4F8PA

X-ray structure of psaa from yersinia pestis, in complex with galactose
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
141
structure length
141
Chain Sequence
TFHVDFAPNTGEIFAGKQPGDVTMFTLTMGDTAPHGGWRLIPTGDSKGGYMISADGDYVGLYSYMMSWVGIDNNWYINDDSPKDIKDHLYVKAGTVLKPTTYKFTGRVEEYVFDNKQSTVINSKDVSGEVTVKQGLEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pH 6 antigen
publication title Structural basis for the specific recognition of dual receptors by the homopolymeric pH 6 antigen (Psa) fimbriae of Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Cell adhesion
total genus 21
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3590 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4f8pA00
4F8OA 5LNDA 5LN4A 4F8NA 5LN8A 5LO7A 4F8PA 4F8LA
chains in the Genus database with same CATH superfamily
5CFAA 1A9BB 2V7NA 4FQIL 5ESVA 1HAUA 4QTHA 4BH8A 4QXWA 1F6AB 3MJGX 4PGEA 1AQKL 4OZHF 4Q9RH 4ODUB 1TQWA 4ESKA 4UV4H 4RRPA 5EBLA 3TT1H 5C2BL 2OX5B 3MRPB 2Z35B 2UXTA 2K0RA 4XWGL 2GSIB 4X6CA 1M1XB 1AGCA 1F1DA 2DKMA 5I71B 5KEZA 4F8PA 4H5SA 1ED3B 5FF6B 4X7SL 3VXRD 2BM3A 1J7VR 3PG2A 2VM9A 3BPOB 5F88B 1YVLA 3MRLB 2X4TB 1KPRA 2R39A 4G6AD 4QLRA 3ARUA 3T5WA 2GJRA 4HOZA 5I1JH 2OP4H 3P0VH 1HYSD 3QCTL 2D2OA 1P7QD 4UTBL 1KBGH 1DBBH 1XF3A 5IFAH 1I3RB 3BZEB 3KYAA 1Q0YH 1Z9NA 3OAUH 4MX7A 2A4CA 2OSLB 3PWPE 3NQIA 3S4SA 4Q8BA 2VR6A 3TP4A 5F8RC 3HZYA 4YE4L 5GS0C 1FORH 2CH8A 3V4VL 4NN5B 3LKPB 3F64A 4LSDA 4CSSA 3WTYA 3OXSA 2LVCA 3CDCA 3ARXA 4U1NB 3RZCC 3IDUA 3DOIA 1O7VA 2NQCA 1MI5A 3KDMB 3RPIA 3QZMA 1CL7H 1XB6A 2GTZB 4WHYH 5I9QB 2GK0A 2CHXA 1PSKL 4K7PL 3U30C 4K94L 3QWNA 3BP4B 3S88H 4XNDA 2DWTA 2E74C 1IKFH 1P6WA 1VPOH 2O30A 2YPKA 3NABH 4FFZH 1DCEA 3IDXL 5D7HA 2X2YA 3TVMB 2E6JA 1OAYL 4OJEH 4UTCA 3AWEA 4JFDE 4MDIB 3IWVA 4WU7B 2IC2A 1D6EB 5SWSE 2V9QA 4DH2A 2P7TA 5FR3A 2NUTA 1BOGA 3VRIB 1DO5A 3UTQB 2NOYA 4FXGA 2H32A 2W95A 4N5UA 1ZT1A 4J28A 4PRPE 2XFGB 4I87A 25C8L 4F2ME 1G7HB 3QI9C 3RIAK 2Y7QB 5DMYA 3NIDF 1AKJD 2EDXA 3O6FC 1AH1A 4XBGB 5IF0A 3QXTA 4Y9EA 5JHLA 5EULV 2F8XC 2ZUVA 3O6LL 3MLVH 3SDXB 2BZCA 2ALWA 3OTTA 1UENA 2BWQA 2BNRB 4LMQI 4JKLA 2BSEA 3NPSC 2YD1A 3QDMB 2YEZA 4AQEA 1SHMA 2Z64C 4N1CA 3JSSA 3EJZD 2VLRA 3QYCA 1IQDA 3EH4B 4WHTA 4PLKC 4A6YA 4E41E 4FFVC 1T20B 3EYUL 5D2NC 5INCB 1ETA1 4HHWA 4BFJA 1PIFA 1MDAA 2AK4B 1BX2B 2I27N 2W5PA 1M6OA 2HVBA 1FNEA 2MNWA 1KXVA 3IE9A 4XPTL 5KUKA 3DHMA 1SOKA 2D0HA 2WXIA 4K8RL 4FQCH 1OAUL 4G5ZL 2NXZC 5DSCA 2NCMA 1GCFA 2I9TA 5J1TC 3KBFA 2BNQE 4P4RA 2HVJA 2OI9C 2VDKB 2NY2C 2P24A 3B4NA 3OMIB 4Q58C 2GITB 3VXMA 4ONGH 1EDHA 1WPCA 1OGAA 4E5XB 3DX0A 4S0TD 4WV1A 3PWNA 3FMGL 3GXUB 4OZGE 1VEMA 4OJDH 4KNQA 2R0KL 3MRKB 1F3JB 1MW3A 3OKOB 1CDCA 5H4ZA 3VJ6A 5H37A 4W4OC 4DN3H 4MXWL 5ITFB 2GSGA 1N6QH 2A9BA 1U92B 1MKFA 1SN0A 3VXOA 1S3KH 4I5BB 3DO7B 3L08A 2EQDA 