM B;  4WQM A;  1OQR A;  2GBR A;  1ZOY B;  1XLO A;  5E6O A;  3PZ7 A;  1B1Z A;  3ZYY X;  2SEB D;  3NUH B;  3NVZ A;  4YTM B;  1SSN A;  2RSU A;  3KYD D;  3PPA A;  2LUE A;  4E71 A;  1NI3 A;  2K9X A;  2D3C A;  2ZEQ A;  4HWI B;  1LXD A;  1V1P B;  3KW5 B;  3PT2 B;  4G11 A;  3ML9 A;  2N7E A;  2BS3 B;  2MA9 B;  1XT9 B;  3AXC A;  1V9J A;  1YNT E;  3RD2 A;  2L05 A;  3MC9 A;  4AUQ C;  5G5G A;  1N5W A;  2G4S A;  2WX0 A;  2BS4 B;  1EU4 A;  2Z59 B;  1T6B X;  4A6Q A;  5D3D A;  3VTV A;  2JT4 B;  2HTH A;  5C1Z A;  3QWZ B;  3KH0 A;  1HTO A;  4ANX A;  3IFW B;  3BIN A;  1GUA B;  3V6E B;  3N9Y C;  3DHI C;  1J8C A;  4AOF A;  3RZF A;  3LXF A;  5JHA A;  3NG0 A;  4A9A A;  3VUY A;  2UYZ B;  1QF6 A;  2HJ1 A;  2I38 A;  2ZCB A;  2CHX A;  4KGR A;  1ROE A;  3MJ5 A;  3NY5 A;  2WXH A;  2DEN B;  3RT3 B;  1ZW7 A;  3HUI A;  3VDZ A;  3T3O A;  3URY A;  2KN4 A;  2MEK A;  1I7H A;  2AL6 A;  1KLV A;  3PO0 A;  4MH8 A;  1XEE A;  4RGT A;  4J3O D;  3R7R A;  1XLN A;  4LNI A;  1P7F A;  4C7Z A;  5TSS A;  2KFK B;  1M4V A;  3WAL A;  4RF1 A;  1SE2 A;  1MJD A;  2GBK A;  2MP2 A;  4DWF A;  1WJU A;  4W9J A;  4LDT B;  2KDE B;  4NJC A;  2KT7 A;  2V3N A;  3V62 A;  4PS7 A;  2ON8 A;  2ZNV C;  4II3 B;  2KLC A;  2KHW B;  5D6J B;  2DNF A;  3IVF A;  3VUX A;  1L5P A;  1M94 A;  1TZ1 A;  2INN E;  2L7R A;  4K3C A;  3NVY A;  1QQR A;  2JWU A;  2ZW0 A;  1QIL A;  1N62 A;  5J2R A;  3X0W A;  2CU3 A;  4A3O A;  5D7G A;  1WRD B;  3N20 C;  3CMM B;  1STE A;  3ZNI D;  2LGD A;  1JCK B;  1XCQ L;  2KNB A;  3ENE A;  2N4F A;  3DBH B;  2WXQ A;  3ETR A;  1HXY D;  1K53 A;  1EWY C;  2VH1 A;  5G55 A;  1KTK A;  2IO1 B;  2K25 A;  1BUI C;  2VZK D;  1K52 A;  5DPS A;  3RPF C;  4P16 A;  3DVN U;  5J18 A;  1WRI A;  2JPH A;  2K6D B;  1FNW A;  4LTU A;  3EEC A;  2KDF B;  3ZNG C;  2I1K A;  3T9L A;  1TIF A;  3ABV B;  3BWU D;  1JWM D;  1J7C A;  2GMI C;  3ZGZ A;  4P1C C;  1CMX B;  3B08 A;  2V9H A;  2NBW B;  2M0A A;  2IZV B;  1FEH A;  2O6V B;  4MT5 A;  5FR6 A;  2PKO A;  3JVZ X;  3IAS 1;  4B9K A;  5IO9 A;  1ZXH A;  3C0R B;  4HLE A;  3IT6 B;  4FJZ A;  4NJ6 A;  1WM2 A;  2G45 B;  2KXJ A;  1R4M B;  3V05 A;  1PFD A;  2W54 A;  2KK8 A;  3IT4 B;  1WF9 A;  2LVQ A;  4NY0 A;  2MHJ A;  2MW5 A;  2ZJD A;  3GB1 A;  3P4P B;  1F2R C;  1UGM A;  5CHV C;  4W9I A;  3NRZ A;  2N9E B;  2VH2 A;  1JWB D;  3C8Y A;  4RNA A;  1P98 A;  4DHJ B;  2NBV B;  1VD2 A;  3Q8F A;  2DZK A;  2E6X A;  3H6N A;  2KKC A;  2B3A A;  2W3S A;  4GIV A;  1E8Y A;  2ZVO A;  5GMV A;  2GRI A;  4DXF A;  1UBQ A;  1ET9 A;  1XO3 A;  1ZP0 B;  4OVV A;  3WA0 A;  1MG4 A;  1PGB A;  1ET6 A;  1Q0W B;  4KDL B;  3TEZ A;  3ZNZ B;  1V2Y A;  4CYE A;  1F9J A;  2KN5 A;  3R8B A;  1UD7 A;  4K7U A;  3ZQ4 A;  2LVO A;  2LGY A;  2MQJ A;  4IG7 B;  3RNG C;  2LJI A;  1WX9 A;  1MG8 A;  2NPT B;  3Q3O C;  1QKZ A;  2KC1 A;  3M95 