4F8CB

Structure of the cif:nedd8 complex - yersinia pseudotuberculosis cycle inhibiting factor in complex with human nedd8
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
b'MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cycle Inhibiting Factor
publication title The molecular basis of Nedd8 deamidation by the bacterial effector protein Cif
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Cell cycle/protein binding
total genus 22
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4f8cB00
4EFOA 4WJQA 1GC7A 3S2AA 1IPGA 4RMAA 3DVNV 4OVUA 2HJ8A 2JT4B 3QIJA 4HXDA 2ZVOA 4MELA 2J0KA 5GMVA 1WX9A 5TR5A 2FCSA 4IWQA 5FR6A 2XEWA 1J8CA 2O2VB 3ZRCA 4ANUA 1WGYA 3KVFB 4WQOB 1E8YA 2KWCA 4IWPA 2MRPA 2BKFA 5AZFA 5G2NA 3V6CB 3M3JA 4NPNA 2DHZA 2L7RA 3ML9A 4NJ6A 4GMVA 4URKA 4WJPA 3QX1A 4HPLB 3U7DA 2GBKA 5J2RA 3QK0A 1RFAA 5AEKB 2KMAA 5LLIA 2KD0A 1WJ4A 2BF8B 4G50A 2DZKA 3L13A 3Q3JA 4X57B 1KLVA 3QWZB 2NS5A 4KDIC 3GZNI 4IG7B 3JW0X 5E6NA 1UELA 2ASQA 1RLFA 4GIVA 2D11A 2CR5A 2UYZB 2RPQA 3CF6E 2FUHB 2BKRB 3ZO5B 4IC7B 1OGWA 1WJ6A 3VQIA 1WIAA 3V61A 3VTWA 1EUVB 4HVBA 2FCQA 5JHAA 2KN5A 1WMHA 3QQ8B 4FHKA 4B9KA 2REXA 2KK8A 2LXCA 2PPHA 3RCZA 3IVFA 5JH5C 4ZYNA 4K7SA 2KLCA 2WYQA 3DBSA 2JZ3B 4GSWA 3PRPB 3ENEA 3TJPA 3RZWC 4FHJA 4EKUA 2MBOA 3CSTA 3AULA 2C5LC 3NHEB 1Y8RC 3DVNU 4ICUA 4DHJD 2RR9A 4HWIB 4MSMB 2KVRA 4LJPB 1I42A 3VDZA 4FULA 2IO0B 3ZNGC 4DK5A 3DBHI 3ZRFA 2C60A 2ZJDA 4CO7A 3AI5A 3X23A 3QCAA 2KFKB 1YX6B 2LXAA 4NAWB 4MH0E 3IG3A 3WALA 1WM3A 5E6OA 2CHXA 3L10B 4MGIE 1Q5WB 2I1JA 2BYEA 2M4NA 2LGYA 3PREA 2LD9A 1XQQA 2NBUA 4ANWA 3HK0A 2XK5A 2J0MA 1YX5B 2C7NB 3VXWA 2HE7A 2AL3A 2K6QA 4BBNC 5IAAC 4A3OA 2YLMA 4ANVA 4EUTA 2D2QA 2FIDA 5JHBA 1R4NI 1V9JA 1Q1OA 3PRZA 2PE9A 1V2YA 2NBWB 4ICVA 3VH4B 2EMTA 2K1FA 5J18A 1P98A 2UWQA 3L17A 4TQ1A 4PS3A 2JWZA 1KJTA 4DBGA 3I3TB 2MBQA 4WJOA 2MLBA 3IHPC 2AWTA 4GB9A 2JF5A 3HM6X 4PS8A 3UF8A 3QA8A 3ZTDA 4ZDVA 4W9HA 4IW0A 1NDDA 2K39A 3L0WB 4JQWC 3VUXA 2BPSA 1FXTB 1YJ1A 3QHTA 4K81A 4EOYA 3TMPB 5LXIB 3RYTA 2CHZA 3VTVA 4G3XB 3KUDB 4HDOA 5J17A 1U4AA 2WWZA 2BWES 2DZMA 2ZCBA 5D6JB 5E6PA 2WDTB 4PYUA 2DYBA 2KJHB 2KWVB 4YL8A 2LVQA 2MW5A 1S3SG 5AZHA 2A5UA 2KQ7A 4KZCA 3A4RA 1L2NA 2CKHB 1LFDA 4IM0A 1WZ3A 2C7MB 4P7IA 4GU2A 1T0YA 1UBQA 1WH3A 1D3ZA 1NI2A 4BFRA 2NR2A 3JSVA 4F7ZA 5IA7A 1P1AA 4TKNA 4FA6A 4BKSD 2DAFA 3OJ3A 4JGHB 2Z59B 1WMHB 3OLMD 3MJWA 1WE6A 4BKSA 4XZ4A 2GBRA 3PV1A 3R7RA 3M62B 1TZ1A 2PEAA 5CTRC 3W1SA 1SGHA 4F8CB 4B6WA 3PRMB 1KM7A 4B95A 2ZPYA 5D7GA 2DX5B 2FIFA 2KTFA 2NVUI 4BOZB 4EEWA 2M17A 3KW5B 3R7QA 2KANA 2KWUB 3SHQA 4ASWC 2KC1A 1WJNA 2KO3A 2IBIB 1WXSA 2R2QA 3DVGY 4K7UA 3VH3B 2CHWA 4E74A 2DYOA 1LXDA 1C1YB 3PVLA 1GG3A 4DHJB 2EKEC 3M95A 1V81A 2IY0B 2LI5A 2G4DB 3U8ZA 1UZXB 1LM8B 2LJ5A 4FLHA 4G11A 4DXAB 1GUAB 2JVCA 2D10A 2KNBA 3ZKJC 1A5RA 3PHXB 4XX5A 4ZRJA 1GC6A 2L05A 1J19A 1K8RB 1WGRA 2LASA 3WAOA 2EMSA 1V5OA 3DVGX 3QARA 2XK5B 5DPWA 4AOFA 3HHMA 2D07B 2NPTA 1TTNA 3RT3B 1QZEA 2L3ZA 2MP2B 1TBEA 3L08A 1LQBA 2ZCCA 1Q0WB 2L0FA 3QC8B 1V49A 2NBVB 3TIXA 1WI0A 5CHWA 3NZSA 4GN1A 1WM2A 4MDKE 3T9LA 2Z0DB 3WANA 2LGXA 2V4LA 3HIZA 4FN2A 3IFWB 4J6IA 2HD5B 3PTFC 1RRBA 2LRUA 2JXXA 2JY6A 3DCGA 2HTHA 1UD7A 4GGQA 4JL9A 4JLCA 3SU8X 1KOTA 1WE7A 3WAPA 3NS8A 3M63B 2N7DA 3ZVVA 4BBNF 2N4FA 1RAXA 4AP4C 4G0NB 2RD0A 1GNUA 4NQKE 2O6VD 4LDTD 3A9JA 2NCNA 2K6DB 2KDEB 1SE9A 2LGDA 3ZUNA 2KJ6A 2O6VA 2B3AA 1BT0A 3VVWB 4ANXA 2N9XA 4AUQC 3JYUA 2BYVE 5CHVC 2CU1A 4I6LB 4W9CA 2IZVB 5DPRA 1MG8A 3N32A 1V5TA 3D32A 4GOCA 3ZLZA 4HDQA 5C1ZA 1E5WA 2PJHA 4W9EA 1PQSA 2DZIA 4GDLB 4MM3A 2LUEA 4M0WB 3JSVB 3ZDMC 3A1QA 3UINB 3APDA 1YQBA 4WJNA 1TGZB 2ZVNA 3PS6A 5L83A 1G6JA 4EZLA 4BOSC 4KZ0A 2G4SA 3MHSD 2RSUA 2BGFA 3U30A 3AXCA 2ZZPB 4HPMB 2KMCA 3L16A 5L95C 2BWFA 2V1YA 3PLUA 4K1RB 3PZDA 1WRDB 2MQJA 3KYDD 4KDLB 5DCNA 1EO6A 3WA0A 2J7QB 3T8MA 2MBBB 4NY0A 4W9IA 3ZNID 5C23A 3B08A 1OTRB 2KX3A 1V80A 2ZNVB 2KDFB 2OJRA 4ZRKA 3UIPB 2MWSB 1S1QB 2DYMA 2LZ6A 4GXBA 3R66C 2QHOA 5CHFA 4AJWA 1WF9A 2XBBC 3H1UA 2G45B 3NOBA 2KLGA 1OEYA 2PE6B 2L76A 1XD3B 3EFUA 2KFJA 1F9JA 4A20A 4KV2A 4F1SA 1P0RA 4W9LA 1SIFA 1ZW7A 2MBHA 1UH6A 2KTRA 4CHKA 3UGBB 1H4RA 4MGZE 5DPSA 3W1YA 4DHZE 3AU4A 4HJKA 2C7HA 3VTUA 2KDBA 3AU5A 3BY4B 4KIKA 4I6PA 2Y5BB 4W9FA 4NAWA 3ZIMA 1R4MI 2MBEA 2LVOA 2N9EB 2NPTB 3A9KA 5JZEB 3PLVA 3A33B 5CX3A 2CS4A 3X0WA 2IO3B 4PS7A 2GBMA 1EF1A 5D2MB 2FNJB 2ZEQA 4MGKE 3RULA 5DPTA 2GBJA 4LCDE 1Z5SB 2MSED 3ONSA 3PT2B 3ZNHB 4ZRIA 4OVVA 3CMMB 1NBFC 2KOXA 4HLEA 3B1LX 3C0RB 3CSFA 3R3MA 1E7UA 2GBNA 3KUCB 4TQ0A 2KX0A 5KHOA 3KYCD 2KHWB 2W9NA 2VRRB 2N1WA 5EDSA 1JRUA 4KVGB 1C3TA 4NQLB 3ECIA 4W9DA 3PHWB 4GDKA 2ZNVC 1V86A 3V6EB 2GOWA 3DBLI 3A9JB 5HKHA 4HCPB 2C9WB 4MEMA 1OQYA 4FJYA 4WAAA 4A3PA 2O6VB 2AL6A 2FCNA 4LDTB 4PYZA 1AARA 4HCNB 3OJ4B 4WWPA 1WGGA 4MSQB 2N9PC 4IWOA 2M0XA 4MJSA 4BVUC 3DQVA 4N9F4 4NNJB 2L8JA 2Z0EB 5LXHA 2AEHA 2BYFA 4EZJA 3N3KB 2MCNB 5KHQA 1X1MA 1ZGUB 3NZUA 4BKTA 3O65B 2KC2A 2M8SA 1IYFA 4W9KA 1M94A 3H7PA 4II3B 3A1QB 3PPAA 1WY8A 2L00B 4RM8A 3EECA 4E3CA 3VHTC 2K8BA 3H7SA 4TV3A 1CMXB 2FAZA 4BKGA 1WZ0A 3HM3A 4RM9A 2KJRA 4KSLC 2DAJA 2OOBB 2JRHA 1XT9B 2KKCA 3RUIB 2JUOA 2LWPA 3DPDA 1HE8A 1WJUA 3TL5A 3UQBA 3UIOB 2JRIB 3LJ3A 2RGFA 3LDZE 5BO4B 2M1MA 2J0JA 3ZTCA 3UQAA 2K25A 4JIOU 1P3QU 3TCAA 5D94A 3PGEA 3TBLD 4FBJB 3VUWA 2O2VA 1GJZA 1WR1A 4IM3A 3ZW3A 2MA9B 1P9DU 4II2B 3VFKA 3GOEA 3MTNB 3DBRI 3RD2A 2R2OA 1VCBA 3PSEB 2L0TA 4MGYE 1WR6E 1WX7A 2G3QB 4NJ7A 2IYDB 1WGDA 2WX1A 3VUYA 1EF5A 1WFYA 3QJZA 4CYEA 2KTRB 4WWOA 3V62A 1WXMA 1L7YA 2DENB 1E7VA 3H6NA 2GMIC 2IY1B 4DDID 2KQSA 4KIKB 5AZGA 1YIWA 2K8CA 2JPHA 3A9KB 3IBEA 4IUMB 3ALBA 3P2BA 1WXVA 3DOWA 4M8NA 4AWJA 1VD2A 2IO2B 3A4SC 3EHVA 2DZJA 3BINA 2KZRA 3ZDTA 1WX8A 4IM2A 4FJZA 3QAQA 2YVCA 4LJOB 4FADA 3L54A 3K9OB 2V3SA 3EC8A 3Q3FA 1UBIA 4M8MA 1WXAA 2MP2A 3SD5A 3KH0A 2WX0A 3WIMA 4TUUA 3WAMA 2LVPA 4HK2A 2LRWA 1J0GA 4GDKB 4E71A 1UGMA 2N7EA 2D3GA 3N30A 4KSKC 1I35A 4DDGD 1ZKHA 2I1KA 3JVZX 3H9DA 3SDLC 3VAWA 4I6NB 3NY5A 1E8WA 3APFA 1E90A 2FCMA 3APCA 3RZFA 4W9JA 1OEYJ 3OAWA 4MJSB 5G55A 4FJVB 3K9PB 2A4ZA 1H8CA 2KFKA 4DHZB 1IP9A 3ML8A 4EZKA 4XC2A 1WGHA 2MX2A 1YD8U 2K8HA 1E8ZA 2KDIA 2IO1B 3KUZA 2N1VA 4AJYB 2JZZA 1Z2MA 3H7PB 1ISNA 4W9GA 2ZPNA 4DWFA 3V60A 3B0AA 4WWNA 2KXJA 1V6EA 1E8XA 3W1SC 3ZNZB 4K7WA 2AYOB 1WYWB 4GDLA 3DDCB
chains in the Genus database with same CATH superfamily