3H54A 2NY3D 4JMNA 4TVPD 3SE3C 1A6VH 1CB4A 2YD9A 3K71B 5IZ7A 4S0HA 2RMNA 1ASQA 1MRCL 1XQ4A 3BDBA 4BDVA 4IIQA 4WFHD 1S9WA 3NUKA 1YEGH 2KYIA 3R0NA 4FYQA 4MTMA 1KXQE 5C07A 1YQ2A 3FHEA 3VXSA 4PY8I 5IHZA 5ADPL 1SEBB 1JK8A 1G4RA 1RHFA 1OM3H 4JFYA 4BHUA 3MI6A 4AYGA 1MAMH 4OFIA 3IMSA 4I77L 4IOFD 3TO4A 35C8L 1OCOB 2BZDA 4TNVF 4YFEA 5I1KL 1LK2B 4X99A 2B59A 5GZNC 3VFPA 4P23C 3VRJA 1UCTA 4BYHA 3BVNB 3OPUA 3EUUA 4AVIA 2V8LA 2CIKA 4HISA 1DVYA 4LBAA 5C0GA 1XF2A 5CUSH 2V2TA 3S3JA 5ECJE 4F7TA 4H20L 3GSNA 3GLAA 4KKBD 3NJNA 4IKIA 5D4JA 3ILQC 3WMQA 3OJDA 4D9RD 2X28A 4QRRD 3EUDA 5DHYB 1TO4A 2B39A 1DL7L 3D85B 5AW6B 3U6XA 1CD1A 1CTOA 3VH8B 3T04D 3R8QA 4D8OA 5JLZA 3T0EA 1QABA 3BW9A 4PS8A 1CGXA 1R24B 5DFWH 2IH8A 4NI6A 3V0DA 3CN2A 1BW8A 1CYXA 2VSKB 2YPLB 3GTTA 3QK0A 4D7BA 3ZHNA 1WZKA 1U4FA 2FJFB 4HZAA 3RKPA 1ZIAA 2A6DA 1D5ZA 1FL5A 4OZHB 3WBDA 2P8MB 4WY7H 3V5HB 2N0KA 1L9PA 2BIMA 1CFVH 1E6OH 2VAJA 9PCYA 4E9VA 3FZUC 3VI3E 2OMUB 5I24A 2VN3A 2FUTA 1HJCA 5IFJB 4UCFA 2J2ZA 1P4IH 3HR5A 5BXFA 1BJ1J 3VD7A 1OOWA 3LNFA 4Q7DA 4BA8A 2QV4A 3P1VA 4D3CH 1DHKA 1A7OL 1C12A 1FAKT 4XVOA 2R69H 4XZ4A 1MCEA 5CJXC 3GSVA 3MNWB 2ITDB 4P2YA 4B95C 1AG6A 1EO7A 1A9BA 2IPTH 3Q2CA 1KJ2B 2NX5E 4NPJA 4CN4A 2BXYA 4YXHH 2BOLA 1YNTF 2BHFA 2PP8A 1KTDA 3MNZB 1F6AA 4NFCA 3G04A 1V7MH 2ZOUA 3NFPB 4XO8A 2EDDA 2WAHA 1KCWA 2W0LA 4TVPH 2OX5A 3MRPA 4PRNB 5KSBA 3CCHB 4HGWB 2GSIA 3RGBA 1M1XA 2D0GA 5DMIL 3B9VA 1ED3A 1QHQA 5FF6A 3JWDH 4YEEA 4M7KL 4ZAKC 4NT6B 4TRPH 2R15A 5F88A 2ZCKH 2R29L 4LSPL 3MRLA 3UBXI 3TV3H 3H2PA 5KVFH 3MLRH 2JELH 5J57B 5CJ5A 1QSEB 3T1WA 4MB3A 1NCWH 1JPFB 2OMZB 4FG2A 1K5NA 4IRJD 4Z8FH 3CFEA 3VW3L 3VSTA 1I3RA 2K9UA 4NGHL 1A47A 3BZEA 5IVZB 4AI7A 1BCIA 2OSLA 3GZPA 2C3XA 1EDQA 1Q1JH 3HTLX 2ORBH 4JS7A 5LQBH 3LKPA 4ZMPA 3OZ9L 5F89B 2FK9A 3T3PF 1DEDA 2VKXA 4DO5A 1F5WA 3UYRH 4PB9H 2ZICA 1X5JA 3KDMA 5DZJA 5D7LA 5JZ7C 1TJHH 4NDMB 4I2XE 3VDBA 3NIDB 1BREA 4ZUSB 4PJ5B 4MZ2A 5D1ZC 2EEBA 4NHUB 4QI3A 4XMXA 4QR7A 3EDEA 4BQCA 3IF1B 1FL6B 5T5FL 4Z7IA 3ZL1A 4UDTA 5ALCH 3Q6GL 4NOFA 5E99L 3OM3B 3IGFA 3PHAA 4OFVA 5AW1B 3WJMB 3Q01A 1QLFA 3ERXA 3TVMA 3KHOA 1XCXA 3VA2C 1QLEL 2F7RA 1M9WA 4MDIA 1W91A 5LB1A 1OL0A 1D6EA 5IJCC 3T8VA 3AW5A 4OU3A 1KIPB 4HEMA 4YGVB 2AJSL 5KSVA 1EXGA 3BRDA 3AUVA 3BUDA 2XN9B 4Z7NE 4Z7VF 4AL8C 2ZD0A 1ORSB 4HXBL 3TBTB 3OB8A 1GGBL 1EZVY 3ATDA 3KLLA 3V0EA 3TBWB 1O9WA 3OHMB 4J3VA 2X4SB 3F6IA 4G6ML 4F9PA 2FQDA 3FFCB 3SDXA 3TA3C 4NLAA 2VXVL 4NQED 3ES6B 2WK2A 3L4CA 3ZW3A 1TYRA 2VXSL 3T6XA 3QDMA 2HMIC 5IHUL 3ZY7A 2WWMC 1LQSR 2YA2A 3AACA 3RY6C 4XNMA 5HDQH 1RZKH 4DQOH 4A2FA 5E9AA 4MQSB 3DVFA 4JPVH 3DURB 4GO9A 1SF3A 2APSA 3Q1SL 1IQWH 1OCWH 4OGZA 4JKWA 5INCA 2N3JA 1XH0A 1FNSH 5DURB 2AK4A 1BX2A 1ETB1 3UDWC 3B3IA 1DVFB 2XPGB 3OHXC 4L8DB 1N5AB 4M5ZL 2D4DA 3MXVH 3EFOB 3FUHA 3B2DC 4JG1L 4DPAX 1OSYA 2J8OA 2VR9A 1AMYA 4IU2B 