A;  3HRD D;  2FCS A;  4F8C B;  2J0M A;  2RPV A;  4N6E B;  1E6E B;  3AEB B;  1CZP A;  2LAS A;  3HHM A;  3S2A A;  5IN7 A;  2Q5W D;  3MP9 A;  2WP9 B;  2MBQ A;  1EUV B;  2D10 A;  3Q69 A;  2DX5 B;  3SDL C;  3VXW A;  1VDV A;  1C4A A;  3Q3N C;  2QDF A;  1T0Q C;  2WXR A;  2A5U A;  3GP7 A;  4HKZ E;  1NDD A;  3WIM A;  3ZXR A;  3RFZ B;  3DCG A;  2FE8 A;  1FFV A;  2BF8 B;  3VTU A;  1VRA B;  5G5H A;  3AB5 A;  5D94 A;  2HDE A;  3B9J A;  5AZF A;  3N1Y C;  3SD5 A;  3JSV B;  2LWP A;  3AE4 B;  5E6P A;  4WWN A;  1GG3 A;  2DZI A;  1WGH A;  1XLQ A;  3VTW A;  4PK1 A;  1FRD A;  1Z5S B;  2D3G A;  3AE5 B;  3ZXV A;  3KLS X;  1TGZ B;  4XWT A;  2MBB B;  3A1Q A;  5AZH A;  3LDZ E;  4AWJ A;  3OLM D;  3U8Z A;  3AEF B;  1KFY B;  2AYO B;  4ASW C;  5EE9 A;  3A9J A;  2QSD A;  3ZUN A;  1D5X C;  1MHH E;  4M0W B;  2WXP A;  1JW9 D;  2CHW A;  4GLS C;  1UUP A;  3PRE A;  1ZKH A;  1R4M I;  4AQ7 A;  1R4N I;  4WWP A;  5CTR C;  4AS1 A;  3NVV A;  5L95 C;  3SR6 A;  2VRR B;  3UIO B;  1WYW B;  1ISN A;  3QK0 A;  4BKS D;  3OWE B;  2OOB B;  4F7Z A;  2PJH A;  1D5Z C;  1ENF A;  1T5X D;  2JF5 A;  1J19 A;  4XDD A;  3DVN V;  2DLB A;  2REX A;  4BKG A;  4HPM B;  2WWZ A;  3NZ3 A;  4KX6 B;  3KVF B;  2LFI A;  2KX0 A;  1WXQ A;  5LLI A;  1TT5 B;  4FHJ A;  3U2S C;  2EKE C;  5LXI B;  2KD0 A;  1L0X B;  2MBO A;  2R2O A;  4WJP A;  4IOI E;  2AEH A;  1EM7 A;  1XLP A;  3FIL B;  3PVL A;  2JU6 X;  1BXT A;  1D5M C;  2B76 B;  3FC4 A;  3ALB A;  2MX2 A;  3BY4 B;  4FJY A;  3VHT C;  2DYM A;  2WXF A;  1K51 A;  4N58 A;  1E5W A;  5L83 A;  2D2Q A;  3KQ4 A;  1WR6 E;  3OG5 A;  4BKS A;  5LXH A;  2LXA A;  4YTP B;  1J7B A;  2LEK A;  4EEW A;  3MFG A;  1JRU A;  3QQ8 B;  4GDL A;  3I5J C;  2N7D A;  2R61 A;  1FRR A;  2WXJ A;  1TJE A;  1TS4 A;  3ZTD A;  1SIF A;  4K7W A;  3DBR B;  2IO2 B;  3Q2A C;  1E7U A;  4C7Y A;  1KLU D;  4NNJ B;  3FAH A;  1Y56 A;  1E8Z A;  2BVC A;  3QHT A;  3APF A;  2INC C;  1AW7 A;  2FCM A;  4NAW A;  3DQV A;  2RGF A;  4REZ A;  3CIR B;  1YIW A;  2WXL A;  1U4A A;  1IGD A;  1RFA A;  3KUZ A;  3PZD A;  1YN3 A;  4OW0 A;  2BKF A;  3NVW A;  1YJJ A;  4MM3 B;  3WAN A;  2M0X A;  4BZA A;  1TZO A;  4CO7 A;  5KHQ A;  4TKN A;  4W9E A;  2BKR B;  3AE2 B;  3NZS A;  2D3A A;  4JGH B;  2K22 A;  3L10 B;  3IAM 1;  1ACC A;  3ZDM C;  2L83 A;  1GC6 A;  2BWE S;  4XZ4 A;  3A33 B;  3W9C B;  3AI5 A;  3GE8 C;  1RWS A;  3A9K B;  1UBI A;  4G0N B;  2MRP A;  3P4R B;  5IAA C;  5EDS A;  2AX5 A;  2MJ3 A;  1IUE A;  2N9L A;  2ZNV B;  3ZDT A;  1SXT A;  4W9L A;  2K5P A;  3HVZ A;  1SJE D;  4GDK A;  4AP4 C;  5CX3 A;  1H8C A;  1V8C A;  2PLP A;  4JWS C;  4H2A A;  1NEK B;  2ZW1 A;  4XX5 A;  4KSK C;  2O2V A;  3H8H A;  2KAN A;  4HEA 1;  4YSY B;  2KWV B;  1DGJ A;  5JH5 C;  1V81 A;  1C78 A;  3RUI B;  3DDC B;  1KLG D;  3TL5 A;  1YOV B;  3OJ3 A;  3QA8 A;  3KWL A;  