4EFOA 4DXGA 4WJQA 2QDFA 3GB1A 5BYRA 4OVUA 2FUG1 4IWQA 2NTSA 4WQOB 4M00A 3AE5B 4IWPA 4ZHOA 2LGIA 2KN4A 4NPNA 2L7RA 3ML9A 4RGTA 4GMVA 4A9AA 4WJPA 5FKAC 5J2RA 1RFAA 2DZKA 2J42A 2XNAC 5E6NA 4GIVA 2E3TA 2RPQA 4OW0A 2FUHB 3ZO5B 1TKGA 3MFGA 3BVZA 4IC7B 1OGWA 3VTWA 1HQRD 1XF5L 4B9KA 2REXA 2KK8A 3RCZA 4L2YA 3IVFA 4ZYNA 3DBSA 2JZ3B 1DGJA 3GE3C 3PRPB 3ETRA 3NVWA 4FHJA 2MBOA 1QOBA 1ZDVA 3DVNU 4ICUA 4LJPB 1I42A 1EWCA 1R7SA 2OEDA 2C60A 5HI1A 4CO7A 1WYGA 3X23A 3QCAA 3RNEC 2LXAA 3WALA 1CZPA 1WM3A 2CHXA 1C4PA 1VZ8A 2LGYA 5EE3A 1XQQA 4ANWA 1KTKA 2J0MA 4ZHPA 1QLBB 1NI3A 2PLPA 5FK9C 4A3OA 2D2QA 3VRAB 2NBWB 4ICVA 5BYQA 2SEBD 4PS3A 1C77A 2QC8A 4K3CA 3CWIA 3NZ3A 3ZTDA 3ZJTA 4W9HA 2K39A 4JQWC 2K5PA 1YN3A 4USAA 3QHTA 1YJ1A 4K81A 1RM6C 4HDOA 3U7ZA 1E9MA 1K50A 5J17A 1Q10A 2KWVB 1GAQB 3IAS1 1ZXHA 1N5WA 2RDHA 3WCQA 2C7MB 1I4HA 1T0YA 1ZPSA 1P1AA 2PKOA 2DAFA 1F77A 2LEKA 1SJHD 2DBYA 4PK1A 2WXJA 2JU6X 3GZNB 2K22A 5CTRC 2GRIA 2L52A 4BOZB 1FRRA 4L23A 4ASWC 4TSSA 2KO3A 3DVGY 2R2QA 1C1YB 1YNTE 2G4DB 2HTME 1J19A 2EMSA 3QARA 2NPTA 1TTNA 1HZ5A 1QZEA 1F0ZA 2ZCCA 3DBHB 3QC8B 1L0YB 2NBVB 3AE2B 2GB1A 1WM2A 4MDKE 2QCZA 3WANA 2LGXA 4J6IA 3AE8B 1IBXB 3Q3OC 2LRUA 4JLCA 3AECB 1TY0A 2IGHA 1MPEA 3ZVVA 1RAXA 1GNUA 1R4NB 2NCNA 2KDEB 1C78A 1NENB 3W5UB 3ZUNA 2KJ6A 4YSXB 2N9XA 3JYUA 2JYEA 1YQ4B 3AN1A 5DPRA 3D32A 2JYTA 5BMGA 4A90A 4XYCA 1E5WA 1PQSA 2MH7A 4MM3A 3UINB 1SBBB 5HFYA 3ZXRA 3VRBB 5L83A 3W2DA 4EZLA 4P6VF 4KZ0A 2G4SA 1I4RA 2BGFA 4HPMB 2KMCA 2EKIA 2V1YA 4K1RB 2BT6A 4KDLB 5DCNA 1I4PA 3WA0A 4HPPA 1WSPA 1PDXA 2KDFB 3UIPB 2DYMA 2LZ6A 4GXBA 3R66C 2KLGA 2CJOA 2PE6B 1FNWA 1F52A 2KTRA 1PUTA 4ZYSA 2KDBA 3OWEB 3DWGC 2QIEB 2N9EB 1CK1A 1FCCC 2IO3B 2KMMA 3FAHA 4PS7A 2GBJA 3ZNHB 2WU5B 1YN4A 2WXPA 3TUOA 1E0ZA 3KUCB 2N1WA 4KVGB 4HROA 3ZQ4A 1QKZA 2KQ4X 1VJKA 3V6EB 1HTQA 4B0MA 4MEMA 4K3BA 2AL6A 2V0GA 2RDBC 4LDTB 1AARA 4QAYA 2K9XA 4WWPA 1WGGA 2WXLA 1CQVA 2JXTA 4MJSA 4BVUC 4N9F4 4NNJB 3Q8BA 2AEHA 4EZJA 2MCNB 1ZGUB 2M8SA 2LFIA 3Q2AC 2BB5A 2L00B 4RM8A 4ACFA 4E3CA 2K8BA 1NEKB 3HRDD 1FD6A 1XT9B 4MT5A 4WAFA 1EU4A 3Q69A 2JRIB 2J0JA 3ZTCA 2K25A 4JIOU 1P3QU 5D94A 3VR8B 2LGSA 3VUWA 4IOIE 3ZW3A 2RMMA 3TEZA 1HZ6A 3RD2A 2R2OA 1VCBA 4MGYE 1WX7A 2G3QB 1FCLA 2WX1A 4BAXA 1QOGA 1YOVB 2J53A 2IY1B 2KQSA 2K8CA 1E7PB 3BYTB 4IUMB 1C76A 1ESFA 3DOWA 3A4SC 3EHVA 3GS2A 4US8A 3ZDTA 2YVCA 3L54A 2MHJA 1D5ZC 1L6VA 1WXAA 2MP2A 2E6XA 2MJ3A 4TUUA 3U4EG 2LRWA 3DHHC 3R2TA 4GDKB 4E71A 3AH7A 4KSKC 1I35A 4RCOA 1ZKHA 2I1KA 3JVZX 3APFA 4S0RA 2MJDA 2FCMA 3APCA 3RZFA 5G55A 1XLPA 2KAJA 3K9PB 2WP9B 2A4ZA 4XC2A 1WGHA 2GLSA 4DQOC 3KUZA 4O1NA 4ZOHC 3DBLB 3H7PB 3Q8FA 2KDMA 3V60A 3B0AA 2BS3B 1E8XA 3Q8AA 4K7WA 1WYWB 2KT7A 1RFKA 2ON8A 1ZDXA 1MJDA 3GE8C 4XWTA 1GC7A 1IPGA 4RMAA 1JW9D 3QIJA 3T3NA 2ZVOA 4MELA 2XN9C 5GMVA 5TR5A 1AWDA 2XEWA 4ANUA 1F2RI 2LJIA 1JROA 2W3RA 5AZFA 5G2NA 3V6CB 1Y56A 2DHZA 3Q6BA 4N58A 4URKA 3U7DA 1MHHE 3NRZA 2KMAA 3E56A 5BYSA 4G50A 1C4AA 2HDEA 1DOIA 3JW0X 2CR5A 2UYZB 4ARIA 3BYYB 3VQIA 4LNOA 4WURA 4LLGM 2ZW0A 3QQ8B 3RN9C 1T5XD 1TS5A 2WYQA 3RZWC 3CSTA 5IOIA 3AULA 5IO9A 3NHEB 3TEWA 5LNK1 1UGJA 2W3SA 1ZE3D 1TKEA 2IO0B 4FULA 4DK5A 2JZPA 3AI5A 3KLSX 1IGDA 3EUB2 5E6OA 1L5PA 4MGIE 1V97A 2I1JA 3NVZA 3PREA 3HK0A 1VLBA 2KYWA 2HE7A 4BBNC 2BS2B 4EUTA 3LXFA 1Q1OA 3PRZA 4ITKA 1C9FA 4RF0A 1V2YA 2ACZB 2K1FA 5J18A 2QEJC 2UWQA 3L17A 4DBGA 3IHPC 2AWTA 4GB9A 1IBXA 3QA8A 3T3OA 4IW0A 2R61A 1I7HA 4EE2A 3AV8A 2WXOA 4HKZE 3TMPB 4EOYA 5LXIB 5HHDG 2CHZA 1BXTA 3KUDB 1T0QC 1U4AA 2IGGA 2WWZA 2DZMA 1YQ3B 2DYBA 2LVQA 2MW5A 3NS1A 1HA5A 1WZ3A 3PZ8A 4P7IA 4GU2A 3AEEB 1WH3A 3HVDA 5BMHA 3AEDB 4FA6A 4BKSD 4JGHB 2K3UA 1J7BA 4BKSA 4XZ4A 2GBRA 2H89B 3I5JC 4EEWA 3KW5B 2JQRB 3SHQA 2KC1A 1ENFA 3VH3B 2Y5CA 2CHWA 4XE0A 3C19A 2Y5PA 4DHJB 2IY0B 2LI5A 2J4XA 4N59A 3U8ZA 1UZXB 2WDQB 1LM8B 4FLHA 1V1PB 4G11A 1GUAB 2KNBA 2D10A 1A5RA 4ZRJA 1K8RB 1WGRA 4J3OD 4MH8A 4AOFA 3HHMA 5TSSA 2MP2B 5HG2A 1QOAA 1WI0A 5CHWA 3NZSA 2V3NA 4P1CC 2Z0DB 1JALA 4IDIA 2MEKA 2HD5B 1XO3A 1RRBA 1MHXA 2JXXA 3DCGA 1UD7A 3FILB 4GGQA 1KOTA 1L0XB 4BBNF 1ZUD2 5IKCM 2RD0A 3SFDB 4LDTD 4NZLB 1BT0A 4ANXA 3N9YC 2IJ0A 3Q3MC 2BYVE 4I6LB 2IZVB 1SJED 4A8XC 3N32A 4GOCA 4HDQA 2BBCA 2PJHA 3AE9B 1DOXA 3AE6B 3P4QB 4WJNA 2IDYA 1G6JA 4BOSC 3MHSD 1ROEA 3U52E 3U30A 3AXCA 2BWFA 1UUPA 3PZDA 1WRDB 3KYDD 5FR3A 1UF0A 1EO6A 2AQ3B 2J7QB 3BVMA 2MBBB 2VH2A 5C23A 3AMZA 1OTRB 1V80A 2QHOA 4AJWA 1I4XA 3NOBA 2DWQA 4ARCA 2L76A 1F1HA 3EFUA 1F9JA 4A20A 4KV2A 3ZXVA 1P0RA 3IT6B 1SIFA 4M02A 1ZOYB 1H4RA 3H8HA 4DHZE 3AU4A 1VRAB 4HJKA 2C7HA 4KKJA 2Y5BB 1R4MI 2MBEA 2LVOA 5CX3A 3A33B 2CS4A 1QOFA 2ZEQA 3RULA 2DNFA 1Z5SB 2WXQA 1SEBD 3B1LX 3CSFA 3R3MA 1E7UA 2BVCA 4TQ0A 2KX0A 1K52A 2QSDA 2W9NA 1C3TA 4S17A 3PHWB 3B9JA 4GDKA 4R3DA 2ZNVC 5BMIA 2WQYB 1QT9A 2PVGC 2YEPF 4HCPB 2FE8A 4WAAA 2O6VB 1NVID 1PGXA 4PYZA 2FBWB 3B2FA 3OJ4B 4IWOA 4RFBA 3FKYA 4RF1A 5E6JA 5LXHA 2WU2B 1X1MA 3NZUA 1YJJA 3H7PA 3A1QB 1WY8A 3VHTC 3H7SA 3B2GA 3HM3A 1KLGD 2KJRA 4KSLC 4RM9A 2OOBB 3DPDA 1HE8A 3TL5A 2D3BA 1SIJA 3UIOB 1KRHA 3LJ3A 2L1AA 5BO4B 2UU7A 2M1MA 3TCAA 3LB8C 3P1MA 1FEHA 3TBLD 2WDVB 3V3XA 5EE1A 1P7FA 1GJZA 4IM3A 1XCTL 3VFKA 3GOEA 4D2KA 3MTNB 3N1YC 3PSEB 2IYDB 1WGDA 4TMAB 5G5HA 3V62A 1WXMA 1I4GA 1E7VA 3H6NA 3W9CB 4DDID 4KIKB 3VR9B 2JPHA 3IBEA 3I57A 3RNAC 3P2BA 4AWJA 1IGCA 2PIAA 3BINA 3O13A 1T6BX 4YXDB 4LJOB 4C7ZA 2V3SA 3RNCC 4NAMA 3BWUD 1OFFA 4M8MA 1V8CA 3KH0A 2WX0A 4YSYB 3IAM1 3WAMA 4HK2A 1ZP0B 5T8IA 1UGMA 1C4CA 2D3GA 1IUEA 4DDGD 3N1XC 3SDLC 3AE3B 4C7YA 3P4RB 1PGBA 1JWSD 1E8WA 3NY5A 1E90A 3ZJVA 4HRSA 2WXHA 4W9JA 1LO5D 2MX2A 2AX5A 1YD8U 3MJ5A 1E8ZA 2N1VA 4AJYB 2JZZA 1Z2MA 1A70A 1ISNA 5EE0A 1N6ZA 2KWDA 2ZPNA 4DWFA 1C79A 3NVYA 2KXJA 3W1SC 1T3QA 2BB6A 3BVGA 2WXMA 3U2SC 3S2AA 3DVNV 3BIID 4HXDA 1L6UA 3ZJUA 2J0KA 1WX9A 3OG5A 1J8CA 2O2VB 3ZRCA 1WGYA 2KWCA 2MRPA 3M3JA 5JXVA 3QK0A 4LK0M 2KD0A 2BF8B 1UWXA 3L13A 1KLVA 4KDIC 3GZNI 2PVOD 2PMVA 1RLFA 4L1BA 1YMHE 3DBRB 2BKRB 4YT0B 1VR9A 3V61A 1EUVB 3RFZB 5JHAA 4IKGA 1ACCA 2PPHA 1PFDA 4MACA 4GSWA 3P42A 1CJEA 1FFVA 2WNMA 1Y8RC 4DHJD 4YSZB 3J9CA 2RR9A 2KVRA 3SFEB 3VDZA 3ZNGC 3DBHI 3ZRFA 2ZJDA 1V1PA 2WS3B 4MH0E 1Q5WB 4NJCA 2BTEA 2QJLA 2LHDA 3AE7B 3VXWA 1FNVA 2IGDA 3NUHB 2AL3A 5IAAC 2FIDA 1V9JA 1R4NI 2N7JA 2M56B 2PE9A 3VH4B 1HTOA 1KJTA 3I3TB 1LGRA 1SB3C 3HM6X 4PS8A 1FM0D 4ZDVA 3FILA 1V1OA 1QF6A 4UDUC 2BWES 2ZCBA 5D6JB 4KGTA 1XLNA 1WWTA 2KJHB 1S3SG 2KQ7A 1L2NA 1MFWA 4KZCA 2INDC 1LFDA 4IM0A 1DYQA 2WXKA 1D3ZA 1WRIA 2AQ1B 4BFRA 1N60A 5IA7A 1FIQA 4TKNA 1YJIA 2WHIA 2Z59B 1WMHB 2YEPB 3Q14C 4WQMA 1GB1A 2PEAA 3W1SA 4B6WA 2ZPYA 2DX5B 2KTFA 2NVUI 3C8YA 1D5MC 2M17A 2KANA 2KWUB 1WJNA 4K7UA 4E74A 2DYOA 2W55A 3BZDB 1EU3A 3M95A 1V81A 1GB4A 2LJ5A 1BUIC 4HKQA 3PHXB 2L05A 3WAOA 4REZA 1V5OA 3DVGX 2XK5B 5D3DA 2LUMA 2D07B 1SF0A 3RT3B 4CQNA 4JPSA 4OZCA 1HXYD 3T9LA 3AM9A 2V4LA 1L0VB 3IFWB 2NTTA 2X8XX 3PTFC 2JY6A 2HTHA 1D4BA 1K53A 1B1ZA 4OZBA 1WE7A 3SU8X 3WAPA 4AP4C 1XXGA 2O6VD 1TKYA 3RNFC 4YWGG 2O6VA 1MVKA 4AUQC 4C56C 4W9CA 3AEAB 1MG8A 3RMKC 1FO4A 5C1ZA 4LNKA 2DZIA 2DLBA 4M0WB 3JSVB 3ZDMC 3A1QA 3EGRA 1YQBA 1TGZB 3RI7C 1HEZE 4US9A 4WWMA 2RSUA 1T0RC 2ZZPB 1QQRA 1D5XC 3PLUA 4KX6B 1KLUD 3T8MA 4W9IA 3ZNID 3B08A 1JWBD 1VZ7A 2KX3A 4OZAA 4RGOS 2ZNVB 2OJRA 2EELA 2MWSB 1S1QB 1JWAD 2W82A 3H1UA 1K51A 1OEYA 4JE3B 3RNGC 1L4DB 4B0EA 1E10A 2KFJA 5G5GA 4F1SA 2BW2A 1ZW7A 2MBHA 1UH6A 3UGBB 2OJWA 1EM7A 3AU5A 3BY4B 4KIKA 4ZRQA 4I6PA 3ZIMA 4NAWA 3AE1B 5JZEB 4AQ7A 3X0WA 2GBMA 4C4VB 2NMQA 1EF1A 2FNJB 4MGKE 4LCDE 2MSED 3CMMB 4HLEA 2WXIA 2GBNA 1SE4A 4C80A 2WXGA 3KYCD 1P7EA 2KHWB 5IN7A 5EDSA 3MP9A 2CJNA 1TY2A 2VZKB 3DBLI 3A9JB 5HKHA 1OQYA 2FCNA 4MSQB 3DQVA 2BYFA 3N3KB 2WXFA 1FRDA 4BKTA 4JWSC 1I4QA 2KC2A 1TS4A 4W9KA 3PPAA 3EECA 1RYJA 2FAZA 3R2IA 1UNSA 1WZ0A 1ET9A 2JRHA 3RUIB 2JUOA 1WJUA 3UQBA 3EFCA 3V05A 4Q2JA 2L83A 3LDZE 2LMCA 3I9V1 5I4DA 2QMTA 3UQAA 2N0SB 1J7CA 4FBJB 1M4VA 2O2VA 3IXSA 1P9DU 4NJ7A 4RNAA 5H92C 1WFYA 4N6EB 4CYEA 1L7YA 1SE3A 2DENB 2GMIC 5AZGA 1YIWA 3NJTA 3A9KB 2JWUA 1WXVA 1VD2A 2IO2B 2WDRB 2KZRA 1WX8A 