4F8PA

X-ray structure of psaa from yersinia pestis, in complex with galactose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
141
structure length
141
Chain Sequence
b'TFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFDNKQSTVINSKDVSGEVTVKQGLEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pH 6 antigen
publication title Structural basis for the specific recognition of dual receptors by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell adhesion
total genus 21
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f8pA00
4F8NA 4F8OA 5LO7A 5LN8A 4F8PA 5LNDA 5LN4A 4F8LA
chains in the Genus database with same CATH superfamily
2W8CA 3KWXA 4X5PA 2F53B 1I82A 1UQSB 4PJ8D 4MB5A 5FO2A 1LEKA 5KVMC 2YEZB 1BJ1J 3P4NB 3RWEA 1S7UA 3CSFA 5BO1H 4HH9B 4YQXH 3O3EB 1P69B 3V4PB 1BVNT 4HJSA 5I1KL 4OZHA 4YE0A 4PY7B 2HKHH 5AKSA 2ZSVA 4QJ4B 4YSAA 1BEYH 2VKWA 4LLUB 4CA4A 1B4JL 1FAKT 1OAKH 5D71H 4ELKA 1JDAA 4NZDA 4ZRGA 1ZEAL 2CO6B 3PV6B 1QFWM 1Q9WA 1NGXB 5E2UL 3BSZL 5HHMB 1LDPH 4XNMB 3RVVC 2GAZB 4G8IA 4NN7B 2MSPA 1DVXA 3QJSB 5JHLA 1FHNA 3CBRA 2F7RA 3ALWA 3EFDL 1G1CA 3GSWA 4M7LH 3VFSB 1XIWA 4NQED 5I1LB 1RK1A 3KVPA 1EFXD 4TULL 2WXLA 1Z0NA 1W8NA 3PXJA 3U7WL 1KT2B 1NC2D 1ZVSB 4L4TA 4JLRA 3O8XD 2ZF9A 3ZXAC 1O9VA 4FFTA 3ILQC 2MTPA 4IKKA 1WD9A 3GBLA 4NQTA 3UTZA 2YPVA 2J57A 4JFZL 4XH2A 5E6SB 1C5DA 3E0GA 3GZPA 5EUOB 3M88A 1I7TB 1IGFH 3DJTA 4S10A 2AXFB 4Z95H 4FABH 5BS0D 1X5KA 5BVPH 4FQ1H 5GJTH 5CCKH 4P5TC 3UGUA 4CN4A 3KYNB 3QHFH 3NOIA 1XCTB 4AM0Q 5A2CA 1KEML 3F00A 3HN3A 3MRPB 5FC9A 4OZ4A 1GY2A 1U3HC 4FEMA 3VFTA 5IQMA 5JZ7C 3LB6C 2FEDD 1YQVL 4NKMB 4C56B 1PX4A 2VJXA 2VXVH 2K7PA 2IPUK 5HD8C 2Z4QA 4NKQB 4W93A 4KKLC 4WVRA 1J8HD 3F83A 2H41A 4NENB 4YGAB 1U8MB 4W9CC 5GS2D 1TJGH 1I3RB 4UTBL 5HDOA 3UX9B 1FORH 3V0VA 1S5IH 4PBDA 3U2JA 3QJRB 3MC0A 5I0VA 2NPLX 2PCPB 2ZAHA 4DUXA 4PJHE 2XN0A 4NDMA 1DZBA 2Y5QA 3F3HA 3IRCA 3KL3A 2CGRH 3MLRH 2HG0A 3W0WD 2IAMA 2GABA 4JN2B 5FB8A 1OGAB 1OOAA 1E5CA 3LSOB 4X6CB 3NSYA 4NOBA 2ZJSL 4R4FH 5CP7A 1IM9A 1URIA 4HKZA 2FB4L 3QR1A 4HK0A 4L1TA 4NT6A 1OPOA 4LF3A 4XRCB 4C4UA 1JPSL 2QFPA 2ZYHA 4U1MB 1IX2A 3QEQE 2NZ1A 2D0GA 4DP7X 1CD1A 2FBRA 3L9EA 4KZDL 4X5RA 5JIIA 4P9HL 1CJYA 1M7DA 4BZ1L 1JFHA 4DQOH 4YLCA 5I6XC 5ILTH 1CLOH 2CUIA 2Y6SD 4UU9A 3ARUA 4HUNB 5AAWA 4PI2A 5F3HB 3WEAA 4U1LB 1MJJB 2BW5A 5IBLC 5KSUB 4XBEH 3R8QA 3I9AA 5I1CH 5C0GB 1DSFL 3UTQB 3AQDA 4PV8A 5C7ZA 4GY4A 25C8L 1UZ6E 1PMYA 3PHQB 3FONB 4NPKA 4O51B 1IC7H 1S7TB 2DMGA 2X4SA 4FJ6A 2GJRA 3HE6D 4P2QD 1EXHA 4XNQA 3CX5J 4PJAF 3AXHA 5E9DA 2BK8A 4PD4K 4YDZA 1VHPA 2FX9H 4PWKA 4B5EA 3IDJB 1RU9L 3B8YA 1PBYA 3FBQA 4LSTL 1SHXA 2XPGB 5CJ8A 4Z7NB 2DM3A 1TSRA 3ALXA 1NCWH 4GKLA 1TCRA 2YRLA 3A4EA 3NPSB 4HK3J 4D0BA 4FQ2H 3S88H 4J3OD 1MW3A 3DURA 3IAQA 1P9MA 4Q9BA 4IIQC 3QCTH 2E7DA 4TPRL 3UG3A 5CJXA 1HXYB 3RHWF 2H3XC 4R26L 1CXHA 2C1PA 4BJLA 1ZA3A 2BP0A 3MLXL 4JN1H 4F80A 3HS9A 5D1ZI 4DP1X 5HXMA 3ISWA 1DEEA 4NQDD 2C7FA 2C3VB 4U6YA 2E3VA 2F1EA 2VM9A 1MCIA 3ZDWA 4QRUA 4IMKC 2F58H 2OZ4A 1F5WA 3QEUA 1XGTB 3D33A 4UZUA 4OI8A 2KPWA 1AQDB 2IOMA 4KJPD 3PDDA 3W9DB 3BZ4A 1AE6H 3PWPA 3Q7JA 4HT1H 3C5JA 3B6SB 4UINH 2EIKB 1I3GH 1Q8MA 3KWTA 2C9AA 3IPFA 4DTGL 1T1ZB 4DW2L 1BZ9A 1IAIM 2JELH 3HZVA 2C7UB 4PTTA 2BSCA 3DKHA 4S1QH 3ROOB 3ESOA 2XG5A 2JB6A 1RZ8B 4LPTA 4NN7C 3RWHA 3VXMD 5DUJA 1SPDA 2PTTB 1PJ9A 3JV6A 1UG9A 2QDWA 4MNQA 3FTXA 2I25N 3QVAA 1V10A 3UTSA 2V9UA 3KBHE 4HJIA 5ISZD 1YEEL 2XBZA 3Q2VA 2R56H 1HS6A 1UA3A 1LJMA 4X9HA 3MUY1 3ULVH 5HJGA 3JYCA 3NSJA 5I0WA 5F7KC 7PCYA 1FYTA 2OR7A 4KK5D 1KPRA 4LKXB 2VLME 4QHUB 2DYRB 5C0BD 2VDKL 2JKJA 1GIGL 2P48B 3GMMA 3HFMH 5I5JA 3ULUH 1LGVA 1SMDA 5DK2B 4BKSC 5IQ7L 1CFTB 1AS7A 3LEYH 3B9KC 3T0EB 5C9JA 4FMFA 4P2OB 3VFPB 4X6FB 3WN5C 2DYPB 4LSQH 1U8KA 3GFUA 4LCIH 1KB5H 3H9SD 3N1QC 1F3RB 2VLJB 4JHVA 4EIUA 3V0FA 4DGUA 4GXFA 5EU7E 2DLFH 5JXAL 3SQRA 1E5AA 3LV3A 2L04A 2XWXA 1EANA 5AOLA 3BE1L 1ZT1A 5C0JB 3AC0A 2QPUA 1LLAA 1TR7A 3H9HA 2W88A 4CSTA 2GJZB 1OCCB 2P26A 4Z7IA 1BQLL 5A7BA 1QBBA 4PG9B 3TASA 3A23A 5FYJL 4Y1AE 4AH2B 1QWUA 3Q06A 1VGEL 1SXZA 2LAGB 1G6RB 2NY0C 5J1SC 2X53A 3B5TA 1J8KA 2HG5B 3L3KB 1N0LB 4FDWA 1VCAA 4O02A 1DE4B 4M56A 1YEDB 3PE9A 2BIOA 2P8PA 1D7CA 1W0WB 4UIMB 4MCMA 3UTTB 5D2LE 1K3IA 4CU8A 1OD9A 1A9EB 4LARH 1V54B 4CBPA 1CQYA 3FMGH 5AW4B 3VXPA 1EHXA 3MQIA 1TTCA 1O7SA 1ZLEA 1ASQA 4YHKL 4MA3B 3V7MA 4HV8B 1AZUA 1NUFA 2EDYA 3JVGC 1EERB 4A6YA 1X5GA 3QORC 1SFDA 3QZWB 5C0CE 2YPKA 4JQVC 1HJBC 3KYKH 3QH3B 3S37H 2VAJA 3L5IA 2ERJB 5IHWA 4HC1A 1XQ4A 4PP1D 3EGDA 2FL5A 3L95A 5DRWB 3TT1L 4P4RB 5C0EA 1L6XA 3FOLB 1KJ2B 2YJQA 3VXSA 2P43B 2WWNA 1K85A 3VYOA 5MP6H 2P9RA 5F6IB 4OZIB 3GNMH 4GSDL 5FA3A 5KAQG 3KL0A 4ZO7A 4KX8A 1NFIB 1BQHB 2E7MA 5D1QA 3T0AA 1X4ZA 1KXTB 1EMTH 1NJ9B 3Q2NA 4JG0H 4AJ0A 4IYKA 3IJ8A 4G11A 5CSZA 4G3YH 2DJSA 1E7VA 1MI5A 1T5KA 2ATPB 3PJLA 3DK0A 2WNKA 4DVBA 3L1OL 3NZUA 1ETJA 1TTFA 5IROA 4BE5A 1Q1JH 2E9GA 3T65B 3GF8A 1CYGA 1HHGA 1F11B 2VMJA 5D93C 1YUKB 5E8PB 5JW5A 1J5OH 3UBFA 3C8DA 1RK0A 3RY6C 4HKJB 3OKEB 3DXAD 4Y4KB 4PH8A 1GZQB 1JPFA 1NDGB 1NGQH 3VW3H 2DIAA 3V10A 3IDNB 1O6SB 