1P0R A;  4D2K A;  3NHE B;  4S17 A;  1GJZ A;  1LM8 B;  4RM9 A;  4DQO C;  2BYF A;  2NVU I;  2EMT A;  1UNS A;  3GOE A;  1BT0 A;  2IBI B;  2BYT A;  3R2T A;  3UIN B;  4BBN F;  3SFD B;  4M8N A;  2N1V A;  2AQ1 B;  2KVR A;  2BYV E;  2Y3A A;  4ZHP A;  4LNF A;  3N1X C;  1Q10 A;  2DZJ A;  1QOA A;  1C76 A;  3ZJT A;  3KYC D;  3L16 A;  3T8M A;  1QLB B;  2C7H A;  2LZ6 A;  4FA6 A;  3DWG C;  3EUB 2;  1HZ6 A;  2EEL A;  1KF6 B;  1FNV A;  4WJO A;  5CHW A;  3UF8 A;  4FAD A;  4IUM B;  1L2N A;  4MJS B;  4LK0 M;  2INP E;  1V6E A;  2WHI A;  1FD6 A;  4ARI A;  1FCC C;  2ICI A;  1LFD A;  1WE6 A;  2X38 A;  1VR9 A;  3FKY A;  1FIQ A;  1RYJ A;  4X57 B;  1GAQ B;  3RI7 C;  1EO6 A;  4XC2 A;  1WYG A;  1YN5 A;  4OZA A;  3AN1 A;  4DXA B;  1J0G A;  4XYC A;  3TMP B;  2RDB C;  2HE7 A;  1FFU A;  4TQ1 A;  2BGF A;  2IJ0 A;  1OTR B;  4O1N A;  3U52 E;  4JPS A;  4EUT A;  3HIZ A;  2N1W A;  4BVU C;  5FK9 C;  4HCN B;  2KDB A;  4MGY E;  1QOG A;  2IND C;  5E6N A;  2LRW A;  1D3Z A;  1TBE A;  4BOS C;  4URK A;  3M3J A;  3Q6B A;  1TKY A;  2A4Z A;  3VQI A;  4ZHO A;  3V3X A;  4C4V A;  4I6P A;  1WXV A;  3H7S A;  1EU3 A;  3L08 A;  3W2D A;  2LHD A;  2MWS B;  4ICU A;  4A20 A;  2G1E A;  1HZ5 A;  3QX1 A;  4TSS A;  2DYO A;  1JRO A;  4GOC A;  4FJV B;  3VAW A;  5HG2 A;  1WGR A;  1UH6 A;  2RPQ A;  2K8H A;  3QAQ A;  2FCN A;  3W1S A;  3VR9 B;  3PS6 A;  2KX3 A;  5DPT A;  5EE3 A;  1N60 A;  1IBX B;  1WXS A;  4HXD A;  1WR1 A;  3O13 A;  1P7E A;  4PS8 A;  1FXA A;  2PW9 A;  2YLM A;  2WDV B;  5HI1 A;  4CHK A;  3AE9 B;  2M4N A;  2NR2 A;  1QZE A;  4OZC A;  4ARC A;  4KZC A;  3UQB A;  1TKG A;  2GBN A;  1DYQ A;  2ZZP B;  4ZYN A;  3VFK A;  1XQQ A;  1LGR A;  1WH3 A;  4MGZ E;  3UGB B;  2G9H D;  5AUI A;  3BK2 A;  4XDC A;  2N9P C;  4WWO A;  3J9C A;  1D6E C;  5T8I A;  1WSP A;  2KTF A;  2QCZ A;  1E7P B;  2J0J A;  5JHB A;  3TEW A;  4ZRQ A;  2CJN A;  2DAJ A;  2ONQ A;  3RZW C;  3N30 A;  3DHH C;  5C23 A;  3DVG X;  2M17 A;  5HHD G;  1OQY A;  3N1Z C;  2KMA A;  3EA6 A;  1WY8 A;  2KWU B;  2O2V B;  3UQA A;  1CJE A;  4LJO B;  1N63 A;  1SBB B;  2K6Q A;  3U30 A;  5MPO A;  2OHF A;  2IPK D;  1P9D U;  4NQL B;  2BS2 B;  2KYW A;  2NS5 A;  2V0G A;  2QIE B;  2MSE D;  3U4E G;  2KFJ A;  1KM7 A;  2C5L C;  1N6Z A;  4I6N B;  1F2R I;  1V49 A;  2KO3 A;  3E56 A;  2FID A;  3EFC A;  2L32 A;  1HE8 A;  4AJW A;  1RM6 C;  1JWS D;  1WM3 A;  1A70 A;  3APC A;  1WMH A;  4JQW C;  3TSS A;  3ZO5 B;  2GBM A;  2JVC A;  3AE1 B;  3A4S C;  3OAW A;  2N7J A;  1HEZ E;  3BZD B;  5BMH A;  4LLG M;  3N32 A;  3QAR A;  1I4R A;  5BMG A;  3MHS D;  4JL9 A;  1ZUD 2;  2UWQ A;  1YQB A;  4TV3 A;  4YT0 B;  2FNJ B;  1KOT A;  4FHK A;  3AE6 B;  4KKI A;  1SE3 A;  4NPN A;  3W5V B;  3O65 B;  5H8Y E;  1WZ3 A;  2KWD A;  4TMA B;  4QAY A;  2FUH B;  1MPE A;  3DBH I;  1P1A A;  3BYY B;  4ZRI A;  