4IM2A 1GPXA 4FADA 3EC8A 3TEYA 1OQRA 2Z8LA 2V4IB 4OVZA 1FFUA 2LVPA 2VH1A 4XDCA 2M19A 2I2YA 3H9DA 4LNNA 4M01A 1JWUD 1TT5B 1TS2A 4FJVB 3KQ4A 2BQQA 1MI0A 1H8CA 5IP4D 1TYGB 2IO1B 3Q8CA 1NYRA 4OHJA 2CU3A 2RPVA 4A6QA 4W9GA 2G9HD 4WWNA 3N1ZC 3AEGB 4GDLA 1JCKB 4KGRA 1FXAA 2HJ8A 2JT4B 3PZ7A 3DHGC 2FCSA 5FR6A 2MJEA 3KVFB 2D3AA 1E8YA 2BKFA 1VDVA 4BZAA 4YTNB 4KKIA 4NJ6A 3BK1A 3QX1A 4HPLB 3CIRB 2GBKA 4JWUC 5AEKB 5LLIA 2TSSA 1WJ4A 4X57B 3Q3JA 3QWZB 2NS5A 4IG7B 1UELA 2ASQA 4HEA1 2D11A 1AYFA 3GP7A 3CF6E 1VZ6A 2WXNA 4RH6A 4FXCA 1WJ6A 1WIAA 4HVBA 2W54A 2FCQA 3MC9A 2KN5A 1WMHA 5GXGB 4FHKA 5JH5C 2LXCA 4K7SA 3FC4A 3UI3A 2KLCA 1KFYB 3ENEA 3MHZA 2H88B 3TJPA 3AEFB 1QILA 4EKUA 2J52A 2C5LC 4HWIB 4MSMB 1RWSA 2D3CA 2KFKB 1YX6B 4NAWB 3IG3A 3L10B 2BYEA 2M4NA 2LD9A 1TZOA 2NBUA 2XK5A 3IT4B 4XGAB 1YX5B 2C7NB 1AW7A 3ABVB 2K6QA 2PW9A 2YLMA 4ANVA 4GLSC 5JHBA 1SSNA 2EMTA 1P98A 2V9HA 4TQ1A 2JWZA 2RDGA 1ET6A 2MBQA 4WJOA 1T0SC 4P1BC 2MLBA 2JF5A 2B76B 3UF8A 1NDDA 3L0WB 3VUXA 1PGAA 3L4PA 4KGSA 2BPSA 1FXTB 3RYTA 3VTVA 3P4PB 4G3XB 2WGSA 1SXTA 5E6PA 2WDTB 4PYUA 3R8BA 4YL8A 2ZW1A 1N5XA 2A5UA 5AZHA 3ZGZA 3A4RA 2CKHB 1PYWD 3NVVA 3TSSA 5H8YE 1UBQA 5D3IB 1NI2A 4M0WA 2NR2A 3JSVA 4F7ZA 4HJGE 3OJ3A 3KWVA 3OLMD 3TEXA 3MJWA 1WE6A 3PV1A 3R7RA 3M62B 3AEBB 3DWMA 1TZ1A 2ICIA 1SGHA 4F8CB 3PRMB 1KM7A 4B95A 5D7GA 1KF6B 1STEA 2FIFA 4PT5A 3R7QA 4C00A 2JSVX 2IBIB 1WXSA 3DHIC 1UWMA 2IPKD 3I63C 1LXDA 3PVLA 1GG3A 2EKEC 3HUIA 2WXRA 3EA6A 4XWWA 4DXAB 2JVCA 1TJEA 3ZKJC 4XX5A 1OQQA 1GC6A 2LASA 1FXIA 5AUKA 5DPWA 4LNFA 2L3ZA 1TBEA 3L08A 1LQBA 4C4VA 1Q0WB 2L0FA 1V49A 3TIXA 4GN1A 4LTUA 3HIZA 4FN2A 1WGKA 3P4SB 2V3PA 4JL9A 3RNBC 2JX5A 2VZKD 3NS8A 3M63B 2N7DA 2N4FA 2INNE 4G0NB 4NQKE 5MPOA 3A9JA 1XCQL 2K6DB 1SE9A 2LGDA 2GI9A 2G1EA 2B3AA 2ONQA 2Y3AA 3VVWB 5CHVC 2CU1A 1V5TA 3ZLZA 4W9EA 4GDLB 5AUIA 2LUEA 3URYA 1XLOA 3APDA 2D5GA 4XDDA 2ZVNA 3PS6A 5EE9A 4P16A 4WH4A 1JWMD 3L16A 5L95C 1AN8A 1FNUA 2MQJA 4NY0A 1MG4A 4YTPB 1L4ZB 3Q8EA 4ZRKA 3AE4B 5CHFA 2Q5WD 1WF9A 2XBBC 2HJ1A 2G45B 3SEBA 1XD3B 4W9LA 1ZXIA 3BK2A 4CHKA 2N9KA 4MGZE 1D6EC 2K0PA 3PO0A 5DPSA 3W1YA 3VTUA 1J7AA 4W9FA 1N63A 2NPTB 3A9KA 1XEEA 2WLBA 3PLVA 4ZRPA 3W5VB 5D2MB 4JX1C 5DPTA 1GOZA 2AQ2B 3ONSA 2M0AA 3PT2B 1TIFA 4OVVA 1JMLA 4ZRIA 1NBFC 1XLQA 2KOXA 3P63A 3C0RB 3NG0A 2L32A 5KHOA 2I38A 2VRRB 3N20C 1JRUA 1YN5A 4NQLB 1B9RA 3ECIA 4W9DA 1WXQA 1V86A 2KVZA 2GOWA 1TS3A 2C9WB 3Q3NC 4FJYA 4A3PA 4HCNB 1F2RC 2N9PC 1N61A 2M0XA 3AB5A 4RGNA 5C2TB 2L8JA 2Z0EB 1EWYC 4H2AA 2N9LA 5KHQA 4MM3B 3O65B 1IYFA 1M94A 1DOYA 4II3B 2QILA 4TV3A 1CMXB 4BKGA 4A55A 2DAJA 2KKCA 2LWPA 2SAKA 2RGFA 2BS4B 3HVZA 2BYTA 1FPYA 3PGEA 2LHEA 2PTLA 1WR1A 2INPE 2MA9B 4II2B 3DBRI 1SE2A 3E9SA 2L0TA 1WR6E 4AS1A 3VUYA 1EF5A 3QJZA 4DXFA 2KTRB 4WWOA 3KWLA 5C3JB 1BMLC 1JQ4A 3ALBA 4M8NA 4LNIA 3MC8A 2DZJA 1FMAD 4FJZA 3QAQA 1JRPA 1E6EB 3K9OB 3Q3FA 1KH0A 4WIPA 1UBIA 3ZYYX 3SD5A 4YTMB 2X38A 3WIMA 1R4MB 1J0GA 2INCC 2N7EA 4RGMA 3N30A 3LYYA 3VAWA 4I6NB 1NYQA 1OEYJ 3OAWA 4MJSB 3RPFC 2KFKA 4DHZB 1IP9A 3ML8A 4EZKA 2K8HA 2KDIA 3SR6A 3MC0B 2OHFA 1V6EA 1N62A 3ZNZB 2KACA 2AYOB 3DDCB
chains in the Genus database with same CATH topology
4EFOA 4WJQA 1GC7A 3S2AA 1IPGA 4RMAA 3DVNV 4OVUA 2HJ8A 2JT4B 3QIJA 4HXDA 2ZVOA 4MELA 2J0KA 5GMVA 1WX9A 5TR5A 2FCSA 4IWQA 5FR6A 2XEWA 1J8CA 2O2VB 3ZRCA 4ANUA 1WGYA 3KVFB 4WQOB 1E8YA 2KWCA 4IWPA 2MRPA 2BKFA 5AZFA 5G2NA 3V6CB 3M3JA 4NPNA 2DHZA 2L7RA 3ML9A 4NJ6A 4GMVA 4URKA 4WJPA 3QX1A 4HPLB 3U7DA 2GBKA 5J2RA 3QK0A 1RFAA 5AEKB 2KMAA 5LLIA 2KD0A 1WJ4A 2BF8B 4G50A 2DZKA 3L13A 3Q3JA 4X57B 1KLVA 3QWZB 2NS5A 4KDIC 3GZNI 4IG7B 3JW0X 5E6NA 1UELA 2ASQA 1RLFA 4GIVA 2D11A 2CR5A 2UYZB 2RPQA 3CF6E 2FUHB 2BKRB 3ZO5B 4IC7B 1OGWA 1WJ6A 3VQIA 1WIAA 3V61A 3VTWA 1EUVB 4HVBA 2FCQA 5JHAA 2KN5A 1WMHA 3QQ8B 4FHKA 4B9KA 2REXA 2KK8A 2LXCA 2PPHA 3RCZA 3IVFA 5JH5C 4ZYNA 4K7SA 2KLCA 2WYQA 3DBSA 2JZ3B 4GSWA 3PRPB 3ENEA 3TJPA 3RZWC 4FHJA 4EKUA 2MBOA 3CSTA 3AULA 2C5LC 3NHEB 1Y8RC 3DVNU 4ICUA 4DHJD 2RR9A 4HWIB 4MSMB 2KVRA 4LJPB 1I42A 3VDZA 4FULA 2IO0B 3ZNGC 4DK5A 3DBHI 3ZRFA 2C60A 2ZJDA 4CO7A 3AI5A 3X23A 3QCAA 2KFKB 1YX6B 2LXAA 4NAWB 4MH0E 3IG3A 3WALA 1WM3A 5E6OA 2CHXA 3L10B 4MGIE 1Q5WB 2I1JA 2BYEA 2M4NA 2LGYA 3PREA 2LD9A 1XQQA 2NBUA 4ANWA 3HK0A 2XK5A 2J0MA 1YX5B 2C7NB 3VXWA 2HE7A 2AL3A 2K6QA 4BBNC 5IAAC 4A3OA 2YLMA 4ANVA 4EUTA 2D2QA 2FIDA 5JHBA 1R4NI 1V9JA 1Q1OA 3PRZA 2PE9A 1V2YA 2NBWB 4ICVA 3VH4B 2EMTA 2K1FA 5J18A 1P98A 2UWQA 3L17A 4TQ1A 4PS3A 2JWZA 1KJTA 4DBGA 3I3TB 2MBQA 4WJOA 2MLBA 3IHPC 2AWTA 4GB9A 2JF5A 3HM6X 4PS8A 3UF8A 3QA8A 3ZTDA 4ZDVA 4W9HA 4IW0A 1NDDA 2K39A 3L0WB 4JQWC 3VUXA 2BPSA 1FXTB 1YJ1A 3QHTA 4K81A 4EOYA 3TMPB 5LXIB 3RYTA 2CHZA 3VTVA 4G3XB 3KUDB 4HDOA 5J17A 1U4AA 2WWZA 2BWES 2DZMA 2ZCBA 5D6JB 5E6PA 2WDTB 4PYUA 2DYBA 2KJHB 2KWVB 4YL8A 2LVQA 2MW5A 1S3SG 5AZHA 2A5UA 2KQ7A 4KZCA 3A4RA 1L2NA 2CKHB 1LFDA 4IM0A 1WZ3A 2C7MB 4P7IA 4GU2A 1T0YA 1UBQA 1WH3A 1D3ZA 1NI2A 4BFRA 2NR2A 3JSVA 4F7ZA 5IA7A 1P1AA 4TKNA 4FA6A 4BKSD 2DAFA 3OJ3A 4JGHB 2Z59B 1WMHB 3OLMD 3MJWA 1WE6A 4BKSA 4XZ4A 2GBRA 3PV1A 3R7RA 3M62B 1TZ1A 2PEAA 5CTRC 3W1SA 1SGHA 4F8CB 4B6WA 3PRMB 1KM7A 4B95A 2ZPYA 5D7GA 2DX5B 2FIFA 2KTFA 2NVUI 4BOZB 4EEWA 2M17A 3KW5B 3R7QA 2KANA 2KWUB 3SHQA 4ASWC 2KC1A 1WJNA 2KO3A 2IBIB 1WXSA 2R2QA 3DVGY 4K7UA 3VH3B 2CHWA 4E74A 2DYOA 1LXDA 1C1YB 3PVLA 1GG3A 4DHJB 2EKEC 3M95A 1V81A 2IY0B 2LI5A 2G4DB 3U8ZA 1UZXB 1LM8B 2LJ5A 4FLHA 4G11A 4DXAB 1GUAB 2JVCA 2D10A 2KNBA 3ZKJC 1A5RA 3PHXB 4XX5A 4ZRJA 1GC6A 2L05A 1J19A 1K8RB 1WGRA 2LASA 3WAOA 2EMSA 1V5OA 3DVGX 3QARA 2XK5B 5DPWA 4AOFA 3HHMA 2D07B 2NPTA 1TTNA 3RT3B 1QZEA 2L3ZA 2MP2B 1TBEA 3L08A 1LQBA 2ZCCA 1Q0WB 2L0FA 3QC8B 1V49A 2NBVB 3TIXA 1WI0A 5CHWA 3NZSA 4GN1A 1WM2A 4MDKE 3T9LA 2Z0DB 3WANA 2LGXA 2V4LA 3HIZA 4FN2A 3IFWB 4J6IA 2HD5B 3PTFC 1RRBA 2LRUA 2JXXA 2JY6A 3DCGA 2HTHA 1UD7A 4GGQA 4JL9A 4JLCA 3SU8X 1KOTA 1WE7A 3WAPA 3NS8A 3M63B 2N7DA 3ZVVA 4BBNF 2N4FA 1RAXA 4AP4C 4G0NB 2RD0A 1GNUA 4NQKE 2O6VD 4LDTD 3A9JA 2NCNA 2K6DB 2KDEB 1SE9A 2LGDA 3ZUNA 2KJ6A 2O6VA 2B3AA 1BT0A 3VVWB 4ANXA 2N9XA 4AUQC 3JYUA 2BYVE 5CHVC 2CU1A 4I6LB 4W9CA 2IZVB 5DPRA 1MG8A 3N32A 1V5TA 3D32A 4GOCA 3ZLZA 4HDQA 5C1ZA 1E5WA 2PJHA 4W9EA 1PQSA 2DZIA 4GDLB 4MM3A 2LUEA 4M0WB 3JSVB 3ZDMC 3A1QA 3UINB 3APDA 1YQBA 4WJNA 1TGZB 2ZVNA 3PS6A 5L83A 1G6JA 4EZLA 4BOSC 4KZ0A 2G4SA 3MHSD 2RSUA 2BGFA 3U30A 3AXCA 2ZZPB 4HPMB 2KMCA 3L16A 5L95C 2BWFA 2V1YA 3PLUA 4K1RB 3PZDA 1WRDB 2MQJA 3KYDD 4KDLB 5DCNA 1EO6A 3WA0A 2J7QB 3T8MA 2MBBB 4NY0A 4W9IA 3ZNID 5C23A 3B08A 1OTRB 2KX3A 1V80A 2ZNVB 2KDFB 2OJRA 4ZRKA 3UIPB 2MWSB 1S1QB 2DYMA 2LZ6A 4GXBA 3R66C 2QHOA 5CHFA 4AJWA 1WF9A 2XBBC 3H1UA 2G45B 3NOBA 2KLGA 1OEYA 2PE6B 2L76A 1XD3B 3EFUA 2KFJA 1F9JA 4A20A 4KV2A 4F1SA 1P0RA 4W9LA 1SIFA 1ZW7A 2MBHA 1UH6A 2KTRA 4CHKA 3UGBB 1H4RA 4MGZE 5DPSA 3W1YA 4DHZE 3AU4A 4HJKA 2C7HA 3VTUA 2KDBA 3AU5A 3BY4B 4KIKA 4I6PA 2Y5BB 4W9FA 4NAWA 3ZIMA 1R4MI 2MBEA 2LVOA 2N9EB 2NPTB 3A9KA 5JZEB 3PLVA 3A33B 5CX3A 2CS4A 3X0WA 2IO3B 4PS7A 2GBMA 1EF1A 5D2MB 2FNJB 2ZEQA 4MGKE 3RULA 5DPTA 2GBJA 4LCDE 1Z5SB 2MSED 3ONSA 3PT2B 3ZNHB 4ZRIA 4OVVA 3CMMB 1NBFC 2KOXA 4HLEA 3B1LX 3C0RB 3CSFA 3R3MA 1E7UA 2GBNA 3KUCB 4TQ0A 2KX0A 5KHOA 3KYCD 2KHWB 