2Y3AA 5D93C 3VAEA 2WQRA 1G84A 3P4LA 1A0QH 4FFWC 4LSVH 4YC2B 3VE0B 1KPUB 2WO2B 5BO0D 4H1LG 1XBDA 2GITA 4GS7C 4MXVF 2ZXEB 4G8EB 1DSYA 4Y16B 1FLTX 3WEOA 4KJWC 4QTIH 3BD3A 3UBXG 5D7JD 1I1YB 1OARH 3NCYS 5IB2B 3OQRA 1N7ML 3CPUA 3MRKA 1F3JA 1NKRA 4RGNC 3LEYL 2F54E 3OKOA 5I19H 5ISZD 1ZTXE 4QRPB 1UHVA 1ZCRA 3TCLB 5CILL 3TBSB 1EA9C 3TJEH 4B0MM 2F1AA 1S9KC 3CH1B 4H40A 5HI5D 5ITFA 4P4KB 1KCSL 1S7RB 3RTQC 3FL7A 1U92A 1A22B 2VN6A 4AL8L 3HBGA 1Q1PA 3DO7A 4G6FD 4ZQKA 3PQYD 3U0TB 4Y5XB 3O9WA 1GL4B 3K71A 1TMQA 2VMEA 3BJ91 4P5TD 4D0CB 1VACA 2F1EA 3NRFA 3PDDA 4GKOA 3NZ8B 3QDAA 4GW5A 4KK8C 4YDIL 2Y1YA 2VAAB 3CFCL 1PYWB 1SEBA 2Z6FA 1WZ1L 3BZ5A 1CF8L 1SJEA 3RVWD 2CJUH 3I9GH 4HIXH 2ZX6A 5ACLA 1HSBB 3BD4A 4DKFL 3TL5A 4KDTA 1FNAA 1T3FA 2QR0B 4XMLH 5SWZE 1MIMH 2HRGA 5GZOD 1OAZH 1G9NL 4NNXB 2IOOA 1LK2A 2UXFA 4NPKA 4AJYV 1H3XA 1GRWA 1U21A 1MCFA 1T0NB 3NG5A 3QQDB 4QOKB 1CS6A 3IS0X 3NGBC 5IR1B 1FGNL 2JKTM 3BGMB 4TF4A 3Q9PA 4ERSH 4ZOBA 1EAPB 1JGLL 3ARDA 1M7IB 3OLIA 4Z9KB 1DQJA 2B77A 2A74B 4XMKH 1C5CL 4WSJA 2AFNA 4QTFA 4RRPG 3VXRB 2QDWA 4HJGB 3VH8A 5AG8A 1PZSA 4R4BB 1G6VK 5DD0L 1PY0A 2KH2B 6FABL 1R24A 1WBZB 2FEEI 5GGVH 1KGYE 2O6FA 4LLDA 1P7QB 1XGTA 2YPLA 5L4MA 4WDIB 2B1OA 4X6BB 2FE0A 4IEFB 1YNTB 1TDQA 4QXVA 4XP1H 4MMYA 3JWNC 4OZHA 5ANME 2X5PA 5PAZA 5HDBE 2P8MA 4S1RL 3V5HA 1SOQA 2ICEC 1FP5A 3GS4A 1PPIA 4MAUH 4HT1L 4OJCA 1WBYB 2OMUA 1RU9H 5KYYB 3NCCB 5IFJA 2XWJB 5B3SB 1X9QA 3BVTA 1P4LB 4NQDD 1MCIA 3RVXD 3ZKND 4YGAB 1HOEA 5GSRB 5JA9A 3TF4A 2O5ZL 4KXDA 2GBVA 2J6EA 3BMWA 2VDMH 3MNWA 2ITDA 2XACC 3GM8A 3ZR6A 3D39E 4BEIA 5AW9B 3ZTNH 2GJPA 4QHPA 1Z2KA 1IX2A 3V6OC 1J10A 3KMDA 3NFPA 3L3OC 3PNWB 1I8KB 4HUNB 4JFFE 4HUWB 1F2XK 2J4WH 3IFNL 4FFTA 4PRNA 4U1KB 4BHUI 1HQRB 3CCHA 3T3PB 3T4AB 4HGWA 2VJXA 2Y2WA 3LS4H 2DWSA 1PS3A 3MUUA 3LNDA 1WAAF 1BYNA 1HYRC 3ZSTA 2XX1A 3ASOB 3IDYB 3MRIB 4UBDD 2NY4D 3MHZA 1QSEA 4MCYB 4PJ8D 2KBGA 4JNXA 2UZIH 2VB5A 1JPFA 3BP5B 3CLFH 5F71A 1RIVL 1JD7A 1B0RB 4GQZA 3LQMA 1PG7L 4NSKA 2J6WA 1AXTL 3P40A 4X8GA 3SKNB 4HJ1A 2P48B 5A43C 1GGCH 3ECUA 1A7QL 3R19A 1QZNA 2ITFA 5E8DL 5EZPA 4FP8H 4JB9H 4JZJB 5F89A 1CPUA 5IWLA 5H4YA 4XNBA 3ARBC 4U4BA 4A04A 4E9RA 3VGGA 1S9VB 1GY2A 2C9AA 5HVWA 1OQOA 4FNLH 2HA1A 4NDMA 4Z7VB 1DBKH 2BIHA 3DJSA 1ZTXL 3HPLB 4HIEB 5GRVK 2GJZB 3FO1B 4EDWL 2DIJA 2WB1A 3HI6L 4G43B 2F15A 4FLHA 2DQTH 3IF1A 1FL6A 3OR7B 3X1NA 2X0UA 1R34A 3V2AR 4JHWL 1OCCB 2Z8RA 3C08L 2R27A 2D4FA 3P2DA 4MYPA 3WJMA 4FQJL 4I85A 4MNQD 3DXAA 4IKLA 4OCXH 4P2OD 4J7RA 4GAYB 5K93A 3FQWA 4BKSC 5D7SH 3UC0H 2OM5A 3QUZC 3T9WA 4YGVA 1BFVH 1OLZA 2B0SL 4L8CB 3FUFA 2GQHA 4FCHA 3QZNA 4Y2DC 2Y72A 3EH3B 1FLRH 4LP5A 2W0PA 3EGDB 2XN9A 7PCYA 2EH7H 3BPLC 1F4WH 3CVBA 3H9ZA 3JV5A 3O0RL 4KXZH 4OCWL 1G7PA 3GI9H 4A66A 3CXDH 4FABL 1WZLA 2ZF9A 4UYPA 1GYCA 2X4SA 5JQIB 1Q90A 4NM8L 1PQZB 2AEOA 4N87A 5A16B 4C55A 1J5HA 