4F8PA

X-ray structure of psaa from yersinia pestis, in complex with galactose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
141
structure length
141
Chain Sequence
b'TFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFDNKQSTVINSKDVSGEVTVKQGLEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pH 6 antigen
molecule tags Cell adhesion
source organism Yersinia pestis
publication title Structural basis for the specific recognition of dual receptors by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia pestis.
pubmed doi rcsb
total genus 21
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f8pA00
5LN8A 4F8LA 4F8PA 5LNDA 4F8OA 5LO7A 5LN4A 4F8NA
chains in the Genus database with same CATH superfamily
1KCSH 3GSUA 1N6VA 1PCXA 3F7VB 3BDXA 5TDNB 4KK5C 1LWJA 2XETA 4I77H 5EIIA 1OCCB 1A6WL 1EDHA 3PPSA 4BZYA 4JG0L 4LHUA 4WFED 4YWGH 3RX8A 5IFJB 1R3IL 3T2NH 4DSYA 3MUZ1 4GRWB 1NLBH 3OGOE 1FBIL 2EXYC 4XCEA 2TRYA 1PX3A 4X7DC 1OP9A 3QT2A 4EI6B 2ATKA 2UZXB 3VWKC 2XWRA 3KPPB 2VC2H 3ZL1A 1OE1A 1DBJL 2ZKMX 4FI7A 4G7VH 2V3EA 4YAQA 1ETZA 5D4QA 4CN4A 4LCWB 3FTUA 4TQIA 3E6HB 4JHAH 1W72B 4X6BB 4DK5A 4KQ4H 4PRPA 1DJXA 1M53A 2JI3A 3MMEA 4YHNB 4UT9L 3ARQA 5E6IA 1Y0LB 1H3PL 4GMSH 3SBQA 5IQ9B 2DM2A 4JHVA 2HJFB 1J1XL 1NGYB 3W0WB 1IZKA 3RG1C 2HFFB 1YEIH 4A7TA 1UH2A 4P2OC 2FNBA 5JR1H 5IT2L 1FH5H 4HJTA 3N41B 3QIBA 3AREB 1R5VA 5DJDA 2FBOJ 4JHUA 4NFCA 1O9VA 5EUOF 1MFBH 5HHXH 4FFVC 4U6VL 3MBEA 2XLLA 3CC5B 3ARFC 3OAZH 4CVUA 1FBIH 1GPOL 3STZA 3FTVA 1HOCA 4O2FA 4N24A 1JPGB 5TK4A 5AWNH 1U6AH 1HHKA 4G1EA 1RVFL 3IAQA 2K8QA 3V4UH 1B4JL 1A6WH 4PWJA 3IJSB 5CZRA 1BP3B 5FGCE 2A38A 5GGTL 1IGIL 2JIXD 5EDXA 1NCGA 4TOYH 4EQ2A 5M94B 4Y1AB 1XEDA 4P57B 3AITA 1W72A 1IBFA 2XN0A 4G8FA 2JKNA 2C26A 3FQ2A 1D9KD 4ERSH 2VDMH 3A47A 4KNUA 4PGDB 3SE3C 3MRNB 1U8IA 1FFOB 4JZNB 4PBXA 3LQAC 1MWAB 3ECVA 4N86A 4H8QA 2WJ5A 2Y72A 4OIIH 4OT1L 3NZSA 3N06B 2DYPB 4G1MB 3HCVB 1FL6A 5EZOH 1A7RH 2PETA 3FCTA 4ZPTB 3WN5A 1BMGA 3PWJA 2X70A 3KR3L 4PS4H 1WSST 2CDEA 2HUEA 4JY4B 1U3YA 1FIGL 5FHAL 1W72H 2J8UE 5KN5A 4KNSA 4F7CA 2HMIC 3V52L 4TNVK 1A14H 5DLLA 4KXCA 2A6DA 4QRRA 5IFHL 2F8XC 3WYRA 1MCPH 2R56L 5GGSB 3BLPX 4LVNB 4AL8C 2CM6A 4PJIF 1XH1A 5IVXE 1MSPA 4KK9D 5F1IB 1RU9H 2H9GA 4LCVA 3IPBA 1NM4A 4G6AC 4L8SC 1DANT 1YNTA 1J10A 3U0PB 4YH6A 1JWSA 1G6RL 3PJLA 3S35X 2LOEA 3VWJD 4LCWE 4FJZA 2PR9A 3VW3H 2O5XH 4HIJA 5HYJA 4PJGB 4MJ5B 4APXA 5HHVL 3FW6A 3QULB 3DVNA 4AQEB 4GRLC 1SOXA 2AC0A 3L3DB 1JK8A 2ZNWA 3HLKA 3PWUB 3FT0A 4W9EC 5D7JC 4ZO9A 4OD1H 3OXRB 1U91B 4N0YL 1PF3A 4DGWC 5I6XC 1ZPUA 1T2JA 3DIVA 1PYWB 1ZLWK 3DGGB 1NFDF 3R1GL 1IMHC 2CBQA 4AEFA 2KDYA 3O3BB 3Q2NA 2ZUXA 1PX8A 2YN3A 3MJ6A 3LZQA 1BHGA 5TGBA 5TE7H 5CWSA 2UXVA 1IE4A 1UT9A 4HU2A 4YXLH 3PFUA 3I9GH 4BFRA 3KXFA 5DHXB 2YGPA 1OLZA 3MBEC 1UEYA 3PQYA 4R90H 1EPFA 3O6KL 1NPUA 5EEWA 1UWXK 3OMAB 3TBVB 3W2DH 4V1DD 5GGUA 4WEUD 2XRAL 2K3TA 2VZVA 2HFEB 4ELKB 5I0VA 5KSUA 4KKRA 4R83A 3WJLA 2F5AL 3SYPA 4HD9A 4NGHL 3QFJD 3JWOH 4MCZA 4OZGA 1CB4A 4OI8A 5I73B 3DRQB 5J9PB 2IANE 1B6DA 5MEOA 1MQKL 3JYBA 2P5WB 4X6DA 4HUKB 4DUXA 1Q9LB 2FJGB 2WVTA 4NQDD 1U92B 2WJ7A 3PWNA 3MVSA 3UMTA 3VYNA 4AEHL 4DOHB 1PJWA 1GZHA 4K8RL 4X5XA 1JNJA 4QNPF 1PZ5B 4DHLA 1M1XA 2OMVA 2L7EA 4Z7UA 5C0CB 1JN6A 1P5VA 1SY6L 5D2NA 2AEPH 5JPMA 3FQTA 1A3QA 5D93C 5J0BA 3QHFL 5KSUB 5KJRH 1IM9D 4OGQC 1KJ2H 2E0PA 5HDQH 2EQDA 3GHBL 4GSQA 3BFWA 2DQTH 2NY2B 4Z0BH 1NC4B 4Y4KC 1MCBA 3TNMB 2D7NA 5H37H 1NQBA 1E9PA 1S7WA 3I2CL 2VDQB 1CI3M 4PJHB 3VXSA 3X2QB 4F91B 5HYIA 1A6TB 2PR4L 3HIZA 3QG6B 4CMMA 4J6IA 3QXTA 5DQJB 3CC5A 5JOEA 3VG0H 2FK9A 2GAZB 3PQYD 4ADJA 3C5SB 2XN1A 3W37A 4K0OA 4NENB 3D0VB 3R8BB 1IFRA 4CGUB 4TV3A 3N5AA 5GSRB 5B1AB 1YUHA 1N2RB 1EEQA 3UO1H 5CP3H 1V5JA 4OLVH 3VG9C 4UNIA 1BWWA 3FZUC 3LXBA 5DQ9B 3TBWB 1Q0XL 4XPBH 2YEZA 1TCRB 2JCCF 3CLFH 3CFMA 3EOBB 2CLZB 1A1NB 3G5XB 5E00B 4OJFH 5EOQH 1HE7A 5FB8A 4MMYB 3FQ4A 2GFBA 4PSRA 3WKPA 4R96A 3MRKA 4XI5C 1KTKE 3PPEA 4U1JA 1FVDB 5BRZA 4M48H 4XO5A 1KGUA 1I8IB 1NAMB 4OF8A 5FIEA 5IEKB 3ZDWA 2Q6WA 1C5CL 2J8HA 2YLKA 5IVZA 5F71A 1FL6B 2GPZA 5DR5L 3QJFA 3OM3B 1JV2B 3OWEA 3RPKA 3S3SA 5DEGA 3FUMA 5E08H 2XFXB 3HE7D 1XHHA 4YDJA 2YUXA 3LDBB 5CEZH 3HMWH 5DGQA 1CLCA 2BHZA 1RZFH 3TESA 2OZNA 5EF2A 1J9TA 1XR8B 3P3YA 1S7XA 4PMEA 4GP8B 1RJLA 3RVUD 4DK3A 2R0ZL 4GSDH 4TQ8A 3FFDA 1R3HB 1INEH 4OCXL 3TPUB 4WTZG 3QEHA 1ETZB 2QPUA 5DDHA 4ONFL 4YHPB 1RZ7L 2GT9A 1G7HA 2PWEA 3QDMA 2VQ4A 1GZPA 1T0MB 4KDWA 4PRID 5ENWA 2HTKC 5GS0D 1FVEA 1H3XA 1WQVT 3WJLC 4XHJD 5C8JA 1OB1B 4LESA 4OGYL 2YEQA 4KI5E 2XZQL 5KG9A 1MWAL 1QBLL 4X8JA 5C71A 3D2TA 3PJNA 2WZPD 4D2NA 4O4YL 4G8IB 2WOYA 1NAMA 1MIMH 5JIQA 4JLRA 4MA8H 2BIMA 4P4RA 1HINH 4NZRL 2B1AL 5EZIH 4LGPB 3EJJX 4YX2L 2MQGA 2FJHA 2VDLH 5GZNA 1P5UC 4JGMA 3SYCA 3VFRA 2UXFA 3BPCA 5D6DA 2IPUK 1MJ7L 2XFXA 4P4KB 3T08A 4KZEL 3VD4A 2AZAA 4V1DE 1H6TA 1N5AA 1JPGA 1OM3L 5DZNA 1CL7I 5KG9B 3ZTJG 4AGLA 4XT1C 5I71C 1IKFL 1SYVB 3O3DB 3ULSB 3LTVA 2XRAH 2V2XA 2K3HA 2VCOA 2GUYA 4YAQB 4BHUA 4PWFA 1UGNA 1M2OA 1JOIA 1PNCA 1KTDB 4HSCX 2C3WA 3EYFB 1OPGL 5F7KC 2XWJA 4E0RB 5JW5A 4U3CA 3LPFA 1XCTB 2CCLA 