2W9NA 2VRRB 2N1WA 5EDSA 1JRUA 4KVGB 1C3TA 4NQLB 3ECIA 4W9DA 3PHWB 4GDKA 2ZNVC 1V86A 3V6EB 2GOWA 3DBLI 3A9JB 5HKHA 4HCPB 2C9WB 4MEMA 1OQYA 4FJYA 4WAAA 4A3PA 2O6VB 2AL6A 2FCNA 4LDTB 4PYZA 1AARA 4HCNB 3OJ4B 4WWPA 1WGGA 4MSQB 2N9PC 4IWOA 2M0XA 4MJSA 4BVUC 3DQVA 4N9F4 4NNJB 2L8JA 2Z0EB 5LXHA 2AEHA 2BYFA 4EZJA 3N3KB 2MCNB 5KHQA 1X1MA 1ZGUB 3NZUA 4BKTA 3O65B 2KC2A 2M8SA 1IYFA 4W9KA 1M94A 3H7PA 4II3B 3A1QB 3PPAA 1WY8A 2L00B 4RM8A 3EECA 4E3CA 3VHTC 2K8BA 3H7SA 4TV3A 1CMXB 2FAZA 4BKGA 1WZ0A 3HM3A 4RM9A 2KJRA 4KSLC 2DAJA 2OOBB 2JRHA 1XT9B 2KKCA 3RUIB 2JUOA 2LWPA 3DPDA 1HE8A 1WJUA 3TL5A 3UQBA 3UIOB 2JRIB 3LJ3A 2RGFA 3LDZE 5BO4B 2M1MA 2J0JA 3ZTCA 3UQAA 2K25A 4JIOU 1P3QU 3TCAA 5D94A 3PGEA 3TBLD 4FBJB 3VUWA 2O2VA 1GJZA 1WR1A 4IM3A 3ZW3A 2MA9B 1P9DU 4II2B 3VFKA 3GOEA 3MTNB 3DBRI 3RD2A 2R2OA 1VCBA 3PSEB 2L0TA 4MGYE 1WR6E 1WX7A 2G3QB 4NJ7A 2IYDB 1WGDA 2WX1A 3VUYA 1EF5A 1WFYA 3QJZA 4CYEA 2KTRB 4WWOA 3V62A 1WXMA 1L7YA 2DENB 1E7VA 3H6NA 2GMIC 2IY1B 4DDID 2KQSA 4KIKB 5AZGA 1YIWA 2K8CA 2JPHA 3A9KB 3IBEA 4IUMB 3ALBA 3P2BA 1WXVA 3DOWA 4M8NA 4AWJA 1VD2A 2IO2B 3A4SC 3EHVA 2DZJA 3BINA 2KZRA 3ZDTA 1WX8A 4IM2A 4FJZA 3QAQA 2YVCA 4LJOB 4FADA 3L54A 3K9OB 2V3SA 3EC8A 3Q3FA 1UBIA 4M8MA 1WXAA 2MP2A 3SD5A 3KH0A 2WX0A 3WIMA 4TUUA 3WAMA 2LVPA 4HK2A 2LRWA 1J0GA 4GDKB 4E71A 1UGMA 2N7EA 2D3GA 3N30A 4KSKC 1I35A 4DDGD 1ZKHA 2I1KA 3JVZX 3H9DA 3SDLC 3VAWA 4I6NB 3NY5A 1E8WA 3APFA 1E90A 2FCMA 3APCA 3RZFA 4W9JA 1OEYJ 3OAWA 4MJSB 5G55A 4FJVB 3K9PB 2A4ZA 1H8CA 2KFKA 4DHZB 1IP9A 3ML8A 4EZKA 4XC2A 1WGHA 2MX2A 1YD8U 2K8HA 1E8ZA 2KDIA 2IO1B 3KUZA 2N1VA 4AJYB 2JZZA 1Z2MA 3H7PB 1ISNA 4W9GA 2ZPNA 4DWFA 3V60A 3B0AA 4WWNA 2KXJA 1V6EA 1E8XA 3W1SC 3ZNZB 4K7WA 2AYOB 1WYWB 4GDLA 3DDCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EFO A;  4WJQ A;  1GC7 A;  3S2A A;  1IPG A;  4RMA A;  3DVN V;  4OVU A;  2HJ8 A;  2JT4 B;  3QIJ A;  4HXD A;  2ZVO A;  4MEL A;  2J0K A;  5GMV A;  1WX9 A;  5TR5 A;  2FCS A;  4IWQ A;  5FR6 A;  2XEW A;  1J8C A;  2O2V B;  3ZRC A;  4ANU A;  1WGY A;  3KVF B;  4WQO B;  1E8Y A;  2KWC A;  4IWP A;  2MRP A;  2BKF A;  5AZF A;  5G2N A;  3V6C B;  3M3J A;  4NPN A;  2DHZ A;  2L7R A;  3ML9 A;  4NJ6 A;  4GMV A;  4URK A;  4WJP A;  3QX1 A;  4HPL B;  3U7D A;  2GBK A;  5J2R A;  3QK0 A;  1RFA A;  5AEK B;  2KMA A;  5LLI A;  2KD0 A;  1WJ4 A;  2BF8 B;  4G50 A;  2DZK A;  3L13 A;  3Q3J A;  4X57 B;  1KLV A;  3QWZ B;  2NS5 A;  4KDI C;  3GZN I;  4IG7 B;  3JW0 X;  5E6N A;  1UEL A;  2ASQ A;  1RLF A;  4GIV A;  2D11 A;  2CR5 A;  2UYZ B;  2RPQ A;  3CF6 E;  2FUH B;  2BKR B;  3ZO5 B;  4IC7 B;  1OGW A;  1WJ6 A;  3VQI A;  1WIA A;  3V61 A;  3VTW A;  1EUV B;  4HVB A;  2FCQ A;  5JHA A;  2KN5 A;  1WMH A;  3QQ8 B;  4FHK A;  4B9K A;  2REX A;  2KK8 A;  2LXC A;  2PPH A;  3RCZ A;  3IVF A;  5JH5 C;  4ZYN A;  4K7S A;  2KLC A;  2WYQ A;  3DBS A;  2JZ3 B;  4GSW A;  3PRP B;  3ENE A;  3TJP A;  3RZW C;  4FHJ A;  4EKU A;  2MBO A;  3CST A;  3AUL A;  2C5L C;  3NHE B;  1Y8R C;  3DVN U;  4ICU A;  4DHJ D;  2RR9 A;  4HWI B;  4MSM B;  2KVR A;  4LJP B;  1I42 A;  3VDZ A;  4FUL A;  2IO0 B;  3ZNG C;  4DK5 A;  3DBH I;  3ZRF A;  2C60 A;  2ZJD A;  4CO7 A;  3AI5 A;  3X23 A;  3QCA A;  2KFK B;  1YX6 B;  2LXA A;  4NAW B;  4MH0 E;  3IG3 A;  3WAL A;  1WM3 A;  5E6O A;  2CHX A;  3L10 B;  4MGI E;  1Q5W B;  2I1J A;  2BYE A;  2M4N A;  2LGY A;  3PRE A;  2LD9 A;  1XQQ A;  2NBU A;  4ANW A;  3HK0 A;  2XK5 A;  2J0M A;  1YX5 B;  2C7N B;  3VXW A;  2HE7 A;  2AL3 A;  2K6Q A;  4BBN C;  5IAA C;  4A3O A;  2YLM A;  4ANV A;  4EUT A;  2D2Q A;  2FID A;  5JHB A;  1R4N I;  1V9J A;  1Q1O A;  3PRZ A;  2PE9 A;  1V2Y A;  2NBW B;  4ICV A;  3VH4 B;  2EMT A;  2K1F A;  5J18 A;  1P98 A;  2UWQ A;  3L17 A;  4TQ1 A;  4PS3 A;  2JWZ A;  1KJT A;  4DBG A;  3I3T B;  2MBQ A;  4WJO A;  2MLB A;  3IHP C;  2AWT A;  4GB9 A;  2JF5 A;  3HM6 X;  4PS8 A;  3UF8 A;  3QA8 A;  3ZTD A;  4ZDV A;  4W9H A;  4IW0 A;  1NDD A;  2K39 A;  3L0W B;  4JQW C;  3VUX A;  2BPS A;  1FXT B;  1YJ1 A;  3QHT A;  4K81 A;  4EOY A;  3TMP B;  5LXI B;  3RYT A;  2CHZ A;  3VTV A;  4G3X B;  3KUD B;  4HDO A;  5J17 A;  1U4A A;  2WWZ A;  2BWE S;  2DZM A;  2ZCB A;  5D6J B;  5E6P A;  2WDT B;  4PYU A;  2DYB A;  2KJH B;  2KWV B;  4YL8 A;  2LVQ A;  2MW5 A;  1S3S G;  5AZH A;  2A5U A;  2KQ7 A;  4KZC A;  3A4R A;  1L2N A;  2CKH B;  1LFD A;  4IM0 A;  1WZ3 A;  2C7M B;  4P7I A;  4GU2 A;  1T0Y A;  1UBQ A;  1WH3 A;  1D3Z A;  1NI2 A;  4BFR A;  2NR2 A;  3JSV A;  4F7Z A;  5IA7 A;  1P1A A;  4TKN A;  4FA6 A;  4BKS D;  2DAF A;  3OJ3 A;  4JGH B;  2Z59 B;  1WMH B;  3OLM D;  3MJW A;  1WE6 A;  4BKS A;  4XZ4 A;  2GBR A;  3PV1 A;  3R7R A;  3M62 B;  1TZ1 A;  2PEA A;  5CTR C;  3W1S A;  1SGH A;  4F8C B;  4B6W A;  3PRM B;  1KM7 A;  4B95 A;  2ZPY A;  5D7G A;  2DX5 B;  2FIF A;  2KTF A;  2NVU I;  4BOZ B;  4EEW A;  2M17 A;  3KW5 B;  3R7Q A;  2KAN A;  2KWU B;  3SHQ A;  4ASW C;  2KC1 A;  1WJN A;  2KO3 A;  2IBI B;  1WXS A;  2R2Q A;  3DVG Y;  4K7U A;  3VH3 B;  2CHW A;  4E74 A;  2DYO A;  1LXD A;  1C1Y B;  3PVL A;  1GG3 A;  4DHJ B;  2EKE C;  3M95 A;  1V81 A;  2IY0 B;  2LI5 A;  2G4D B;  3U8Z A;  1UZX B;  1LM8 B;  2LJ5 A;  4FLH A;  4G11 A;  4DXA B;  1GUA B;  2JVC A;  2D10 A;  2KNB A;  3ZKJ C;  1A5R A;  3PHX B;  4XX5 A;  4ZRJ A;  1GC6 A;  2L05 A;  1J19 A;  1K8R B;  1WGR A;  2LAS A;  3WAO A;  2EMS A;  1V5O A;  3DVG X;  3QAR A;  2XK5 B;  5DPW A;  4AOF A;  3HHM A;  2D07 B;  2NPT A;  1TTN A;  3RT3 B;  1QZE A;  2L3Z A;  2MP2 B;  1TBE A;  3L08 A;  1LQB A;  2ZCC A;  1Q0W B;  2L0F A;  3QC8 B;  1V49 A;  2NBV B;  3TIX A;  1WI0 A;  5CHW A;  3NZS A;  4GN1 A;  1WM2 A;  4MDK E;  3T9L A;  2Z0D B;  3WAN A;  2LGX A;  2V4L A;  3HIZ A;  4FN2 A;  3IFW B;  4J6I A;  2HD5 B;  3PTF C;  1RRB A;  2LRU A;  2JXX A;  2JY6 A;  3DCG A;  2HTH A;  1UD7 A;  4GGQ A;  4JL9 A;  4JLC A;  3SU8 X;  1KOT A;  1WE7 A;  3WAP A;  3NS8 A;  3M63 B;  2N7D A;  3ZVV A;  4BBN F;  2N4F A;  1RAX A;  4AP4 C;  4G0N B;  2RD0 A;  1GNU A;  4NQK E;  2O6V D;  4LDT D;  3A9J A;  2NCN A;  2K6D B;  2KDE B;  1SE9 A;  2LGD A;  3ZUN A;  2KJ6 A;  2O6V A;  2B3A A;  1BT0 A;  3VVW B;  4ANX A;  2N9X A;  4AUQ C;  3JYU A;  2BYV E;  5CHV C;  2CU1 A;  4I6L B;  4W9C A;  2IZV B;  5DPR A;  1MG8 A;  3N32 A;  1V5T A;  3D32 A;  4GOC A;  3ZLZ A;  4HDQ A;  5C1Z A;  1E5W A;  2PJH A;  4W9E A;  1PQS A;  2DZI A;  4GDL B;  4MM3 A;  2LUE A;  4M0W B;  3JSV B;  3ZDM C;  3A1Q A;  3UIN B;  3APD A;  1YQB A;  4WJN A;  1TGZ B;  2ZVN A;  3PS6 A;  5L83 A;  1G6J A;  4EZL A;  4BOS C;  4KZ0 A;  2G4S A;  3MHS D;  2RSU A;  2BGF A;  3U30 A;  3AXC A;  2ZZP B;  4HPM B;  2KMC A;  3L16 A;  5L95 C;  2BWF A;  2V1Y A;  3PLU A;  4K1R B;  3PZD A;  1WRD B;  2MQJ A;  3KYD D;  4KDL B;  5DCN A;  1EO6 A;  3WA0 A;  2J7Q B;  3T8M A;  2MBB B;  4NY0 A;  4W9I A;  3ZNI D;  5C23 A;  3B08 A;  1OTR B;  2KX3 A;  1V80 A;  2ZNV B;  2KDF B;  2OJR A;  4ZRK A;  3UIP B;  2MWS B;  1S1Q B;  2DYM A;  2LZ6 A;  4GXB A;  3R66 C;  2QHO A;  5CHF A;  4AJW A;  1WF9 A;  2XBB C;  3H1U A;  2G45 B;  3NOB A;  2KLG A;  1OEY A;  2PE6 B;  2L76 A;  1XD3 B;  3EFU A;  2KFJ A;  1F9J A;  4A20 A;  4KV2 A;  4F1S A;  1P0R A;  4W9L A;  1SIF A;  1ZW7 A;  2MBH A;  1UH6 A;  2KTR