2WIIB 3ES6A 3QG6A 3OKNB 2K1MA 1G9ML 2F5AL 4JLRA 4UT9H 2NY3B 2V37A 2EH8L 4S2SB 1Z9LA 2WWKO 4CVZB 1FH5L 2YMOA 2Z8VC 4MCNA 5MERB 4YDMA 1AXSB 4KY1L 1QHOA 2CG9X 3N0AA 4YE0A 1YY9C 4R0LA 5EBWB 2A7BA 4LXFA 5DD3H 5CGTA 3WCYA 4MQXC 1SVCP 1UWGH 4TKWA 1YMME 1DVFA 1JCKA 4W1TA 2XPGA 3QCUL 1MCDA 4L8DA 1GGIL 2KZWA 3DECA 3I2CL 4JRYD 4TV3A 4Y19D 1N12A 5I2IA 2I60L 2KI6A 2F5BL 3EFOA 3B43A 3GSQA 3LQAC 4XMUA 3CBJB 1BJMA 3IGUA 4OT1L 5IEHA 4IJ3C 4IU2A 3K8LA 2YXMA 1PLGL 5I18H 3O81A 1ZVYA 2HFEB 3TT3L 4FS0A 1CT8B 1KPUA 3II3A 1UZ8A 4G8EA 2EXTA 4Y16A 4I0KA 4M48L 1E4KC 1I1YA 3NJGA 5IB2A 2OMYB 3O6MH 3FONB 2ITCB 3R1GL 4QRRB 1YEJL 2XRAH 4AK1A 3TCLA 4UIKH 5CLWA 3J7HA 4Y9CA 3CH1A 4P4KA 4L2YA 1S7RA 4FFZA 4P9HL 4H13C 4OLUL 5KANI 2P9RA 4J3OC 4JO1H 3U0TA 1ANUA 2B3IA 4Y5XA 2CWRA 1PZDA 3B9KD 4NAMA 1IARB 5CHNB 3CXHK 3T3MF 4AQAA 4D0CA 1E5CA 3O41B 3LZOA 2XCMC 4XVSL 2PWFA 3QC6X 5DJ2A 4PG2A 3GTVA 1F4YL 4NBXB 1UACH 4HJJL 1PYWA 4OD1H 2R4RH 4P5MB 3Q8AA 3UO1H 3LXBA 2QBWA 3S36H 3BP6B 3SQOH 5IB3B 1L3WA 3AT8A 4QHUB 1HSBA 3WFDH 1F8TL 43C9B 3APFA 2CBTA 1QRNE 2ZWZA 5E6RB 4NNXA 15C8L 4RSVA 5CBEB 3FQ1A 1T0NA 1DQLL 3B3BA 3L4ZA 1V3LA 2W07B 5AVXB 4HSQA 5DS1A 3KH4A 4GSRA 2BPBA 1I7ZA 5IR1A 3EYSH 3BGMA 3BWSA 3LQAL 3MBEB 1FA4A 2KMWA 4P8QA 3APNA 5GRYA 1M7IA 3HC4H 5HI3D 1RZGA 3E38A 2XWCA 2Z0UA 4KKLD 1TZGL 2CA3A 1MXGA 3REWB 1EEYB 2CD0A 4LP8A 2K7QA 4WW2C 1CDYA 1FZOB 1AI1L 4NQCB 4HJGA 3VXRA 4OF6A 4FRWA 2WZ6A 3RGVD 2IPKB 4QNPF 1PVHA 3DGDA 1DUZB 1QPPA 1WBZA 3O2DH 1MPAH 3BT0A 1M7DB 4KK5C 4KV5E 4IRJB 4WDIA 43CAB 4X6BA 4IEFA 4J6RL 1YNTA 4TSCL 5C0BA 3OKDB 2PCPB 1I82A 5B8CB 4RAUB 3NK3A 3HC3L 1IBGH 4MNGA 1I7RB 5DZOA 1SM3L 1WBYA 2HFGH 5KYYA 3RWCB 5B1CA 2XWJA 4JM4L 4KMLB 3K1KC 4CBPA 4TQHA 4PRHA 2X12A 3LKQB 3WMPA 1P4LA 1M7UA 3DOSA 4EEEA 3QZOA 1KN4H 2K70A 1DQML 3L3IA 3B1TA 4AG4L 4HG4K 1YLBB 1BMZA 3DX1A 3MRCA 2BRQA 3DUUB 1IC4L 2ENPA 4ZMTA 1KIUA 1TLKA 1B2WL 4CVWA 4HOWA 5AVTB 1CVRA 4HULB 3U4BL 5CFHA 3PNWA 1I8KA 4R2GC 2E4TA 3QXUA 2QGEA 4X8CA 4CGUB 1HQRA 3T4AA 4URTB 3U0WL 4XH2B 3N42F 1NCAL 3F6LA 1Z7JA 3UBHA 1OANA 3S3SA 4J27A 3ZUNC 4FQIH 4U3XA 2FNWA 1SY6L 1WFTA 3DBSA 4JAMB 2FECL 1MJ8L 4HMDA 1MFDL 3BUIA 5KANG 3AS2A 4MCYA 4UI2A 1AKJA 3BP5A 3FU3A 5C2BH 1SMAA 3ARFD 1B0RA 1CXFA 2E59A 2WXMA 3MRHB 5BMFH 1ZAGA 1I53A 1AO7D 4PD4K 3HMXH 1X5FA 4NQEB 4U6YB 4KHTL 4X7SH 5CCHE 2A9MH 2W9EL 5I0YA 1HX0A 3FN0L 3MLXL 4JZJA 3FPXA 3TCTA 1NCCL 1U30A 2FATL 3QPXL 2XZQL 4L8SC 3IDIA 2Y7NA 3QCTH 4OQTL 3EJJX 1ZHBB 4UQ9A 5J12B 3QULB 1LEGB 3FRUB 4Z7VA 4BCYA 1B88A 2NUPA 3DMMD 4HIEA 2M26A 3WFBL 4NIYE 5GJSL 4PJ7A 2EE3A 2GJZA 3FO1A 4PIBA 4PW9A 4G43A 3FQRB 3OR7A 3BH9B 5HYSB 5JIMA 1A9EB 2P3YA 4PMFA 1H8SA 3L5XH 4I9WD 4M6NL 3Q05A 2A6JB 2BW5A 4L9DA 3VXQB 2P28B 1JFHA 3ZQWA 3B2UC 3OLEA 3L4XA 2QQNL 4GAYA 4NC2B 4DP2X 3QJSB 1PSKH 4NO3A 4K7PH 1BZEA 3Q2WA 4K94H 4YLQT 3ZYOA 4L8CA 