4CVXB 5D7LB 3OKLA 1F4WL 3BKYL 3B1UA 1IFGA 1IEAA 1HHKB 4FTVA 5DSCA 4HG4K 3AY2A 3ULVF 2YKLL 3GIVA 4FKKA 3II2A 4FQJL 2EO7A 1KCSL 4BCXA 5LN8A 2BY1A 2IWEA 4UQ2A 3DARA 4YIQB 5E6UB 1J9SA 1TMQA 4QXUL 3UP1A 4LQ1A 4A38A 1DVYA 1YDPA 1OTUC 3E6HB 4WJKB 4Y9EA 3TFKC 3ET9F 2QMJA 5LNEA 2EJ1A 3L5WB 5F89B 4E9VA 1HWGB 4QRTA 3GJFA 3P0VH 2GSGA 1BXUA 3HVNA 4ZXBA 4R97B 4OIIH 1CDCA 4JM0A 3QO1A 4GMSH 4WWKD 4CAGA 3MJWA 4XB8A 3RA7L 4XO4A 5FYKU 3T2LA 2R23B 5EF0A 2MNUA 3WFBL 5JHDD 3UJJH 3QAZB 3HUJF 1HH9A 4H25A 3LX9A 4ZMYA 1G94A 1AD9B 1Z3GL 3WLBB 2DDQH 3GSUA 3KH3A 4OD1H 1A5FH 4P2OC 1KXQA 1E67A 5KOVC 4X6DF 3EYQD 2RBLA 4DN4H 3TCLB 1YNLL 3ETSA 4XPHL 5C0RL 3US9A 1Q0YL 2GYSA 2VW7A 2IO5A 3KJ6H 4Y19E 2FUQA 1JNHB 3SN6N 1MNNA 4H8QA 3RVXC 3X12A 2O6DA 5ETUB 1F3DH 2KPNA 5GGTL 1I31A 3GGWB 3QNYB 3BRGC 1KN2H 3LXUX 3FRPB 4B7LA 3MOAH 2VXUH 3FQRB 1AFVL 1J05B 3K0YA 1N10A 3QXAA 4N9OB 4PRPD 5IGXL 3OR6A 3TF4A 4WNQB 4YDKH 4J3VA 1UWEH 3O9WD 4APQB 5I2IA 3ARBD 1KTDA 5DU7A 4Z7OE 4G6JH 2BMKA 1RZPA 4NRZB 5B39B 1KNOA 3ZDXE 4UTCA 2NY4C 1KPUA 5GSVA 4NCC2 5DZNA 4YPGA 2W9EL 4BBWA 4DSYA 4W6WB 1HSBA 4CC1A 3VD7A 1E0OB 1QOKA 1A9BB 4UAHA 5J6GB 1K4CB 4HJ0D 3NIGB 1WISA 1JNNH 5A1AA 4J1UA 3WAKA 1CFQB 2DTMH 3ZDZE 1TQUA 2CRZA 5JPMA 1KIQA 4RGND 5B7MA 3KPSD 3OB8A 3W38A 4B9YA 2F5AL 4WW1B 4GIOA 3RIFF 3VGGA 2NNFA 3B7TA 1HN1A 3S4SG 3HNTL 5EFIB 1DVFC 3NCMA 3NCYS 2CM6A 3CHQA 4NS0A 4PRHE 4NP4H 4XHJC 4G9FE 4M9OA 4NZFA 3VJ6B 4JJHA 5LCVL 5GGRB 2ZKHL 2HLAA 1Q9OB 1BIIA 3C2AH 3WNNA 2BERA 4PREA 3D4ZA 4JO2L 4GIAA 3MHZA 4YFLF 1D5MB 3EOBB 3ILPB 1HL5A 3CD4A 4LL4A 4Q8BA 3CE1A 3BQUC 3S35X 4K94H 5EZOL 1ORSB 1WWWX 1ZK5A 1GPOL 4ZAKD 4ODTL 2VDPL 3LQAH 1K72A 4LCYB 3FO1B 3H56A 3NJIA 3CFMA 5K59E 2G30A 3MV9D 5DHYB 1UOWA 1DQDL 1IVLA 1VGKA 1QLEL 2BLFA 1UADC 3FRUB 3QEQA 1SLVA 1YMMA 3MRLB 3CAFA 1JDCA 4P9MH 3MJ8B 4XP9L 3AB0C 3TEUA 4ZX3A 3VM7A 2V5TA 2QHRL 2OXGB 2F08A 4OD2A 1YEFL 2XRAH 5CSGA 1DDTA 2QQKH 4RWHA 1QBLH 5DEFB 5C7XL 5IOKA 2HJKB 3G6JA 1AXTH 4K5PA 1TPXC 4EZMA 1IZKA 1VB9A 4A6YH 5I76A 2AGJH 2G2NA 1T21B 4N0FA 1UWGL 2BS8A 3KPQB 1S9XA 5IBTL 4M5SA 3PWUA 2CALA 3CPLA 1KLFA 4KNSA 1EVTC 5JOFB 1E5UI 2AK4B 4GQZA 5GRYA 5DWUH 5IKCB 2IADB 2ZXQA 3FTGA 1IILE 4PJDF 4X6EB 5F96H 3NQIA 1MLBA 4FLSA 4UQ3B 1G4RA 4GMTL 4MSWB 1F56A 4AM0B 4QEGA 5CFAA 1QZNA 2R2CA 4MCYA 4Y5XA 3BZFB 3U6RB 3H85A 5CGTA 1JK9A 2D2CC 1EXUB 3Q5TA 5B1CA 3VX0A 2O6FA 5DTFA 3VRJA 2R29H 5E4AA 1CXLA 2AMGA 3EO1B 3QG7L 1PY4A 4JO5A 4IRJB 5JPNB 4FQCL 3BWSA 4FKHA 4EZJA 2D31A 1MCFA 2W65A 3PP3H 4ETQA 3VU2A 4R97C 1IEBA 4XP1H 2PW2B 3BP5A 3NFNB 4PJIF 4EF3A 1ORQA 1Q0XH 4A7QA 4KTEH 1DJIA 1RUKH 5A2AA 5LAXA 3MRRB 5IB3B 3UJTL 1GC1L 2VITB 4OD3H 2OLDA 4OZGE 5IOPB 4YX2L 3WYRA 3D2TA 4LIQH 1NCBH 1SNRA 3CZGA 4JR9L 1ZSHA 1DBKH 2V0AA 2ESVE 5GRVL 1SXSA 3UC0H 2WCSA 5C0IB 1ZLUK 3CHXA 2NTFB 1QX1A 4NWUH 4XO3A 3K72A 5CHNA 4GQ9L 3QJFB 4EN2A 4YE4H 1XSOA 2V2XB 1V55B 3QI9A 3TJPA 5MEPA 1YNKH 3BQVA 5CLWA 4APQC 3I3BA 3PF2A 2Y7SA 4TSCL 3VFNB 3L1EA 3ARGD 3P30L 4NRYA 3WKML 5TF1H 2MCPH 2CCLA 1ECYA 1ED3A 2HT4C 3UPRB 4Z0XA 1YEHL 4DHLA 2NNXA 3MMEA 2D0FA 4HKXA 3BCFA 3HEIB 3WXWL 2F8IA 1CDHA 3IE9A 3OKKB 4H20H 4NUMA 5DF0A 1P5VB 4GAGL 4JO3L 1OSPL 4TVPD 5AW8B 1PZUB 4BZ2L 4ABWA 5HYSB 3U1SH 3PFUA 5AZEH 4D9RD 2ID5A 5HJBA 2F8VA 4X83A 2YZ1A 3CWGA 2QV4A 5FKAB 3QUXA 2UYLA 3IFPA 4QKTA 1KTRL 3HAEB 3KVQA 5I8EB 4APXA 4JPIB 4RAHA 3ULVD 3V9FA 3FSVA 3MNVB 4XCYB 4ZD3H 2YLKA 5INCB 3UO8B 5J56B 5EU6D 5KYWB 3DX3A 1S78D 4U6TA 1LO0H 1E5BA 4EBQL 3D3VD 4JFDB 2XICA 4PGJA 2VKXA 1MZZA 3H6JA 3MX0B 4AUJA 5DO8A 2B1HL 4FC3E 5HHQA 4FYQA 3W11D 4J6RL 2WVVA 3RUGF 3LN9A 1HKLH 1JZEA 1ZWIB 4HWUA 3L1FA 4Y1AA 4AUUA 3DROB 4BXVA 1PG7X 1P7BA 3QUZB 3WGUB 5IHLB 5ICYB 3U0WL 4GAYA 1QI3A 4M1CC 1NDMB 4HLEA 1BGXH 1PU0A 5I1HL 3AACA 1B0RB 5D5MF 4EEEA 2N7SA 2B2XH 1XZ0A 3QIUD 4CU6A 4ZZKA 2PPFA 3NGBB 3RFZB 2EAEA 1IJNA 3S3CB 1M2VA 2FTAA 4U1KB 3EGXB 5C2UB 5IW1B 4TYUA 1F58H 5AW6B 2DZEA 1OOWA 1S3KL 3KYOA 5SWSD 2ZUYA 2OMTB 5GSRB 4LKCB 5HGDB 2YKKA 1OTSC 1UZGA 4FNPA 4Y4FA 4JRLA 4JFQA 1JCVA 2EXWC 4QRQA 3ZKNC 3QS3A 4RH4A 5I28A 2ADGB 1X5AA 3MLTB 4YGVB 3VGHA 3RIAK 3VH8G 1KLGB 2GSMB 2WB7A 3OJMB 4QDGA 4TUJA 4OVUA 1JXDA 43CAA 2F74A 3KGTA 4QHMA 4M3JA 4CSZA 4NKOA 4OM1L 1NUGA 1PJWA 4KGJA 3MLZH 4PW3A 5IBUB 2GEQA 4NQDA 3OKNA 4NUQA 4N2IA 4DT2A 2D3NA 3BAYA 1QQDA 3IFOA 4V2BA 1FDLH 5ABDE 1XSIA 4EO5A 1AR1C 4UTAL 1FPTH 3AWGA 1B2WH 4KK6D 4RESB 5B1JA 5M7QA 4Z78B 1EZUA 1ZLSH 1OCRB 4X4KA 4B9PA 3EW3B 3PGCA 1OARH 2QVIA 3ZQXA 4M4RA 3TIEA 1YY8B 3ZKMC 1JDDA 2GITB 2E8YA 3OB0H 3ZTNH 3OC5A 1KGCD 3H42L 2FZ3B 2FEEL 1JNLL 1P7KB 2PCFA 5EIIG 4LVNB 3N42F 1OF2B 1U3JA 5CILL 4YLQT 4Z7VE 2VDRH 2CLZA 4FQXD 1T0NB 3I6KA 3SCMB 3CDGB 4KJQD 2Q6WA 4G72B 3BFQG 1GTFA 2ZP0T 4OCWH 2P80D 1WBXB 1XTMA 4V11A 3KBEA 1N3NA 1GOHA 2J6EA 4ODVL 3CVHL 1SOKA 3A6BH 3B56A 4XMUA 1J1PL 3VVVA 2C9RA 1ZGLA 1FVEA 2UVEA 4UBDD 5HHPA 5I6OA 5T1DL 2FJFB 3NBNA 3QDJE 2UXGA 2NOYA 2WWMC 4FAAB 2JIXA 4RX4A 2P5ED 1BZ8A 1JNJA 2V7HB 2EXYD 2CDEA 3GSVB 4OLYL 1PAMA 3IKKA 2EDXA 2VAAA 1SYSB 4X7TA 1J8SA 3O3DA 1MFCL 3H9SA 2FJSA 3RLSA 4D8PB 1VJSA 2OCFD 5AAPA 1OP3K 2CKNA 4PJ7F 3U0TB 1OAXL 1RJYB 