A;  4CHK A;  3UGB B;  1H4R A;  4MGZ E;  5DPS A;  3W1Y A;  4DHZ E;  3AU4 A;  4HJK A;  2C7H A;  3VTU A;  2KDB A;  3AU5 A;  3BY4 B;  4KIK A;  4I6P A;  2Y5B B;  4W9F A;  4NAW A;  3ZIM A;  1R4M I;  2MBE A;  2LVO A;  2N9E B;  2NPT B;  3A9K A;  5JZE B;  3PLV A;  3A33 B;  5CX3 A;  2CS4 A;  3X0W A;  2IO3 B;  4PS7 A;  2GBM A;  1EF1 A;  5D2M B;  2FNJ B;  2ZEQ A;  4MGK E;  3RUL A;  5DPT A;  2GBJ A;  4LCD E;  1Z5S B;  2MSE D;  3ONS A;  3PT2 B;  3ZNH B;  4ZRI A;  4OVV A;  3CMM B;  1NBF C;  2KOX A;  4HLE A;  3B1L X;  3C0R B;  3CSF A;  3R3M A;  1E7U A;  2GBN A;  3KUC B;  4TQ0 A;  2KX0 A;  5KHO A;  3KYC D;  2KHW B;  2W9N A;  2VRR B;  2N1W A;  5EDS A;  1JRU A;  4KVG B;  1C3T A;  4NQL B;  3ECI A;  4W9D A;  3PHW B;  4GDK A;  2ZNV C;  1V86 A;  3V6E B;  2GOW A;  3DBL I;  3A9J B;  5HKH A;  4HCP B;  2C9W B;  4MEM A;  1OQY A;  4FJY A;  4WAA A;  4A3P A;  2O6V B;  2AL6 A;  2FCN A;  4LDT B;  4PYZ A;  1AAR A;  4HCN B;  3OJ4 B;  4WWP A;  1WGG A;  4MSQ B;  2N9P C;  4IWO A;  2M0X A;  4MJS A;  4BVU C;  3DQV A;  4N9F 4;  4NNJ B;  2L8J A;  2Z0E B;  5LXH A;  2AEH A;  2BYF A;  4EZJ A;  3N3K B;  2MCN B;  5KHQ A;  1X1M A;  1ZGU B;  3NZU A;  4BKT A;  3O65 B;  2KC2 A;  2M8S A;  1IYF A;  4W9K A;  1M94 A;  3H7P A;  4II3 B;  3A1Q B;  3PPA A;  1WY8 A;  2L00 B;  4RM8 A;  3EEC A;  4E3C A;  3VHT C;  2K8B A;  3H7S A;  4TV3 A;  1CMX B;  2FAZ A;  4BKG A;  1WZ0 A;  3HM3 A;  4RM9 A;  2KJR A;  4KSL C;  2DAJ A;  2OOB B;  2JRH A;  1XT9 B;  2KKC A;  3RUI B;  2JUO A;  2LWP A;  3DPD A;  1HE8 A;  1WJU A;  3TL5 A;  3UQB A;  3UIO B;  2JRI B;  3LJ3 A;  2RGF A;  3LDZ E;  5BO4 B;  2M1M A;  2J0J A;  3ZTC A;  3UQA A;  2K25 A;  4JIO U;  1P3Q U;  3TCA A;  5D94 A;  3PGE A;  3TBL D;  4FBJ B;  3VUW A;  2O2V A;  1GJZ A;  1WR1 A;  4IM3 A;  3ZW3 A;  2MA9 B;  1P9D U;  4II2 B;  3VFK A;  3GOE A;  3MTN B;  3DBR I;  3RD2 A;  2R2O A;  1VCB A;  3PSE B;  2L0T A;  4MGY E;  1WR6 E;  1WX7 A;  2G3Q B;  4NJ7 A;  2IYD B;  1WGD A;  2WX1 A;  3VUY A;  1EF5 A;  1WFY A;  3QJZ A;  4CYE A;  2KTR B;  4WWO A;  3V62 A;  1WXM A;  1L7Y A;  2DEN B;  1E7V A;  3H6N A;  2GMI C;  2IY1 B;  4DDI D;  2KQS A;  4KIK B;  5AZG A;  1YIW A;  2K8C A;  2JPH A;  3A9K B;  3IBE A;  4IUM B;  3ALB A;  3P2B A;  1WXV A;  3DOW A;  4M8N A;  4AWJ A;  1VD2 A;  2IO2 B;  3A4S C;  3EHV A;  2DZJ A;  3BIN A;  2KZR A;  3ZDT A;  1WX8 A;  4IM2 A;  4FJZ A;  3QAQ A;  2YVC A;  4LJO B;  4FAD A;  3L54 A;  3K9O B;  2V3S A;  3EC8 A;  3Q3F A;  1UBI A;  4M8M A;  1WXA A;  2MP2 A;  3SD5 A;  3KH0 A;  2WX0 A;  3WIM A;  4TUU A;  3WAM A;  2LVP A;  4HK2 A;  2LRW A;  1J0G A;  4GDK B;  4E71 A;  1UGM A;  2N7E A;  2D3G A;  3N30 A;  4KSK C;  1I35 A;  4DDG D;  1ZKH A;  2I1K A;  3JVZ X;  3H9D A;  3SDL C;  3VAW A;  4I6N B;  3NY5 A;  1E8W A;  3APF A;  1E90 A;  2FCM A;  3APC A;  3RZF A;  4W9J A;  1OEY J;  3OAW A;  4MJS B;  5G55 A;  4FJV B;  3K9P B;  2A4Z A;  1H8C A;  2KFK A;  4DHZ B;  1IP9 A;  3ML8 A;  4EZK A;  4XC2 A;  1WGH A;  2MX2 A;  1YD8 U;  2K8H A;  1E8Z A;  2KDI A;  2IO1 B;  3KUZ A;  2N1V A;  4AJY B;  2JZZ A;  1Z2M A;  3H7P B;  1ISN A;  4W9G A;  2ZPN A;  4DWF A;  3V60 A;  3B0A A;  4WWN A;  2KXJ A;  1V6E A;  1E8X A;  3W1S C;  3ZNZ B;  4K7W A;  2AYO B;  1WYW B;  4GDL A;  3DDC B; 
#chains in the Genus database with same CATH topology
 4EFO A;  4DXG A;  4WJQ A;  2QDF A;  3GB1 A;  5BYR A;  4OVU A;  2FUG 1;  4IWQ A;  2NTS A;  4WQO B;  4M00 A;  3AE5 B;  4IWP A;  4ZHO A;  2LGI A;  2KN4 A;  4NPN A;  2L7R A;  3ML9 A;  4RGT A;  4GMV A;  4A9A A;  4WJP A;  5FKA C;  5J2R A;  1RFA A;  2DZK A;  2J42 A;  2XNA C;  5E6N A;  4GIV A;  2E3T A;  2RPQ A;  4OW0 A;  2FUH B;  3ZO5 B;  1TKG A;  3MFG A;  3BVZ A;  4IC7 B;  1OGW A;  3VTW A;  1HQR D;  1XF5 L;  4B9K A;  2REX A;  2KK8 A;  3RCZ A;  4L2Y A;  3IVF A;  4ZYN A;  3DBS A;  2JZ3 B;  1DGJ A;  3GE3 C;  3PRP B;  3ETR A;  3NVW A;  4FHJ A;  2MBO A;  1QOB A;  1ZDV A;  3DVN U;  4ICU A;  4LJP B;  1I42 A;  1EWC A;  1R7S A;  2OED A;  2C60 A;  5HI1 A;  4CO7 A;  1WYG A;  3X23 A;  3QCA A;  3RNE C;  2LXA A;  3WAL A;  1CZP A;  1WM3 A;  2CHX A;  1C4P A;  1VZ8 A;  2LGY A;  5EE3 A;  1XQQ A;  4ANW A;  1KTK A;  2J0M A;  4ZHP A;  1QLB B;  1NI3 A;  2PLP A;  5FK9 C;  4A3O A;  2D2Q A;  3VRA B;  2NBW B;  4ICV A;  5BYQ A;  2SEB D;  4PS3 A;  1C77 A;  2QC8 A;  4K3C A;  3CWI A;  3NZ3 A;  3ZTD A;  3ZJT A;  4W9H A;  2K39 A;  4JQW C;  2K5P A;  1YN3 A;  4USA A;  3QHT A;  1YJ1 A;  4K81 A;  1RM6 C;  4HDO A;  3U7Z A;  1E9M A;  1K50 A;  5J17 A;  1Q10 A;  2KWV B;  1GAQ B;  3IAS 1;  1ZXH A;  1N5W A;  2RDH A;  3WCQ A;  2C7M B;  1I4H A;  1T0Y A;  1ZPS A;  1P1A A;  2PKO A;  2DAF A;  1F77 A;  2LEK A;  1SJH D;  2DBY A;  4PK1 A;  2WXJ A;  2JU6 X;  3GZN B;  2K22 A;  5CTR C;  2GRI A;  2L52 A;  4BOZ B;  1FRR A;  4L23 A;  4ASW C;  4TSS A;  2KO3 A;  3DVG Y;  2R2Q A;  1C1Y B;  1YNT E;  2G4D B;  2HTM E;  1J19 A;  2EMS A;  3QAR A;  2NPT A;  1TTN A;  1HZ5 A;  1QZE A;  1F0Z A;  2ZCC A;  3DBH B;  3QC8 B;  1L0Y B;  2NBV B;  3AE2 B;  2GB1 A;  1WM2 A;  4MDK E;  2QCZ A;  3WAN A;  2LGX A;  4J6I A;  3AE8 B;  1IBX B;  3Q3O C;  2LRU A;  4JLC A;  3AEC B;  1TY0 A;  2IGH A;  1MPE A;  3ZVV A;  1RAX A;  1GNU A;  1R4N B;  2NCN A;  2KDE B;  1C78 A;  1NEN B;  3W5U B;  3ZUN A;  2KJ6 A;  4YSX B;  2N9X A;  3JYU A;  2JYE A;  1YQ4 B;  3AN1 A;  5DPR A;  3D32 A;  2JYT A;  5BMG A;  4A90 A;  4XYC A;  1E5W A;  1PQS A;  2MH7 A;  4MM3 A;  3UIN B;  1SBB B;  5HFY A;  3ZXR A;  3VRB B;  5L83 A;  3W2D A;  4EZL A;  4P6V F;  4KZ0 A;  2G4S A;  1I4R A;  2BGF A;  4HPM B;  2KMC A;  2EKI A;  2V1Y A;  4K1R B;  2BT6 A;  4KDL B;  5DCN A;  1I4P A;  3WA0 A;  4HPP A;  1WSP A;  1PDX A;  2KDF B;  3UIP B;  2DYM A;  2LZ6 A;  4GXB A;  3R66 C;  2KLG A;  2CJO A;  2PE6 B;  1FNW A;  1F52 A;  2KTR A;  1PUT A;  4ZYS A;  2KDB A;  3OWE B;  3DWG C;  2QIE B;  2N9E B;  1CK1 A;  1FCC C;  2IO3 B;  2KMM A;  3FAH A;  4PS7 A;  2GBJ A;  3ZNH B;  2WU5 B;  1YN4 A;  2WXP A;  3TUO A;  1E0Z A;  3KUC B;  2N1W A;  4KVG B;  4HRO A;  3ZQ4 A;  1QKZ A;  2KQ4 X;  1VJK A;  3V6E B;  1HTQ A;  4B0M A;  4MEM A;  4K3B A;  2AL6 A;  2V0G A;  2RDB C;  4LDT B;  1AAR A;  4QAY A;  2K9X A;  4WWP A;  1WGG A;  2WXL A;  1CQV A;  2JXT A;  4MJS A;  4BVU C;  4N9F 4;  4NNJ B;  3Q8B A;  2AEH A;  4EZJ A;  2MCN B;  1ZGU B;  2M8S A;  2LFI A;  3Q2A C;  2BB5 A;  2L00 B;  4RM8 A;  4ACF A;  4E3C A;  2K8B A;  1NEK B;  3HRD D;  1FD6 A;  1XT9 B;  4MT5 A;  4WAF A;  1EU4 A;  3Q69 A;  2JRI B;  2J0J A;  3ZTC A;  2K25 A;  4JIO U;  1P3Q U;  5D94 A;  3VR8 B;  2LGS A;  3VUW A;  4IOI E;  3ZW3 A;  2RMM A;  3TEZ A;  1HZ6 A;  3RD2 A;  2R2O A;  1VCB A;  4MGY E;  1WX7 A;  2G3Q B;  1FCL A;  2WX1 A;  4BAX A;  1QOG A;  1YOV B;  2J53 A;  2IY1 B;  2KQS A;  2K8C A;  1E7P B;  3BYT B;  4IUM B;  1C76 A;  1ESF A;  3DOW A;  3A4S C;  3EHV A;  3GS2 A;  4US8 A;  3ZDT A;  2YVC A;  3L54 A;  2MHJ A;  1D5Z C;  1L6V A;  1WXA A;  2MP2 A;  2E6X A;  2MJ3 A;  4TUU A;  3U4E G;  2LRW A;  3DHH C;  3R2T A;  4GDK B;  4E71 A;  3AH7 A;  4KSK C;  1I35 A;  4RCO A;  1ZKH A;  2I1K A;  3JVZ X;  3APF A;  4S0R A;  2MJD A;  2FCM A;  3APC A;  3RZF A;  5G55 A;  1XLP A;  2KAJ A;  3K9P B;  2WP9 B;  2A4Z A;  4XC2 A;  1WGH