4H8WL 1G7MA 4OQ1A 2YUVA 5MP6H 3FSZA 1E6JL 1ZE3H 4E5XB 3NPSC 5D1XE 4CBPA 1EUUA 4G9FB 1JZ5A 5K9JH 2IH3A 4BJLA 3MRMB 3B9KA 1ADWA 3E1F1 2W59A 4HKBA 5I30L 5EEXA 2FB4H 3SBWA 1WBZB 5A2KH 5HYJE 1RPKA 1KY7A 4I0KA 1IBDA 3UTSE 4B7IA 1E65A 4KZ0A 5T3XE 4Z3EA 1BVLB 4X5XB 4N6RA 1BZ9B 1MJ8L 2BFVL 3I3EA 3B9AA 3JT0A 4A2HA 4YLCA 3QXUA 5KYXA 4UNVA 3FT4B 2DMHA 4RMVA 1IVLA 3GNMH 1U8NB 4P46C 5IMOA 4C58B 3O3AA 1BVNP 2R4RL 3NZHH 1KCWA 1E2ZA 3H9SE 5AL8A 3MV8B 2I60H 4ZS6D 3CHSA 5TFSL 2UUDK 3HAEA 4RDQF 1LE5A 3ALXA 3T0XA 1Y6KR 3X13A 1LWHA 5J7CC 4A6YH 2GAZA 2G4EA 3SE3A 3DMMA 4TYUA 2P44B 4L9LC 4DPAX 3SDYL 4BUGA 2APTA 2Z7WA 2HN7B 2C3XA 3DWTA 2ZX9A 4HKJA 5C0IB 4GRWF 5DUBA 1NBZB 3KWWA 4MDIA 3AGWA 4XPAL 4HKZA 1YNKH 1B90A 4OQTL 3SDDC 4NP9A 2WLZA 3ZHDA 3LN4A 5K1JA 3S2AA 3UCRA 4KKCD 2HRPH 4HFWA 1A3LL 1QSZA 2IAMD 5B3JE 4CUCA 4YDNA 5EU3B 3ZN6A 1KTLA 2C4FU 3L4ZA 2ZJSH 4O2CA 1TZGH 1H9VA 1KOAA 4HOXA 4U2ZA 4ADIA 1WBYA 2HT4C 2YD1A 2X42A 1QSED 2F0CA 4QUOA 1ZIAA 4QWWD 1UATA 5F9OL 35C8H 2IGFL 1P5UA 4W9ZA 1LNUB 4X83A 5T1DH 1FYTB 3Q8CA 3RFZB 5EF3A 1JV5B 5T1LA 1QACA 4ORZC 2ODHA 4UQEA 4XNUL 4ESKA 3DGCR 2H2SC 2YQBA 1SYSB 3T1FB 4AGQA 4UQDA 1SDAB 1PL3A 4LCIH 5J6HB 3DMMB 3HLAB 4L3CB 1MZYA 4DNLA 5JHDB 2ERJC 2ROYA 1F58H 2GIXA 3QNZA 4XRCB 4RMWA 4BA0A 3BGFB 3L5JA 1JK9A 4P46B 3U1SL 3ZDZB 4KRPB 1RJYA 2DV6A 4PJDF 1TPXC 3BSGA 2CWRA 3DTXA 4FEMA 5FPIA 2RALA 5F3HB 3OLIA 3CU7A 5AB1A 1FLRH 1IC7H 1AE6H 2VLLA 5T5FA 1RK0B 4NXSA 3GQFA 4EI5B 1QSEA 3F6JA 4P9ML 3KYOB 1TLMA 5E8OA 1VADA 2R2EA 1XIWA 4LK4A 5I19L 3MGTA 5D72L 1AMXA 5ISZA 4L4VD 1BECA 3JVGA 4AKPA 5FDWB 1C5DA 2HB0A 5EC1B 3TNMA 3ZW3A 5E2UL 4IBTA 3ZTNL 3GZKA 3EDJA 1D9KC 1WD8A 2UY7B 4PP2A 2I25N 3EYVB 4Z7QB 4XXDA 5JPNA 1IBHA 5FWRA 5EPMB 3QYNA 2A77H 1L9QA 4ZOCA 3HRZB 5DC9B 1KBBA 3IKCB 3P9LA 4NI3A 5D2NB 3H6JA 2F6AA 3MRFA 1MHCB 4L3AA 3NIDE 3VG9B 3UBFA 2D7TH 1MCLA 4NWUL 3ARFD 1D6VH 3ZKNC 3PWNB 3QCVL 2Y7MA 1QSFE 4WZ9A 1LEIA 4J6RH 1X7SA 1IX2A 1XTLA 1X9UA 1OGTB 4DEPC 4OCRL 3ZRSA 4E41A 4XNYL 2DEYX 1CE6B 1A4AA 4LOUD 3ZMNA 1KIRB 1RY7B 4U2YA 2AK1L 1ZLVH 4U4BA 4P2QE 4PWGA 3QORD 4WCYL 4DCQA 5I23A 2OL3B 4DJMA 5T3XL 1A7PL 2C7UA 4OFYA 5D72H 4ABQA 3MXWH 4W68A 2L7QA 1D5MA 4YE4H 1BCIA 4AUYA 2XKSA 3U0TA 2BWDA 5F88A 3UJJH 4G8GB 2J21A 4KRPC 5JIDA 2GQHA 4PRIA 5DEGB 1E4XL 5AW7B 3AREC 2ZWZA 3VI3F 5LN8A 5TK2A 1P2CA 3MJ9A 4KO7A 1KNOA 4X5LA 2WUCH 3HC0B 4FFZA 3D5OF 1TJHL 1HEJC 5DHVH 4HS8L 4AVHA 4H4NA 1Q8MA 1U8OB 2E59A 3TN0A 2NUPA 4RGNB 4D0CB 3GMMA 5DEZA 3VTAA 2GT9B 4LBAA 1RQ5A 4GT0A 4R2GC 4UM9B 5D1XD 5I30H 4X9GA 4M61B 3C5XA 2AANA 1ZLUK 4ZFOL 4NEHB 1XB3A 2IH1A 2OMXA 1ZHLB 3I6SA 7PAZA 3FTXA 5AB0A 1N5YH 4RIRA 3TTYA 2YJQA 3WFEL 2XWTA 3OVUB 1HXYA 3HI1A 4JFHE 3W9DA 4W93A 3E0GA 5GS2H 2A9MH 5B1JC 4FQPA 5LCVH 3STZB 2OAAA 4ZW8A 2XV6B 1VGEL 4U6HA 1R34A 1G9EA 2PYED 4FQLL 1DUZB 4JVWA 4OR1A 4X4YB 3GZOA 2FLBT 2OMUB 1AOZA 1OGAB 3D33A 2EEFA 1E9QA 4ZMWA 5C1MB 4MDJB 4UYPA 1TJIL 3GXFA 5KBKA 4NPKA 1CXFA 1WV7T 3DK0A 2K6YA 1AQMA 1BIIA 3WFCL 4JKKA 3TA4D 3JXAA 1XGUB 2ZSVA 4C57C 4OGXH 3Q06A 2AV7A 4Y89A 5E1AB 2IADB 2WNGA 2V5RA 4NM8L 1JF5A 5DUPH 2XJKA 4Y0GA 4I4WA 1U8OA 3RAJL 2E8ZA 3AY4C 1UFUA 5EBWB 1D9KA 1JZHA 1BQHB 1MFAL 1BD2E 4LMQI 4NZDA 2HP4A 2VRKA 2C9QA 2LT9A 3HS9A 3MACH 4P9HL 1NCJA 3BZFA 3CCHB 4YZFF 3WSQL 1I8UA 2IIJA 4PJ8A 4X8GA 3ZDYF 2DQGH 2GJ6E 3L5XH 1UT1A 3CLWA 5FK9A 1JVOA 4CAGA 4NSKB 4P2QA 3ZHFA 4BZ2H 4IHOA 4Q2ZA 1BZEA 2BY3A 2QVMA 1AD9B 4F7PB 3E8UL 4ZO6A 5EU6D 2AJZB 3FO9A 4NJ9L 2Y2YA 4ODUA 4WVRA 4K15A 3GBNL 4ODXB 2HVJB 5GZNC 4GRMB 3BW9B 3S4SA 5JDSA 3I6LD 5EORL 1J0ZA 3EO0A 3QQ3B 5CJXC 4L18A 4JRFA 1ONQB 4RAUB 4JO4L 3RVVC 3KPMB 3NZ8A 5E2JA 1JHKL 1MCPL 3P77B 1FZOB 5BRPA 5C09E 3DMMC 2NTFA 3MZTA 3I74A 2ZSWB 4JPVH 5J6GA 3ZKMC 4I1PA 5AKVA 5DYOB 4EUPG 4Z7VF 3QIBB 5HDBE 5I6MA 2BNUA 1M3JA 3BOVA 3NFPB 4L0ZA 3K8KA 4GKNB 2KBGA 2WYIA 3KBFA 1MRFL 4YR6B 3RPBA 1ZHNB 1YQ2A 4HUMB 3L5XL 2CMRL 1IBGL 1MFCL 3DTDA 5C09A 5DJ8A 5HDBB 3UTZB 5EO1B 2WK2A 2KMWA 1JK8B 5K9QI 4IRSA 5HDRA 2IWGA 2V17H 2YUWA 2WTRA 3WNOA 3HNVL 3L5IA 1BOGB 1KACB 1I3VA 4IU2B 2ARJB 3X3FL 1BZQK 2A6JB 1JBJA 5I76B 1CBVL 3BPNB 3IU4H 1TNNA 5F6IC 2A4CA 4JW3A 3RWGB 4QHLA 1L9OA 5GGVL 4IK6A 3WIFA 2F1EA 2C9XA 3O6ML 2GBAA 1H6FA 4QOKE 4X98A 3GBLA 4GRLB 4QF1A 2C3GA 3CVIH 4ZAKA 2EKSB 3V79C 1ZT7B 1E5BA 2QADB 4N2IA 3M45A 3GLEA 2MHAB 4Z3JA 1ZVYA 3IAGC 4JKPH 2IH9A 5IROA 3ESVF 2XXFA 4IRSD 3IPFA 4HCRL 4UNTA 3VJ6B 3IFNL 4FNLL 3D85D 2ICES 4N0UA 1FN4A 3V0VA 1P4UA 2X89A 1EERB 4JZJC 5J3HD 2PYFA 1WFTA 4NQED 2BXZA 4IYKA 3QRLA 5E8NB 4H88H 5JA9A 5C0ND 1GGBH 1JD9A 3D50A 3OAYH 4BSVA 2PYEE 4PTUA 5C0BB 3G08A 4JY5L 5F8RC 1EHAA 2E4FA 5E23A 1U93A 5FYLH 3RNKB 2P47B 4M6AA 2WANA 1P4LB 2YA2A 2O5YL 2IWFA 4Z95H 2AEIT 1QBAA 2YOCA 2E4TA 4I13B 3REVA 5A43C 2BZCA 1QUPA 3BCFA 1OAKH 4C56E 4TULH 3KLQA 4WO4A 3RNQB 2WSPA 2VRQA 1A0QH 2YAEA 3QDJE 4S1SH 3UPAA 4DP8X 5KEZA 4GAGL 1CUOA 2AQSA 1BVNT 1H5BA 4OKVA 5FC9A 4QT5B 2XQBH 5DF0A 3T04D 5JHLH 1T03L 3GHBH 2PWDA 3LRKA 2VZSA 3GMNA 1J1OL 4P46D 2UY6B 5LAXA 3C75A 1ILUA 3WDJA 3OR7A 4PH8A 5D70H 4DESA 4JR9L 4PRPE 1MVYA 5CM1A 3VI4F 4MS6A 4DVBA 3HB3D 1QUNA 3MLRL 1HHJA 4Y4FB 1AQKH 