3MUJA 5A3ID 5KBKA 3ZT6A 2FYYB 2X42A 4ZFFA 3PDGA 2NYZA 2DEWX 3B7YA 4J4PC 2QQLH 4EN3B 4H8WL 3AWFA 4L9DA 3NACL 2A6DB 3O45A 1RURH 4M1GL 2DTSA 2YSSA 3CFKB 3UFIA 3N43F 5DA4A 3TO4C 5EH1A 1HESA 4TTDD 3T3MB 3RWIA 2Y1AA 5I17A 1BVNP 4RAVB 4JM4L 2VOTA 4ADGA 1N19A 1Z0MA 5DVOA 4F9PA 1A6WL 1FZMA 3BP7A 4MWFB 1QACA 4S1SL 2NXZB 2I9TB 4XWOD 2QBWA 1RVFL 5F9WB 5TPWL 3A4FA 1OE3A 4DO5A 2A9MH 2XN9E 1UHVA 2XA3A 3OPUA 3BKMH 3R4RA 4PW9A 3V4VB 3LAFA 5FHAL 4BH8B 3U6XA 5C8JB 4YVNA 1R3LB 4PVLA 2VUOA 4PUBH 3RWGA 1K9TA 1S7VA 5GHWL 3RVUD 5JIHA 2ZOKA 3NGBC 1FE8H 2AZAA 2EUZA 2O6PA 1A7QH 1I7ZA 1KY6A 3SJVD 2XTJB 3PREA 5BW7C 4CGUB 2XIIA 3MRFB 1EAQA 1Y7VA 5CN1A 5DC4B 1U21A 5F7EL 4AQEA 4WJG3 1U8NA 2Y06H 8FABA 2XIDA 4F7MA 2ZG2A 5DZ9A 4DERA 3DUHA 3MA9H 3S6CA 1JVLA 4M7LT 2OX5B 3TWYA 1OL0A 4G8GD 1XH1A 2P5WE 2WCGA 5B38A 2BNUB 4G9FA 4PGZA 1QVOA 1L9MA 1F3JB 4PR5A 2ITDA 4TNWF 4IBZA 5BO1L 4ZO6A 4YQXL 1U8PA 4I13B 3ARFB 2AXGA 5F0JB 5IUCA 1FNGA 1ZVNA 3BD3A 4MJJA 3BKCH 4IQHA 4O58L 3KLHD 1BDYA 1NGYB 2EIJB 1UFUA 5D6CA 2R7EA 4LCUB 1PY0A 4Q6IA 4G9DB 5B1KA 3EJQA 3RB5A 4ENED 2KLRA 4OB5H 1OSYA 1U2CA 5DURD 1BBJA 4MJ5B 1JWUB 4GAJH 3D0VA 3MACH 4LCWE 1DVQA 1GHFL 2WD0A 4U1IA 1CVRA 3FCUB 1Y6NR 3G08B 4XC1H 1AR2A 4JG9A 5GS1A 1WFOA 1Z6JT 4YK4C 4E5XG 3AAZB 4JZJA 3N0PB 4PEEA 5EG6C 1UA6H 4LLVB 4Z76B 1SJVA 1MFBH 5DJ8A 5ANHA 3MCKB 1MNUH 4CVUA 1IGFL 5EZIH 2D7NA 4Z95L 4B9KC 4OBSA 2K8MA 5A2BA 3TVMD 4FQ1L 5CCKL 1NC4B 4X98A 3IETB 1YRKA 3HC0B 4NLHA 4GQQA 3UYPA 2Y2YA 4WI6A 2J4WH 5ITFB 5B7FA 3V5HB 1NCDH 5IVNA 4LVNC 5TE6L 4B9FA 1YYLH 2BSEA 4RBPK 4ZS7L 5FGBC 2WIIA 5D7HA 3OKDA 5A6IA 1K8DB 2VXVL 4I3RL 3S3BB 2NR6C 3CIQA 4PJBF 1L3NA 5BJTA 4E41B 2R69L 4W81A 1QTSA 1DEDA 4POZC 1QHPA 2ED8A 1FORL 3ELQA 1S5IL 4Y4HB 3ZE1B 2PTUA 3EBAA 1V3LA 5KN5A 4LZKA 1MFMA 2I32A 3MLRL 4UV7H 2CGRL 3P0YH 3DBXB 4OF0A 5C6WH 2YA1A 4BXSV 5I1IH 4R4FL 3FUFA 4XO9A 3MUGA 3SPJA 3D18B 2KKQA 1RUQH 2HVBA 2AJYH 4EIBA 1JGDB 3BH8A 2ITCA 2IV9A 5IB4B 3TO2A 4BELD 2Y5TB 3CUPA 2XZCH 1QFWI 2NNCA 2O5ZH 4OFKA 4DQOL 4NHCH 3BC9A 1X5JA 4MMXB 4OZGA 5AB1A 1BLNB 4IRZL 15C8H 2ZCHL 2RD0A 4N2DA 4ZFOA 1U91A 4XBEL 3QQ3B 1S7WA 5DZLA 1MCWW 1AO7E 1PTZA 4X8JA 4LCCA 4PRPA 2WXRA 3FYEB 5H2BB 4EN3C 1ACYH 4V33A 4TVUA 3WO4B 2GK0B 4R4NC 3T8XA 3VXTA 1E6JH 2AEPH 3BLKA 3BPNC 3QZLA 4FI7A 4OFPA 3WBDA 5IEHA 3MKGA 1MRFH 4HFWB 4IS6A 4QKXB 4KX9A 1FHGA 1CT8A 4IKNA 2FX9L 4BGDA 2XVBA 4H1LH 2H26B 2HTKC 3GKWH 4PSRA 1NCWL 1NEZA 4NQCB 5IK3B 1LWHA 4D0DA 5L8KB 4ZW5A 4FQ2L 3S88L 3TEWA 4DP9X 3KPSA 3CLFH 5GZOA 5ERWA 2HXAA 1I8MB 2BVPB 4OM0L 1CGXA 1NDTA 5TFSH 1XGZA 1FV1A 4HUUB 2EH7L 2G9KA 3KGRA 3W37A 2VXSH 2BVTA 2J73A 2WCPA 4JN1L 4KJWC 4FCHA 2XHNA 3SE4A 4NP9A 2JKNA 2PXYD 3Q8FA 3UPAA 5A2KH 5DD0L 3RWJB 1R4XA 3S34L 2KHAA 1RKRA 3KYMB 3DOSB 3WNKA 4ZMZA 5IWLC 2FHBA 3EF7A 3VSQA 1DLHB 3G6AA 4HIXH 1TQBB 4F8QA 3KPRB 2RJMA 3MJ7A 4G8EB 5E5MA 4IK7A 3KR3H 1UD5A 3WL9B 3K4ZA 1AE6L 1E4JA 4ZPTB 1U93A 5HJ3B 3QUGA 4NQSB 3MV9A 1CDBA 2J72A 1QEWB 2DI9A 1TYJA 2HRPL 5D2LF 1CU4L 4OCSL 4GW1B 1M57B 1KDJA 4EI6B 4TVSa 4AJYV 1JHLH 3CCHA 2JELL 1Y1UA 4YC2C 4S1QL 3U4EB 3OKMA 3OXRA 4J39A 1QRND 2Y7QB 5I1GH 5D1XE 1VCBC 3L4CA 3DVFA 3LVTA 3BD5A 1IGIL 4KK9D 1JGVL 4NNXB 3PUCA 2CDGA 2ICEB 2WQSA 2R56L 4LMQE 4MD0B 5DJDA 3OLIA 1A2YA 1FI8C 2E7HA 2IXQA 1RZIB 2AV1B 3QQ4A 3TM6A 4EKXA 5LGHL 5CZXC 1HKFA 1ILSA 2YD5A 4JBSA 1U58B 3SKMA 3HFML 3LKPA 3QZNA 4AG4L 2VLLA 3ULUL 1EEYB 4DO6A 1V7MH 1X5XA 3A6CL 3F7YA 4UT6A 1E3ZA 1R24B 3MLYH 5TK2A 5JNYB 1T03H 5I15L 2VRAA 1LQBC 4LCIL 5H35A 5L88H 4ABQA 1KB5L 3LVEA 2UZPA 2GJ6E 5JLZA 3QIWD 1VAHA 3CIAA 3OHXA 1ZD6A 4PU2A 5EOQL 3X3GH 2ZAGA 1XBDA 1M7UA 5EEXA 4EI5C 2VMCA 2YC1B 5BZWA 4ODBD 3M1OA 2DQDH 2OMZA 2ZWZA 3FBKA 4JKPH 2D3VA 2V17H 3PGFH 1FCGA 2EIZB 3MNZB 1FA4A 1AG6A 1E4HA 3KNBB 1U8HA 3ZRSA 1MLCA 5CD3A 3HN8A 2IMNA 4DGIH 3Q6FB 1BEXA 4U49A 5A16B 5I1DA 2ZX7A 1C1EH 4Q2ZA 5ICZB 4R0LA 3MRBA 3GSOB 5DJAB 2YPVL 1OQXA 1PEWA 5GS0C 4NQQA 3FB6A 1JV5B 4KH2A 3WNJA 2E4FA 4KTDH 5FM5O 3H3KA 1P1ZB 4H1LG 2JJSA 4WJ5B 1FZOB 1HCZA 5DQ9B 4HF5H 2A99A 2HZHA 1IAII 2O93L 3KBPA 2VZUA 5E4IA 4LPWA 4QAWA 2ED9A 1FZKB 3JT2A 4MMXC 3S0PA 3D0LA 2UUDK 3T4AB 3HS0B 3HHMA 3ECBA 3I6LE 2IANE 4Z7VA 1B9KA 1OIOA 3NCBB 2E7LA 5HY9A 1YEGH 4P2YA 1T0MA 1T83A 3ESVF 2OJZH 2LTQC 3QJTB 4IEFA 1OCWH 3FT3B 2R0LL 1IMHC 3WO4C 2H9GB 5E6IB 3D6GA 2XETA 1OKEA 3KYKL 3S37L 3F84A 5K39A 1INDH 1O6TA 1UUNA 3ARGA 4KO6A 3AQZA 4P46D 4PJCE 4U7SA 3KPPA 1G7LA 3STZA 1FNLA 1G87A 1G9MC 4UMGA 2HVKB 2IALA 3QDJA 4X80H 3HC4L 4QWWD 2X6VA 4OLZH 3GNML 3RHWK 1AXSA 4EVNB 4EZKA 3SYQA 1OWRM 4CC4A 3C2SA 3HOGA 3JTTA 3AT0A 1H8LA 1EMTL 3FN9A 1SJXA 1X7TA 3DI2B 4MB4A 2N0KA 4IMLB 1XH3B 2O5XH 1L9OA 4XPBH 1M1XB 1D5ZB 2XZQH 1T04B 3O0LA 3TBSA 4N2GA 1E3FA 1SGKA 5LXVA 4AGNA 4DGYL 4P5KB 2J8UF 3RVVD 3D3VA 3ZT7A 2EYTB 4ATWA 1PPIA 1UYWH 3LN5B 2RHEA 4MJID 1J5OL 2ZAIA 3ZTJH 2FGWH 5J6HB 2GUOA 3VXRB 3W3BA 4TQ8A 4ZPVA 3ZDXF 1Q9KB 3WEOA 1JYNA 5E99H 3MA7A 3MV8A 3QWQB 2C1OB 4Z7NF 1KB9J 1A7RL 4R83A 4H13C 3ILQD 2L7QA 1BVOA 5KYYB 3HI5L 4ADJA 3PNWA 3QJOA 2OSXA 3O2DH 2Y4SA 2VCOA 4N8VG 4YSCA 3K4DA 4YXHL 4RGOH 5I8CB 1TFHA 1JGIA 1JCKA 4P5TD 3EYFB 2XN9A 