A;  2GLS A;  4DQO C;  3KUZ A;  4O1N A;  4ZOH C;  3DBL B;  3H7P B;  3Q8F A;  2KDM A;  3V60 A;  3B0A A;  2BS3 B;  1E8X A;  3Q8A A;  4K7W A;  1WYW B;  2KT7 A;  1RFK A;  2ON8 A;  1ZDX A;  1MJD A;  3GE8 C;  4XWT A;  1GC7 A;  1IPG A;  4RMA A;  1JW9 D;  3QIJ A;  3T3N A;  2ZVO A;  4MEL A;  2XN9 C;  5GMV A;  5TR5 A;  1AWD A;  2XEW A;  4ANU A;  1F2R I;  2LJI A;  1JRO A;  2W3R A;  5AZF A;  5G2N A;  3V6C B;  1Y56 A;  2DHZ A;  3Q6B A;  4N58 A;  4URK A;  3U7D A;  1MHH E;  3NRZ A;  2KMA A;  3E56 A;  5BYS A;  4G50 A;  1C4A A;  2HDE A;  1DOI A;  3JW0 X;  2CR5 A;  2UYZ B;  4ARI A;  3BYY B;  3VQI A;  4LNO A;  4WUR A;  4LLG M;  2ZW0 A;  3QQ8 B;  3RN9 C;  1T5X D;  1TS5 A;  2WYQ A;  3RZW C;  3CST A;  5IOI A;  3AUL A;  5IO9 A;  3NHE B;  3TEW A;  5LNK 1;  1UGJ A;  2W3S A;  1ZE3 D;  1TKE A;  2IO0 B;  4FUL A;  4DK5 A;  2JZP A;  3AI5 A;  3KLS X;  1IGD A;  3EUB 2;  5E6O A;  1L5P A;  4MGI E;  1V97 A;  2I1J A;  3NVZ A;  3PRE A;  3HK0 A;  1VLB A;  2KYW A;  2HE7 A;  4BBN C;  2BS2 B;  4EUT A;  3LXF A;  1Q1O A;  3PRZ A;  4ITK A;  1C9F A;  4RF0 A;  1V2Y A;  2ACZ B;  2K1F A;  5J18 A;  2QEJ C;  2UWQ A;  3L17 A;  4DBG A;  3IHP C;  2AWT A;  4GB9 A;  1IBX A;  3QA8 A;  3T3O A;  4IW0 A;  2R61 A;  1I7H A;  4EE2 A;  3AV8 A;  2WXO A;  4HKZ E;  3TMP B;  4EOY A;  5LXI B;  5HHD G;  2CHZ A;  1BXT A;  3KUD B;  1T0Q C;  1U4A A;  2IGG A;  2WWZ A;  2DZM A;  1YQ3 B;  2DYB A;  2LVQ A;  2MW5 A;  3NS1 A;  1HA5 A;  1WZ3 A;  3PZ8 A;  4P7I A;  4GU2 A;  3AEE B;  1WH3 A;  3HVD A;  5BMH A;  3AED B;  4FA6 A;  4BKS D;  4JGH B;  2K3U A;  1J7B A;  4BKS A;  4XZ4 A;  2GBR A;  2H89 B;  3I5J C;  4EEW A;  3KW5 B;  2JQR B;  3SHQ A;  2KC1 A;  1ENF A;  3VH3 B;  2Y5C A;  2CHW A;  4XE0 A;  3C19 A;  2Y5P A;  4DHJ B;  2IY0 B;  2LI5 A;  2J4X A;  4N59 A;  3U8Z A;  1UZX B;  2WDQ B;  1LM8 B;  4FLH A;  1V1P B;  4G11 A;  1GUA B;  2KNB A;  2D10 A;  1A5R A;  4ZRJ A;  1K8R B;  1WGR A;  4J3O D;  4MH8 A;  4AOF A;  3HHM A;  5TSS A;  2MP2 B;  5HG2 A;  1QOA A;  1WI0 A;  5CHW A;  3NZS A;  2V3N A;  4P1C C;  2Z0D B;  1JAL A;  4IDI A;  2MEK A;  2HD5 B;  1XO3 A;  1RRB A;  1MHX A;  2JXX A;  3DCG A;  1UD7 A;  3FIL B;  4GGQ A;  1KOT A;  1L0X B;  4BBN F;  1ZUD 2;  5IKC M;  2RD0 A;  3SFD B;  4LDT D;  4NZL B;  1BT0 A;  4ANX A;  3N9Y C;  2IJ0 A;  3Q3M C;  2BYV E;  4I6L B;  2IZV B;  1SJE D;  4A8X C;  3N32 A;  4GOC A;  4HDQ A;  2BBC A;  2PJH A;  3AE9 B;  1DOX A;  3AE6 B;  3P4Q B;  4WJN A;  2IDY A;  1G6J A;  4BOS C;  3MHS D;  1ROE A;  3U52 E;  3U30 A;  3AXC A;  2BWF A;  1UUP A;  3PZD A;  1WRD B;  3KYD D;  5FR3 A;  1UF0 A;  1EO6 A;  2AQ3 B;  2J7Q B;  3BVM A;  2MBB B;  2VH2 A;  5C23 A;  3AMZ A;  1OTR B;  1V80 A;  2QHO A;  4AJW A;  1I4X A;  3NOB A;  2DWQ A;  4ARC A;  2L76 A;  1F1H A;  3EFU A;  1F9J A;  4A20 A;  4KV2 A;  3ZXV A;  1P0R A;  3IT6 B;  1SIF A;  4M02 A;  1ZOY B;  1H4R A;  3H8H A;  4DHZ E;  3AU4 A;  1VRA B;  4HJK A;  2C7H A;  4KKJ A;  2Y5B B;  1R4M I;  2MBE A;  2LVO A;  5CX3 A;  3A33 B;  2CS4 A;  1QOF A;  2ZEQ A;  3RUL A;  2DNF A;  1Z5S B;  2WXQ A;  1SEB D;  3B1L X;  3CSF A;  3R3M A;  1E7U A;  2BVC A;  4TQ0 A;  2KX0 A;  1K52 A;  2QSD A;  2W9N A;  1C3T A;  4S17 A;  3PHW B;  3B9J A;  4GDK A;  4R3D A;  2ZNV C;  5BMI A;  2WQY B;  1QT9 A;  2PVG C;  2YEP F;  4HCP B;  2FE8 A;  4WAA A;  2O6V B;  1NVI D;  1PGX A;  4PYZ A;  2FBW B;  3B2F A;  3OJ4 B;  4IWO A;  4RFB A;  3FKY A;  4RF1 A;  5E6J A;  5LXH A;  2WU2 B;  1X1M A;  3NZU A;  1YJJ A;  3H7P A;  3A1Q B;  1WY8 A;  3VHT C;  3H7S A;  3B2G A;  3HM3 A;  1KLG D;  2KJR A;  4KSL C;  4RM9 A;  2OOB B;  3DPD A;  1HE8 A;  3TL5 A;  2D3B A;  1SIJ A;  3UIO B;  1KRH A;  3LJ3 A;  2L1A A;  5BO4 B;  2UU7 A;  2M1M A;  3TCA A;  3LB8 C;  3P1M A;  1FEH A;  3TBL D;  2WDV B;  3V3X A;  5EE1 A;  1P7F A;  1GJZ A;  4IM3 A;  1XCT L;  3VFK A;  3GOE A;  4D2K A;  3MTN B;  3N1Y C;  3PSE B;  2IYD B;  1WGD A;  4TMA B;  5G5H A;  3V62 A;  1WXM A;  1I4G A;  1E7V A;  3H6N A;  3W9C B;  4DDI D;  4KIK B;  3VR9 B;  2JPH A;  3IBE A;  3I57 A;  3RNA C;  3P2B A;  4AWJ A;  1IGC A;  2PIA A;  3BIN A;  3O13 A;  1T6B X;  4YXD B;  4LJO B;  4C7Z A;  2V3S A;  3RNC C;  4NAM A;  3BWU D;  1OFF A;  4M8M A;  1V8C A;  3KH0 A;  2WX0 A;  4YSY B;  3IAM 1;  3WAM A;  4HK2 A;  1ZP0 B;  5T8I A;  1UGM A;  1C4C A;  2D3G A;  1IUE A;  4DDG D;  3N1X C;  3SDL C;  3AE3 B;  4C7Y A;  3P4R B;  1PGB A;  1JWS D;  1E8W A;  3NY5 A;  1E90 A;  3ZJV A;  4HRS A;  2WXH A;  4W9J A;  1LO5 D;  2MX2 A;  2AX5 A;  1YD8 U;  3MJ5 A;  1E8Z A;  2N1V A;  4AJY B;  2JZZ A;  1Z2M A;  1A70 A;  1ISN A;  5EE0 A;  1N6Z A;  2KWD A;  2ZPN A;  4DWF A;  1C79 A;  3NVY A;  2KXJ A;  3W1S C;  1T3Q A;  2BB6 A;  3BVG A;  2WXM A;  3U2S C;  3S2A A;  3DVN V;  3BII D;  4HXD A;  1L6U A;  3ZJU A;  2J0K A;  1WX9 A;  3OG5 A;  1J8C A;  2O2V B;  3ZRC A;  1WGY A;  2KWC A;  2MRP A;  3M3J A;  5JXV A;  3QK0 A;  4LK0 M;  2KD0 A;  2BF8 B;  1UWX A;  3L13 A;  1KLV A;  4KDI C;  3GZN I;  2PVO D;  2PMV A;  1RLF A;  4L1B A;  1YMH E;  3DBR B;  2BKR B;  4YT0 B;  1VR9 A;  3V61 A;  1EUV B;  3RFZ B;  5JHA A;  4IKG A;  1ACC A;  2PPH A;  1PFD A;  4MAC A;  4GSW A;  3P42 A;  1CJE A;  1FFV A;  2WNM A;  1Y8R C;  4DHJ D;  4YSZ B;  3J9C A;  2RR9 A;  2KVR A;  3SFE B;  3VDZ A;  3ZNG C;  3DBH I;  3ZRF A;  2ZJD A;  1V1P A;  2WS3 B;  4MH0 E;  1Q5W B;  4NJC A;  2BTE A;  2QJL A;  2LHD A;  3AE7 B;  3VXW A;  1FNV A;  2IGD A;  3NUH B;  2AL3 A;  5IAA C;  2FID A;  1V9J A;  1R4N I;  2N7J A;  2M56 B;  2PE9 A;  3VH4 B;  1HTO A;  1KJT A;  3I3T B;  1LGR A;  1SB3 C;  3HM6 X;  4PS8 A;  1FM0 D;  4ZDV A;  3FIL A;  1V1O A;  1QF6 A;  4UDU C;  2BWE S;  2ZCB A;  5D6J B;  4KGT A;  1XLN A;  1WWT A;  2KJH B;  1S3S G;  2KQ7 A;  1L2N A;  1MFW A;  4KZC A;  2IND C;  1LFD A;  4IM0 A;  1DYQ A;  2WXK A;  1D3Z A;  1WRI A;  2AQ1 B;  4BFR A;  1N60 A;  5IA7 A;  1FIQ A;  4TKN A;  1YJI A;  2WHI A;  2Z59 B;  1WMH B;  2YEP B;  3Q14 C;  4WQM A;  1GB1 A;  2PEA A;  3W1S A;  4B6W A;  2ZPY A;  2DX5 B;  2KTF A;  2NVU I;  3C8Y A;  1D5M C;  2M17 A;  2KAN A;  2KWU B;  1WJN A;  4K7U A;  4E74 A;  2DYO A;  2W55 A;  3BZD B;  1EU3 A;  3M95 A;  1V81 A;  1GB4 A;  2LJ5 A;  1BUI C;  4HKQ A;  3PHX B;  2L05 A;  3WAO A;  4REZ A;  1V5O A;  3DVG X;  2XK5 B;  5D3D A;  2LUM A;  2D07 B;  1SF0 A;  3RT3 B;  4CQN A;  4JPS A;  4OZC A;  1HXY D;  3T9L A;  3AM9 A;  2V4L A;  1L0V B;  3IFW B;  2NTT A;  2X8X X;  3PTF C;  2JY6 A;  2HTH A;  1D4B A;  1K53 A;  1B1Z A;  4OZB A;  1WE7 A;  3SU8 X;  3WAP A;  4AP4 C;  1XXG A;  2O6V D;  1TKY A;  3RNF C;  4YWG G;  2O6V A;  1MVK A;  4AUQ C;  4C56 C;  4W9C A;  3AEA B;  1MG8 A;  3RMK C;  1FO4 A;  5C1Z A;  4LNK A;  2DZI A;  2DLB A;  4M0W B;  3JSV B;  3ZDM C;  3A1Q A;  3EGR A;  1YQB A;  1TGZ B;  3RI7 C;  1HEZ E;  4US9 A;  4WWM A;  2RSU A;  1T0R C;  2ZZP B;  1QQR A;  1D5X C;  3PLU A;  4KX6 B;  1KLU D;  3T8M A;  4W9I A;  3ZNI D;  3B08 A;  1JWB D;  1VZ7 A;  2KX3 A;  4OZA A;  4RGO S;  2ZNV B;  2OJR A;  2EEL A;  2MWS B;  1S1Q B;  1JWA D;  2W82 A;  3H1U A;  1K51 A;  1OEY A;  4JE3 B;  3RNG C;  1L4D B;  4B0E A;  1E10 A;  2KFJ A;  5G5G A;  4F1S A;  2BW2 A;  1ZW7 A;  2MBH A;  1UH6 A;  3UGB B;  2OJW A;  1EM7 A;  3AU5 A;  3BY4 B;  4KIK