1Z9NA 2CK2A 2GSGB 3O2DA 4IRZH 4L0PB 1DQQB 4WI6A 1PG7L 3P73B 5HGHA 1NCHA 4S1RH 2Z8SA 5JA8B 3BKJL 1Q0EA 3WNKA 5B3NA 1P53A 3MBED 3CBJB 5MI0C 2R4SH 3S3CB 2EUVA 2QQQA 3VXUA 4ZFZA 4BINA 2X0UA 2NNCA 2YWYA 1QO3A 2AJ3B 4BV1A 4Y5XA 1CFVL 3GXNA 5JHLA 1Q72H 2BXYA 5DHYB 2Z7YA 3QJOA 2UZIL 3HI6L 3HPLA 4TN9A 3X3GH 2QVTA 4FA6A 4ZQTA 4JRYD 4Y7MA 1JCVA 12E8L 4HK3J 3ZT7A 2VDLB 4PS7A 1UA6L 3EFFB 1O6SA 1F90H 2IQ9H 4AVJA 2V5YA 4AZ8B 2DJUA 3BCDA 2FHCA 5F44A 2NY4B 1KBGH 4ZX5A 4R26H 1WWCA 2CIKA 4HXAL 5F7EH 2Z31C 1F4AA 2JXMB 5EU3A 4XMUA 5CN2A 4QRSB 2R4RH 1HEZA 4H0GA 1DVTA 3CUPA 5LXVA 1N26A 3FOMB 3QNYA 1T0NA 2J56A 3ZYJA 2NUPB 2Y7OA 2NTFB 2XVKA 4E9TA 3LDBC 3MV9B 1QR1B 1J0IA 3HG3A 3MRIB 3MV8D 1HOEA 2PPFA 4K3DL 2FGWH 1F42A 1QTPA 3OKOA 4B9KC 1IAIL 3UZQB 4Z7QE 1PG7H 5F7MC 2HXAA 5SX4I 2VZTA 5K59F 5DT1L 2I5YH 3OZ9L 3CX2A 4U6HB 3IU4L 1T1YB 4MMZB 4P4RB 4MJHA 4WV1C 4FKHA 5D2LA 1U8LA 4DW2L 4PJ5A 1OAYL 3L5HA 4ALAH 2A6IA 4J39A 4ZMTA 1LO5B 3WNNA 4PTTA 1QBMH 2YAPA 3BEVA 3WTSA 3WY4A 5IB1B 1ZOXA 3QUZC 2R69H 1ZHKB 3HE7C 5IR1B 1HKLH 3DXAB 5F70A 1K5WA 5D6CA 5EO0A 3OXSA 5TTRA 2YAHA 1LE5B 1T0NB 1WTLA 4H8WH 3A6CL 4XMXA 1YYLL 2ICWI 2R2CA 4F8LA 1I9RH 2UZXA 5AVQB 5DK0B 4TSCL 5E9DA 4ODVL 5I75B 1UASA 2N3JA 3IMUA 1KEMH 2HG5A 3AABA 2BOBA 3CVCA 4YSRA 4PG2A 1I9IL 4DEWA 5MHSD 3KL5A 4PU2A 1XCTA 4FNTA 4C47A 3PL6D 1ROWA 1HOCB 3QZMA 4FFYL 5L2KB 1XGRA 5GS1C 2WOBA 3B9KD 4DERA 1OQOA 1UA6H 3MGOA 1WA0X 4MXQC 4DKEL 3A6BH 4NQSB 1OF2B 2ADIA 1H9DA 1HH6A 3MSPA 5FA3A 4HGMA 3BVNB 4J3SA 1FL5B 4O2EA 3NZHL 4FFWC 4OLWH 2EYTB 3PP4L 1FJ1A 1DJSA 4OZIF 2AQRA 3DOIA 4HUWB 2Q7YB 1J5OH 5E6IC 4JFTA 5J8OA 3ZE2E 3TA3C 3APCA 8CGTA 3K1KC 4I48A 2ALAA 3O4LD 3HS0B 1M7DA 1E5CA 1Y0LA 1L3WA 3EYSL 2IAND 4XC1H 2G3MA 4HFUL 2ZPKL 5AB9A 1RXLA 2FB4L 3L4TA 4PIBA 2NYKA 1EZVX 3ZZSA 1K4DB 4EE2A 3WI9A 2BW5A 4MQTB 4PV9A 3EFDL 1F3JA 1HIMH 3TWYA 1F02I 3LVTA 4WFHD 2PCPA 5EULV 5KOMC 4LPUA 1KLFB 4WSGA 2FQDA 4JDVA 4K94H 3EADA 4HIXH 1XCWA 2XZAH 4ZX3A 3OLDA 4R3SB 2NLJB 4JQIA 5DVKA 4LEOA 4FFZL 3S88L 1NAKH 3JYCA 5HHMB 3C60D 4OLUH 5CEXA 3D4GA 3U4BH 2AJUL 3LZFL 2H6PA 5TQ2H 2H32B 2E7BA 4JM2B 3VE0B 3FMGL 3FFDB 2YC1B 4DP6X 2MKLC 2CLRB 1W6WA 5CD5C 3AGVA 1ECYA 1YYML 3BWUC 3V4PA 1RIUH 4Z7OE 2FX8L 2D2CC 2F53B 1UWEH 4XVUD 5I1CH 1WZAA 1DLFH 4OZHA 3OAZK 3BFOA 1EHLL 1FYTE 2EYSB 4TF4A 2FJFB 2XQYA 5EWIL 1PY4A 2OMUA 5D8JL 4QXTB 3TTSA 3ZTJH 1KXTA 4YDKL 3WKMH 1T83C 2R9HC 4BK5A 2IOIA 4Y5VB 3U9WA 2F2HA 2X3CA 4XBMA 1RKRA 2MKWA 1AO7A 4LNRB 1O7SA 3CFDA 4KRNA 1ZVNA 1MXGA 2B2XL 2BP0B 5ACZA 3ESUF 1JGEA 3H7LA 1KULA 3QEGH 1P7KA 4X42A 2ZKHL 4U1HA 5IKCA 5ISZB 1FAIH 3T0EB 4G7YH 3L9EA 5FX3A 2ETWA 2C8NA 1ZK9A 1NJ9B 4EZMA 3N1GC 2FL5B 5CGTA 4JMNA 3G7TA 3WLWD 1DFBL 3UTSD 4BIKA 2Z91A 1P6AB 4C59B 1BQHG 4GJTB 3QHZL 1MDTA 4MB3A 6CGTA 1X7QB 4HS3B 3KJ6L 4LL4A 2K8MA 1A65A 3KPTA 4P5TC 3HPJA 3FRUA 1FV1B 1UD2A 4L8CB 5D1ZI 1QW9A 1L5GB 5JMOC 4NRZA 1XZ0B 1FORL 4GQPH 1NCDL 1X7TA 2WQRA 3PY9A 3W1ZA 4B50A 3SE4A 4KK9C 3VWKA 5BOPA 3KWTA 4F37K 4X6FA 5IHUH 5A2FA 5IP4A 4MBOA 4ZFFA 1MFDL 4FLOA 4Y5VA 3V4LA 2L04A 2BVOA 2OMTA 43C9A 1MCJA 1AYOA 4Z7UB 3TH3T 4AC4A 4UQ2B 1MVUB 1QKZH 4UCFA 3ISRA 4CGTA 1F1DA 4I5BA 2CXGA 1J87A 4GUPB 1SEBA 3HN8A 2K6WA 2BO0A 3SDXB 1R3LB 4PGEB 5DD3H 4K3EL 3IKKA 1EQWA 1LDPH 1F4WH 1I3RA 1KYDA 2V33A 1DDHA 3IAPA 3OSVA 4TUJA 2MTPA 5IVNA 1VFMA 5E2TL 3TV8A 4KQ0A 1NBCA 2APSA 3SB3A 3ZK0A 1S9YA 3WE1A 2R0KL 4X6EB 3PXHA 4NO0D 4Y16A 3V9CA 2R29A 1JHTA 3HS0C 4BH7A 4EIUA 4JB9L 3I9AA 1OSYA 1I75A 1YNTF 1SN0A 5JXAH 1Y1UA 3NN8A 5KBDA 1M71B 3GMMB 3NACH 3QEQA 5ICXB 3ES6B 2AQTA 1FL5A 1F6AA 2EJ1A 1BZ7A 3QWRA 4NKDB 3AJ7A 1S7QB 2P43B 2DD8L 3NABL 3NEXA 5T33H 4L1TA 2FCBA 5D1XC 1TR7A 1RK0A 3EXLA 2P24A 1ZA6A 2Y1AA 1M7IB 1ND0B 2CJ3A 1GS8A 4FULA 2J2ZA 2BY0A 3TVMD 1NFDA 1RSFA 2MNWA 4AWJC 1FPTL 2FO4B 4W4OA 4ZSOB 3LZFH 1X9RA 3OMZA 3SKOA 3OF6D 4AMWA 2WGXA 1FZJA 4IOSD 4JJOA 2VAAA 3QNFA 4ZBJA 5EZOL 5JW4M 4RNRB 1TJHH 2DMGA 4X99A 1NFDE 2CNYA 3CZNA 2FX8H 4JS7A 1XF3B 3HJEA 1SF5A 3HC2A 4YDIH 2I24N 2VL4A 2VR5A 3NP4A 3D69A 3L1GA 1CO1A 1D2PA 3SGJA 2A6IB 1MHHB 2G3NA 4QKXB 1CK0L 2GCYA 2PXYC 1KB3A 3FU0A 3WFEH 1QA9B 5DJXB 2KYIA 3AM8A 4JRXD 5BW7A 2GC4C 3Q48A 5I19H 1U3HC 2YKKA 1MCFA 2HWZH 5LAPA 4PJBE 3LNEA 3I50L 3K4DA 2X1QA 2WC7A 3TYGH 4LEEA 1FL3A 5FW8A 4KKNA 4ES9A 2DBLL 4NSKA 2FR4A 3POCA 4X6DF 1NKOA 4FQJH 3B7TA 4HLZG 4QRPE 5DSCB 4HKJB 4IOSA 4JL2A 4KMTL 1U2CA 3BKYH 2WKOF 2Z6FA 3CHOA 2Q8BH 4KKZA 5F7NC 2JKIS 1T0MA 4CN1A 5AFAA 4GEJA 3RWDA 3ML9A 1GTNA 3MUGA 3GSVB 1BFOA 1L0QA 4OZFH 1SY6A 3PREA 4OZGB 4NPYA 1J1XH 1ETJA 2OFQA 2WMPA 3HC3H 1F13A 3OC5A 2CGZA 4ZRGA 5CUSH 4CVZA 3PDOA 4JGUA 4IJ3C 4J3VA 4YK4B 4BKTC 1FCGA 4MNGB 4GP4B 2PXYA 1M1XB 2OMVB 2HPTA 1QATA 2ADJA 4ISVB 1S7UA 1OOWA 4M7ZC 2NY1C 1CFTA 4WI7A 4YFDB 3TN0D 3EBAA 3O0LA 4ZAKD 3B9KB 4PJ9D 1OGSA 3O3EA 3F83A 5CBEA 5IHWA 4GINA 2OZ4H 4FQQA 5AD0A 4Z7AA 4Y4HA 1EEYB 1I1AB 3QDHA 5JUEH 2DI7A 3KDMA 2R27A 3N6YA 3TX4A 1CICB 4FQJL 1MG3C 2H1PL 4BZ2A 4E0RA 3X1BA 1KCKA 2AKRA 1HYSD 2A9DA 4Z6AT 2W9EH 5E8OB 4B0MM 5GGVH 1I8MB 2DMCA 1E27B 2M26A 5GGTH 2IANB 5KVMC 4PB0H 2XACC 1RZJC 4NKMA 1BFVL 4PY7B 4KKCC 1BJMA 3RGHA 1NDMB 