4H0HB 4IM8A 4M48L 2FATH 1MAJA 3P9LA 2JFCA 5B3SB 2NX5D 1CBVH 3P11H 2JCCB 1P0SE 4PRID 1U3HD 3WN6A 1ZA6B 5JZ7D 2VQ4A 4FLRA 1HINL 3LB6D 4IRSA 2VWEE 4X6DA 1WICA 4LPCA 1SEBB 5SWSA 2IEPA 4PJFF 4HA1A 1ADQA 3HA0A 3P0VL 5CBAB 1V27A 4MA8H 2H4EA 3EDEA 1LNUA 5HD8D 4OIIL 2G9HA 2F15A 4HJ1A 4KKLD 5EOTB 3QA3B 2VM3A 4W68A 2YUVA 1H8NA 2Q2LA 4ODSL 3HE7B 1A8ZA 1O9ZA 1R3JB 2TSBA 3HRZB 5D7EA 3OKOA 4GXUN 4CILA 3P4MA 2HPTA 2OZ4L 3UJJL 4IBSA 3HFFA 2HLFC 4XN7A 4NJ9H 2Z7UA 3BAEL 5DK0A 4TTGA 3O0RL 2DDQL 4JX0A 3WUWA 5J3HC 4OD1L 2DL2A 2EEAA 2ORBH 1BFOB 3X1BA 4DN4L 5DFAA 5LWYL 2EEBA 4HLJA 3A47A 3CMGA 4AT6B 3T0DA 4JY4B 5ID1B 3KJ6L 4PAZA 3RBGA 2AITA 2K6YA 1HHJB 1HHHB 1BCIA 4NPYA 4CMHC 4ORGB 4DVRH 1DJXA 4PP2B 2VQ1B 3ILEA 3LZQA 2JKLA 1YCSA 2HRHA 3MOAL 3MV7B 5KJ7E 1MQKH 4QUOA 4X5XB 1J88A 4WEEA 4YDKL 3ZLQC 5BV7H 1UWEL 3CH8A 5IBLD 4U6VH 4UT9H 1MFDH 1VZGA 4ZMLA 1AJ7H 2J44A 4QT5B 4G6JL 4DJMA 3IDMA 3K2MC 2Z35B 3M7OA 2WKOF 3D30A 5AW3B 3TTSA 1R5IB 5TK4A 2A6JA 2QKIA 5JMRA 2OTUB 4LCVA 3WTSA 5MI0C 2CK0H 1PD0A 3TH2T 3DIDA 2APBA 1OAZH 4GRWB 3ECUA 3MFFA 4XOEA 1OM3H 2HT2C 2P80A 4YHLH 3WKNA 4Y8DC 5IB1B 2DTML 2KT6A 4UT6H 2DJMA 4G7YH 3X3FL 2X4QA 3MXWL 2J20A 4FXKA 2UXVA 4QHKI 1N70A 4D9QE 1IIIA 2PW1B 1ZSDB 4F7PB 5FECA 2PWEA 5EC1A 1QFWH 3CLEL 4A1RA 5ANMB 2QVFB 3EO0A 2F54A 3FT2A 4YBHA 1X9UA 4R9HA 2Q3XA 4BM7A 4NP4L 3VG9B 4EE2A 2B39A 3SQOH 2YXFA 3GMOB 4L8BB 4WDIB 3DOHA 4D9LL 2ROXA 3C2AL 4HZLA 5CWSA 3EH4B 4LMQI 1JGEA 2CDFA 2WTOA 3C6LA 3DECA 3GM0A 1CDJA 4LGSB 4XMLH 3ZTJG 2EACA 3KPTA 4QYAA 4KRNA 5FUOH 1N6VA 1ND0A 4K94L 4KAQL 5C0CD 1QUNB 3OWEA 5A7EA 2WLIA 2V5YA 4P5RA 4JFHE 2G2PA 4I4WA 5FIEA 4LT7A 4L8CA 1CF8L 4B0MB 3BW9B 4HSCX 5DR5H 2BP5M 4X5WB 3QXDA 4O02L 4XX5A 3A6OA 1MVFA 2OK0L 2Y1VA 4HH8A 4A7UA 1N4XH 3KHOA 4P9ML 4FFZH 2G2RA 3WS6C 1XV8A 4FQHB 1MCRA 4XCEA 2B59B 4FNLH 3REWA 2FIKB 2PWGA 4PJDA 2XRAL 3CFBA 1CO1A 1P6WA 3LQZB 4RGMC 2QQKL 1QBLL 1EXGA 3LNHA 5DZPA 4D0CA 3QZOA 2BX5A 5DJZA 2IBZX 3GMRA 1AZVA 4A6YL 2YRPA 2CHDA 4XP6L 5GPRA 4GXUM 5D6DC 4MD4B 4HU2A 4EIZC 1JMZA 4OI7A 4L3CB 4R8WH 3WDHA 4BA0A 3TZVB 3BWUC 4DKFL 1MJUH 2GSIB 4OZIF 3V6OE 3QNXA 4HAKA 4DKEH 3WHXA 2IV8A 3CZFA 3UEQA 4IIZA 1WCBB 3U1PA 5IFAL 4Y5YA 1Z32X 1IQDB 3VNZA 5HTSA 2FH8A 3GRWH 1JD7A 4ZFZB 2YK1H 2PUQT 4UM9A 3SO5A 5KZCD 4M8QA 4HX1B 2X3AA 3LNEA 3BP6A 3HI1A 1KIRB 4C83B 3B9KD 1FNHA 4PWGA 5DS8B 5FDWB 5KW9L 2E9WA 1H8SA 3EYOA 4FQQB 3Q3GA 3FCTB 3LKQB 3WDJA 1ZK9A 1ZTXE 5A6MA 4U4BA 1YC7A 1T4WA 1KY7A 5JXEC 2FO1A 4G8GA 4PJ5D 2F0CA 4YHYB 3L5XL 1WG3A 1A6ZB 3DX7B 1IBBA 5E8NB 1I1YB 5C70A 1IAKB 4QRPE 4UOW1 5DRZB 1WFJA 1BREA 1Q0XL 4KTEL 4JG1H 5KSAA 3APFA 3F5WA 3FTUA 2DB8A 2DWDB 4PCYA 3QC5X 4P23B 3FT4A 3TBVB 2DQEH 2XKNB 4LIQL 1B9ZA 4P8QA 3SO3B 1QWNA 5DC9B 2NY0D 4Q7DA 4XZUB 5DJ0B 4NN5B 3KXFD 3RNKB 3FJTA 1DBKL 4HCGA 5ALCL 1E4XI 4KNUA 4BFNA 1TTAA 1AHWA 3QDME 4NYLB 4U1JA 4XXDA 3V7AE 4NWUL 4XAKE 3WEXA 2E75C 2AQ3A 4MRBA 4X9YA 4F7CB 4FHJA 4LPXA 5CEZL 5IQOA 3G9AB 4QRSA 1FC2D 1T80A 1YNTB 2ZXWB 1P84J 3VFGH 5D7JB 4IJTA 1QWHA 1VFBB 2FX8L 1J1OH 4O4YL 2V5MA 5B3NA 4Z77A 2ZUXA 5DD6B 4HOXA 1AGEB 1A3ZA 3RNQA 4Y19D 4K55A 5C09B 4M4PA 1I1AB 3QORD 4N0UB 3TX4A 1ZDQA 5J11C 2MCPL 1ADQH 3PWJB 1DQKA 3PJSB 1W91A 2XWBA 3K91A 3CZSA 1SF5A 4FYSA 4L9LC 4L1SA 2R9HC 3ZPDA 2BVQB 4LBEB 3OGOE 1UGKA 1J48A 5JQIB 3ZVVA 2EC8A 1K8IA 3BVNB 2XBTA 4LEEA 4EI0A 4MXVE 2Q9OA 3RUGA 4PRBA 2V33A 1OV8A 3MR9B 3RWFA 3AITA 2GJ6A 2BDNL 3T09A 1HIMH 2ZCLL 3BT2H 4L4VA 5JW5B 5T1KB 1LWJA 4XMKL 3IVKB 4FJYA 5DXWA 3BUYB 2A9AA 1JZ4A 1LO0L 4WNSA 4WUKL 1ZLWH 2TRYA 3H8NA 2F53E 3L3OA 4L37A 4MA7H 3BUDA 4PB9H 4AQAB 2RALA 1U8JB 3SOTA 2YARA 4YUEL 4JQXC 2OTWA 1MFAL 4XNZB 1XL4A 4PRHD 3X17A 2E4TA 4NIYE 4XO8A 5F3BA 2OW7A 4PVNA 3L4WA 3V5DA 5I0DA 2VMEA 3BKJL 4FXLA 5J12C 1XHHA 1T7ZA 2X4NB 2X4UB 2IIJA 3LDBB 1HI6A 4PJ9B 2DL9A 1UEYA 3C5ZA 5CCGE 3ZU8A 4JM2B 4R4BB 1RY7B 2M26A 4ONGH 1BG1A 4X2UA 5FM5M 1ETZB 2YEVB 3FFCD 4AQOA 3I2CL 5DVLA 1JIBA 3O41A 2Z7YA 4WUUB 4YSPA 1EX0A 3TNMA 1YLBB 3TGXA 2D2OA 4AGMA 1OTUD 4OCYH 1GZHC 1FH2A 1JS4A 3EFOA 4Q0XL 5EUOE 4ODUA 2ADFL 1BAFH 4JRXB 3TFKD 3LH2H 4FL4C 2RAMA 3UROR 1NMBH 2BIMA 2YD7A 4P9HC 5D9SB 1UFGA 1TJMA 3HZYA 1Q90A 2K0RA 4DGVL 3TL5A 3NFPA 4JRFA 4JFYA 1S9KC 2ZCKH 5F1IB 3H2QA 4K7PY 2CO3A 5I8OH 1KGJA 5J8OA 2FE0A 3QHZL 3EG9A 2D3LA 4GG8A 5C07E 4MZRA 4WI8A 4C56E 2EDJA 3EDFA 1MCPH 4A2GA 1OHZA 2YAQA 5AW5B 5TQ0L 1YN7A 2WTRA 4KO5A 1I4FB 3D09A 3RTLA 2PWFA 3THML 2CKBB 3BX7C 2MCAA 4P2OD 4YH6A 2OMYA 2YMTA 1SXAA 1FDLL 3LEVH 3QNFA 1BJ1H 1FIGL 1OSZB 2WLJA 1FPTL 1OGAE 3BP4B 4X6CE 3RVXD 1OARL 4Z7UE 3QUYB 4PBVC 2Y24A 4Y16A 4XMWA 3AXLA 1L9RA 1GAFL 4UQCA 4XNAA 5IY5B 4JNXA 1G7MA 3WTVA 1ACCA 1I9EA 3V55A 1QPPA 3GZQA 3BEVA 3US0A 2Y25A 3V0WH 3DGGB 3L7EA 4LNVA 1VFAA 1A1NB 1XF5A 1BYOA 2NY4D 4NC1C 2CAKA 2YPLE 2NNAA 5IQNA 5JOPE 4OCWL 1DP0A 3F12B 1WWBX 4ZS6C 2P45B 5BUPA 1I7UA 5D4HA 2WLZA 1HYSC 2HB0A 3LEXB 3A6BL 4PJ7A 3PP4H 1U4EA 1ACZA 1HK6A 4E9YA 5D7JC 2PF6A 4L8SA 1KULA 2BVOA 2DKSA 1W15A 4JFUA 5HGBB 3SSGA 1KFGA 3V4UL 4O5LL 2ADYA 1AS6A 5T8IA 2ESVD 2WO4A 2G0LA 2CLRA 5FA4B 1DQJB 3TA3B 1BQKA 1UB6A 2NZIA 1DVFD 3BVDB 4H88H 3DPBA 3R19A 