3IJSB 2WQAA 3IS1X 5D7JB 2XPZA 1A4BA 3VXUB 1O7DE 2R69A 4GXVL 1QMUA 1JDAA 5ISZB 4Q9QL 4YX2H 1OAYH 4D8PB 4L18A 1JJUA 2FUQA 1BGXH 2KPNA 5F70A 1MFNA 3CZGA 2DL2A 3SDCD 2BMKB 4YSPA 5A16A 1O0VA 2WIIA 1U2HA 3OKNA 3KWXA 4G6FB 4JG5A 1I8AA 5FGRA 5C97A 5F6IB 3PQYB 4K9EL 2NY1C 4S2SA 4CVZA 1NBYA 5J6GB 5MERA 4P5TB 2IPUK 1QBML 1AXSA 4HF5L 5D55A 2EINB 4OBSA 2R56L 5IVOA 1T7ZA 5EBWA 3B2PA 3V9FA 5EUKB 4DKDC 1LDSA 3O6LH 3MRRA 3LRHA 4A7SA 3RJQB 4PMEA 4S1DD 3S8WA 3IMWA 3QJOA 3V4LA 3SGDI 5BPPA 2X38A 5AKSA 2XPYA 4QRAA 4XPFL 1RK0A 3RX9A 1I75A 2YUZA 5BV7B 4KXAA 4W68A 2G3XA 3O3DB 1RUAL 3EYUH 3KNBA 4FHBD 3LXCA 2OR9L 1GXEA 2HFEA 4JX0A 5G4MA 3T3MB 1CT8A 1E6JH 3L9YA 4FF9A 2X7LB 2VR3A 5E4EC 2Z31D 5CEYB 3MFGB 4XPTH 5FOBA 2WP3O 4LQ1A 3NTCH 3QQ9D 3BZ4A 2IQ9L 4K8RH 1ZHLB 3GBML 2WBXA 2ITCA 4G5ZH 4QRRA 4JFDD 4AX3A 1SXNA 4XOAA 3PUUA 3CQPA 3K4ZA 4AGOA 2Y1VA 3QJFB 1UOKA 4HC1L 4FLRA 3VFTB 3RDTC 1WIPA 4V2BA 3DVNB 5JIIA 4PRPD 1M2OA 3GQFA 4NQXB 4PRDB 5K39B 1W72B 1MLCB 3RWJB 1JUFA 3VH8G 3CN1A 3X14B 2J88L 4CMHC 1ZVHA 5T1DL 1EJ8A 4Y4KD 3O41A 1C8PA 2OS7A 4X5WA 4XO4A 1RJLB 2C9QA 4P5MA 3ZT6A 4DO4A 2N0MA 1OSEA 4PIRF 4J4PD 3BP6A 5IB3A 4QHUA 4NQDB 2DM4A 5E6ID 1PG7W 5I5JA 1DBML 1EANA 2OCFD 4HUCA 3UCQA 43C9A 4A63A 2Y7MA 4DK6A 1IFRA 1MRCH 4N3UA 3M1CA 2FQGA 2YJLA 1A2YA 1Z5HA 2VLLB 4RRPM 1A6AB 4MD0B 3V0VB 4XVUD 1HJBC 3KL0A 1O5DT 5CBEA 3QJHB 3GMQB 3MJWA 1NPJA 5CCJA 1FFQA 4PWEA 2UUDK 4UQ3B 5IMLB 5E2UL 2VXQL 2E47A 1U3HA 3AREC 4DERA 2K4AA 4ENEC 1ZRUA 4BFEA 4I77H 3TYGH 2AABH 5DT1L 4XE0A 35C8H 3REWA 1EEYA 1TPXC 2BNQD 4FQ2L 5I1KH 4YVNA 4K4KA 1WT5A 3M46A 5F7NC 1FZOA 4POZD 4AXWB 4ADIA 1R19A 5HJBA 3IDMB 4FG6C 1XAKA 1DUZA 2L7QA 2NY4B 2PO6D 4AIZB 5LGHL 4PJ8B 1M7DA 5CSZB 4H20H 5F9WC 4IRJA 2AQ1A 4S1QL 3OZKA 4P2RE 1HEJC 4XPHL 3OKDA 1ACZA 3RGHA 2FEDC 2RB8A 4JHBA 4DTGL 1S5IL 1QFWL 3KHQA 1I7RA 3QUKB 3MBWB 1IC0A 2CO1A 3QZLA 4Z7UF 2QGDA 2DQHL 5ABZA 1VF5C 3N42B 4F20A 2IXQB 4LASH 1WAAA 5MHSE 3LKQA 4TNFA 4I1PA 3C8DA 4YXLL 2H2SD 3GS7A 2AAVA 1FI8C 3ETSA 5ALBH 4JGJA 2A9CA 5C09E 4NFDA 4UINL 4BFFA 4YK4C 4N5ED 2D7QA 5AVSB 1IBFA 2IFGA 1BBDL 3KLQA 2J73A 4XCEB 5KBMA 2HSIA 2NNAB 1TJXA 4XPGL 4E9YA 4G6KH 4MNQB 1QUPA 4P2OB 5D71H 5DD5L 4QYOA 5DJ0B 4G8AC 4XH2A 4YAQB 3WO4C 3FU7B 2V17L 1Z5YD 3F2LA 2AQRA 4NRZB 3KWTA 1CGSL 3KVPA 4GRLD 4HKJB 2G3ZA 3CHSA 4JAMA 4PBWD 1TETL 4AENA 4B9GA 1IKNC 1JNLL 2O6EA 5FYJL 1IM9D 3GT6A 5DJ6B 3MRHA 4U49A 4PPTA 2F8OA 1RK1B 3C2AL 4NQEA 3H6JA 1X7QB 3QORD 4GQRA 4TUOB 5E1AB 2Z93B 3V5DA 2NY0C 4I13B 4MAZA 4M7KH 3QNYB 4MXQD 4A7GF 3NSYA 3FB8A 3OF6D 4KRPD 1W15A 2ZJSL 4FL4C 1W0WB 2ATPB 2MPAL 1L6PA 2WBKA 4N2MA 2Y5EA 4JQIA 1ZHBA 1SBSL 3QULA 3VW3H 3I6LD 5FCUL 3FRUA 3TF7C 3LNEA 3PJSB 4NGHH 4Z3TA 5FKAB 2APFA 1ADWA 4ELKB 4U3CA 5MEOA 1NDMB 4F37K 4XAWL 1HS6A 4K0OA 1SEQL 3FQRA 1N67A 2GJJA 4JRYB 3BH9A 4UB0L 4Y19B 1OTSC 3ARGD 2W65B 