3FUDA 3RA7H 1HIML 2YZ8A 5HTSA 3NAAL 3VFVA 1D7FA 3WY2A 1A7QL 3N42F 3F8UB 1X5JA 1JHTB 4WFFE 4BH7B 4LVHC 4BRJA 5D96B 2BFVH 3ARZA 4AG4L 1VLXA 1MW0A 1UD5A 3IE4A 2JKSA 4HUXA 2V7NA 3FOLB 4XTRC 3JZYA 3D8MA 5LNDA 5EBGA 3ZT5A 5AOJA 4WWKC 4OJDH 4BQ9A 1WC7B 1F4WL 2ITCB 4QRQB 1YMME 5T1MA 1YCSA 3NIDF 1UXMA 2DLHA 2X1PA 2ZG1A 3GJFK 1ZTXE 3T3PB 1DSWA 1AVAA 4M8QA 1EFQA 3QW9A 3SOBL 1JTTA 4HLZH 4A04A 3S37L 4AZUA 2J6EH 1RU9L 2TSBA 3TPUA 2CO1A 3VX1A 1I3GH 2V7NB 3G3LA 5HYSG 5IB3B 2BIQA 2GJPA 3D4ZA 2CGRH 4Q9QH 1Y7VA 1C16B 2ADFH 2YRLA 5CR1A 4M1CC 1J0JA 2B0SH 2EIJB 2BINA 3LN4B 3SSGA 3A24A 3PE9A 1UM6L 5JHMA 1A6VL 2BP8B 2PXYD 4AYBA 3EJYC 5C09B 1E30A 4H1LA 1O6VA 3HB3B 3MA9H 2CO7A 2MCAA 4M9OA 3BESR 1PZCA 4GIPD 5FK9B 4HIEB 2CKNA 5IIEA 5K9KB 1AC0A 4Y1AD 3MXWL 1MY7A 2QEJA 3N43F 3D4CA 4YHZH 2WBJC 5HHOB 1DBKL 4YQXL 2X4NA 1BM7A 4HEPG 1YNTB 4ZXBD 4PJXE 3JUYA 1LO3L 2H5UA 2YRPA 1GIGL 4UUJA 3C6SB 1WDAA 2O1AA 3CHQA 3GO1L 4ZQKA 2SODB 4HLJA 5F72S 5FGRA 3UDWA 2P9RA 4G6FD 3IJYA 2EDYA 3MLYH 5ACZB 4HWBH 2FRGP 2ISDA 4WHDA 1CYWA 3S4SG 1C08B 1JHLH 2KS0A 3KPLB 1ADQA 2RR3A 3KGRA 4N90D 4BKLA 3V7AG 4CADB 1MVFA 2XQBL 1T03H 3PUUA 2WBKA 1DSFL 2N7SA 3LN9A 1U6AL 1PVHA 3VI3B 4LF3A 1XSJA 3ULUE 1X5GA 2ZCHL 4I9WE 2NTSP 5CSGA 1SJVA 4DFIA 1MOEA 4JRLA 3T0BA 3JSSA 4HXAH 4KMQA 1QASA 1IAKB 3QHFH 3QWOB 4H1LB 1DQDH 3VXNB 5D1XA 3ZDYE 1PFCA 4Y5YC 1MJ7H 4ZZFA 3QH3B 1QLEH 1LWRA 4FCHA 4M00A 4MAYC 5HYSA 3E1ZA 3FO0H 4JPKH 5JIIA 5EDSA 2AFNA 2XG5B 3HZMB 2XPYA 5E6SB 5E4EC 2FTAA 4GYBA 1NINA 3QA3B 3HTLX 1P4IL 1NUGA 2ADJB 3SGEI 3L3OB 3W81A 3GSNH 3ULVD 4MSWA 4O2FB 2LTQC 2P80D 1KPUA 2RHEA 5CS7A 5G5DA 5IVXF 3VFUA 2G9KA 5IVZB 4PJ5B 3VRJA 5C0RL 5ILTL 1ZXKA 4J3OG 4M8VA 4XR8C 3ZYIA 3WTUA 1KJVA 3GI8H 3E3QC 2X0WA 1XH3A 1XT5A 4ONGL 1JHLL 2X4UB 4XN5A 3WEXB 1AJ7H 4K4KA 4Y16B 5BS0B 3BD5A 2E9WA 4PUBH 5C6TH 3QB7C 3LH2L 3V5KA 1JWMB 5I6OA 5CEZL 4WUUB 1HHKB 3AMLA 2E27L 2TRHA 3SY0B 5HGGS 2CHNA 4OSUH 4L9LB 1LO3H 4RMQA 3LX9A 1BAFH 1GAFL 5IW3A 2VZOA 4LARH 1F18A 1HXMA 1OP3H 1FHGA 1AS7A 1SOSA 5LXGH 4UQCA 2QPDB 4LSUL 4XVTL 1OAKL 2B2XH 2FD6H 1K8DB 2B9BA 1LGVA 3PP3H 2XICA 1T5XA 4Y4HD 3QFGA 2Q1EA 4ETYA 4RFEA 5E7FA 4N25A 1DVFD 2XQYK 1OAQL 4S1QH 3AXHA 4RSVA 2R15A 4L8SB 3WKML 4YDKH 4N9GA 1P84J 2E7LC 2J2ZB 5J13C 4U3SA 5TDPA 2IDFA 2NY7L 1NIEA 3QAZB 4BSJA 1USQA 3LKNB 4PGBA 3HR5A 2VE6A 3QC5X 3P4OB 4KK8C 5INDA 1G5AA 5E08L 4E9WA 3LSOA 2VMFA 5DD6B 5LLIC 1R9FA 4LCUA 1TETL 3QIBD 4DP4X 3OJMB 1IGJA 4UBDD 5FHBL 1XCQB 4M56A 4AYDC 1RZ8A 3FSWA 4Z7UE 4OJAA 4LAQL 5EOTA 3O9WA 1DDTA 5CCHE 2N56A 4KVNL 3VM5A 3I02A 1Z9LA 3ASWA 3BZDA 2IF7A 5LBGA 2NY3D 5D1QD 2WQXA 5I1KH 2BCKA 2Z31B 1W0WB 2PKDA 1QFUH 4JFED 4XP6L 5I8KL 3C8HA 2QV2A 3VCLA 2KH2B 4PUBL 5F3HA 4G7SB 3CH8A 2ED9A 3GK8L 3ZX1A 3GIZL 2LV4A 4LDCA 1CBVH 2P52A 3QAQA 3BAYA 2YJLA 3QQNA 5I5IA 2L4OA 2OR8A 2WTPA 1BFOB 2AJVL 4TLTA 4Y5YA 1Q1JL 1T1ZA 4AIZB 5ILTH 4O02H 3GO1H 4K3EH 1AR1B 3L3HA 4WIQA 4PR5B 5T1JA 2GG1A 3LMJH 3IFOB 3KPPA 3T8XA 4QCIA 2LLNA 4NKQB 4LHJB 3SYQA 5D1QC 3RAJH 3CSBA 1AJ7L 3LQZA 1QNZH 2KKQA 3VFGH 1IT9H 3FZUD 1QYGL 2DM3A 3GMPA 4FTVD 4BCZA 4POZD 1TT6A 5E2VL 4U6XB 3O3BA 4AEIH 3IKCA 1WBXB 3L3IB 3ZKXB 3ALWA 2OR9H 3KYNA 1GHFH 1W2KT 2NW3B 3ULVF 3GXDA 1RP8A 4OF3A 5T1KD 3TNNB 1ZT4B 3TBYA 4XNMA 2OM5A 3QDGE 4L37A 4N2HA 4Y8DC 4Y2DC 2B4CC 3OC8A 2Z35A 4RISL 2WLYA 4YXKL 1TG8A 1ZPLA 3NIGB 4YO0A 5E6ID 2C7FA 1ZLSL 3RKDD 5TFSH 3QUXD 3ARXA 2D8KA 2YMXL 4HX1B 4XO9A 4A1RA 1TU2A 1UACH 4X99B 2IPKA 4AQ1A 5FKAB 1SN5A 2DLFH 2EDNA 3IYLW 4MCZB 1I3UA 3DHJA 1OAJA 1YEEL 2DQIL 3IDUA 4XMPH 4ACPA 2W65A 3DUSB 1FG2B 2CA4A 1IC1A 2EZ0C 1XF2B 3JUZA 2VDPH 2OXGA 1XH2A 4ZFOA 1XBRA 3SE9H 4MMXC 4FHBD 5T3XH 3BXNA 3FQUA 1DBML 4YJZL 3QUYA 4NQVB 4XX5A 3KYNB 4JJ5B 5B1KA 1KG0B 5EZPA 4OCRH 2KUTA 3APFA 1N8OE 3TLRA 1T66D 4H5SB 2BNRD 4OBRA 2QGEA 2XVLA 2DQCH 1ZVSB 4FQIH 2H3XC 1X9LA 2W65B 3DUSA 1I85C 4JX0A 4YBQD 2VLME 3OR6A 2WTRB 3PU7A 5DI8B 2IO5A 3U79A 1S9VB 1ZLSH 2EIBA 3QJSB 3HE6C 3Q8EA 2Y3AA 1VPOH 1KGCD 4KDTC 1E7VA 4RWYH 2NY0B 1GS7A 4R0LA 1PLGH 1TVHB 3ZY7A 4N8CL 2H32H 2EKJA 5DJ8B 3BE1L 2WIIB 2AXFB 3MOAL 4OV5A 5E03A 3AAZB 3U9PL 5SWSE 1IAOA 3UTZA 4QRPD 4EI0A 3F05A 2WLIB 3BIKB 1R6VA 3AG1B 4UIMA 2VGLM 2H32A 4JM2A 1H3UA 3QFDA 5I8CB 4BM7A 3V6ZB 4DN3H 1R24B 3C60B 5HBBA 1SXAA 2CPUA 3H9HA 4PJ6A 3AB0C 4ZYKB 4U1NA 4TQEL 3U0PA 3MV7A 1KTDA 3Q8BA 4KJWD 2DLFL 4WFHE 4QRRD 2RH0A 5F7EL 5F9JB 4KKQA 2EDHA 3UP6A 3MKGA 4NQCB 3N85L 1AXTL 2OTPA 2YKLL 4K8RD 2DPKA 3D0AA 4WJ5A 2BIIA 3QZNA 3KPSA 1BXXA 2A9ML 3VXPA 2OMBA 8PAZA 2YD5A 1PLCA 2H41A 3O41B 3PHQA 1EAOA 4HKBB 4A63A 4AMXA 1J05A 2DYSB 1U8LB 4GSRA 1I1FA 4X5RA 1ORQB 3JV6B 1O9WA 2XBTA 4FFVD 2HVJA 4MAYA 4LHUG 3MV9D 3CE1A 1J9CT 3S8GB 1BF5A 3U0WH 1KY6A 4FX5A 5I8KH 5CMAA 3LKRB 3T4YB 3O2WH 3MMEB 4YHNA 4YGVB 4ZMAT 1A7RL 1RUAL 2Y36L 2UV3A 1IAII 4X8JB 3K0YA 1N6QL 1R3IH 5EU5B 3T2NL 3K71B 3F64A 3Q2WA 2Y6SC 3TURA 3VDBA 2ITDA 5B8CA 3CH1A 4KX8A 3BQUB 4LHUD 4HIQA 4G7RB 3WOVA 4J3OF 5IQMA 5CBAB 4W6XB 3ARPA 4RZCB 4YGAB 1JDAA 2JV6A 5L2KD 2GHWB 4HU8A 2Y3NA 3FHQA 2E9IA 1D3CA 4F7MA 2X9WA 2Q0ZX 4Y9FA 1R5WA 3D39B 4FL4B 3AXLA 1DQKA 4YSOA 2IG2H 1M7UA 3CHXA 3DPBB 3H2QA 