3NQKA 4WFGE 2XG4B 1CFSA 2XYBA 3KW7A 4QY8A 4HAGA 1J9QA 2GHZA 1KJVB 3S5LB 2J71A 2VN5A 5EULV 1KTCA 1PLCA 5DHDA 1Z9SB 1LHZA 5EPMB 2RCSH 2WIMA 5SV3A 3BQUD 3CZEA 3QWOB 4MDIA 1CE1L 3FULA 5ENWA 1CD9B 1OCZB 4G5ZL 4BUGA 1CICC 3V79C 1UJ3B 2QQLL 1N5AB 4JPQA 3D07A 1VLXA 3FB7B 2HX8A 4LVEA 4B97A 1RURL 3VWKA 5AZ2H 1FL3B 2H8PA 4FNSA 4ZTEA 4TNVK 1QTYT 3EDKA 1HEJC 4I0PA 3S48A 2BS71 4L0ZA 1SYVA 1WA2X 2QSCH 2MFNA 5I0YA 1KBGH 5GGVY 2IWGA 3IRPX 5KBLA 2CXKA 2X70A 3DUUA 2ATKB 5CINH 4XNZC 4DGWC 3HZMB 5EEWA 4GKSB 4WO4C 2ZSWA 4PV9B 2NW3A 2A9ML 2GY5A 4MMZC 1P4LA 2FBJH 3BKML 3JWNC 3P02A 4EOWH 5J06A 1DN0B 5IT2H 3NSXA 3QRGH 4G8FB 3HG1B 3P9MB 5TDPA 1W0VA 4ZMPA 5L2KA 1UD2A 4NN6C 1QNZH 4PGEA 1YMHB 3P54A 4HUKB 4ZQKB 3CBJB 2HFGL 4LSSH 4PUBL 1MCHA 4PJ9C 4HLZH 1FE8L 2UZYB 1INQB 2CBPA 3QCVH 1JERA 2VL4A 1BX2B 4N2AA 4P46A 3L16A 5SV4A 1ODAA 5IR1B 1UH2A 1PD1A 4PJ8B 4N8PA 1RJZA 3AREC 1KBBA 3MA9L 3X11B 2GTZB 1LE9A 5D2NE 1XXDC 3L45A 5BMFH 3TBTA 4K3JL 1A1OB 2X10A 2Y1ZA 4YXKL 1WRFA 2EE6A 3PP3K 5T1JA 3EXLA 3DIFB 3SKOB 1WAAE 3ZDYF 4PRNB 4QTHB 3L81A 5DQJA 4NAQA 2WY3B 3MCLH 3RZCC 3TBYB 2IVFC 4AI7A 4AVHA 2XY2A 2J25A 2YXMA 3WDIA 2OMUA 4NC1E 3TN0C 2Y7NA 2PYEE 2GI0A 4IW4C 2VLJE 3SDDA 3MLPA 4OB5L 4NQEB 1EFXB 2DMHA 4JAMB 4UM8B 5FWQA 3TV8A 1XDTT 3OC8A 2EDHA 2OCJA 4L48A 1NC2B 2G75B 3MACL 3OPZH 5DD3L 3O8XB 1FZJA 4HAFA 5I0XA 3VD4A 1U3YA 1TEGA 2EE9A 5KEZA 1QATA 4I18B 3GI8H 2ZOUA 4PJBA 2QTEA 3VU1A 3UAJA 5BS0B 2NY1B 1D7DA 3QFDA 2QJDA 3R4DA 1MFBL 1FH5H 1OP4A 3JTSB 4TQEH 3QUYC 5CO1A 5E6RB 3U0PB 2P4AB 4LGPB 2CHWA 2EADA 3SE6A 1TQCC 1E43A 1KJMA 5I74C 3MREA 1NIEA 2WLLA 3VCLA 1T2QH 4APQD 4DN3H 1R9FA 2AV7B 3UTTE 2D7PA 5IVZA 5FO8A 1N9PA 4OR1A 1TVHB 3AS3A 3V6OA 4AQ1C 5I1AA 1EJOL 1YYLL 5MEND 1J8HB 4A2DA 2BWIA 1IAOB 2X9XA 5G2NA 4R2GC 3VFVB 3DV4A 4W70A 3VUAA 2EH8H 5KOMC 3LPFA 3GSQA 2UZXB 1CG9B 2WO3B 3W0WB 3N3EA 4EDXB 5A43C 2YFNA 1AP2B 1HCVA 12E8H 3BDXA 2WUBH 3ZSTA 3SHSA 5DK3A 3SDXE 3DYPA 1H3TA 4PJXB 2F68X 5BXFA 4UV7L 3FTYA 4BKLA 1NAMA 2B7DT 2OTPA 3HIZA 2BOBA 3O6MH 1UCBH 5FV1L 5M94B 5D8JH 5TD4A 1PL3A 3PHAA 1EAPA 5HHNA 5FOJA 1RUQL 2AJYL 1EWHA 4M29A 3MRDA 3E8UH 3RWDB 3BGFB 4ELMF 4L5FH 1MIEH 5ACZB 4F91B 4R90L 1A6AA 2BC4A 2I7OA 4WI7A 7TAAA 1VEPA 4KVNL 2X3BA 1H3WM 2FJHB 3AGWA 3OVUB 4FGMA 4HKBB 4BGLA 15C8L 1HDMB 1PLBA 2OJ1A 5BVJB 1O5DT 4A55A 3GIZL 4G1MB 2OI9C 4ZFQA 5EBWB 3U48A 4K3DH 1HE8A 4QI3A 3ZZLA 4GW4A 4M1CD 5IW3A 3HE6B 4QOKD 4P2QB 5EWIH 2MOVA 4HLZG 4KQ4H 4NO5B 4RMWA 1G7PA 5I18H 2DKUA 5TQ2H 4QHLB 1F13A 2J6EL 2AEPL 3FUJA 4LESA 5SWQB 5ABAA 3GMPA 2ICWB 2HFEB 1MRFL 4K15A 4D3CH 2A74A 5D96B 4NO3B 3JWDC 3FQ4A 3DJZA 5D7LE 3CVIH 4ZUSB 3VWJA 3KMDA 1WZKA 5BZDA 4OF5A 2Z65C 3ZHNA 1OTSD 1TLMA 3RX7A 1L0YA 4NJAH 4DZ8A 4XMXA 1CE6A 1Z5LA 4UIKH 2EXWD 4NKOB 3X13B 3ZKND 5FUZH 2IPKA 2R2BA 4HUVA 1N64L 5F8RC 5ESQB 5TFSL 4I1PA 4LOUC 4K8RH 1MWAH 5GS0H 4M7JH 3IKCB 3SYPA 2WYHA 2VXSL 4OKDA 1A14H 4HEME 3IS1X 2HX9A 1QHOA 2FWOA 2AJZB 3OMNB 2Q20A 3BIBX 3RL2B 3MRGA 4IOIA 1K4DA 1AY1H 4M7ZB 1DBBL 3DVIA 3BISA 3O3UN 2BP8B 3L3IA 3C60A 4H8HA 4IU2B 3QJQB 2AJUH 1A4JA 5T3XD 1DBJH 1N8ZA 1PDKA 3VD1A 1LO4H 4HIXL 3QJUB 2BRQA 1AR1D 4NQVA 5AD0A 4GO8A 3HS0A 4YDJB 2H3NB 1J0KA 2F53A 4HHAB 1UQSA 4YL4A 1WAPA 4I85A 4GKOA 1F90L 4M6NH 2YEZA 3WLWC 3P4NA 3VXMB 1LO3L 3ZKMD 3OB0K 4HH9A 3O3EA 4V1DB 1MVYA 1BJ8A 3V4PA 2P5WD 4PY7A 4DKAA 3D25B 3SGDI 4LLUA 3BESR 4RZCB 1G9MH 2Y9RT 5ISZB 2CO6A 2HJFB 3PV6A 5IVXE 5AB9A 1NGXA 1XCQB 4W9FC 3CQQA 3GT6A 3K3QA 4XNMA 2GAZA 4P99A 3X2QB 1BOGB 1YQ2A 3C8KB 5J1TC 5C0BB 1QW8A 5I1LA 3II1A 3VFSA 2QSQA 1RZKH 4E9QA 2NY1C 5SWZD 3ATDA 4FP8L 5BRZE 1B4RA 4XP4H 3RJOA 1U36A 4GT7A 4YDIH 4NWTH 1KT2A 5IMMB 4K5LA 1ZVSA 4OGZA 4B41A 3CVDA 2CXGA 2YGQA 4P2CG 1XB8A 5SX5H 4YR6B 3B7SA 5EUOA 2EDOA 1I7TA 3HNVL 2AXFA 3N1MC 3MLYL 2R0KH 3NIGE 5EN3A 1T03L 4B96A 2Z4TA 3KYNA 3SBRA 2WWMD 1WBZB 5L88L 1CGYA 1XCTA 3QDGE 1GMEA 5CLZA 2ZOOA 3Q2CA 3IAPA 3L6FB 3WE6B 3MRPA 5T33H 2VN7A 2A9CA 2BSDA 3LIZH 4M62H 3X3GL 1NFKA 4XP5L 1CXEA 1JHKL 2O5YH 3DX4A 1D6VH 4NKMA 2QGBA 5JTWA 4U6HB 4C56A 1NH6A 1HL8A 5FGCE 2DQDL 4JKPL 2VE6B 5F6HJ 2V17L 3PGFL 2HH0L 4FF9A 4NENA 3DNKA 1U8MA 1JN6B 4Q9QL 1I3RA 2WSKA 5A6LA 1E8WA 4ZOBA 2QPEB 4GG6B 1KUMA 4J4PD 1FO0H 4L2YA 2Y72A 2PCPA 4F2MB 4I0KA 1WK0A 2BOLA 1C1EL 2R4SL 4JN2A 1OGAA 3U36B 4UANA 3LSOA 1L5GB 3TO4D 4X6CA 2VM4A 3KVDD 4JW3A 4OF6A 3BLPX 1AXIB 3HLAB 4OJFH 5CM1A 3BGFC 4KTDL 4XN4A 1KWGA 1F0LA 5I82A 4JFDD 1A4KB 4XRCA 4HF5L 4U1MA 3UZEC 1GS7A 1SLWA 5L4MA 4NSKB 1PCSA 2X6AA 1NAKL 4PJ6A 4OIFA 5FFGA 3ZE1F 5L4IA 4G6KH 1YEGL 5F3HA 3S37X 3IJ9A 2OJZL 1MJJA 2VL5B 4U1LA 5KSUA 4JUTA 1VSCA 4F27A 5C92A 1VKXB 2DQCL 4HXAL 5C0GA 5J13B 5C08D 3UTQA 2XQYG 1PFOA 1INDL 3IEAA 1K6QH 4ZW6A 1GC1C 3PHQA 3FONA 4O51A 3UG4A 1S7TA 1GYVA 3MBXH 2Y3NA 4MGXA 5EC2B 2AAVA 1XR8B 2ITDB 3DHUA 3H7LA 3Q48A 4FQIL 2PO6B 1NMAL 3KW8A 4X80L 1ZTXH 4LLQB 2APWA 2DRUA 5HHOE 3CFJB 1F1AA 2QQQA 4A63A 1FGNH 3KGUA 3IDJA 3PAVA 4N6QA 2Q8AH 4BH7B 2YA0A 3B2VH 2R7EB 2Z8VC 2EE2A 1BF5A 2XPGA 1E5YA 4JB9H 2XTSA 3CXFA 4P4KB 5DYOB 2A3TA 4FLHA 3QIBD 2O5XL 4XPGH 1WZ1H 3K8KA 3AS1A 4FKEA 2YAMA 2N7BA 3NIFE 4HJUA 1HXYA 3RTQD 3CHOA 