4DK5 A;  2Z0E B;  5KHO A;  2C7N B;  3AU4 A;  2IO0 B;  4ICV A;  2WXI A;  1JQ4 A;  4RMA A;  4ITK A;  2MLB A;  1L7Y A;  3JW0 X;  4ZOH C;  1YN4 A;  1UZX B;  2W3R A;  2MP2 B;  3LJ3 A;  4ZRP A;  2JYE A;  2KTR A;  4WWM A;  2WXM A;  2K39 A;  2JXT A;  3D32 A;  2JQR B;  1VZ7 A;  2W9N A;  2ACZ B;  3GZN B;  1L0Y B;  4EE2 A;  1NEN B;  4CQN A;  2L3Z A;  5D2M B;  2N9K A;  3NZU A;  5E6J A;  1WX8 A;  1VZ8 A;  2JSV X;  3I63 C;  4KSL C;  4HVB A;  2K1F A;  1MVK A;  1JAL A;  3L17 A;  4HPL B;  1R7S A;  2IDY A;  1V1P A;  1JML A;  4XWW A;  4XE0 A;  4C4V B;  1CQV A;  4FXC A;  2BYE A;  4HPP A;  3TJP A;  2JZP A;  4B6W A;  1IPG A;  1DOY A;  2WDQ B;  3KWV A;  1E0Z A;  3Q3J A;  2KLG A;  3AE7 B;  4LJP B;  4C80 A;  4JE3 B;  4IKG A;  1UGJ A;  4G3X B;  3RUL A;  1KRH A;  1VZ6 A;  3VVW B;  2QMT A;  2JRI B;  2LJ5 A;  1SE4 A;  1LQB A;  4IM0 A;  1GNU A;  4A90 A;  4DBG A;  4IM2 A;  3DOW A;  4B95 A;  3AUL A;  1PGA A;  2V3P A;  1HA5 A;  1UEL A;  1PUT A;  5DCN A;  4JWU C;  4MGK E;  3EFU A;  2YEP B;  2D07 B;  2M1M A;  2K3U A;  2XBB C;  3BVM A;  4B0E A;  2EMS A;  1GPX A;  4HCP B;  5BYS A;  1C4P A;  1WIA A;  3R7Q A;  4P7I A;  3ZRC A;  2WXN A;  2WXG A;  3K9O B;  2PVO D;  4WIP A;  1FCL A;  4NQK E;  2BW2 A;  2W55 A;  2LGX A;  1YMH E;  1WGY A;  1FXT B;  3RYT A;  1RRB A;  1FM0 D;  4FUL A;  2FAZ A;  2KFK A;  2KDI A;  2NTS A;  3IBE A;  2PE9 A;  3H1U A;  3Q8E A;  4MEL A;  4WJN A;  5LNK 1;  3SHQ A;  3P2B A;  2Y5C A;  1NVI D;  4A3P A;  4HJG E;  3VRB B;  4MAC A;  3ZW3 A;  1WFY A;  4N59 A;  2VZK B;  3ZKJ C;  2YVC A;  4OZB A;  4MGI E;  1FMA D;  2WDR B;  1XCT L;  3AEE B;  1SEB D;  3WAO A;  2L0T A;  4C56 C;  4EOY A;  2IGG A;  2PMV A;  4FN2 A;  3APD A;  1Y8R C;  1TYG B;  3TIX A;  1SB3 C;  5IA7 A;  1GB4 A;  4MDK E;  1E10 A;  3IXS A;  2O6V D;  4E74 A;  3B0A A;  1V86 A;  1YD8 U;  2KMM A;  5D3I B;  1IGC A;  2E3T A;  3TEY A;  5C2T B;  5TR5 A;  4MH0 E;  5DPR A;  3C19 A;  1HTQ A;  1PQS A;  1ZPS A;  3RNC C;  2PE6 B;  1NYQ A;  2XK5 A;  3PV1 A;  2LXC A;  2PTL A;  1VCB A;  3AU5 A;  1E8X A;  2V4L A;  4DXG A;  4WH4 A;  2KAC A;  1WXM A;  2C7M B;  2QC8 A;  1UF0 A;  3B2G A;  2KVZ A;  5BYQ A;  3PGE A;  1P3Q U;  1NBF C;  1T0R C;  1E7V A;  1WZ0 A;  2K8C A;  2BB5 A;  3PRZ A;  4BKT A;  2NMQ A;  4DHJ D;  3M62 B;  4ANU A;  3AED B;  3K9P B;  2C9W B;  2GOW A;  2IY1 B;  4MSQ B;  2XNA C;  3R2I A;  1KH0 A;  1WGD A;  2KJR A;  2RR9 A;  4TQ0 A;  2BTE A;  2O6V A;  2CJO A;  4ACF A;  1C79 A;  1C77 A;  3KUC B;  4W9G A;  4GMV A;  1T0S C;  2H88 B;  1GOZ A;  3M63 B;  2JZ3 B;  4RF0 A;  3L4P A;  4PT5 A;  3Q8C A;  4IM3 A;  3PLU A;  3PLV A;  4R3D A;  3PHX B;  2NCN A;  2V4I B;  4GU2 A;  3BVG A;  3AEG B;  4RH6 A;  4EFO A;  1WXA A;  1EF5 A;  3MC0 B;  4LNN A;  4DHZ B;  1A5R A;  2WS3 B;  1ESF A;  2KQ4 X;  3A1Q B;  2JYT A;  2LRU A;  4Q2J A;  1OEY