3DO7A 5AKTA 3T2PA 1YO4A 3G5YA 1A3RL 1GMEA 1T4KA 2B39A 2MH4A 4TQEH 1HL9A 4XXWC 3HN3A 4M1CD 4J5VA 1I9RL 3VVVA 5GISH 4WDIA 1EH9A 3BVNA 1KXTB 2IVFC 1QPXA 2WO4A 5H4ZA 2KPNA 1WT5C 2H26A 3ML8A 2H3KA 3MCLL 4WU7A 3QEUB 3O6FB 3QO1B 5FOJA 2G4GA 4PCTA 2PW1B 3MOBH 4F3FA 2DLEA 3B5GA 5A6LA 2Y7QB 3FAWA 1KCRL 5GRZA 2VXTL 4GQRA 1NSNH 3L3OA 3T3ME 5DFAA 1QFHA 2L3BA 3GI9L 3STLB 1T4KB 5E94B 1CLVA 2BVTA 4UM9A 3HUJE 2WYTA 2K7QA 2GTZA 3V9FA 5F7FA 4BE5A 1WPCA 3WDHA 4WHYG 1FZKA 3DDFA 2GW5A 3U48A 1BJ1H 3KPRA 1EUTA 3JV0A 3ABMB 3H3PL 3QXWA 2F7OA 2VDOB 3GSWA 3DUUA 3I84A 5DRNA 4G11A 2BRRL 1O6TA 1GCYA 2YGNA 3IFLL 4QTFA 4QJ3B 2VE6B 4B9CA 1MRDL 2EIZA 2XXGA 3O4LA 3QJVB 3BQUC 5AALA 3F3HA 4BZ1L 4N2KA 5FAAA 4TVPD 4LLDB 5FYKH 4AENA 5K9OA 2FYYA 4J12A 3WFBL 2YMXH 3MJ9H 5CZXD 3LNDA 4PRDB 4PY8I 4JFEE 2C7UB 4XOEA 3P2BA 4AQ8A 4MB4A 1GGIH 4IIQB 1AGFA 2UWEB 3DV4A 3MRIA 2WCPA 1KB5L 2KLSA 1PSKL 4HH8A 1OZUA 2NNXA 1D7DA 1E6JH 5K39A 1AD0A 3C6LC 2IAMB 4W9FC 1IV8A 4UM9D 5J11C 5IHZA 3GI9H 4LMQE 1QBML 5DRWA 2EILB 5E8PB 4BE6A 1CDBA 3EH2A 1OTSC 2EYRA 2WTOA 3R8QA 5LCVA 3IF1A 1XR8A 15C8H 4KVPA 1WGVA 2DQUH 3PLYA 1CIUA 1T04A 3MLXL 5FLVA 1ACCA 1YJDC 4UIMB 2H1LM 3NCCB 4OM1H 5BOZG 1HHGA 1CR9H 3MRGB 2NY1B 3K6NA 2D3VA 1OO2A 2BCMA 2VDNB 5H94A 4BWUA 5E9DB 2YSTA 4UQ3A 2DIAA 4QMEA 2SEBB 1J8RA 2QMJA 4LGRB 4RQQB 3HNTL 2DF3A 3CFBB 3EJZD 1D5XA 4LCYB 2HH0H 1GMIA 2O6PA 2IDSA 2YBRB 2B1OA 5LWYL 2AQNA 4BQ8A 3LVEA 3HG1E 4JFQA 3GMRA 5I5MA 4TM9A 3BUYA 3VRIA 1NGPL 1V3MA 3LAFA 4PI2A 3HG4A 4WO4C 3ZE0F 2NMSA 4FRWA 2NZ1A 4HEME 5JQ6H 1N67A 1PNDA 1XWVA 2AJSL 2RCSL 4RA0C 3JV6A 3VH8B 3QWNA 4ADGA 4RGNC 4NIYE 5EZLB 3EGDB 3M7OA 4TNGA 1A64A 3ARTA 2G2RB 3QUZD 5B7MA 5J6HA 5I1EH 5ALCH 1JN6B 2HTLD 5GHWH 1JPEA 5EB9A 4MJ6A 3Q5OA 4M62H 1NC2B 4TLKA 3G6JF 1U8MA 2BP3A 2PNDA 2RFXA 4LKCB 4URTB 5DJAA 8FABA 1WIPA 2EEDA 2XXMB 3B2VH 3FRPB 3JVFC 1XEUA 1HZKA 4NQUA 1H3GA 1LEKB 2GTWA 4QHPA 1JWSB 1GW0A 2PWHA 2ESVB 1ES0A 1WG3A 4NXKA 1N4XH 4HG4K 2VM4A 1MHEB 5DHMC 4UV7H 3Q05A 4Y19E 4IRJC 5B22A 2DQDL 3SDCD 3VXTA 3PV6B 1WH0A 4FQCL 2DTSA 5DZOA 3QQ4A 4MNHA 5CMAB 5JYLA 3ZSSA 4TLSA 4X6DE 1NMCB 4L37B 4WSJA 4MDRA 1B2YA 1D5ZA 5DD1L 3CZLA 1P6FA 2FQEA 4JANA 5CNHA 5HI5D 5EC1A 5HHOA 3NJXA 1B88A 1FIGH 3ZQ9A 3GEWB 4MD0A 5EUOB 1GOGA 2B5IC 3PWVB 3FYIB 4JFDA 5CCKH 3B1UA 4MXVF 5B1JA 1N3NA 3ULUH 3GT6A 1RZKC 4EO5A 2X1WL 3C12A 2R2HB 4Q89A 3GTTA 3ARGD 3IN2A 2WINB 4XAKE 4NZRH 1H8OA 4FDWA 3ARDB 2DKMA 4XPBL 2CQVA 3RKDC 2NY6B 1S46A 3L54A 2EDMA 4S2SA 1CGUA 1I8LA 1UM4L 1NAML 1LYQA 3AU0A 4PRHD 3D08A 3EFDH 4PJ7F 3MUJA 4XN8A 1D9KB 4M4RB 2J8UB 4I18B 4JY6B 2PPEA 3ARRA 4Y5VC 4UWQB 2PW2A 4YL4A 2EEBA 4WRLA 3K2KA 2C9UA 4ZW7A 1ZHNA 4KQ3L 3Q9PA 1QLFA 4NBZB 5IV2B 4PHXA 5HHVH 4IRJA 3VXMB 4ZXBB 2A73B 2H0PA 4HPOL 5F1NA 2QQKL 3MBXH 1Z0MA 1Z9PA 4UDUA 5AW9B 1ZJAA 2QKIB 3QEGL 5E1GA 4NO2B 1B6UA 1BOGA 2YPVH 5JMRA 2KZBA 3PWLA 2XN9A 1OARH 2D7OA 2BVQA 4HZAA 4MD0B 4ENED 2YD7A 3ARED 4G71B 5AZEH 5B39G 3FL7A 5BZWA 5IT2H 4ZUWA 4Z8FH 1LJMA 4GG6B 4KC3B 3GMLA 1HXYB 3HI1B 5TE6L 4J6RL 3BSHA 3GMQB 4H88L 5KAQF 3KH3A 4W4NA 2HVBA 3KBEA 3P4NB 1MIEL 3OKMB 4PGZA 2X3BA 3OKDA 1VCBC 2AS5M 3APMA 4JFZH 4EIZC 3WTXA 3EDEA 4ODTL 3K6FA 5CJ5A 3BKJH 3NSFA 3WIHH 4CMHC 2DZEA 1OALA 5GPRA 1ZT1B 1U8KB 2VDNH 3NJVA 2W1NA 4P5TD 5FO2A 4AQ8C 2E7HA 6TAAA 5I16B 1BLNB 3OG6B 2W07B 1S7RB 5HY9B 5I1IH 1J1PH 2LW3A 4YGVA 3WLWC 4JO1L 1QHPA 5GS1A 2BNQE 5I71B 1DUZA 1QZ1A 2YGVA 1ODUA 1UYWH 2XTJC 3VSQA 3DYOA 1J1OH 4E2OA 4Y4KB 1T4WA 4HJSA 4XNUH 1OSPL 1ZLVK 1I1YB 1BMZA 3ET9F 1BBJA 2Q8AL 2X4RB 2NQDA 2QPSA 2X4UA 3GI8L 4QO1A 1ZWIB 3VA6A 1SJMA 2ZUWA 1IILE 4XODA 3MLRH 2B3IA 2OBGA 3HHRB 2V8MA 5B4MD 2AV7B 5E1AA 3UADA 5EMYA 2YD8A 5HDQL 4QY8B 4LSVL 4L0YA 4G8GE 3U1SH 2Y1YA 4IK7A 5DUJA 3A4DA 3EYSH 3HZYA 5IQLA 4WEBL 2XYCA 1SNRA 2OV0A 1INDL 4PRPD 1S2EA 4Y1AA 3FTGA 3NTCH 5BZXA 1XF4A 1MI5B 5HGDA 2DQIH 5CCJA 4AKOA 4L29B 2EXWD 3GHPA 3OWRA 1CFVH 2LABA 3ALPA 1AS6A 3TL5A 2V3FA 3AAZA 3DO7B 2XU9A 3SCMD 2P80A 1CDYA 1CYXA 3SPIA 2XV2A 4PS4L 4UT6A 3KZ8A 4GBXB 5D7LB 3I9PA 3MOQA 3BRFA 3RY6C 1CPUA 1A7NL 3R7RA 3NIFF 2FD6L 4P3DA 4FTDA 1HTYA 1HU8A 2X9YA 4DZBB 3IETA 5DD1H 4PVBA 5IMMA 5IQ7H 3TEYA 4MAUL 4X9FA 1FZJB 4Z7WE 2QDWA 4FNPA 3V5DA 2OYMA 3GKWL 2WZ6A 3EH1A 3F5WA 4XH2A 2WKLA 3NA9L 2GBVA 3QIUA 4JKPL 1BD2A 4PJCA 4EZLA 4N8PA 4K5NA 1DVZA 2Q8AH 5CKGA 4AXWB 1F00I 4P3CH 5E0FA 3UBXA 4G9DA 2JCWA 3APDA 2XTJB 3BC9A 3FO2B 1W91A 2D31B 2IAMC 3KS0J 1NAMH 1RVFH 4U1LA 3NEEA 3D3VB 4Q9RL 3FT3A 4U6YA 5MEQB 4Y2DD 2K9UA 2ZAHA 3C6LD 4L1HA 3RX5A 4PJIE 3GSWB 1GW6A 3ZTCC 1DQTA 3DETC 4MJJA 4N0YH 1CCZA 5E9AA 2P5EE 3EOTL 5DMIL 4WY7H 3GS7A 2QSCL 2D7TL 5ESAB 6FABL 2P7TA 2W9LA 5J6SA 4P2RD 4FFWD 5IBUB 2O6FA 5SV4A 1NCCH 1P5UB 2V3DA 2VMJA 1W8OA 3EBIA 4M5SA 1IEAB 4QTHB 5D7JA 3UCQA 1JE6A 2WXPA 3B7RL 4GAGH 5L2JA 4MAUH 3CFJB 4RAVB 1NCBL 4KROD 1IJ9A 2BP5M 4LP5A 4YIQA 3IGFA 4ZAKC 5ADPL 4PJXF 1OCRB 1A6PA 2YS4A 2GYSA 1UZ8B 4ZFGL 2YO3A 4GUPA 3V7MA 4JFUA 2X4SB 4P2RB 4NRZB 4EIGB 1PKOA 2JSFA 1ZAGA 1I82A 2PPCA 3G04B 2P7TB 4JO5A 4P2CG 5CUSL 3ES6A 1UKTA 1CR9L 4MD4B 2F7IA 5DK3A 1XMWA 2APWA 1T6VN 1KJ2B 4PRAA 2DIJA 3DIFB 1UHVA 3FCGA 3PQYE 4PJAF 