4ZFOL 2WWKT 4GLRI 3DXAB 4X0KB 1UYWL 2GIYA 4LSVH 3LPPA 2XY1A 4P57B 1ZVYA 4XBGB 3IMTA 5I1EL 3EJRA 1NCNA 2C3VA 1R6VA 5E99L 3I9IA 4GSUA 1BQUA 1PLGH 4OFQA 3RY6A 4F93B 3SGKA 1XGTA 1TITA 1YECH 1EQWA 1MJ8L 1AQDA 2GBUA 4J3XA 2OL3B 3EYVB 1OAUH 5I71B 3W9DA 2XA8L 1T0PB 4LLDB 4RFNB 1QYGL 1JV2B 3B6SA 3IDIB 5AVSB 2QSTA 4BRVA 2FATL 1UH4A 1T1ZA 1WCQA 1A6TB 5F2FA 1MVUB 3P11L 2ODHA 3GHEH 1DL7H 2C7UA 3ROOA 3NVQA 1RZ8A 4PS7A 4WWKB 2PP8A 2PTTA 3BO8B 5IJKC 1XGUB 2NR6D 5ECGA 3ZYJA 1MH5B 2NY2C 4H0GA 5DQDH 5CF3A 5B1BB 3NFSH 4WAFA 4HWBH 5F0PB 5JHDB 3VRLF 1JZ8A 4POZD 1BVKB 2NDGA 4OCRH 5CXPA 1FRGH 2HWZH 3LMJH 4LKXA 5L7XH 4M02A 4QHUA 1W6WA 4PJAB 3BMWA 2JH2A 5DK2A 3TTYA 2JXMB 2ORBL 1WAAA 1CFTA 2WKOA 2B20A 1KWKA 1H9VA 3T0EA 3VFMB 1T1XB 2QVKA 4P2OA 3VFPA 4X6FA 4G83A 3RG1C 2DYPA 4PRPB 3ZHFA 2DLGA 1A7OL 2Z91B 5FK9B 5LO7A 2VLJA 5C0AE 3O9WB 1NPNA 3ARBB 3BN9C 1KCLA 2ARWA 4JFFB 5BV7L 3PQYD 2VDOB 4U6VL 3WHE0 2VLRD 3ARVA 3CC1A 4AWJC 1MFDL 4YFDB 5C0JA 2BFGA 5LGKA 4QMEA 2OR9H 4P2RD 2GJZA 3W56A 3T1WA 1RSYA 4NX0A 5IFJB 3WXVH 4PG9A 4R4ND 3SBPA 4AH2A 1SDDB 4AEIL 3KPOB 1G6RA 3K6NA 5EORL 2BWDA 4XO5A 1OAZL 1SJEB 4K5OA 4ZOAA 1SOXA 2HG5A 3L3KA 1N0LA 3PCYA 4D8OA 1RMFH 2OV0A 1OM3L 5KSBE 2X4RB 4YHLL 4DPBX 5M95B 3TWCH 1DE4A 3V0JA 1YEDA 3W9EB 4UT6L 1UWXH 1TETL 4P59H 4ZSOB 3LIUA 4B0MM 5H4ZA 1W0WA 4UIMA 3UTTA 5DD1H 3O4LE 3DSFL 4XB3A 5AG8A 1A9EA 2Z93B 1QFWL 1S9VB 3HG5A 3DV6B 3H55A 5JIKA 3BMVA 4JANB 1PY9A 4ZBJA 2HMIC 4HV8A 2DQHL 1ZIBA 3MXVH 5DJ6B 5GIRB 3ZR5A 1GYWA 2JVUA 3KLAB 2WP3T 1P7HL 3QZWA 3SDAB 4KJWD 2IAND 4UAOC 4XMLL 4ZAKB 3PABB 3LXAA 3QH3A 3H1ZA 2CE6A 1G7JB 3Q6GH 5BCAA 3P69A 4YXLH 1MCBA 5FUOL 5GXBB 2JF1A 1FVCB 4J3SA 3V7AG 2PO6C 1VFMA 5DRWA 4N8UA 3QRBA 3CFIC 4P4RA 4BUHA 3FOLA 1KJ2A 1RCYA 2ISDA 2P5PA 1D9KC 2QFRA 5D7SL 4J3TA 4OZIA 4MASA 3IJYB 4P4KC 1N4XL 2C9VA 1MPAL 4A2HA 1NFIA 1BQHA 3HKZA 4JVPA 1REIA 4OCNC 4DPRA 4FNLL 1KXTA 1NJ9A 1Y0LB 5HYQB 3UACA 3NA9L 5IHZB 1J9TA 1WIOA 2ILLA 1YPZF 5EU6E 2YIHA 2ATPA 3PG2A 3L3JB 4YSEA 2AS5M 3L5JA 3T65A 3UABA 5A2FA 2IF7A 1F11A 4XVUC 2BNRD 3SPVB 5E8PA 4JDTL 3B2PA 2KERA 3VXQB 1MJUL 3QSKB 4QRRE 4WSJA 4JFZH 4E9LA 2DM4A 2FAUA 4HKJA 3OKEA 4DKEL 4Y4KA 1GZQA 1NDGA 5CZXD 3BH9B 3IDNA 1O6SA 3SIKA 4CVXA 5D7LA 5I71C 3L3GB 1OO2A 1HHKA 4IJ3B 4H8WC 1FP5A 4N85A 1KEMH 3D50A 1U4FA 1JP5A 4YDLB 5C6PB 3FB8B 4GRLC 3K0WA 1YQVH 4L2LA 4YIQA 4RMSA 1IBHA 4KMTH 5AVUB 4OCXH 1PZSA 3K6FA 3CPUA 3E6HA 2WN3A 3BFOA 1W72B 4UTBH 3B9EA 2WOYA 1XF2B 3L5WA 5F89A 2ADJB 1LTXA 1U8LB 3J2PA 1WLHA 4EI5D 5GRJL 2NZ9C 3EJYC 5EZLB 1QSZA 4KHXH 3DETC 1OZUA 1KGWA 1CZ8L 1T6WA 1PF3A 3CN0A 1G5AA 1LO5B 2FB4H 3CXHK 4FI8A 3M46A 3I74A 2R23A 3QQDB 3U46B 3ZJAA 5L2JB 1JPSH 3MDJA 1P4IH 5K5YA 3PL6C 4GPVA 1OB0A 1QHQA 1WBYB 3AUWB 4DP0X 1RLWA 2WYZA 1AD9A 2DWXA 3S36L 3QFJE 4NIKB 2XBDA 3WLBA 4AV5A 1XVSA 5GS0D 5IUSA 2X41A 2G5BB 4A7VA 4WHDA 3TCLA 4Z8FH 4LB8A 1ASOA 5CJBA 4YZFF 2QZQA 2D8KA 4WEBL 1XB3A 2YS4A 4XVTL 1ECZA 1JNHA 3CHRA 1J1OL 4Z7WE 5AW1B 3WY3A 5ETUA 3QZPA 2L3BA 3T3ME 3V2AR 25C8H 2PPCA 2V3FA 3QNYA 2RQ8A 1MCNA 2EECA 4LK4A 3FQRA 2YRBA 3W5NA 1J05A 4JFEE 3ZY7A 2VW4A 2CJSA 4DF9A 4WNQA 2W95A 1ADQL 4I3GA 1WZMA 4APQA 1AGCB 4KXDA 1QKZL 1PZBA 4NRZA 5B39A 3BIAX 3LKOB 2YBRB 5C6TH 3FH5A 5L0QC 1RU9H 3VQ2C 4N25A 1YO4A 3UZQB 4JHZA 3ZIMA 4TQHA 4DUWA 1GVIA 1FFOB 1A9BA 1HE7A 1NEPA 4NNYB 5J6GA 1K4CA 3L3HB 3NCEB 2B15A 5EBMB 3VD5A 5CIPH 3T3PB 4TPRH 3U9WA 4NQCD 1CFQA 1IAIL 2ZX6A 1SXNA 5EU6B 1Z7JA 3D39D 2XTJE 1AGFB 1HIML 1SZNA 1X9LA 1AGBB 2P47B 4WW1A 5GZNA 4K2UL 2NY3B 3MLXH 4Y7MA 2MMXA 5AVZB 1GJWA 5EFIA 4MS8C 2JLLA 1FQ9C 4H5SB 5GGVL 2XVGA 3SDAC 4MA7L 4PB9L 4ZAKC 3VYPA 3VJ6A 3HW7A 2APFA 5GGRA 3NJNA 4F57L 5J89A 5LXGL 1Q9OA 1KB5B 2WGXA 1EUUA 4GQRA 4MKMA 1D5MA 2E0PA 3EOBA 1I8KB 3ILPA 4DETA 4F5CE 4ZX6A 5AB2A 1JZ3A 4PSPA 3QIUB 5GRUH 4W9LC 1ORSA 1RPQA 3JQOB 1EO7A 1A21A 4HCRA 2Q8BL 4LCYA 3FO1A 3HUJB 2F5BH 4H7VA 3ZT5A 4DTGH 3ETBF 3F62A 1KYAA 5B22A 4LHUG 1NM4A 5DHYA 4DW2H 1QEXA 5C2BH 4AV4A 5DHMC 3QW9A 4W9DC 4HULB 3FRUA 4ONGL 4IBWA 1P5UB 1BMGA 3BI9X 1DVUA 3MRLA 2ICWJ 2NYKA 3VD9A 3AT8A 3MJ8A 4AE1A 5I5MA 1ZOXA 2B4CL 2XQBL 2YGPA 4LO9A 2K6WA 2OXGA 4NUJB 3QR2A 4IBLT 1YEEH 3SB3A 3BSGA 1EDQA 5DMIH 3IK2A 5DEFA 4JGMA 3LH2L 2HJKA 2BZCA 2DLTA 4OFVA 1GS8A 1NMBL 3C5XA 3P4MB 3G3LA 3CK0L 2WYTA 4GLRH 4BFFA 3MZTA 1T21A 1ZV5A 5DCCA 2KMWA 1GIGH 3KPQA 1RSFA 2NCEA 2EE0A 4LGRB 3RDTC 4KOBA 3WUWB 1XF1A 5IQ7H 5EEVA 2Y0SA 1FL6B 4XR8C 4KKRA 5JOFA 2IGFH 2AK4A 4PJEE 2CO7B 5IKCA 2HLFD 2IADA 3A0OA 4X6EA 2B08A 2OQJB 4UQ3A 4MSWA 4AM0A 4C59B 2K1MA 1IO4C 5JXAH 4QPEA 4Z3GA 3BZFA 3U6RA 1DQTA 5DZOA 4DIXA 1EXUA 3K6IA 1X6NA 2ED7A 3GSNB 4K9JA 3EO1A 3MGTB 4U3XA 3L9RB 2FYVA 4IRJA 3RFRA 3TBWB 5ECJE 3UDWC 4E42B 2CHNA 2XWJB 4B9CA 1OSEA 4WI3A 2HCZX 2PNDA 5JPNA 1BM7A 1RUPL 3FU8A 2NQCA 2OYMA 2A83B 4ZMOA 2PW2A 4ICWA 5F21B 1C5BH 3NFNA 4FQXB 5IVOA 1WS7A 2BSSB 3S4SB 3FZUC 4JDEB 1JHTB 2Y7MA 4WK0B 4XPTH 3VMPA 3MRRA 3OR7B 3Q44A 5IB3A 2VITA 3KPLB 3WTWA 5CEYB 3QNZB 1I1RA 5IOPA 4WQOA 4F37F 4E68A 3JTBA 4TNGA 1HQRB 1S9YB 3RU8L 2WBJD 2Q3ZA 3CZNA 3HZ3A 2CJ3A 3O6LH 2HT2D 4KRLB 4ZYKA 2IDTA 4NZUL 4YHKH 2VDLL 3TONA 2NTFA 