5FYKD 5HYSA 3HR6A 2C1PB 1IJ9A 1JG9A 1YYML 5B4MC 4PW3A 1NGQL 2A6JA 5I73B 5TD4A 3VXQA 2OXHB 1L9MA 4EE2A 2R8SH 1RJZB 1KOAA 4M4PA 4I88A 4KK6C 1OK0A 1D5XA 3HRPA 2NX5D 4NO0B 3GMMB 3IJSA 2D9CA 1X6LA 5T5FH 4HH9B 5D7JA 2EZ0C 5DWUH 2WTRB 3JWOC 4LARH 4LMQE 1K8DA 1LGVA 4JDZB 4N0FB 5C0BD 3QIBC 1WLHA 5ISZA 1JI2A 2WXRA 4D8PA 4QHMA 1H15B 3HAEH 2YD3A 4GKSB 1A1OB 4M7LH 4MB1A 4WHYG 4H44C 4QGYA 2BMKA 2N4IA 4GI8A 5EHFA 3WNNA 5M95B 3A0OA 5EH1A 2YN5A 2B5IB 2VXTH 5KBDA 1OP5H 3B9KB 5DXWA 5FFGA 2VDLB 2XXFA 3BDYL 2CRIA 2VWEC 4P5TA 2WLLB 3E7JA 4NUGH 3SE8L 2VLJA 3SE6A 3QFJA 3W0WA 4XPBL 5EUKA 4H8WC 4IMKA 3I6SA 1F86A 1SN2A 2YXFA 2XTSA 4GG6E 2VRAA 2Q7NA 1LQBC 1FG2B 4KPHL 3W5MA 1A9VA 3AB0B 3W57A 2VXSH 3GXFA 3UTPD 4YVUA 1VKXB 1T6BX 1SJMA 5HJGA 2AEPL 3PL6A 4G8IB 1FSKC 3KXFB 1WC7B 5GZOA 2GTQA 3FO9A 1J05B 3LIZA 1KZQA 3OMZA 3B9EA 1IC7L 1PU0A 1JZ6A 2MQGA 5JQ6L 1DDTA 2BJML 1OE1A 2PP9A 2ZUSA 1LEIB 2WZPD 2EE2A 3NSFA 1TZIA 1MREH 4OUUB 2X7LA 5CEYA 1ID5I 1CXEA 2VUOA 4M5ZH 2WKOF 4OD2B 5D2NE 2OL3B 1ZHLA 4FKEA 4ZD3H 1TFHA 1EX0A 2APBA 4OI9A 4S10A 4JG1H 3QWRD 4LU5L 5J4MA 4OIIL 4JFVA 1DVXA 2X4PA 4AE0A 4FKHA 5C08E 2DWEA 2YD4A 3RGVB 3QAZB 1EEQA 3QJFA 2CUAA 2PYEE 1UG9A 3JWOL 3VFTA 3CDYA 4F2FA 4HEPA 4UNUA 3DVNA 4PRDA 4NQXA 5K39A 5LLIC 1W72A 5BCAA 3RWJA 4L0YA 1KNOB 2EUXA 2CUMA 1SXZA 3QIUD 3D0AA 3X14A 3TESA 3LEYH 3WKPA 4QPEA 4TNGA 2R1YB 5FYKU 1GGTA 1VEPA 2QKIA 5J1AA 3S2CA 1KCSH 3MZGB 3CPLB 1YDPB 4HGKC 1JZFA 2D9QB 1RJLA 2CDFB 4YDZA 3X1FA 3QPQD 1KEML 2YZ1A 4LVNC 5DZPA 2XWRA 4Y9FA 5DF0A 1GCYA 1X5XA 1UH4A 4MWFB 3FJTA 1BFOB 3ZE0E 2BIQA 4H8WL 1IJNA 4KRMB 5CJOH 5HJ3B 2H5UA 3AJ7A 3GSUB 2VLLA 2DIEA 1U0QA 3OG4B 1A6AA 3F7VB 4MD0A 4UT9A 3V0VA 4HOXA 5L0QC 2AQ3A 1ECYA 3NJHA 3QJHA 3TFKD 1UJTA 3SN6N 4MB5A 1CLOH 1WZ1H 3SBWC 4UQ3A 5IMLA 1S7VB 1ZDSA 3SDYH 3Q48A 4BCZA 2OCJA 3O4LE 5D6DA 4WFGD 4DKFH 2XWTB 4Z7UB 3CXHJ 3VFVA 1IU1A 2Y69B 2AJXH 1G9NH 3BSHA 4B50A 1KJMA 1MFBL 1M71B 4AXWA 5MEPB 4ANXA 1R0AL 1J9CT 5SX5K 3FB5B 3NJKA 2I07A 3IDMA 3FHQA 1PZUB 2X87A 1CDUA 1IEHA 2D7PA 1FGNH 4AIZA 4PJ8A 5CSZA 4GB9A 3ZTDC 3RIFK 4UYQA 3WTWA 4OZIA 2PPAA 3ARFB 1BFTA 2F54D 1OEZW 3PE9A 3F8UB 1AO7B 1N0LB 2RQ8A 4LAQL 4O58L 3WS6C 1UZ6E 1MRDL 1C5CH 1OGTB 4HCIA 3HC0B 5TK4A 3QUKA 3MBWA 1MHHA 1T7YA 4C56E 4F8NA 2BVOB 6FABH 4MD5A 1FPTL 3JVGA 5IGXL 2HTKD 1X5GA 2XZAL 3B8SA 4OJFH 4OV6F 5D1QB 1VEOA 2WBJC 5C3TA 1B2YA 1OCRB 2JVUA 4O2FB 1M53A 3C5JB 3DX8B 4WTWA 4CN1A 1UD3A 3DMMB 5IHHA 5CZKA 4S1RH 4BJLA 4FQ1L 2V0AA 4WTQA 3X17A 2FSEA 2BCKB 1COBA 1SVBA 1A6TB 4XCEA 4NZRH 3CVCA 2NNAA 3GIZH 4DP8X 1NWOA 3BWAB 3CVIL 3AABA 5FW7A 3NA9H 3ILPB 5E51A 2YRLA 5SWZD 1TZAA 1NDGB 2O5ZH 2RIKA 4MNQA 4P2OA 3MACH 4JQVA 4YAQA 3FU7A 3LCYA 4BK5A 2D7TL 3WTXA 2FHFA 5ACZB 1HN1A 4NRZA 1JIBA 2VSDA 1IGTB 2J1XA 2DLTA 4R7LA 3RNQA 4CGTA 3QYMA 5LWYL 4C83B 4G59C 4IBVA 5GS3A 4Y4HD 4XBPB 4AIXA 3K8KA 