4FS0A 2F8VA 1JNHB 1WZKA 3NIFB 3UBXG 1A2YB 1DLHA 1KYOK 2BS71 3FUKA 5D1ZA 1KG0A 5IUCA 2LLGA 1TQTA 4KXBA 4QRAA 1OE2A 3VFNA 4KVCH 3MOAH 1J18A 5DUMH 2CLRA 2X5PA 4HCFA 3OKNB 4ZZKA 2ZXWB 1JWUB 4NKIH 6PAZA 1MAJA 1EJOL 2CKBA 1CDJA 4J8RA 1MWOA 4IGBC 2WWMC 1H3TA 4LIQE 1SFHA 5C07E 2I07B 1SVBA 4LVOB 3UTPD 1KTRL 1BVKA 4JFQB 5E99L 4HWBL 4LOFA 3UTTE 1WVZA 1CGYA 1V54B 3KNBA 5DJ6B 1KIQB 4R2GD 4BFBD 1I8MA 3QFDB 4WW2B 3L6FB 3S3BB 5SWQA 1MFAH 2A5UA 2GK2A 4RMTA 4ZJ9A 4AMKH 4IKLA 1UXSB 5IHLB 3WXWH 5T8IA 1FRGL 5FGBC 1U8JB 1XX9C 2YIHA 2RAMA 5CEZE 1TVHA 4MA7L 4NQDB 2CUIA 4KDVA 3ZJAA 2IQAA 5I0YA 3QCVH 2WNKA 4NN5B 1MI5D 4L2YA 4OCNC 1M05A 1T89C 5FA4A 3WG7B 3MRCA 3U4BL 1TJMA 2WKGA 3VGAB 3MV7D 2A83A 3CNKA 1S7TA 2WAQA 1JV5A 3HZYB 4JFFD 3PIQB 4PCKA 2C4FT 5D4IA 3CMOL 1LNUA 5T1LB 1DQLH 3WGVB 5TE4L 1FNSL 4WO0A 1H3PH 3FTZA 4JMXA 1BYPA 3K3QA 4R97B 1B0RB 1WFIA 2X6MA 1T6WA 5C0EB 3FONB 4Z7WA 4JO4H 5IW1B 4FKKA 1YEIL 3DBSA 3HR6A 2FX9H 3FH5A 5KAQG 4K5OA 3T71A 4G7VL 4YXHH 2A6DB 4QRRB 2Y07H 1WZMA 2IDQA 3LH8A 2QZQA 4YHOH 4IU3B 4AMKL 4KO5A 4FG6D 1YUKB 4HMCA 5JW4Q 4ZDHA 4AEIL 5FM8A 2IJ0C 3GRGA 5C7ZA 5BUPA 4K2UL 2DQEL 1GGTA 4LVEA 1PMYA 2GIYA 4G8EB 1I1AD 4X7EC 4QYOB 1UGKA 4L4TE 4NNYA 2AK1H 1CF8H 1GGYA 2JCCE 3WXWL 4LLQB 4NKIL 5E4AA 4Z7NE 4EEEA 3HA0A 2VIRA 3NCYS 5CN1A 4CU8A 2NDGA 1MFMA 4MZ2A 4KKBD 3CFEA 1AGEB 3OXRA 4KJQD 4N0FA 4N2MA 2AI0L 2C1PB 2C1OA 3KCPB 1OK8A 3KPRE 1L4IA 4ZUVB 4O02B 4KZDL 3AS2A 1E9OA 4NIKB 1BZ9A 3UYPB 5D1QB 3VYPA 2FBJH 2X6CA 3GKWH 4AYMC 4BEIA 5DJCB 1X5ZA 5EC2A 1QRND 2GUOA 3NK3A 5EU4B 3S5LB 1FC2D 1MFCH 3LN5B 3BO8B 4R6UA 5HPOA 3FH7A 3AW5A 1R5VB 1DEEA 3GPEA 4APQB 3ABKB 1FVEB 2WCGA 3OBAA 3U2IA 2VABA 4UV4H 3SKJH 3FFCE 2R1XB 2IG2L 2CCVA 3QDAA 5TD4A 4NAMA 3WHXB 4OCSL 3IDIA 3FB8A 1DQLL 1WFMA 3RURA 3O6FD 1UFGA 1PZUB 5JORA 3D52A 4DP1X 4P48A 3TEWA 4ODSH 5CLYA 3E2HB 3M17A 5EIVA 3SHSA 4PRHB 3PJSA 1SJHB 4ZPTA 2FJHB 2V2XB 4HKZB 4XPHH 4MQXD 3SJVA 2X2HA 1SRDA 3INUL 1RZIB 2AEWA 4ELMA 3A5VA 1I8KA 4AKQA 5I0ZA 2I9LB 1PGRB 3HEIB 4G3YH 2I60L 1NCBH 3H8NA 3HC0A 3V8CA 3N40P 3SZKC 2ERJB 1AP2A 1YDPA 3OMNB 4GS7B 2WZPA 2FT6A 2QFRA 1TZHA 2H1PH 2DBJA 5F1OB 4QXWA 4YXLL 1R1CA 2ZXBA 1JXFA 5LG1A 2ZCZA 4G72B 3BFQG 3S97C 1EXUB 1V8HA 1WUZA 3P3RA 4MZ3A 2J20A 4UV4L 4P9HH 3N85H 1XH3B 2DAVA 3SDCB 5CEZD 3V5DB 4GT7A 4XCNB 2CO3A 1MLBA 2HKHL 1YQVH 2PP7A 3RFRA 3KCWA 3TH2T 3V6FB 5IROD 5C08E 4AK2A 3PHSA 1OT1A 5IGXH 1BM3L 4ZODA 3B9VA 1PZ2A 4GQ9H 4JFVA 4NENA 4X4YA 4M4PA 3T77A 1DN0B 4IBVA 3C9NB 3DJ9A 1AQHA 4PGCA 3QZWB 1NIFA 4Z76B 4N9OB 1FH5L 1TQUA 4H8WC 4YPGB 3EOBA 1FLTX 5CP7B 1TCRA 4K7PY 4YSAA 1MNUH 3LB6C 1RULL 4N90E 5I0DA 1R5IB 1UM5L 2PO6A 1NLDH 2CGRL 5FWQA 4RVBA 4GG8B 1A66A 3S2CA 2V37A 5ESVB 1QFWI 1C5DB 1V3JA 3U9UB 3A67H 4XB8A 3QDGD 4ZTPH 4FLHA 1RL1A 4ZUTB 1V3KA 5J89A 1KWGA 4QHKI 4XC1L 2N7AA 5HI4C 4O51A 3GSXB 4Y9GA 5KVEH 3B2VL 2BSSB 3WE6B 4ZMXA 3I6GA 1EFXD 3QIBC 3SGDI 4YPJA 2DJ4A 2Y6SD 1I1RA 3ELQA 3VJ6A 1IEBA 4PS3A 5A3ID 3C08L 4Q52A 4POYA 4CADA 1T2QL 3P73A 2P8LA 4LAQH 2NY1D 1ZS8B 3L3KB 1KIPA 1RV6X 3QWRD 1AIZA 4OT1H 2EAEA 4KFMA 4AM0Q 2WUCL 3PCYA 2BNRB 4JRXE 1RHHA 3ATBA 3GKZA 4NN5C 5GGQH 4Y7OC 2VYRE 1S3KH 1KPVB 5GZOD 1W9XA 5IBTH 5KVEE 3D2UA 3C6SA 3U4AA 2ICEB 1O7DC 3WNMA 4E41B 2ZXAA 1DBKH 3MA7B 4Y4HC 2YEVB 4YQXH 1NLDL 2ZUQB 2GITA 3PAUA 1NGPH 5JZ7D 4TUKL 1H0DB 3WS3B 3I75B 4H26B 1S78D 3BUTA 3ETSA 4JGJA 3VD5A 2XDHA 5CWSB 1OPOA 4ODTH 3VWJA 1CMOA 4GKLA 3K72A 2UXTA 4ELDA 5F7LB 2XG5A 3HZMA 5BXFA 2C1OB 3KCPA 3I3BA 4N2GA 3VXSE 4FMKA 4A7GF 1PZDA 1E5UI 1NCOA 3EGSB 2IPTH 1TFPA 4RDQG 1SOQA 3DI2B 4R7LA 5C0CA 5FKPA 5E2VH 4IGBD 2G5BB 3OZLA 3L8QA 1QEWB 3VXNA 1E3XA 4OCLC 5E2UH 1RERA 3TIEA 2VWEC 4HIPA 4OM0L 1IM3D 1OAYH 1DE4B 1EO8L 4UT7H 2VN6A 4Z5RB 2FJGA 2XN9E 5CILH 3WFBH 3GJEB 3SDDA 5TQ0L 2DWDA 1WC7A 4YHIA 4WFEE 1NCNA 3LQZB 1RJZA 5I18L 3NSDA 5AW2B 4GMSL 3QPQD 5FUCC 4NT6A 4CC4A 3VAEA 2VLKE 4QGYA 4UINL 1EJOH 1GGIL 1VEOA 1QBLH 3EGSA 2WP3T 1S7VA 3AQDA 4XMKH 1NM9A 5GGQL 4G3YL 4X98B 1DFBH 3O9WD 5IB3A 3N1QC 3L3DA 4PGJA 2PTVA 1WHOA 2J8UA 4I18A 5DQDL 1ZLDA 2VDLL 4BCXA 5AZUA 1OP3K 1U91A 2OJEB 1RK1A 3H4FA 4U7KA 5HGBA 4OLEA 3QDGA 1U3HA 4HIHA 4RMBA 4MBRA 2DQHL 4RESB 2PTTA 1XAKA 2XTSA 1W6LA 1UZ6F 2UUDH 3FDWA 3RL2B 3EJQA 4IMKC 3PWPE 3TVMC 1ITCA 1E4XI 1AQ8A 1KIUA 3FT2A 4PJCF 3UYRL 4B9JA 4MQSB 1XD0A 5KJRL 5HHQA 3OJDA 2OR7A 1XQ4A 1M2VB 5F9OH 5AAWC 5I1IL 3GB7B 3P4OA 5INDB 3EGXA 2E6QA 4FFYH 1FNFA 2F8OA 4UQ3B 5I26A 2HT2C 4GB9A 1BGXL 5J1AA 1MCRA 3VNYA 4HSAC 3VXTB 1CTOA 4BH8B 4FFYA 5AUMB 5MI0B 3SDAB 4YSEA 2FAUA 2P45B 3NGBB 3GMRB 1PQZA 4ETQA 2R7EB 5C0BD 1MCWM 4E68A 1MN4A 3AWFA 2DH2A 4FQHA 4NC1E 1QX1A 3GS4A 4Q6YA 4R5TA 1J12A 4FZEH 3U46A 5I1LA 3CK0H 3P0VH 4N2DA 4U49A 3B2UC 1CFNB 4NBXB 5PAZA 5ICYA 1U0QA 3NCBB 4IKIA 5FYLE 3L4WA 4WNQA 5DEFB 3ESOA 3VXRA 1DJGA 2PWGA 3SKNA 3S4SB 1QSFD 3SY6A 4ALAL 2BERA 2ZPKH 3RBGA 3UH8A 1SMAA 4H0LC 1U8IB 2VDRH 4CMHB 4XOAA 2AQ3A 2BIHA 3IDYC 3WAKA 5IG7B 3SJVE 2DQCL 1OCZB 2K45A 4XXWA 3VXQA 3R4RA 3WLBA 2J7LA 3FB7A 1X5MA 1RPUA 1JDDA 1JGIA 4M61A 3IXAB 4U4IA 2Q7YA 1J5DA 3VMNA 1S9XA 3AS3A 4Q6IA 3S34H 4K3DH 2OX5B 5LBSH 3V6OC 1YEGH 1ZIBA 2BC4B 4WWKB 