A;  2MJE A;  1GB1 A;  1AN8 A;  4K1R B;  3ZLZ A;  2KOX A;  3AV8 A;  1K8R B;  1XF5 L;  3A9J B;  2MCN B;  2QIL A;  2M8S A;  2L0F A;  2J4X A;  1DOI A;  2L8J A;  1V5O A;  2JRH A;  1F1H A;  2DZM A;  1RLF A;  3SFE B;  2ZPY A;  1QT9 A;  3H7P A;  1WE7 A;  2PVG C;  2DAF A;  3L54 A;  2KAJ A;  2OJR A;  1LO5 D;  3VUW A;  4A55 A;  1TY2 A;  2D5G A;  3BII D;  2JY6 A;  1V1O A;  1I4H A;  1Z2M A;  1PDX A;  3WCQ A;  1XXG A;  1ZDV A;  1OEY J;  2BWF A;  2N9X A;  2D3B A;  2BPS A;  3OJ4 B;  3AEA B;  2J53 A;  4MSM B;  4LNK A;  1OGW A;  1H4R A;  4K3B A;  3DBR I;  2NPT A;  1S3S G;  3ECI A;  4I6L B;  1T0Y A;  2MH7 A;  2JX5 A;  3MTN B;  1FO4 A;  2I1J A;  4HKQ A;  2IGD A;  3P4Q B;  4EKU A;  1I4X A;  3DBL B;  3UIP B;  1TY0 A;  2XEW A;  1E90 A;  4WAF A;  1MHX A;  3AM9 A;  3CST A;  3BVZ A;  5FR3 A;  4ANV A;  4FBJ B;  1JWA D;  3TEX A;  3RNB C;  3NOB A;  4A8X C;  4DDI D;  1EF1 A;  2KQS A;  3UI3 A;  1ZDX A;  2CU1 A;  3ML8 A;  4BAX A;  3PTF C;  4EZJ A;  2WNM A;  1JWU D;  3JSV A;  2AQ2 B;  1IYF A;  1HQR D;  3LYY A;  4W9K A;  4YSZ B;  3HM6 X;  1L4Z B;  1SJH D;  3HM3 A;  4GDL B;  4NZL B;  2HJ8 A;  1G6J A;  1GC7 A;  3H9D A;  4KGS A;  3Q8B A;  2YEP F;  2ASQ A;  2D11 A;  2XN9 C;  4ZRJ A;  2H89 B;  3I9V 1;  1FNU A;  1F52 A;  1MFW A;  1WJ6 A;  4TUU A;  2IGH A;  3SEB A;  1N5X A;  3RNA C;  2JZZ A;  4NAW B;  4WJQ A;  4M0W A;  4JLC A;  1CK1 A;  2RDH A;  5BYR A;  3L0W B;  3QIJ A;  2AL3 A;  1UWM A;  2IY0 B;  1WJ4 A;  2XK5 B;  3KUD B;  4IDI A;  2M56 B;  3ONS A;  4B0M A;  3VH4 B;  4KKJ A;  4PYZ A;  5AEK B;  1TS5 A;  2GBJ A;  4M02 A;  2PIA A;  3DBS A;  2FUG 1;  3AMZ A;  3EC8 A;  4OVU A;  2RMM A;  3ZJU A;  4YTN B;  2FCQ A;  4G50 A;  4EZK A;  2MBE A;  1C3T A;  1X1M A;  1I42 A;  2L76 A;  4OVZ A;  1WJN A;  2KC2 A;  2GI9 A;  4FLH A;  3CF6 E;  2G4D B;  5JZE B;  4GB9 A;  2LI5 A;  5G2N A;  5EE1 A;  2J0K A;  2C60 A;  3PZ8 A;  2MJD A;  1WX7 A;  3R66 C;  1WI0 A;  4GDK B;  1FXI A;  2JXX A;  1I4G A;  5HKH A;  2W82 A;  2EKI A;  2KZR A;  3ZVV A;  4P1B C;  2LMC A;  2IO3 B;  5CHF A;  2PEA A;  4US8 A;  3FIL A;  1N61 A;  3T3N A;  3MHZ A;  2V3S A;  1YQ4 B;  1V5T A;  2JUO A;  4W9C A;  3EGR A;  3NS8 A;  1R4N B;  3HVD A;  3AH7 A;  4UDU C;  3DBL I;  1WGK A;  4PYU A;  3LB8 C;  4JX1 C;  3RNE C;  2FIF A;  4EZL A;  2X8X X;  1L0V B;  2AQ3 B;  3PRP B;  1ZGU B;  2BQQ A;  2DWQ A;  3RMK C;  2K0P A;  3GS2 A;  3SU8 X;  3ZJV A;  2QJL A;  4BFR A;  4ZRK A;  1J7A A;  1TS3 A;  1Q1O A;  2J7Q B;  3H7P B;  3ZRF A;  1L6V A;  1SGH A;  5IP4 D;  2J42 A;  2KQ7 A;  3PHW B;  5GXG B;  1C4C A;  4KVG B; 
#chains in the Genus database with same CATH homology