3VI3F 4MNHB 4IBYA 4PBXA 5DJ6A 1BZ8A 5EU4B 3SDCB 1AYRA 2HH0L 2VZOA 1WAPA 1RK1A 1ZSHA 4DQAA 4MVBD 1KENL 2DQFB 2JCWA 4HG4J 2ILLA 4FQXD 4P59L 2Z93A 4TUOA 5HHNB 4Z78B 3QNYA 3MODL 5T3XE 1MAKA 2ATPA 3BZFB 3KGUA 4LPXA 4AZ8A 4OGAD 1PJ9A 5I6OA 2RFXB 4ODTH 4HIJB 2LW3A 1A7BA 1Z66A 2W9DH 4JO4H 5I5RA 3I74A 3EO9L 4PJIE 3C5ZD 1RIVH 4LVOB 3NCMA 3PJSA 3SKMA 1AXTH 3T8XB 5FKAA 1E50A 4Y1AE 4ELKA 4I8DA 1NDMA 2IAMC 3IKKA 2XWZA 3O2DA 3WELA 2AHIA 4OVVA 2D0FA 3FU8A 5E8DH 2Q8AL 4Y19A 4JRYA 2W65A 1NEUA 4LL9A 2C1PA 3U1QA 5AWNH 3V0GA 1S4IA 4CKVX 4MHHG 3RNKB 2AJUL 5BS0D 1WCQA 5CU9A 1RZIB 1RJZA 2QVKA 1ZTXH 3FTYA 4PD4J 1MW2A 1AOHA 4ZDHB 1N70A 3H3PH 1EO5A 3F7RA 3P30H 2XY1A 3B2VL 2Z31B 2HT2D 3ILDA 4WTZA 3HI6H 1DEEA 1KBPA 4HS6B 3UG5A 4FADA 4BV1A 2HFFB 4JHWH 4MSWB 4AYBA 3C08H 2FTAA 4JDZA 4KX8A 3D9AL 4JFDB 1XF5B 5JHDE 2OULB 5JHMA 1E9OB 3V6FB 1OZUA 3SYAA 3QARA 4GKSA 1A1OA 1UUNA 1JBJA 3HS0C 3ZT7A 4PRPB 3G6JF 2Z1KA 2GJ6D 1R17A 2XTJD 1S46A 1JDDA 4F2MB 3VG9B 2RTTA 2V33A 5IM7B 3DX7A 4RWYL 3R7RA 4OCWH 3B9KA 2ZYIA 3K6NA 2WLLA 4M4RB 3S7GA 4YJZL 1ZHKB 4Y4KB 1QFUH 4XX1G 5FYLE 1IC5L 3STZB 4NIKB 2ZP9A 5DFVC 2WXLA 2ARJQ 1XCQB 4KTDL 4F7KA 5FO8B 2YAMA 5C1MB 1L0XA 2HPOA 1UZGA 4IKNA 1G9MH 3FQ4A 3BLPX 2DLGA 4N0UB 4G8IA 4RMBA 1FH5H 5CR8A 1P6AB 2E7HA 4DPRA 5IW6B 4KY1H 1I85A 2PCFB 3HMXA 1F18A 3ESPA 1XZWA 2F9BT 1J05A 3MVSA 3KGRA 4RA3A 4BD4A 5AD0B 1OT2A 2V2XA 4ZXBB 3RLSA 3LD8B 2ADFL 3H56A 5F6HJ 1MJUH 4AJVA 4X80L 4Z3HA 3TN0D 1PLCA 4OUUA 3RJOA 4E9SA 2K3HA 1E28B 1W9XA 1FUNA 1TYEB 3I2CH 2WBWB 4K9JA 4DP7X 4OD2A 3GKWL 2OL3A 4GQPH 2JB6B 4NNYB 4HS8H 2LU4A 4FTVE 4AKQA 1XTMA 1BM3L 2BNQB 4U1SA 5FFLA 3DOHA 2B4CC 5AZEL 4KVCH 2G2RA 4JBSA 1IM3D 1PLGH 3CZUB 3NN8B 5F7HA 3TT3H 2V7HA 2Y0SA 2W80C 2PO6B 4IDJL 2YSSA 4A7QA 4BRVA 4M48H 1ZE3H 2OJZL 1AHMA 3MV7D 3SCMD 5FO9A 5F1NB 3R1GH 3SGEH 5DLMH 3V0HA 4B6ZA 2R1YA 1A66A 1HVXA 4EI5D 5F8QC 1DSFL 1FDLL 1OAQL 1K4DA 5IVXE 1BVNP 3F65A 2IH1B 2IJ0C 2LV4A 2XFXA 3DTDA 2CDFA 2DPKA 3QR1A 4I4WA 1FN4A 4IBUA 3OAZH 5DO2D 2IBZX 1AGFB 2OYMA 2P5WE 3GIVA 1ECZA 1IUZA 4P49A 4GMTH 2VL4A 1A8JH 1JTTA 4KZCA 1BFOA 1XAUA 4MWFA 5KVMC 2MTAA 1HKLL 1OB0A 4LT7A 1ZLVK 2EDYA 5HJ3A 3QS3A 2LU5A 1G9HA 4A7TA 3GSUA 1FFTB 2ZIDA 3F7VA 4ZS7L 3V6BR 3QHZL 4Y5VC 5CIPB 1YMMD 3D52A 4PJBF 5AAWC 3UJIH 4JGMA 3ZPDA 5T3XL 5F93C 4HS3A 4NM4L 1F8TH 5EOTB 2OFQA 1DVSA 3OXRB 5HGGS 4W9JC 2AQPA 1G7IB 2I9LB 4PV8B 4WFEE 1ZLUH 1OGAE 5DC9B 4R6UA 2Y23A 2EICA 3KWWB 3W9EB 5HYQA 4LLMB 3D06A 1M71A 1K8IB 1DQLH 2X4QB 3SOTA 2NNCA 1JE6A 3ET9F 4UQEA 4RX4D 4PM1A 1TNMA 2JSFA 1IM9B 4HIQA 3ARFA 2EJ1A 1B6UA 4CJ1A 1UCBL 1ZK9A 1AO7A 1N0LA 2IGFH 3TURA 3AZUA 4FOMA 3QORB 4S11A 1OGTA 1AI1H 2GIYA 3HC0A 4KRPB 2BVOA 2OLDA 2DYRB 3BEWB 4FHKA 5ADOH 3BZDA 5CZXC 1E67A 5ESAB 3FT9A 2DLHA 3VXSE 3SSGA 2NMSA 4TSCH 4O2FA 4JFHE 3C5JA 1HNGA 4KTEL 1JXKA 4CJ0A 2Y07L 3DMMA 3C87A 3HC3H 