A;  4ZRQ A;  4I6P A;  3ZIM A;  4NAW A;  3AE1 B;  5JZE B;  4AQ7 A;  3X0W A;  2GBM A;  4C4V B;  2NMQ A;  1EF1 A;  2FNJ B;  4MGK E;  4LCD E;  2MSE D;  3CMM B;  4HLE A;  2WXI A;  2GBN A;  1SE4 A;  4C80 A;  2WXG A;  3KYC D;  1P7E A;  2KHW B;  5IN7 A;  5EDS A;  3MP9 A;  2CJN A;  1TY2 A;  2VZK B;  3DBL I;  3A9J B;  5HKH A;  1OQY A;  2FCN A;  4MSQ B;  3DQV A;  2BYF A;  3N3K B;  2WXF A;  1FRD A;  4BKT A;  4JWS C;  1I4Q A;  2KC2 A;  1TS4 A;  4W9K A;  3PPA A;  3EEC A;  1RYJ A;  2FAZ A;  3R2I A;  1UNS A;  1WZ0 A;  1ET9 A;  2JRH A;  3RUI B;  2JUO A;  1WJU A;  3UQB A;  3EFC A;  3V05 A;  4Q2J A;  2L83 A;  3LDZ E;  2LMC A;  3I9V 1;  5I4D A;  2QMT A;  3UQA A;  2N0S B;  1J7C A;  4FBJ B;  1M4V A;  2O2V A;  3IXS A;  1P9D U;  4NJ7 A;  4RNA A;  5H92 C;  1WFY A;  4N6E B;  4CYE A;  1L7Y A;  1SE3 A;  2DEN B;  2GMI C;  5AZG A;  1YIW A;  3NJT A;  3A9K B;  2JWU A;  1WXV A;  1VD2 A;  2IO2 B;  2WDR B;  2KZR A;  1WX8 A;  4IM2 A;  1GPX A;  4FAD A;  3EC8 A;  3TEY A;  1OQR A;  2Z8L A;  2V4I B;  4OVZ A;  1FFU A;  2LVP A;  2VH1 A;  4XDC A;  2M19 A;  2I2Y A;  3H9D A;  4LNN A;  4M01 A;  1JWU D;  1TT5 B;  1TS2 A;  4FJV B;  3KQ4 A;  2BQQ A;  1MI0 A;  1H8C A;  5IP4 D;  1TYG B;  2IO1 B;  3Q8C A;  1NYR A;  4OHJ A;  2CU3 A;  2RPV A;  4A6Q A;  4W9G A;  2G9H D;  4WWN A;  3N1Z C;  3AEG B;  4GDL A;  1JCK B;  4KGR A;  1FXA A;  2HJ8 A;  2JT4 B;  3PZ7 A;  3DHG C;  2FCS A;  5FR6 A;  2MJE A;  3KVF B;  2D3A A;  1E8Y A;  2BKF A;  1VDV A;  4BZA A;  4YTN B;  4KKI A;  4NJ6 A;  3BK1 A;  3QX1 A;  4HPL B;  3CIR B;  2GBK A;  4JWU C;  5AEK B;  5LLI A;  2TSS A;  1WJ4 A;  4X57 B;  3Q3J A;  3QWZ B;  2NS5 A;  4IG7 B;  1UEL A;  2ASQ A;  4HEA 1;  2D11 A;  1AYF A;  3GP7 A;  3CF6 E;  1VZ6 A;  2WXN A;  4RH6 A;  4FXC A;  1WJ6 A;  1WIA A;  4HVB A;  2W54 A;  2FCQ A;  3MC9 A;  2KN5 A;  1WMH A;  5GXG B;  4FHK A;  5JH5 C;  2LXC A;  4K7S A;  3FC4 A;  3UI3 A;  2KLC A;  1KFY B;  3ENE A;  3MHZ A;  2H88 B;  3TJP A;  3AEF B;  1QIL A;  4EKU A;  2J52 A;  2C5L C;  4HWI B;  4MSM B;  1RWS A;  2D3C A;  2KFK B;  1YX6 B;  4NAW B;  3IG3 A;  3L10 B;  2BYE A;  2M4N A;  2LD9 A;  1TZO A;  2NBU A;  2XK5 A;  3IT4 B;  4XGA B;  1YX5 B;  2C7N B;  1AW7 A;  3ABV B;  2K6Q A;  2PW9 A;  2YLM A;  4ANV A;  4GLS C;  5JHB A;  1SSN A;  2EMT A;  1P98 A;  2V9H A;  4TQ1 A;  2JWZ A;  2RDG A;  1ET6 A;  2MBQ A;  4WJO A;  1T0S C;  4P1B C;  2MLB A;  2JF5 A;  2B76 B;  3UF8 A;  1NDD A;  3L0W B;  3VUX A;  1PGA A;  3L4P A;  4KGS A;  2BPS A;  1FXT B;  3RYT A;  3VTV A;  3P4P B;  4G3X B;  2WGS A;  1SXT A;  5E6P A;  2WDT B;  4PYU A;  3R8B A;  4YL8 A;  2ZW1 A;  1N5X A;  2A5U A;  5AZH A;  3ZGZ A;  3A4R A;  2CKH B;  1PYW D;  3NVV A;  3TSS A;  5H8Y E;  1UBQ A;  5D3I B;  1NI2 A;  4M0W A;  2NR2 A;  3JSV A;  4F7Z A;  4HJG E;  3OJ3 A;  3KWV A;  3OLM D;  3TEX A;  3MJW A;  1WE6 A;  3PV1 A;  3R7R A;  3M62 B;  3AEB B;  3DWM A;  1TZ1 A;  2ICI A;  1SGH A;  4F8C B;  3PRM B;  1KM7 A;  4B95 A;  5D7G A;  1KF6 B;  1STE A;  2FIF A;  4PT5 A;  3R7Q A;  4C00 A;  2JSV X;  2IBI B;  1WXS A;  3DHI C;  1UWM A;  2IPK D;  3I63 C;  1LXD A;  3PVL A;  1GG3 A;  2EKE C;  3HUI A;  2WXR A;  3EA6 A;  4XWW A;  4DXA B;  2JVC A;  1TJE A;  3ZKJ C;  4XX5 A;  1OQQ A;  1GC6 A;  2LAS A;  1FXI A;  5AUK A;  5DPW A;  4LNF A;  2L3Z A;  1TBE A;  3L08 A;  1LQB A;  4C4V A;  1Q0W B;  2L0F A;  1V49 A;  3TIX A;  4GN1 A;  4LTU A;  3HIZ A;  4FN2 A;  1WGK A;  3P4S B;  2V3P A;  4JL9 A;  3RNB C;  2JX5 A;  2VZK D;  3NS8 A;  3M63 B;  2N7D A;  2N4F A;  2INN E;  4G0N B;  4NQK E;  5MPO A;  3A9J A;  1XCQ L;  2K6D B;  1SE9 A;  2LGD A;  2GI9 A;  2G1E A;  2B3A A;  2ONQ A;  2Y3A A;  3VVW B;  5CHV C;  2CU1 A;  1V5T A;  3ZLZ A;  4W9E A;  4GDL B;  5AUI A;  2LUE A;  3URY A;  1XLO A;  3APD A;  2D5G A;  4XDD A;  2ZVN A;  3PS6 A;  5EE9 A;  4P16 A;  4WH4 A;  1JWM D;  3L16 A;  5L95 C;  1AN8 A;  1FNU A;  2MQJ A;  4NY0 A;  1MG4 A;  4YTP B;  1L4Z B;  3Q8E A;  4ZRK A;  3AE4 B;  5CHF A;  2Q5W D;  1WF9 A;  2XBB C;  2HJ1 A;  2G45 B;  3SEB A;  1XD3 B;  4W9L A;  1ZXI A;  3BK2 A;  4CHK A;  2N9K A;  4MGZ E;  1D6E C;  2K0P A;  3PO0 A;  5DPS A;  3W1Y A;  3VTU A;  1J7A A;  4W9F A;  1N63 A;  2NPT B;  3A9K A;  1XEE A;  2WLB A;  3PLV A;  4ZRP A;  3W5V B;  5D2M B;  4JX1 C;  5DPT A;  1GOZ A;  2AQ2 B;  3ONS A;  2M0A A;  3PT2 B;  1TIF A;  4OVV A;  1JML A;  4ZRI A;  1NBF C;  1XLQ A;  2KOX A;  3P63 A;  3C0R B;  3NG0 A;  2L32 A;  5KHO A;  2I38 A;  2VRR B;  3N20 C;  1JRU A;  1YN5 A;  4NQL B;  1B9R A;  3ECI A;  4W9D A;  1WXQ A;  1V86 A;  2KVZ A;  2GOW A;  1TS3 A;  2C9W B;  3Q3N C;  4FJY A;  4A3P A;  4HCN B;  1F2R C;  2N9P C;  1N61 A;  2M0X A;  3AB5 A;  4RGN A;  5C2T B;  2L8J A;  2Z0E B;  1EWY C;  4H2A A;  2N9L A;  5KHQ A;  4MM3 B;  3O65 B;  1IYF A;  1M94 A;  1DOY A;  4II3 B;  2QIL A;  4TV3 A;  1CMX B;  4BKG A;  4A55 A;  2DAJ A;  2KKC A;  2LWP A;  2SAK A;  2RGF A;  2BS4 B;  3HVZ A;  2BYT A;  1FPY A;  3PGE A;  2LHE A;  2PTL A;  1WR1 A;  2INP E;  2MA9 B;  4II2 B;  3DBR I;  1SE2 A;  3E9S A;  2L0T A;  1WR6 E;  4AS1 A;  3VUY A;  1EF5 A;  3QJZ A;  4DXF A;  2KTR B;  4WWO A;  3KWL A;  5C3J B;  1BML C;  1JQ4 A;  3ALB A;  4M8N A;  4LNI A;  3MC8 A;  2DZJ A;  1FMA D;  4FJZ A;  3QAQ A;  1JRP A;  1E6E B;  3K9O B;  3Q3F A;  1KH0 A;  4WIP A;  1UBI A;  3ZYY X;  3SD5 A;  4YTM B;  2X38 A;  3WIM A;  1R4M B;  1J0G A;  2INC C;  2N7E A;  4RGM A;  3N30 A;  3LYY A;  3VAW A;  4I6N B;  1NYQ A;  1OEY J;  3OAW A;  4MJS B;  3RPF C;  2KFK A;  4DHZ B;  1IP9 A;  3ML8 A;  4EZK A;  2K8H A;  2KDI A;  3SR6 A;  3MC0 B;  2OHF A;  1V6E A;  1N62 A;  3ZNZ B;  2KAC A;  2AYO B;  3DDC B; 
#chains in the Genus database with same CATH homology
 4EFO A;  4WJQ A;  1GC7 A;  3S2A A;  1IPG A;  4RMA A;  3DVN V;  4OVU A;  2HJ8 A;  2JT4 B;  3QIJ A;  4HXD A;  2ZVO A;  4MEL A;  2J0K A;  5GMV A;  1WX9 A;  5TR5 A;  2FCS A;  4IWQ A;  5FR6 A;  2XEW A;  1J8C A;  2O2V B;  3ZRC A;  4ANU A;  1WGY A;  3KVF B;  4WQO B;  1E8Y A;  2KWC A;  4IWP A;  2MRP A;  2BKF A;  5AZF A;  5G2N A;  3V6C B;  3M3J A;  4NPN A;  2DHZ A;  2L7R A;  3ML9 A;  4NJ6 A;  4GMV A;  4URK A;  4WJP A;  3QX1 A;  4HPL B;  3U7D A;  2GBK A;  5J2R A;  3QK0 A;  1RFA A;  5AEK B;  2KMA A;  5LLI A;  2KD0 A;  1WJ4 A;  2BF8 B;  4G50 A;  2DZK A;  3L13 A;  3Q3J A;  4X57 B;  1KLV A;  3QWZ B;  2NS5 A;  4KDI C;  3GZN I;  4IG7 B;  3JW0 X;  5E6N A;  1UEL A;  2ASQ A;  1RLF A;  4GIV A;  2D11 A;  2CR5 A;  2UYZ B;  2RPQ A;  3CF6 E;  2FUH B;  2BKR B;  3ZO5 B;  4IC7 B;  1OGW A;  1WJ6 A;  3VQI A;  1WIA A;  3V61 A;  3VTW A;  1EUV B;  4HVB A;  2FCQ A;  5JHA A;  2KN5 A;  1WMH A;  3QQ8 B;  4FHK A;  4B9K A;  2REX A;  2KK8 A;  2LXC A;  2PPH A;  3RCZ A;  3IVF A;  5JH5 C;  4ZYN A;  4K7S A;  2KLC A;  2WYQ A;  3DBS A;  2JZ3 B;  4GSW A;  3PRP B;  3ENE A;  3TJP A;  3RZW C;  4FHJ A;  4EKU A;  2MBO A;  3CST A;  3AUL A;  2C5L C;  3NHE B;  1Y8R C;  3DVN U;  4ICU A;  4DHJ D;  2RR9 A;  4HWI B;  4MSM B;  2KVR A;  4LJP B;  1I42 A;  3VDZ A;  4FUL A;  2IO0 B;  3ZNG C;  4DK5 A;  3DBH I;  3ZRF A;  2C60 A;  2ZJD A;  4CO7 A;  3AI5 A;  3X23 A;  3QCA A;  2KFK B;  1YX6 B;  2LXA A;  4NAW B;  4MH0 E;  3IG3 A;  3WAL A;  1WM3 A;  5E6O A;  2CHX A;  3L10 B;  4MGI