 3VUX A;  4GDK A;  2NBU A;  3ZRC A;  4AP4 C;  5CX3 A;  3MJW A;  1M94 A;  1TZ1 A;  2L7R A;  3WAP A;  2LVP A;  1H8C A;  3K9O B;  3Q3F A;  4DDG D;  1TTN A;  4IWQ A;  5J2R A;  3X0W A;  4XX5 A;  4KSK C;  4A3O A;  2O2V A;  2KAN A;  4NQK E;  5D7G A;  2KWV B;  1WRD B;  2LGX A;  5JH5 C;  4MM3 A;  4MEM A;  1V81 A;  3CMM B;  1WGY A;  2L00 B;  3RUI B;  1FXT B;  3DDC B;  4KIK A;  3TL5 A;  3TBL D;  3V61 A;  3OJ3 A;  3ZNI D;  1C1Y B;  2LGD A;  4HJK A;  3RYT A;  1RRB A;  3QA8 A;  4FUL A;  2KNB A;  3ENE A;  2FAZ A;  2KFK A;  1P0R A;  2KDI A;  2AWT A;  2N4F A;  4HK2 A;  1IP9 A;  3IBE A;  4GN1 A;  4JIO U;  5G55 A;  3NHE B;  2PE9 A;  5DPW A;  3HK0 A;  2IO1 B;  1GJZ A;  1LM8 B;  4WAA A;  2K25 A;  4RM9 A;  3H1U A;  4MEL A;  4WJN A;  3U7D A;  3SHQ A;  3P2B A;  2BYF A;  2NVU I;  2EMT A;  3GOE A;  4ZDV A;  4W9D A;  4A3P A;  5DPS A;  1BT0 A;  2IBI B;  3ZW3 A;  1WFY A;  3DVN U;  3ZKJ C;  4N9F 4;  2QHO A;  2YVC A;  4MGI E;  5J18 A;  3A9K A;  3IHP C;  3UIN B;  3N3K B;  1YX6 B;  2K6D B;  2JPH A;  4BBN F;  4M8N A;  2N1V A;  2L0T A;  5BO4 B;  3WAO A;  3EEC A;  2KDF B;  4KZ0 A;  4EOY A;  3ZNG C;  2KVR A;  2I1K A;  2KJ6 A;  2BYV E;  2WYQ A;  3T9L A;  4FN2 A;  2RD0 A;  2R2Q A;  4HDO A;  1NI2 A;  2DZJ A;  3APD A;  1Y8R C;  4HDQ A;  1YJ1 A;  3QCA A;  3KYC D;  3L16 A;  3TIX A;  5IA7 A;  2GMI C;  4WQO B;  2C7H A;  4MDK E;  2LZ6 A;  3T8M A;  2O6V D;  1CMX B;  3B0A A;  3B08 A;  4E74 A;  4FA6 A;  1V86 A;  1YD8 U;  2NBW B;  1WGG A;  2IZV B;  2O6V B;  5FR6 A;  1E8W A;  3JVZ X;  4B9K A;  4WJO A;  2ZVN A;  5TR5 A;  3C0R B;  4MH0 E;  5CHW A;  5DPR A;  3UF8 A;  4HLE A;  4FAD A;  4IUM B;  1PQS A;  1L2N A;  4FJZ A;  4MJS B;  4K7S A;  2PE6 B;  1V6E A;  1WM2 A;  4NJ6 A;  2G45 B;  2XK5 A;  1I35 A;  3PV1 A;  1LFD A;  2KXJ A;  2LXC A;  1WE6 A;  1VCB A;  3AU5 A;  1E8X A;  2V4L A;  3IG3 A;  1SE9 A;  2KK8 A;  1WXM A;  2C7M B;  2DHZ A;  4X57 B;  1WF9 A;  2LVQ A;  1EO6 A;  4NY0 A;  4XC2 A;  2MW5 A;  3PGE A;  1P3Q U;  2ZJD A;  1NBF C;  4DXA B;  1J0G A;  2LD9 A;  2JWZ A;  1E7V A;  3R3M A;  3TMP B;  1UGM A;  1WZ0 A;  2K8C A;  4LDT D;  5CHV C;  4W9I A;  2N9E B;  3PSE B;  3PRZ A;  4BKT A;  4DHJ D;  3ZNH B;  3B1L X;  3M62 B;  2HE7 A;  4M8M A;  4ANU A;  4TQ1 A;  2BGF A;  3K9P B;  2C9W B;  1P98 A;  2ZCC A;  2WDT B;  4DHJ B;  1OTR B;  2NBV B;  1VD2 A;  4RM8 A;  2DZK A;  2GOW A;  2IY1 B;  4LCD E;  4MSQ B;  4AJY B;  4EUT A;  3HIZ A;  2N1W A;  4BVU C;  3H6N A;  4HCN B;  2KDB A;  4MGY E;  2KKC A;  2B3A A;  4YL8 A;  3WAM A;  5E6N A;  1WGD A;  2KJR A;  2RR9 A;  2LRW A;  4GIV A;  4TQ0 A;  1E8Y A;  1AAR A;  2ZVO A;  2O6V A;  3A4R A;  3X23 A;  5GMV A;  1D3Z A;  1TBE A;  3VH3 B;  1YX5 B;  4BOS C;  1UBQ A;  4OVV A;  3WA0 A;  4NJ7 A;  4F1S A;  4URK A;  3KUC B;  4W9G A;  4GMV A;  4IWO A;  1Q0W B;  4KDL B;  4IW0 A;  3M3J A;  1V2Y A;  3ZNZ B;  4CYE A;  1F9J A;  2KWC A;  3M63 B;  2A4Z A;  4MJS A;  2JZ3 B;  3VQI A;  3V60 A;  2KN5 A;  4KV2 A;  4I6P A;  1UD7 A;  4K7U A;  1WXV A;  4IM3 A;  3PLU A;  2LVO A;  