3V4VL 1FFOA 2WO3B 5BS0D 2DKUA 3KVDD 7PCYA 3GSNA 3CDFA 4OD1L 1XBDA 3HMWL 1I7ZA 4PJCE 2VKXA 3GEFA 4DKFL 1G6RB 5BNXD 4PM1A 1PQZB 1UWXH 1IM9A 3J8F7 4ZW6A 4YSSA 4MAZA 5IM7A 4JPKL 4PJ7B 2NOYA 4Z3TA 4N87A 3QJZA 3MJGX 3CZUB 4NQEB 1FCCA 3QHTC 4ZFFB 4UU9A 1UB5A 5C07D 2O72A 2PN5A 3QS3A 4X5QA 4JRXB 4P3CL 4ZT1A 1R3KB 2Q20A 3CX5J 1SUJA 4X4XB 4BD4A 5AVRB 1R5WB 3N9GL 1M9WA 3GDCA 3RY5A 5C9JB 5JIHA 5CHNA 4EAEA 1ACYL 4NDMB 4BWTA 2NX5D 1FNHA 2YD0A 2GUOB 5AVZB 3SN6N 3JTBA 1JPST 5D7JD 3RY4A 1CICC 1JAEA 1MG2C 3PJSB 2Q6WB 2UX7A 5IK3A 3WMSA 2LTQB 4QPEA 1HYSC 3TIDB 5DRXA 2GJ6B 2AEQH 3UJJL 1JXGA 3ETTA 1NEZG 5GSVB 4ZX4A 1KCBA 2WCSA 1S8DB 3IJEB 4W9CC 4F5CA 1IQWH 1GL4B 1BD2B 5B38G 1T0PB 1ESOA 1DVQA 3H42H 5SWZA 1NCDH 3LKOA 4M6NL 4IHOB 4Q2ZB 1KGYE 4ZS6C 1IIKA 1SQ2N 4B6ZA 32C2A 3L4XA 2IXQB 4XMWA 2X4NB 4BQCA 2ZQKA 4F37F 5ID0B 4A7QA 2HUHA 4I8DA 5JQHC 5KJ7E 4L8BA 4UIKL 2DM7A 4C54A 1GR7A 1TETH 5I5RA 3MFFA 2XA8L 4MSWB 1LP9F 3Q7JA 3D3VD 3F12B 4H1LH 4UTCA 4U1MB 4K94C 1U8QB 3RUGE 1FGVL 3BEWA 4I87A 4U1GC 5LHDA 2XN2A 5DHVB 2X05A 4PG9A 4B9ZA 1K8IB 5CILL 3CGTA 5DFWH 3UEZA 4PS8A 3BWAA 1N8ZB 3K4ZA 4J2QA 4CDGC 1VZGA 1CD1A 5GZOA 3EF7A 3MR9B 5FHBH 1YN6A 3MRHB 4KRLB 3IN0A 1XFPA 2OS7A 3ELAT 3F7QA 5BVJA 3DMMD 1TDQA 3FQXB 1KB9J 2OMYB 5JHDA 2BY1A 3FRUB 5ADPH 4NUJA 4PD4J 1XGPA 4DO6A 1M3IA 3NCXA 2V7HA 3N1FC 2YD2A 2WBJB 3HS8A 5TQ2L 1N7ML 1D6EA 3ARBD 1GKEA 4XBGB 5EEYA 1FA4A 1EEUA 1D5IH 5GZND 2CKBH 4H2AA 4XPGL 4EN3D 3ZL4H 4BH8A 3WD5H 2IV8A 3LZOA 1U8CB 4XGZA 1FRGH 2OL3L 1C5CH 4HT1L 1Q9KA 2GSGA 4Z7VB 3ZTDC 2FEEL 3C2AL 4HS3A 2OR9L 4S11A 3ZTNH 1OZTG 2N1KA 2NUTB 3HG1D 2NY3B 2ZOTA 3WO4B 4J3TA 3C87A 5IOPA 3L6FA 3SQRA 1CFNA 1NPJA 1QI5A 5ICYB 1IT9L 4ZTOH 3TT3L 1VFBB 2IFGA 4IKNA 1BZ7B 1IQWL 5SX4H 4UTAH 4O51B 4WUKL 5LB1A 3EXJA 2J72A 3CPUA 1EXHA 1C8PA 3UZEC 3GRWA 2VDKB 2RD0A 3SDXE 3OLGA 4GQQA 4KJPD 4GXUM 3H85A 3VFOA 2FIRT 2RMNA 3NSYA 3H56A 1OCWL 2BJML 4K23H 3W11D 1EVUA 1B3IA 5AVSB 3T4AA 5IQ7L 2ZIDA 1VKXB 2ADYA 3P4LA 2FX9L 5KSBA 5B8CC 4PJ8C 3SE8H 2PCYA 5I8OL 1I3RB 3GLAA 4LCCA 2F1BA 1CE6A 3QNXA 2Q2EB 5FO8B 2XNAB 4CILA 1T21A 3I50H 4OB5L 1DR9A 4HIJB 1YEEH 2BDNL 5LGHH 3PAVA 2H6OA 4IMKA 1CFQA 2FJFA 4LLVA 2HN7A 2ZOOA 4O58L 2YK1L 1EBPA 5CR8A 5E4EB 4OTXL 3NJGA 3FRPA 1DN2A 4N2NA 3RUGA 3WIAA 3S96B 1F97A 1IKOP 2ZF8A 5HD8D 3CSYA 1I7TB 2AQ2A 2NR6D 1Q9WB 1BBJB 1GGBL 5IGXL 4QTIH 5LXGL 4XVJH 2EDOA 4OAWB 2P46B 5KTEH 3ECBB 3GGWA 1NCCL 1K2DA 2DLIA 4WF7A 3D48R 3DOHA 1E28B 2BRQA 4JRYE 5F6IB 5A2CA 1SLUA 1A4KA 3DVIA 4KKAD 4EKJA 2MSPA 2R2BA 4FQXA 3R7QA 4E36A 3VSUA 5GRVL 1UD3A 5AAMC 4RX4D 5GJSH 2QHLA 1C1EH 3S37X 4A2LA 3GSXA 4MKMA 5FO8A 1C9SA 5F3BA 4NP4L 1G7QB 4L4VE 3R1GH 3GXTA 4P05A 1EO5A 3VXMD 5BJTA 4AIZA 3UDWC 2YAOA 1HEZB 3HN5A 1OAUL 2EACA 3V10A 5SWZB 1KENL 1CF8L 3SE6A 1IL1A 1GC1L 3CJJA 3K2UH 1HK6A 4RFOL 2HX7A 5E9NA 4DETA 1AC6A 3BKMH 2EECA 5SWSB 4LNVA 1FJ1B 4G80B 4A67A 5DT1H 2E8YA 4X6CA 4J3BA 1DEEB 1Z0NA 2JB5L 4L5FL 4APQA 3OL2A 2XWJB 1XV8A 1NC4D 1S7UB 2CO6A 3TVMA 4ANWA 2B1HL 3NFSL 3QCUH 4HDIB 1BFSA 4HP5A 3B2DC 1CFTB 5AVUB 3E2HC 3DO3A 3GSRB 3PF2A 3PGCA 2X44D 5CD3B 2OQJA 4HUUB 3VFPA 3PDOB 4YSDA 4I1RA 2B59A 3VDAA 2WQWA 2EEXA 3KVPA 4AQAB 4FQ1H 2CK0L 1K8IA 2YPVL 3LKNA 4PGBB 1VGKB 5J1TC 4LAJH 1FO0B 5ANMA 5AYTA 1YN6B 3UTQB 5HHPA 4M03A 3DLQR 3B5HA 1KCLA 3MRLB 2Y23A 4BZ2L 3F00A 1MIML 4MYPA 3QUKB 5FDYA 3VRIB 1PZ3A 4QAMB 3T4AC 2BHUA 1T7ZA 1R0AH 2A6KA 2H0EA 1TYRA 3NQKA 4WKZB 5K59E 5DS1A 2P5EA 5IHUL 2OJZH 1INQA 4KROB 4KAQL 4NKDA 3KPQA 4OFQA 2WHVA 1LO5A 3KEDA 5FYJD 3JV4B 3O6KH 5G4MA 1YN7A 1AR2A 2BSTA 3VGEA 1VENA 4XP4H 4Q6IB 2J5WA 1Q94B 1ORSA 1AIFB 1E4XH 5HHMD 4DGIH 4J3OD 1UZ6E 2COVD 4Y2NA 2HWZL 7FABL 4UTAL 3VXQB 4NZJA 2Y69B 4IBWA 1IM9B 4G5ZH 3T6VA 5MENE 5DZPA 4IKJA 3C9NA 2Y5TA 1AZCA 4GH7B 2FGZA 3BAKA 3ILPA 4ZUUB 2CO2A 3TO4B 3UROR 4Y19A 2BSTB 1LQSR 1QPPA 2CUAA 2OP4H 3V6FA 4PW9A 1I3GL 3NYKA 2ZYRA 1GYCA 3Q8AA 2R1YB 5JUEL 4IS6A 5MENA 4JFPA 4Q7DA 1SBBA 3M7FB 3PHOA 3O6FC 3N9GH 1J8HA 2MEJB 1F3RB 2TSAA 3H9SD 3E3QE 2VLJE 1N4XL 2J8UF 4FYTA 4XNQB 3GBML 3RB5A 2GJJA 3DX6B 2VL5B 3NCJL 2X89D 4R0LC 3IFNH 4L48A 1VFUA 1W0YT 3IVKA 4P5KA 1FFQA 4X6CE 1HHIA 2C3HA 4N8VB 1M57B 2WQAA 4G6MH 3WIFB 3S5YA 4QOKA 2VERN 5F7UA 5IB4B 2AGJL 3FN0H 2B77A 2Q10A 4M1DL 1CE1L 3EDFA 1FH2A 2R7EA 3IEAA 1CL7H 2BNQB 2BJMH 3G9VA 2R0LH 5KSAB 2ALWA 3DHUA 2G5UA 1UOVA 1MW2A 4Z77B 2VR3A 4M8UA 4HJIA 1HQRA 5IQOA 1K5NB 3V0AC 1NLBL 3PL6C 1KYFA 3D05A 1ZJBA 1E4JA 3BXNB 3T4YA 3ZKMD 4Z18A 3QI9D 2OPCA 5EOCL 2MCPH 4I3GA 1FHNA 1T04B 2ZKYA 4F58L 1SXZA 4FYQA 3WLBB 4XP4L 3D30A 5ICUA 1W8NA 5C0RH 4XNYH 3H6AA 2B08A 4DTGH 2ZICA 5HDWA 4ATWA 4HFUH 1LDSA 1X5YA 4G6JH 4PV1C 4ZMPA 3PABB 1EO8H 1SXBA 1DJYA 1WICA 2JLPA 3FO1B 3T0DA 1QI3A 2DI9A 3V2AR 4FQXC 3NH7H 1C08A 5T1DL 1OAXL 5GGRY 1HH9A 2WW8A 2WXLA 1PTZA 2FSEB 3MU3A 4OUUA 4AV0A 3HOGA 3DGDA 4FHJA 2EDJA 1KB9K 4LASL 4O5LH 5HHXL 5ACMA 5BRZE 2D7MA 4I7ZC 2AJUH 1SOKA 2CH8A 1KCVL 4HFWB 5A3IC 3MRPA 4JM4H 3U83A 3QWOA 4LPTA 3VFMA 1K3ZA 1BQUA 1OP5K 2Z91B 4G8EA 3EAKA 2BSEA 3EYOA 4K8RH 1G7PB 4XAWH 1OT4A 1WA1X 1N64L 2I7SA 3BIAX 1QMUA 5J9PA 2O26U 1A9BA 2W5PA 4YX2H 1FP5A 4PG2C 3QI9A 4PBWD 1AE6L 