E;  1Q5W B;  2I1J A;  2BYE A;  2M4N A;  2LGY A;  3PRE A;  2LD9 A;  1XQQ A;  2NBU A;  4ANW A;  3HK0 A;  2XK5 A;  2J0M A;  1YX5 B;  2C7N B;  3VXW A;  2HE7 A;  2AL3 A;  2K6Q A;  4BBN C;  5IAA C;  4A3O A;  2YLM A;  4ANV A;  4EUT A;  2D2Q A;  2FID A;  5JHB A;  1R4N I;  1V9J A;  1Q1O A;  3PRZ A;  2PE9 A;  1V2Y A;  2NBW B;  4ICV A;  3VH4 B;  2EMT A;  2K1F A;  5J18 A;  1P98 A;  2UWQ A;  3L17 A;  4TQ1 A;  4PS3 A;  2JWZ A;  1KJT A;  4DBG A;  3I3T B;  2MBQ A;  4WJO A;  2MLB A;  3IHP C;  2AWT A;  4GB9 A;  2JF5 A;  3HM6 X;  4PS8 A;  3UF8 A;  3QA8 A;  3ZTD A;  4ZDV A;  4W9H A;  4IW0 A;  1NDD A;  2K39 A;  3L0W B;  4JQW C;  3VUX A;  2BPS A;  1FXT B;  1YJ1 A;  3QHT A;  4K81 A;  4EOY A;  3TMP B;  5LXI B;  3RYT A;  2CHZ A;  3VTV A;  4G3X B;  3KUD B;  4HDO A;  5J17 A;  1U4A A;  2WWZ A;  2BWE S;  2DZM A;  2ZCB A;  5D6J B;  5E6P A;  2WDT B;  4PYU A;  2DYB A;  2KJH B;  2KWV B;  4YL8 A;  2LVQ A;  2MW5 A;  1S3S G;  5AZH A;  2A5U A;  2KQ7 A;  4KZC A;  3A4R A;  1L2N A;  2CKH B;  1LFD A;  4IM0 A;  1WZ3 A;  2C7M B;  4P7I A;  4GU2 A;  1T0Y A;  1UBQ A;  1WH3 A;  1D3Z A;  1NI2 A;  4BFR A;  2NR2 A;  3JSV A;  4F7Z A;  5IA7 A;  1P1A A;  4TKN A;  4FA6 A;  4BKS D;  2DAF A;  3OJ3 A;  4JGH B;  2Z59 B;  1WMH B;  3OLM D;  3MJW A;  1WE6 A;  4BKS A;  4XZ4 A;  2GBR A;  3PV1 A;  3R7R A;  3M62 B;  1TZ1 A;  2PEA A;  5CTR C;  3W1S A;  1SGH A;  4F8C B;  4B6W A;  3PRM B;  1KM7 A;  4B95 A;  2ZPY A;  5D7G A;  2DX5 B;  2FIF A;  2KTF A;  2NVU I;  4BOZ B;  4EEW A;  2M17 A;  3KW5 B;  3R7Q A;  2KAN A;  2KWU B;  3SHQ A;  4ASW C;  2KC1 A;  1WJN A;  2KO3 A;  2IBI B;  1WXS A;  2R2Q A;  3DVG Y;  4K7U A;  3VH3 B;  2CHW A;  4E74 A;  2DYO A;  1LXD A;  1C1Y B;  3PVL A;  1GG3 A;  4DHJ B;  2EKE C;  3M95 A;  1V81 A;  2IY0 B;  2LI5 A;  2G4D B;  3U8Z A;  1UZX B;  1LM8 B;  2LJ5 A;  4FLH A;  4G11 A;  4DXA B;  1GUA B;  2JVC A;  2D10 A;  2KNB A;  3ZKJ C;  1A5R A;  3PHX B;  4XX5 A;  4ZRJ A;  1GC6 A;  2L05 A;  1J19 A;  1K8R B;  1WGR A;  2LAS A;  3WAO A;  2EMS A;  1V5O A;  3DVG X;  3QAR A;  2XK5 B;  5DPW A;  4AOF A;  3HHM A;  2D07 B;  2NPT A;  1TTN A;  3RT3 B;  1QZE A;  2L3Z A;  2MP2 B;  1TBE A;  3L08 A;  1LQB A;  2ZCC A;  1Q0W B;  2L0F A;  3QC8 B;  1V49 A;  2NBV B;  3TIX A;  1WI0 A;  5CHW A;  3NZS A;  4GN1 A;  1WM2 A;  4MDK E;  3T9L A;  2Z0D B;  3WAN A;  2LGX A;  2V4L A;  3HIZ A;  4FN2 A;  3IFW B;  4J6I A;  2HD5 B;  3PTF C;  1RRB A;  2LRU A;  2JXX A;  2JY6 A;  3DCG A;  2HTH A;  1UD7 A;  4GGQ A;  4JL9 A;  4JLC A;  3SU8 X;  1KOT A;  1WE7 A;  3WAP A;  3NS8 A;  3M63 B;  2N7D A;  3ZVV A;  4BBN F;  2N4F A;  1RAX A;  4AP4 C;  4G0N B;  2RD0 A;  1GNU A;  4NQK E;  2O6V D;  4LDT D;  3A9J A;  2NCN A;  2K6D B;  2KDE B;  1SE9 A;  2LGD A;  3ZUN A;  2KJ6 A;  2O6V A;  2B3A A;  1BT0 A;  3VVW B;  4ANX A;  2N9X A;  4AUQ C;  3JYU A;  2BYV E;  5CHV C;  2CU1 A;  4I6L B;  4W9C A;  2IZV B;  5DPR A;  1MG8 A;  3N32 A;  1V5T A;  3D32 A;  4GOC A;  3ZLZ A;  4HDQ A;  5C1Z A;  1E5W A;  2PJH A;  4W9E A;  1PQS A;  2DZI A;  4GDL B;  4MM3 A;  2LUE A;  4M0W B;  3JSV B;  3ZDM C;  3A1Q A;  3UIN B;  3APD A;  1YQB A;  4WJN A;  1TGZ B;  2ZVN A;  3PS6 A;  5L83 A;  1G6J A;  4EZL A;  4BOS C;  4KZ0 A;  2G4S A;  3MHS D;  2RSU A;  2BGF A;  3U30 A;  3AXC A;  2ZZP B;  4HPM B;  2KMC A;  3L16 A;  5L95 C;  2BWF A;  2V1Y A;  3PLU A;  4K1R B;  3PZD A;  1WRD B;  2MQJ A;  3KYD D;  4KDL B;  5DCN A;  1EO6 A;  3WA0 A;  2J7Q B;  3T8M A;  2MBB B;  4NY0 A;  4W9I A;  3ZNI D;  5C23 A;  3B08 A;  1OTR B;  2KX3 A;  1V80 A;  2ZNV B;  2KDF B;  2OJR A;  4ZRK A;  3UIP B;  2MWS B;  1S1Q B;  2DYM A;  2LZ6 A;  4GXB A;  3R66 C;  2QHO A;  5CHF A;  4AJW A;  1WF9 A;  2XBB C;  3H1U A;  2G45 B;  3NOB A;  2KLG A;  1OEY A;  2PE6 B;  2L76 A;  1XD3 B;  3EFU A;  2KFJ A;  1F9J A;  4A20 A;  4KV2 A;  4F1S A;  1P0R A;  4W9L A;  1SIF A;  1ZW7 A;  2MBH A;  1UH6 A;  2KTR A;  4CHK A;  3UGB B;  1H4R A;  4MGZ E;  5DPS A;  3W1Y A;  4DHZ E;  3AU4 A;  4HJK A;  2C7H A;  3VTU A;  2KDB A;  3AU5 A;  3BY4 B;  4KIK A;  4I6P A;  2Y5B B;  4W9F A;  4NAW A;  3ZIM A;  1R4M I;  2MBE A;  2LVO A;  2N9E B;  2NPT B;  3A9K A;  5JZE B;  3PLV A;  3A33 B;  5CX3 A;  2CS4 A;  3X0W A;  2IO3 B;  4PS7 A;  2GBM A;  1EF1 A;  5D2M B;  2FNJ B;  2ZEQ A;  4MGK E;  3RUL A;  5DPT A;  2GBJ A;  4LCD E;  1Z5S B;  2MSE D;  3ONS A;  3PT2 B;  3ZNH B;  4ZRI A;  4OVV A;  3CMM B;  1NBF C;  2KOX A;  4HLE A;  3B1L X;  3C0R B;  3CSF A;  3R3M A;  1E7U A;  2GBN A;  3KUC B;  4TQ0 A;  2KX0 A;  5KHO A;  3KYC D;  2KHW B;  2W9N A;  2VRR B;  2N1W A;  5EDS A;  1JRU A;  4KVG B;  1C3T A;  4NQL B;  3ECI A;  4W9D A;  3PHW B;  4GDK A;  2ZNV C;  1V86 A;  3V6E B;  2GOW A;  3DBL I;  3A9J B;  5HKH A;  4HCP B;  2C9W B;  4MEM A;  1OQY A;  4FJY A;  4WAA A;  4A3P A;  2O6V B;  2AL6 A;  2FCN A;  4LDT B;  4PYZ A;  1AAR A;  4HCN B;  3OJ4 B;  4WWP A;  1WGG A;  4MSQ B;  2N9P C;  4IWO A;  2M0X A;  4MJS A;  4BVU C;  3DQV A;  4N9F 4;  4NNJ B;  2L8J A;  2Z0E B;  5LXH A;  2AEH A;  2BYF A;  4EZJ A;  3N3K B;  2MCN B;  5KHQ A;  1X1M A;  1ZGU B;  3NZU A;  4BKT A;  3O65 B;  2KC2 A;  2M8S A;  1IYF A;  4W9K A;  1M94 A;  3H7P A;  4II3 B;  3A1Q B;  3PPA A;  1WY8 A;  2L00 B;  4RM8 A;  3EEC A;  4E3C A;  3VHT C;  2K8B A;  3H7S A;  4TV3 A;  1CMX B;  2FAZ A;  4BKG A;  1WZ0 A;  3HM3 A;  4RM9 A;  2KJR A;  4KSL C;  2DAJ A;  2OOB B;  2JRH A;  1XT9 B;  2KKC A;  3RUI B;  2JUO A;  2LWP A;  3DPD A;  1HE8 A;  1WJU A;  3TL5 A;  3UQB A;  3UIO B;  2JRI B;  3LJ3 A;  2RGF A;  3LDZ E;  5BO4 B;  2M1M A;  2J0J A;  3ZTC A;  3UQA A;  2K25 A;  4JIO U;  1P3Q U;  3TCA A;  5D94 A;  3PGE A;  3TBL D;  4FBJ B;  3VUW A;  2O2V A;  1GJZ A;  1WR1 A;  4IM3 A;  3ZW3 A;  2MA9 B;  1P9D U;  4II2 B;  3VFK A;  3GOE A;  3MTN B;  3DBR I;  3RD2 A;  2R2O A;  1VCB A;  3PSE B;  2L0T A;  4MGY E;  1WR6 E;  1WX7 A;  2G3Q B;  4NJ7 A;  2IYD B;  1WGD A;  2WX1 A;  3VUY A;  1EF5 A;  1WFY A;  3QJZ A;  4CYE A;  2KTR B;  4WWO A;  3V62 A;  1WXM A;  1L7Y A;  2DEN B;  1E7V A;  3H6N A;  2GMI C;  2IY1 B;  4DDI D;  2KQS A;  4KIK B;  5AZG A;  1YIW A;  2K8C A;  2JPH A;  3A9K B;  3IBE A;  4IUM B;  3ALB A;  3P2B A;  1WXV A;  3DOW A;  4M8N A;  4AWJ A;  1VD2 A;  2IO2 B;  3A4S C;  3EHV A;  2DZJ A;  3BIN A;  2KZR A;  3ZDT A;  1WX8 A;  4IM2 A;  4FJZ A;  3QAQ A;  2YVC A;  4LJO B;  4FAD A;  3L54 A;  3K9O B;  2V3S A;  3EC8 A;  3Q3F A;  1UBI A;  4M8M A;  1WXA A;  2MP2 A;  3SD5 A;  3KH0 A;  2WX0 A;  3WIM A;  4TUU A;  3WAM A;  2LVP A;  4HK2 A;  2LRW A;  1J0G A;  4GDK B;  4E71 A;  1UGM A;  2N7E A;  2D3G A;  3N30 A;  4KSK C;  1I35 A;  4DDG D;  1ZKH A;  2I1K A;  3JVZ X;  3H9D A;  3SDL C;  3VAW A;  4I6N B;  3NY5 A;  1E8W A;  3APF A;  1E90 A;  2FCM A;  3APC A;  3RZF A;  4W9J A;  1OEY J;  3OAW A;  4MJS B;  5G55 A;  4FJV B;  3K9P B;  2A4Z A;  1H8C A;  2KFK A;  4DHZ B;  1IP9 A;  3ML8 A;  4EZK A;  4XC2 A;  1WGH A;  2MX2 A;  1YD8 U;  2K8H A;  1E8Z A;  2KDI A;  2IO1 B;  3KUZ A;  2N1V A;  4AJY B;  2JZZ A;  1Z2M A;  3H7P B;  1ISN A;  4W9G A;  2ZPN A;  4DWF A;  3V60 A;  3B0A A;  4WWN A;  2KXJ A;  1V6E A;  1E8X A;  3W1S C;  3ZNZ B;  4K7W A;  2AYO B;  1WYW B;  4GDL A;  3DDC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...