3PLV A;  2LGY A;  2MQJ A;  3H7S A;  4IG7 B;  3PHX B;  2NCN A;  4GU2 A;  1WX9 A;  3L08 A;  4EFO A;  1WXA A;  1MG8 A;  2MWS B;  3DVG Y;  4ICU A;  2NPT B;  4E3C A;  4A20 A;  1EF5 A;  4BOZ B;  4DHZ B;  1KJT A;  3QX1 A;  1A5R A;  2KC1 A;  3A1Q B;  3M95 A;  2FCS A;  4F8C B;  1V80 A;  2LRU A;  3DPD A;  4BBN C;  2DYO A;  2J0M A;  1OEY A;  4GOC A;  4FJV B;  4K1R B;  3ZLZ A;  2LAS A;  3VAW A;  2KOX A;  3HHM A;  3S2A A;  1WGR A;  1K8R B;  1UH6 A;  2RPQ A;  2K8H A;  3A9J B;  3QAQ A;  2MCN B;  2FCN A;  4GXB A;  2MBQ A;  1EUV B;  2D10 A;  3W1S A;  2M8S A;  2DX5 B;  2L0F A;  3PS6 A;  2KX3 A;  3SDL C;  4DHZ E;  5DPT A;  2L8J A;  3VXW A;  1V5O A;  2JRH A;  2DZM A;  1WXS A;  1RLF A;  4J6I A;  4KDI C;  2CHZ A;  2ZPY A;  2ZPN A;  4HXD A;  3H7P A;  1WR1 A;  1WE7 A;  2A5U A;  2DAF A;  4PS8 A;  1NDD A;  3L54 A;  2OJR A;  3VUW A;  3WIM A;  2YLM A;  3DCG A;  1XD3 B;  2BF8 B;  2HD5 B;  3VTU A;  2DYB A;  4CHK A;  4K81 A;  5D94 A;  2JY6 A;  2M4N A;  1Z2M A;  2NR2 A;  1QZE A;  3ZIM A;  4W9H A;  4KZC A;  1Q5W B;  5AZF A;  3QJZ A;  1OEY J;  2BWF A;  3UQB A;  1S1Q B;  3SD5 A;  2N9X A;  3JSV B;  2GBN A;  2LWP A;  2ZZP B;  4ZYN A;  2BPS A;  2KJH B;  2Y5B B;  3OJ4 B;  5E6P A;  1RAX A;  3VFK A;  4WWN A;  4MSM B;  2WX1 A;  1GG3 A;  1XQQ A;  1OGW A;  2DZI A;  1H4R A;  1WGH A;  1WH3 A;  2V1Y A;  2CR5 A;  4IC7 B;  4MGZ E;  3UGB B;  3VTW A;  5J17 A;  3V6C B;  3DBR I;  1Z5S B;  2D3G A;  2KMC A;  3GZN I;  2NPT A;  2IYD B;  3EHV A;  1S3S G;  2N9P C;  1TGZ B;  3ECI A;  4WWO A;  1WMH B;  2MBB B;  4I6L B;  3A1Q A;  1T0Y A;  2KTF A;  5AZH A;  3LDZ E;  2J0J A;  3MTN B;  5JHB A;  2I1J A;  4AWJ A;  2DAJ A;  2CS4 A;  3OLM D;  3U8Z A;  3RCZ A;  3JYU A;  3RZW C;  4EKU A;  3N30 A;  3TCA A;  3UIP B;  5C23 A;  2AYO B;  3DVG X;  2XEW A;  4ASW C;  2M17 A;  1E90 A;  1OQY A;  3A9J A;  3CST A;  2KMA A;  2PPH A;  4ANV A;  4FBJ B;  1WY8 A;  2KWU B;  3ZUN A;  2O2V B;  3W1Y A;  3UQA A;  4M0W B;  4ANW A;  2CHW A;  2MBH A;  4LJO B;  3W1S C;  2K6Q A;  4PS3 A;  3U30 A;  3PRE A;  1ZKH A;  4IWP A;  4KIK B;  1R4M I;  3NOB A;  4GSW A;  1R4N I;  4WWP A;  5CTR C;  4DDI D;  4GGQ A;  1P9D U;  1EF1 A;  4NQL B;  2KQS A;  5L95 C;  2Z0D B;  2NS5 A;  2VRR B;  3UIO B;  3ZTC A;  3I3T B;  1WYW B;  1ISN A;  2CU1 A;  2G3Q B;  3ML8 A;  3QK0 A;  2MSE D;  3PTF C;  4EZJ A;  4BKS D;  2KFJ A;  1KM7 A;  4II2 B;  2C5L C;  3CSF A;  4I6N B;  2OOB B;  1V49 A;  2KO3 A;  3JSV A;  4F7Z A;  3QC8 B;  3L13 A;  2PJH A;  2FID A;  2JF5 A;  1IYF A;  1J19 A;  1HE8 A;  4W9K A;  4AJW A;  3HM6 X;  3DVN V;  2REX A;  1WM3 A;  4BKG A;  3HM3 A;  2CKH B;  4GDL B;  4HPM B;  4W9F A;  5AZG A;  2K8B A;  2KTR B;  2WWZ A;  3PRM B;  3APC A;  1WMH A;  4JQW C;  2HJ8 A;  2GBM A;  3ZO5 B;  2JVC A;  1G6J A;  2GBR A;  3A4S C;  1GC7 A;  3H9D A;  3OAW A;  2ASQ A;  