3S48A 3N0AA 1DVUA 1WAAE 4I9XA 5ADOL 4F15B 1FNGB 4EF3A 3UPRA 1L7TL 3U2SA 2P42B 4FTVA 5F7AA 1B9KA 4HALA 3CDGA 1NEUA 4JUSA 5T33L 3QYCA 2NR6C 2ZCHH 4L1BA 3OPUA 4RGMC 1KN4L 1I9EA 1THCA 3ASNB 5DC2A 3NVQA 4LLUA 4HYTB 2CCWA 1TZOA 1XH0A 4G1EB 3HUJF 1N0LA 4Q0XL 3U30C 1XF5A 5C2BL 2X70B 3LIZL 4ALAC 5CSZA 4PGCB 1JJUA 4H0HB 3FJTA 3NA4A 1NOLA 3QWQB 4QRQA 1TZIB 9CGTA 5FM4A 1BX2A 5BVPH 4RNRA 3BD3A 1T20B 2BZDA 4MLSA 5C09D 3T3PE 1QFWL 3EYOB 4GFXA 4JZNA 1WBYB 1E0OB 4JG1H 4M5TA 3FK3A 3O11A 3W0WD 5FOBB 3VXME 2C34A 2WLLA 3DX4A 1IM3A 2WYHA 4URKA 2MCG1 2H2PC 2Z35B 1EZUA 1MPAL 1N59B 5T1LD 5F7HA 4X7TB 3RJOA 3FHAA 4P5RA 3WO3B 2H4EA 3S35H 4FZ8L 3VDCA 2B15A 3A6CH 4ELME 1ZTXH 4RFEB 3MLVL 4G59C 5D5MA 1SDDB 4AW4A 5ID1A 3GSVA 4X9BA 1AFVL 3TA3B 2NT0A 2WQ8A 4OCSH 3F62A 5DVLA 1XGPB 5KVGL 3AWGA 1VRSA 2X09A 2AXGA 5KANG 4HJJH 4PJBF 3K8LA 4P04A 1NFAA 3LPOA 4PTTB 4WW1B 1WEJH 5EUOE 1PD1A 3FTYA 3RTLA 4XPAH 5D55A 2XPGB 1Z7JA 2DEXX 2UZYB 1KPVA 2HRGA 4CSZA 4D3CH 4MA1B 1MREL 3TBVA 4OGAD 4KBPA 5SX5K 2G30A 4MA8L 1GSMA 5DVPA 3K74B 4XPTH 4DP9X 3KWUA 1LP9B 1KUMA 3PDDA 1L9RA 3STLA 4YNYA 5E7BA 5I75C 1L0PA 2A0LD 2R0KH 2Z31A 4I0PB 1DJIA 3FQNB 4TVPL 1MUJB 4IQHA 4KKLD 5EFIA 4PCSA 1E5AA 1ZT1A 4V2CB 1MCIA 4JJHA 1KZYA 3RWEB 5D5MB 4WWID 5ELIA 1FNEA 3QQDA 4GO9A 1X3DA 3U25A 2MPAL 4A2GA 3FT3B 4U6YB 2H3NA 3QUKA 4OD2B 4TNFA 3N91A 3CZKA 1NH6A 1MCNA 3QQ9D 4EDXA 2WLIA 3QCTL 4OU3A 2F1AA 4WW2C 4YVNA 4BDVB 3MBWA 2BSBA 4UM8A 2K9FB 4NFDA 4Z7NF 1OPGH 2FEEI 1YN7B 2ZG3A 1JDCA 3GSUB 4GRWH 4KK6D 2X9ZA 3CFEB 5TDNA 1O9ZA 1AGBA 4I3SH 4Z0XA 1CQKA 3PABA 4R5VA 4KZCA 5IR1A 3CQQA 4YHMH 2EADA 3LXCA 1F4YH 2EICA 4V2BA 3KPMA 3NZ8B 3O0RL 3T2OA 1LD9B 2LGNA 3BISA 3LKOB 3PAZA 2CJUL 5B39A 4C8XA 2HFGL 1VFAA 3WIIH 3RIAF 4K5MA 3R19A 4JDZA 3CFUA 1ZDSA 3OB0K 5B21A 1ZXQA 5IQNA 2WWNA 1T7WA 2ZE0A 3TO4C 4G8GA 3ZTEA 5GSVA 2RA1A 2Y25A 2YEZB 2D0GA 1BIIB 1AXSB 2YHGA 4NAQA 3GSQA 1WGOA 2EC9U 3NTCL 1YECH 1MY5A 3KL0A 3HNSL 4Y1AE 4LVOC 3PHOB 1TXKA 2EDRA 1P1VA 5KVDE 3IGAA 4LLAA 5I0WA 3VD9A 5FGCB 5I8OH 4YLQT 4JRWA 2V2TA 2JTYA 3MJ9L 1VAHA 2Z1PA 3SKMB 3MV9A 4PW4A 4AG4H 1QR1A 3P1VA 2R2BB 4IW4C 2J88L 2YPLE 5CZVL 5F0PB 1RZ7H 4XPHL 5DFTA 3IVKB 3T0ED 4H0IA 4RA3A 3RRQA 1KBWA 2GB2A 4P23A 4HQQH 4P5SA 1IAIM 3IDIB 4ANUA 1V55B 4PB0L 2C9AA 3S8FB 1SGKA 4XAWL 2VC2B 3A6BL 3BIKA 2JK5A 1A7PH 1UA3A 3FXIC 5E2WL 4JM2D 5IB2A 1QW8A 5FCUH 1CTMA 2Z31D 3BGMB 3QJFB 2APBA 1S7QA 2XHNA 2QHRL 3HBPA 3LRMA 4JREB 4NUGL 5BRQA 3S36L 3QO1A 4KHTH 5CINH 3LOWA 4GW5B 2HKFH 2WXHA 1T20A 3CVHL 3VI4E 4D7BA 4RGNE 4UMGA 4EUPB 3LS5H 3SO3C 3P3TA 1MRCH 5KSVB 2FLMA 4N0CD 4FZ8H 4EQ3A 1Q1PA 1T89A 2CLVA 3MLVH 3MNZA 3Q3GA 1MQKH 2R4SL 3GLZA 4P59L 3RI5K 4IEFB 3ZGHA 4QEGA 5JIKA 1G9ML 3OKDB 4WY7L 4YDLC 2K4WA 2Z65C 3O41A 4PRHE 4HLEA 2Z93A 5F8QC 1AGEA 5KVGE 3MCLH 2YPVA 3OPZL 3RX7A 5LQBL 4U31A 2IDCA 4OW6A 5B38A 4NKOA 1JGDB 2QPEB 3PS6A 2X4PB 4B27A 4LNRA 4CNIB 1G7IA 1GY2A 4GO8A 1VPOL 3HMXA 1A3RH 1HHJB 3S88H 1GZHC 3SCMA 2O5ZL 5EU5A 4NM8H 2F08A 5AOKA 2PUQT 3NACL 3BI9X 1J5CA 2QADD 2DQEH 5D2NC 5LN4A 1VZHA 3RY6A 3SPVA 1VF5C 2ARJQ 2CRMA 2H7WA 3E38A 4JFWA 4ZDHB 3WJJC 5AAWA 3TCLA 1J9RA 2QT6A 3QI9C 1G9NL 1PZAA 1U8HB 4JB9H 4PHZA 4MLIA 4CA4A 5IY5B 5DVOA 4WUUD 4W1TA 3CVDA 3VFMB 3VGAC 3ZE1B 2R8SH 1F2QA 2VH5L 1R5IA 4O9HH 1LHZA 1DEDA 4HMDA 3AMKA 1FNLA 1G7MB 4Q74A 3AG3B 3I6KB 3HMXH 5IEHB 3TONA 5DO2C 3T8MA 3BMVA 3QNZB 3RHWF 3VGDA 1CF1A 2X28A 5SWZE 3VXOA 1GIGH 1R3LA 4PGEA 4RZCA 4O58H 1WS8A 3BZEA 3BKCL 4PN6A 5BXFB 2X1OA 3AU1B 1QFPA 3GJFB 1XGZA 1BJ8A 3JZ7A 2IAMA 5E6UB 5LGJB 1ZY9A 1XGTB 2X3AA 4NYLB 4QRPA 1KLGA 2CA3A 1JMZA 5AVYB 5EEUA 3VXMA 1GC1C 1L9SA 2MTAA 2Y7SA 4ZFGH 4GBXD 4JK0D 4N2AA 4QHMA 1FN4B 3V0VB 3T0VA 5J13B 4L4TB 3IDJA 4P8QA 3SY0A 4L05A 3U36B 3QYMA 4WI9A 4I18C 1OIOA 4JFXA 4JFFA 1B0IA 4HA1A 3CHRA 3RI5F 3VWKB 2R69L 3MXVH 2ENJA 1MXDA 4JO3L 1EWHA 3FH8A 3P0GB 2ZUTA 1KYAA 3PRZA 2HJLB 4LL9A 1W15A 2A74B 2JVUA 1BYNA 3SGJC 4LFHG 2GJZA 5JIMA 1SJEA 2OI9C 3L3JA 4KH2A 2V9TA 1PY0A 2XUWA 3LEVL 1G7PA 3NJIA 5F89B 1RZGB 3VWJC 2VN4A 3MLUH 4JO2L 1LD9A 2A83B 4H5SA 3VRLE 2YPKB 2FBRA 2AK4B 2B8OT 5GS2D 1KB5H 4WCYH 2W80C 3Q1SL 2YRZA 1A6UH 1UD6A 4G43A 1WA2X 2XT1B 1P7QD 1Z5HA 3KPSD 2YPLA 3ENEA 2VDML 2YPLD 4JCLA 1HL8A 3TBTA 1M6OA 4HS6B 4QAWA 3ULAB 3LZPA 5BVPL 1KZQA 3IT8D 2IWEA 1BW8A 4UOW0 2ICEC 1MW1A 5GGVY 2VDKH 4GAFB 4RH4A 4QHMB 4PJEE 1UURA 4HULB 3J27A 4AYGA 1RUAH 2CKBL 2FWUA 4A6YB 2NRDA 5IMOB 2GJ6D 4G8AC 2OQJB 3SKMA 3G6JE 1KB5A 1CZ8H 3QZWA 3IU3B 5DQDH 1GPOH 5DVMA 2D03L 1NCWH 4MD5B 4HHAA 2Z7UA 2CK0H 2VN5A 2VXVH 1MCOL 1XCQA 4RLDA 2AVFA 4X0KA 4HKXA 2R56H 2WVUA 4Z7IA 5F6HJ 2VXQL 3LY6A 1LP9A 3ECWA 3WFDH 1XCXA 2E9BA 4Y8AA 4M9PA 4YFLF 1THAA 5DJZB 1AGCA 1IGTB 4PRBB 3QUXB 4X7SH 4HUWA 1RHFA 3MCG1 1NAKL 1WIOA 1KF9B 5IMMB 3DIFA 4J4PC 1MFNA 5E8PA 1OSEA 2DDQH 5DA4A 3SDAC 3NJJA 2J44A 2YBRA 2WVVB 2A74C 1U3HD 2A77L 3IJ8A 4NZFA 4OFYD 4NQSA 3SQBB 1KLUA 4F7TA 3C6LB 3IFOA 3T8XB 3H3KA 1OOAA 2EE9A 3BH8B 1A4KB 2Y1ZA 3WY3A 3UJTL 5AW8B 4YNYB 3L7EB 2X4QB 1WITA 2EH8H 3IXAA 1BFVH 4JFFE 5DSCA 2IOOA 3S7GA 2Z93B 1M1SA 1CGVA 3BWAB 2D3NA 3BQUD 4LHUB 3MLUL 1E6OL 4JO2H 1WZ1H 5BQDA 3U4EA 4D0BA