5C0IA 2R1YB 2Z7WA 2V2TB 1QP1A 1GGIH 3QJFA 2P5EB 3GKZA 4WV1B 5DEGB 4ZMNA 4HUWB 1SHMA 1MELA 2OMWB 4M5YH 4H88L 4JQIA 1ZMYA 2V2XA 1KCRH 2HKFH 3GZKA 4XCFH 1M3IA 4BK5C 2VTFA 1JRHL 4TQPA 3B3IB 4JPVL 3TT1H 3VFNA 4BFKA 2J3SA 1WIPA 2F7OA 1OTTC 4ETYA 3QO0B 2OAAA 3UPRA 2B9BA 1E9QA 1FVDB 1YHPA 4GSQA 4LLMB 3WOVA 4MAYC 2VH5L 2WHVA 4I0CC 4ZUVB 1YNTF 3OKKA 3VE0B 1P5VA 1CWVA 3E3QE 1X5MA 1Z66A 5HYSA 3VI3E 2XJKA 3C08L 2CIIB 4W6YB 1PIGA 3E2HB 5FKAA 1W2KT 2NY3C 2XI9A 4KXBA 3VI4E 3ULUC 1W80A 2UWEB 5AW0B 3HAEA 4EUPH 4LSUH 3D4CA 4JPIA 5I8EA 2NQ3A 4Q6YA 2JQAA 3MNVA 3KBFA 1EZSA 1RZGB 2HT3C 4OAWB 4TL4A 4XCYA 5INCA 3H3BC 5KYWA 5D7IE 4ABVA 1JJUA 5C1MB 1WJ3A 2QZ5A 1L0QA 4JFDA 1AHKA 3MX0A 5HI4C 4NQUA 4PJIB 3QZWG 1ZWIA 3CFDB 3ARWA 4MNGB 3GD1C 3QUZA 2KBGA 4H2CA 5ICYA 1QNZL 1IGJB 1KCSH 2ZYSA 1NDMA 1QSVA 1QRKA 3NG5A 3SJVB 1KTJA 1B0RA 4HCFA 5EO9B 3UYOD 2LLGA 1SQ2N 2X4OB 1XGRB 2DBJA 1MW2A 1BV8A 5T5FA 3IDGB 4XXCC 3OG6B 3RFZA 3VQ1C 1JWMB 3BPOB 5HDBE 3WGVB 5BW7A 2FR4B 2ZT9C 1BQHG 1JZ7A 2JWYA 3EGXA 3LS4L 4U1KA 5IW1A 3PWVB 1EO8H 4J3BA 3P4OB 5GRWA 1K3ZA 2HFFB 1NIDA 2OMTA 5GSRA 4LKCA 5HGDA 5JXED 3RA7H 1E2VA 3GSRB 4LP8A 3MCLL 4JVWA 4HW6A 1QSED 1RZJL 4HCIA 3WFBH 3ASOB 3MGAA 3CDFA 2CPUA 2ADGA 2P42B 4YGVA 5DURB 4DZBB 2H45A 1Z3GH 2GUYA 1FCCA 3LNFA 2H6OA 1KLGA 4JL2A 4Q56A 5JDSB 1MG2C 2WXPA 1CXKA 3D9AH 1YNLH 5DFWH 3IMBA 3LNIA 4XPHH 3OPZL 4KY1L 1Q0YH 3DGDA 4HCRH 4TLKA 3SOBL 2DIJA 1NIAA 4LP4A 1AZNA 3IDYC 3GJEB 5C07D 5FKPA 3ZHDA 3BIKB 2WKLA 3FB5B 3GI8L 2CZNA 2ZYIA 2IAMC 1NWPA 1AFVH 4OH2A 3TVMB 1NFDE 4QGTA 2ARJQ 2HTLC 5I5RA 4BKTC 4ZT1A 3K46A 1GYAA 4Z78A 3B3BA 3TC9A 3MRJB 5FGRA 4DN3L 1YY8A 2W9EH 2B77A 2GITA 3IS0X 4H44C 1QR1B 3QT2A 1USZA 4DEPC 2FZ3A 4KK8C 5AAWC 1P7KA 5E1QA 3T6QC 1OF2A 3ARQA 2R9HD 3OGCB 3PAYA 3SCMA 1T0NA 3VRIB 3GLZA 1UACH 3CDGA 3FUMA 3LN4B 4P07A 2NR6A 12E8L 5D5MB 1WBXA 2F5AH 5D1ZB 1QZ1A 6CGTA 5AVVB 1E4XL 2Q86B 2V3DA 1KG0B 3WJMB 5DI8B 1BIHA 4P04A 3QK0A 1NWOA 2CM5A 3O6ML 4Q89A 4YWGH 2IGTA 1THAA 2WB1A 5LCVH 1IB5A 4EUPG 4X9BA 2ZKHH 3GEFA 1XGQB 1ZHBA 2CNZA 2FJFA 2VLKD 3P9WB 4KDTA 3E8UL 1CI3M 1ZLWK 4A2FA 2I07B 5FYLE 1XAKA 3FRPG 2YHGA 2V7HA 2H32B 4U1GC 5EZOH 3GSVA 1GPOH 1JAEA 2VDQH 3C75A 4ODTH 5C3IA 2VDPH 3EHBC 3FK3A 4LLWB 5DMKB 2MQCA 2XCMC 1SYSA 3BXNB 1KGIA 1XTLA 3D0AA 4D8PA 5CJXC 3U6XS 2VXQA 1DQDH 2R2HB 3U0TA 5B3JE 1RJYA 1QLEH 2FT6A 1PZ2A 4KZ0A 3GUFA 2JKSA 4YDVB 1PKOA 5EWIL 1JGUL 5E8OB 2FYYA 4X4XB 2D7TH 2VLRA 4L4TE 5I18L 4HGWB 2QHRH 4EN3A 2FO8A 2HRGA 4KKQA 4JHBA 2A6DA 1YEFH 3VH8B 2K4AA 3VXRE 3HLKA 2DM2A 3CFKA 2FJUB 1DFBH 3TV3L 4AZUA 4D3CL 5C7XH 1ZHKB 5FCSH 4YHNB 1XGPB 5ESAB 4XWOC 4UT7L 1UWGH 3V52H 4ALAL 5BNXD 1MDAA 4RAVA 5AAMA 4JQIH 4BWTA 3TF7C 5IBTH 3UTOA 3VA2C 3GSXB 8CGTA 4NJAL 4WFED 4MWFA 2R4RL 1C5CL 2I9TA 1OF0A 4ODWB 2K6ZA 5FUZL 3KDPB 3DMMB 4K8RL 2PXYB 4U3SA 2EYSB 3V4VA 4B3EA 2JCCE 3N42B 3ZTEA 2XZAH 5TH2B 4KZCA 3VGEA 3O6KL 4BH8A 4FG6C 4AMWA 3CX2A 3TNNB 4ZMVA 2P46B 1E40A 1R3LA 5C8JA 4OVVA 3UXFA 4NO0D 3NEEA 3DDGA 1JGLH 4Y9CA 4YS4A 1CD8A 3QG7H 4BQ9A 3BPOC 2VQUA 3P3YA 1PZAA 2AJUL 5EIIB 3CZKA 4F7TB 3MRFA 1CFVH 4FQCH 1DBJL 4JREB 4KI5C 3QEGH 3X1EA 1ZS8B 3SZ6A 1EUTA 4QCIB 2OX5A 4L4JA 3ISRA 1X7QB 2MKLC 5C71A 2BNUA 4PS8A 4GJTB 1F3JA 1QG3A 2BCMA 3ARXA 3UJTH 4MQSB 1QRNB 5GGRY 3W81A 2VC2H 4RMRA 1R5VB 3O6FB 1LL1A 3ARFA 3LNGA 1UENA 5ELIA 1H3XA 4YX2H 1JZ6A 2HAZA 4G59C 2YUXA 2G4GA 1F18A 3EUUA 4XXWA 2BSTB 3FQ1A 4JR9H 1NGYA 4BQ8A 2EVGA 2O4EA 4LCUA 3MOQA 5IM7B 3MRIB 3MV7E 3VSTA 2PYED 1T89A 3M8OL 3QXWA 4MJ5A 3QJVB 1JWUA 1VENA 4GQ9H 3Q8EA 1NMCB 4FZEH 4ZS6D 1RZKL 4K94C 2JKIS 3G08A 3ME0B 4XP4L 2Y22A 3DX6B 1HYSD 4NWTL 3LQAC 2FWUA 3AAZA 3BD4A 2E86A 2X1QA 4KH9A 5D7JD 5A2IH 4TSCH 4LLVA 4Z76A 3P30H 3WKMH 1P4BH 3MCKA 4GRWE 2R0KL 3QIWB 4L3ED 1I85A 1NC4A 2C4FT 3W39B 3IETA 3FCBA 3HG4A 4Y0GA 5AZUA 3HC0A 3SKUD 4B9JA 1FNAA 1AC6A 3H0TB 2XN2A 3GXIA 5ITFA 3V5HA 5T33L 4M62L 1JL8A 5E03A 5CAYB 4BZ2H 7FABH 5DZJA 3EBIA 3WKPA 1K8DA 1XR9B 4WGVB 1TXKA 3OJDB 4H26B 4KKPA 5D1ZC 3POHA 2YR3A 4E41A 2Z1PA 1MHCB 2X4PB 5CR8A 4LFHG 2DV6A 1CICD 1MRCH 4Y4HA 1AG0A 2ALAA 2C3XA 4HEPA 4PJHB 3QUMB 1TTBA 3EUDA 3DBXA 3PWPE 3B5GA 3L3DB 5FO7B 2EZ0C 3JUYA 1J0HA 5AVTB 5T1KD 3T5WA 3SZKC 4O00A 1WFMA 4XCCL 3S3PA 1NSNL 4J6RH 1SQMA 2M1KA 3R7QA 3R7RA 3D18A 5BUGA 2DQTH 2CO2A 4KBPA 2MPVA 1JGDA 3APMA 5IB4A 2H1XA 5AUMB 3U0WH 3CSTA 3VFUB 2Y5TA 1FFPB 1W9XA 2DQ6A 1XD1A 1P53A 4WO4D 1DUZB 1B4TA 1I8AA 2A6IB 2AAAA 4OTXL 2OP4H 3MUZ1 4MMXA 1BLNA 2J21A 4PJXF 3EO9L 1SLXA 3MTRA 3U2IA 2JI2A 4P06A 1CGVA 4RETB 3QQ3A 2AW2A 2QADB 4F3FB 1H15B 3CX5K 2PKDA 5H2BA 1FYTE 3AM8C 3C87A 3WKYA 1K6QL 4PJ9D 2K70A 3AABA 3FQ2A 4KI5E 2GK0A 3F64A 2YSTA 1XMWA 2VERN 3MBXL 2VJ8A 1S3KH 5FYJD 3E1ZA 4S0TD 1YUHB 2IH1B 4ZW7A 1NAML 3NJFA 2VDRB 2WV3A 3M17B 4HFWA 1EA9C 3B37A 3VGAC 1R3HB 4MX7B 3ARED 1E7UA 4NI3A 5AALA 2HSIA 1MAMH 1W0YT 1JK8B 1FGNL 5ICUA 2Q8AL 4DWHA 3B2VL 2H26A 1HXMB 2DPKA 4XMZA 4NCDA 4A7GF 4E5XB 2COQA 5DUPH 1T22B 2ENYA 1MXGA 4NQCA 3BUTA 1JFQL 3DMMC 1X4XA 5IK3A 4BHUI 2ZOWA 3IU4L 5IB5B 4B60A 3RZCD 4G71B 3FT1A 2Z0BA 1AZBA 1L0PA 4OM1H 3TN0D 1T7XA 4MJIB 2DLIA 4JKLA 4QNPE 4M8RA 1I8MA 