2D11 A;  4ZRJ A;  5E6O A;  3KVF B;  3N32 A;  3QAR A;  1WJ6 A;  4TUU A;  3MHS D;  2KX0 A;  5LLI A;  4JL9 A;  4FHJ A;  2UWQ A;  1YQB A;  2JZZ A;  2EKE C;  2RSU A;  3KYD D;  3PPA A;  4TV3 A;  4NAW B;  2FNJ B;  4WJQ A;  5LXI B;  2LUE A;  4E71 A;  4JLC A;  1KOT A;  3L0W B;  3QIJ A;  2KD0 A;  2MBO A;  2AL3 A;  2ZEQ A;  2R2O A;  4FHK A;  4WJP A;  4HWI B;  1LXD A;  3KW5 B;  2AEH A;  3PT2 B;  4NPN A;  4G11 A;  3O65 B;  2IY0 B;  1WJ4 A;  2XK5 B;  3KUD B;  1WZ3 A;  2N7E A;  3ML9 A;  3PVL A;  3ONS A;  2MA9 B;  1XT9 B;  2FUH B;  3DBH I;  3AXC A;  3VH4 B;  1P1A A;  1V9J A;  4PYZ A;  4ZRI A;  3RD2 A;  5AEK B;  2L05 A;  4DK5 A;  2Z0E B;  3ALB A;  5KHO A;  2C7N B;  2GBJ A;  2MX2 A;  3AU4 A;  3BY4 B;  4FJY A;  3VHT C;  4AUQ C;  2DYM A;  2G4S A;  2IO0 B;  4ICV A;  2WX0 A;  3DBS A;  1E5W A;  3EC8 A;  4OVU A;  4RMA A;  5L83 A;  2Z59 B;  2D2Q A;  2MLB A;  1L7Y A;  3JW0 X;  1WR6 E;  2FCQ A;  5LXH A;  4BKS A;  4G50 A;  4EZK A;  2MBE A;  3VTV A;  2LXA A;  2JT4 B;  1C3T A;  1UZX B;  2HTH A;  4EEW A;  5C1Z A;  3QWZ B;  1X1M A;  1I42 A;  2MP2 B;  3KH0 A;  3LJ3 A;  1JRU A;  2L76 A;  3QQ8 B;  4GDL A;  4ANX A;  3IFW B;  2KTR A;  2N7D A;  1GUA B;  3BIN A;  3V6E B;  1WJN A;  2KC2 A;  4FLH A;  3CF6 E;  2G4D B;  2K39 A;  5JZE B;  3ZTD A;  3D32 A;  1SIF A;  4K7W A;  4GB9 A;  2LI5 A;  1J8C A;  2W9N A;  2IO2 B;  5G2N A;  1E7U A;  4AOF A;  2J0K A;  3RZF A;  2C60 A;  4NNJ B;  5JHA A;  2L3Z A;  5D2M B;  3VUY A;  1WX7 A;  2UYZ B;  2ZCB A;  2CHX A;  1E8Z A;  3NZU A;  3QHT A;  3R66 C;  3NY5 A;  3APF A;  1WX8 A;  2DEN B;  3RT3 B;  1WI0 A;  1ZW7 A;  3VDZ A;  2FCM A;  4GDK B;  3DQV A;  4KSL C;  4NAW A;  4HVB A;  2JXX A;  2K1F A;  2RGF A;  5HKH A;  2AL6 A;  1YIW A;  3L17 A;  1KLV A;  3ZVV A;  2KZR A;  1U4A A;  4HPL B;  1RFA A;  3KUZ A;  2IO3 B;  5CHF A;  3PZD A;  2PEA A;  3R7R A;  2V3S A;  2BKF A;  2BYE A;  3TJP A;  4B6W A;  1V5T A;  3WAN A;  1IPG A;  2JUO A;  4W9C A;  2M0X A;  3Q3J A;  2KLG A;  4LJP B;  4CO7 A;  3NS8 A;  5KHQ A;  4TKN A;  4G3X B;  3RUL A;  3DBL I;  4W9E A;  2KFK B;  2BKR B;  3NZS A;  3VVW B;  3WAL A;  4JGH B;  2JRI B;  2LJ5 A;  1LQB A;  4IM0 A;  1GNU A;  4PYU A;  3L10 B;  4IM2 A;  4DBG A;  3DOW A;  4B95 A;  3AUL A;  2FIF A;  2GBK A;  3ZDM C;  2MP2 A;  4DWF A;  1UEL A;  5DCN A;  1WJU A;  4EZL A;  4W9J A;  1GC6 A;  3PRP B;  2BWE S;  1ZGU B;  4LDT B;  4XZ4 A;  3A33 B;  2KDE B;  3SU8 X;  3AI5 A;  4MGK E;  3EFU A;  3A9K B;  4BFR A;  1UBI A;  2D07 B;  4G0N B;  2MRP A;  2M1M A;  2XBB C;  4ZRK A;  3V62 A;  4PS7 A;  2ZNV C;  1Q1O A;  2EMS A;  2J7Q B;  2KLC A;  3H7P B;  4HCP B;  4II3 B;  2KHW B;  5IAA C;  3ZRF A;  5EDS A;  5D6J B;  1SGH A;  1WIA A;  2KQ7 A;  2ZNV B;  3PHW B;  3R7Q A;  4P7I A;  4KVG B;  4W9L A;  3ZDT A;  3IVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...