2BVPA 5EV7A 3MOBH 1TU2B 1JF6A 4HUUA 2ZICA 3AQYA 3GMLB 1OLZA 5DLMH 4ZXBC 4YNYB 3SODB 2EKJA 5CGYC 1U8IB 3UC2A 4N2LA 3RWJA 1H5BB 5ADPL 3KYMA 2A0LC 3DOSA 1X5IA 5IQ9B 1DLHA 1OP9A 3DX2A 5IVZB 4P5TB 3KPRA 4G8EA 1G9EA 5GGUB 1RIUH 3WL9A 3QUYD 4ZPTA 3H42H 4AX3A 5HJ3A 4NQSA 1CGTA 4HHGA 3O6FC 2NX5B 1QEWA 4PRIB 1U3HB 5CILH 4CJ0A 1SVZA 4KK9C 1Q94B 4GW1A 2DH2A 4EI6A 1AKPA 1SY6A 5E1HB 1DL7L 3IJ7A 2VSMB 2F8OA 3CVBA 3I50L 3U4EA 2Y7QA 5E0QA 1QFPA 2AEOA 4F24A 4JHUA 3CVHH 1UGNA 4R2GD 1DQQB 1Q9LB 2W0PA 4NNXA 1MOEA 3DHJA 3NFSL 2ICEA 4MD0A 3BGMB 3VXSE 4OCRL 1HQ4B 5T1DH 3GEWB 1RZIA 2AV1A 4RRPM 1FRGL 3DWTA 5FAAA 3LMJL 3E7JA 4G43B 2GJPA 3BZDA 1U58A 3D5OF 1SDYA 4B3VA 4LL9A 1I53A 2MWCA 4CL7A 1LYQA 1EEYA 2WNWA 4HD9A 4OLYH 5BRZD 5D1QE 2H1PL 3ZHKA 2X12A 5CGBA 3PWLB 4OU3A 2M2DA 1R24A 3WD5L 5JNYA 3VACA 5JPMC 3NCWA 5I6XB 2G0KA 1CDYA 4DOHE 4G6FD 3V4PL 2C34A 4BWUA 3FW6A 2GG1A 4HIQA 2GT9B 1E65A 1MCKA 3ZE0F 2L7UA 1G1YA 2C4FU 2YC1A 4M1GH 1TZIB 4OZFH 5AVQB 1TKWB 1ONQB 2YWZA 5FYKE 1U8QB 4KMQA 5KS9F 2OR9L 2EIZA 1RHHB 3MNZA 3VGFA 2JKTM 1L0XA 1UXWB 1WITA 4YAQB 3WXVL 3KNBA 4FTVE 3S96B 3KWUA 2NXYD 2A2QT 3GMNB 2WQVA 3HI6L 3Q6FA 5A16A 4N68A 5ICZA 3GSOA 1W8OA 4S1SH 1RMFL 5CEZE 4PG2A 5DJAA 4MRCA 2K9FB 3TWCL 1JV5A 3ABMB 5TPWH 2IMMA 4L0PB 4HUVB 1P1ZA 4P59L 4WJ5A 5DQ9A 1FZOA 3SYOA 4IIQB 5D2LB 4BHUA 4WO0A 1MWOA 1FZKA 4GNKB 2MIZA 2WWOA 3WNLA 1BD2D 3T4AA 4WUUE 3TH4T 5GHWH 2QADC 4U0QB 2AMUA 4LOUD 1IGTB 5MEQB 2XQYK 3FT3A 3HMXA 5C0CB 3QQNA 4FOMA 2H9GA 4JRXE 5E6IA 3WJLC 4MB3A 1QBAA 1PD6A 3OM3B 4WKZB 4XBPB 2G3MA 4YXLL 4LRNH 1DVSA 1JZGA 4XN5A 4MLSA 4C58B 2EDBA 1IBGH 1KXQE 3BAKA 2VQTA 4ANXA 1RIVH 2HVKA 3TYFB 3PIQB 3A24A 2DWYA 1BJMA 2AQQA 4U05A 3WKQA 5D55A 3CU1A 2QEJA 4Y5XC 4O58H 3U7YL 4N28A 1QUPA 4GRMB 4EVNA 4UDTB 3WLWD 5HDWA 5HHOD 1MXDA 2UY6B 3RYMA 1HL4A 4I9WD 4IMLA 3WS6A 1XH3A 1OE1A 5KYXB 1KELL 1GHFH 4Q6KA 1M1XA 1IM3B 1D5ZA 2NUTA 1HNFA 1T04A 4PY8J 1CQKA 2FO4B 4IU3B 2J7LA 4P5KA 4E9RA 3O81A 4IDJH 1EHLL 2EYTA 1H5BC 3T2OA 3LN5A 3VXUD 5J6HA 5DHVH 3VB9A 2UXTA 4ESKA 1NTDA 3VXRA 1WE5A 3FUIA 5E2WH 3ML8A 2AERT 1Q9KA 1CD0A 2ARJB 1AI1L 3QUKB 5KZCB 2NY1D 4W9KC 3TEXA 5LUMA 5JORB 2C1OA 4KY2A 1USQA 4J3WA 3B9KB 3REVB 2PN5A 3VNYA 1BBDL 4JGNA 5KYYA 5HGAB 3RX8A 3IT8D 3WN5B 3L2LA 5TE6H 1T1YB 4ZS7H 2CQVA 1PSKL 1MHEB 1JPST 3MTXA 4KMTL 3PGDB 5I8CA 4I3RH 4OCXL 4PJ5B 2J5LC 3EYFA 4KZEH 4F1ZA 2X28A 4KXCA 1RQ5A 2R69H 3LJ3A 2JCCA 2F1BA 1MFEH 5I19H 4H1LB 5ACMA 5F9JB 1ZA6A 1WH0A 2BY2A 1SEBA 5HHVL 5KBNC 1D5BB 3STLB 5JXEA 4OZFG 5CBAA 4KHXL 4LEXL 5EUKB 3C6EA 5EOTA 3T71A 3QA3A 3BJ91 2NY0B 3ZUNC 4AKPA 3HE7A 3KXFB 5BZXA 1R3JA 3HRZA 2VSKB 4LVHB 4XB7A 1P4IL 4QHKJ 5E95B 3S36X 3UP6A 4DPCX 3VB8A 1TVBB 1YMME 3P73B 2LLLA 4K23H 4CJ1A 3ZO9A 2FJGB 1IJ9A 3NCXA 4X4YB 1XF3B 3MJ9A 4RMTA 1RUML 1BFOA 4OFDA 4IRZH 4Z8FL 1QSFD 1CLCA 2ZCHH 3QUXC 4AT6A 2J55A 4JY4A 5JUEH 3Q13A 4PS3A 5ID1A 4RFOH 4Y19B 3G6JE 5EU7C 1HHHA 1HHJA 3QORB 1A25A 2XTLA 1BP3B 4ORGA 4PP2A 2VQ1A 4U33A 3MCG1 2ZTBA 5EA0H 3MV7A 4TQIA 2KZWA 4X5XA 2IH3B 2OJEB 2E6PA 1RUAH 4Z7QE 1SJHB 3Q1EA 5C0AD 2J8UB 3L9BA 4PGDB 5ID0B 3S3DB 5F6HI 3ZL1A 4QT5A 4YEEA 1F00I 5I6LA 2Z35A 5C6TL 2JV6A 3ZDXB 1BWMA 3Q9QA 1R5IA 2AZUA 3QR0A 2OTUA 3HG1E 1N8OE 2EIEA 4XE0A 2ITEA 1UXMA 3NK3A 3MV11 5JDJA 1RULL 5IB1A 1D5RA 1DBAL 1UM4L 4NKDB 5KSVB 2QELA 4OM0H 5C86A 2VN3A 4JMNA 5JIQA 2EH7H 5TDOB 2PW1A 3WNPA 3RGBA 5EF1A 2VRQA 1ZSDA 4F7PA 2YQGA 3F8UB 1V7NL 1J86A 1ZE3C 2VJ0A 3KLLA 5ANMA 2YAEA 1YY9C 5D93B 3O4LD 5DD0H 4PRHB 4JRYD 4N8VB 3S34H 4Y4FC 4FJZA 1KBPA 3GMOA 4L8BA 1CFBA 4PJFB 4WDIA 2FUTA 1FF5A 2J12B 3GPEA 2OKMA 5J4MA 3J07A 5G5DA 2DMCA 2EKSB 3NSDA 1J1XL 1I1CA 2AVFA 1MEXH 3CC5B 5GRUL 4MXWL 3P77B 1QUNA 1HOCB 2HRPH 1CU4H 4NQEE 1G6RL 2ZX8A 5BQDA 3SE9H 2BVEA 2F5BL 2QV2A 2CHXA 2Z7ZA 3BW9A 4OCSH 5F88B 3FFCB 2X1OA 4GIPD 3INUH 4X5WA 1NEUA 5C2BL 5EHFA 3ZBMA 4BSJA 4XVJH 3QISA 4V1DD 5KVEE 1TZGH 4FQHA 2X38A 1EJ6A 2B59A 1IGIH 3M1BB 1JGVH 2FIKA 2APVA 1JMXA 5B1JC 5BS0E 4DFHA 5IHUL 4ZUUA 1OAYH 1NQBA 2AQSA 3FUHA 4LNRB 4TLTA 3LQZA 4U6XB 4WF7A 3SPGA 5DMIL 2WZAA 1IRAY 1FBIH 2WSDA 4J27A 5GRZA 5LGHH 3ZR6A 1J5CA 2C9XA 4MD4A 4MDJB 2NY2D 3N2JA 4AG4H 6PCYA 4L3CA 1R34A 2H2PC 2F6AA 3MO1B 4OBRA 4R7NB 3TZVA 3CN4A 2GSIA 3I84A 3A6CH 2W0KA 4OY9A 4UB0L 1J8HE 1H9DA 2IGFL 1E4WH 3CH1B 1WCBA 4BWWA 2WO2B 4ACPA 5I15H 1IQDA 1KIUB 1DQLH 1KJ2L 4PWHA 4E9TA 2CNYA 4QXVA 3QAQA 4ZTOL 5I8KH 3RRQA 4ZFZA 3W0WE 1UT9A 3D4YA 2IPUG 4HX1A 3MJ6A 4UYPA 5EOQH 4L29B 5FUCE 1KIRA 4C83A 5EIVA 4X99B 5T1LD 3QZBA 3GI9H 4AC2A 5DS8A 5FDWA 1L6ZA 1UKSA 2VT0A 2BZDA 4FQQA 5DDHB 3FCTA 3LKQA 5JHLH 2XPYA 3TLRA 4XI5C 5D7IF 3BN9D 3NZHL 2MJWA 3HB3C 4HBCH 4WU7B 3KYAA 1A6ZA 3DX7A 3QPXL 5E8NA 1I1YA 1IAKA 1C5BL 1G9NL 1HAWA 5DRZA 4ZG1A 2NY4B 4XX1E 5AW2B 3C5SB 2C8NA 5IESL 1H6UA 4XPTL 3K2UL 2YPVH 4LVHC 3ESNA 5FFLA 4WWOA 1J10A 4WRLA 2DWDA 3MNMA 3OXSB 4P23A 3TBVA 2ZWNA 3ETTA 1EZVX 2XKNA 3N85L 3WFDH 3NJMA 3RI5K 3G5YB 3FQUB 4ANUA 3DX8B 4XZUA 3LHPL 5DJ0A 1KF9B 4MBRA 3RNKA 4P2QE 3O6LL 2ESVB 2XFXB 1S9WB 1UWFA 4NYLA 1SFHA 1GJUA 4OCLC 3UEZA 4ZFGH 4XOAA 3QS2A 1DVFB 1GGBL 4UQ9A 1KTBA 2K3TA 2VUYA 1T20B 2LVCA 2NNRA 1GGIL