3VI3B 1MEXL 2DQDL 2X3CA 1CZ8L 2OW6A 3AG4B 4U1LA 5HJDA 3CVDA 3LPFA 2BCKA 3HEIB 3ARGB 4F58H 2R51A 4JM4H 1A6TA 3UBFA 3JWNE 2PPFA 1BHGA 3S96B 3VXTB 3ULVL 4A7GA 3BWAA 4GUQA 5C8JB 5HYSG 1DQMH 2E7LC 4CKQA 2GKIA 1FNFA 2NX5B 3M6DA 4LSQL 3T2NH 4V33A 4EXPX 2X89D 5ACZA 3VA6A 3UBGA 1PGRB 1IGTA 1S8DA 1MXDA 1Z3GL 4YL9A 3TBCA 4DGUA 5C0BB 4C83A 3TH2T 1BQUA 4NN7C 1LK3L 4KNTA 1VJSA 4W93A 4XBPA 4K71C 4MA8L 2X9WA 2UY6B 5GS1B 3TFBA 1TTRA 5EU4A 1NCIA 3U0WH 3SDAD 4IBZA 4PB0H 3TJHC 3VFWB 4R5XA 4YSDA 3M86A 3MRBA 4Z78A 5HHNA 4PCKA 1DQQA 3AY2A 5G4NA 3SE4A 4TUUA 2XQBH 4HK0A 2P80D 1RD6A 1MFDH 2W1NA 1JHLL 3SKJL 5B38B 4NXSA 2RCSH 1OM9A 4PRAB 6PAZA 2VZ3A 3EYOB 4KKQA 1VDGA 1DZ0A 4ETYA 3T8XA 3PWPA 4Q89A 4Z3EA 1MCQA 3F62A 4NAJA 5EIIB 32C2B 1G0YR 3ZQ9A 4TM9A 2P5PA 2Y2YA 3T8MA 4WUKH 4Q14A 4QDGA 1R3KB 3MLXH 4ABUA 3M8OL 4B9PA 1NCCH 2FATH 1BP3B 1CXKA 1AP2B 2R2CA 1D7DA 3L3KA 5KWYC 5AYUH 2JF1A 3G6JB 2BK8A 3RNKA 5C6TH 3SO3B 5JHLL 4IIQC 3UX9B 3H53A 4HUXB 2EXYD 3ZSSA 2CXGA 1RZIA 1IBZA 5CD5C 3WFBH 3L3DB 4NAQA 5GJSH 2A73B 4ZDHA 2Z31A 2ZXBA 3HI5H 4HS6A 3LRMA 5AKVA 3W2DH 2HFFA 1VFBB 5J56B 2VQ1B 5EEZA 1WYJA 4A6YL 3MLPA 4LGPB 4A68A 2V8MA 3CG8A 3M7FB 3IBOA 1GA2A 4JFDA 1XF5A 1ZS8B 4M6NH 3TO4C 3U4EB 2AJYL 1E9OA 2WO3B 4WI8A 3V6FA 4ALAC 5SWSA 2QQNH 3ABZA 4AVHA 3EKCA 4H8UA 2LAAA 2HT3C 3EO0B 3KPOB 2FVNA 4PRPA 5KAQF 3WN6A 4TOYL 5HVFB 3IJEB 2J5WA 2YEVB 5DEGA 4F2MA 3RFRA 3OKKA 2WGNB 3QIUB 1YJDL 4UT7L 5DA4A 4FQPA 1CLYL 4HEPG 4Q9QH 4L3ED 1RUQL 4M4RA 5J3HC 2CGRL 1ZHKA 4Y4KA 2FEEL 3STZA 3VX1A 5AW4B 4PVBA 1NCHA 1MCWM 1U6AL 4K55A 4QRQA 2WKOA 1XCQA 1EH9A 4ZZKA 3T0EC 4NHCL 4PTUA 1U8KA 2P5EE 5J5EA 4J4PA 1AC6A 5E6IA 1OIOA 1U58B 4JN1L 4XNXH 1MELA 3RE0A 2ZWLT 3TH4T 5IW6A 4EZJA 2PCFA 3GSOB 1MCPH 1FH2A 1T0PB 5AD0A 2D31B 4U0RB 3C60D 3UPAA 2BWIA 2DL9A 2D03H 3DYOA 3G5XB 3FKUS 1H3PL 4NJAL 1E28A 5D7KE 1AACA 3PHQB 5EOQL 4NNYA 4HEME 3A4AA 1EHKB 4XPFH 3H7BB 3HZ3A 4XR8C 2BNQA 4KQ3L 4N0YH 1L6ZA 3FDWA 3ZK0A 4OI7A 1RUAH 2ZG2A 3FT4B 4NLHA 4DGWC 2NT0A 3NN8A 5HVGB 2WLIB 1QLRB 2NYYC 2JTDA 2PO6A 1CE6A 2YD5A 5EWIL 2HTLC 4HPOH 1BYPA 4KU1A 1YNLL 4LSUL 2IQ9H 1U33A 3GBMH 1GGUA 3EBAA 4M8QB 3ZHLA 4PJBB 2IGLA 3T08A 5JDJA 3QHFL 2BNRE 4Z7OF 2NTSP 4Y9GA 3QDME 4JCWA 5T5FA 3PNRB 1THCA 4HH8A 1JGVL 1USZA 1CDJA 2A6IB 2IH1A 2XWEA 3AT0A 3TPUB 1ILSA 3BPOC 2VQTA 5E2TL 5GGSB 3GSNL 1PG7X 5I6PA 1AGFA 3P3SA 5C0JB 1PKOA 2FX9L 1SDDB 4BWUA 2WNKA 1IGJB 5J11B 3U7YH 1CFBA 4FXLA 5FHAH 2E9GA 2XBDA 4LSTH 1LE5A 3N6YA 5TGBA 4E0RB 5TQ0H 4I89A 3FSWA 3TZVD 2CRYA 1QBLH 3QEGH 3RUGE 2YD6A 3EJRA 5CIPA 4LFHG 4TTGA 3KLHD 3TPKA 1SRDA 4ZW3A 2CBOA 1GH7A 2PNDA 3OGCA 4ZUTB 3WJJA 1IRAY 3EYQC 1QP1A 5EOTA 4ABVA 1DBMH 1YZZA 2YAEA 4GIOA 5SWZB 3OXRA 4BFRA 1R33A 3QEQD 2ROYA 3BSZH 4PV8A 3D6GA 1AZBA 4N0CC 4U6HB 2RH0A 3UOAB 4JN2A 5I1IL 3KWWA 3W9EA 3RB5A 4LLMA 3NSDA 1K8IA 4GRLA 2J8UF 3ARYA 4XPAL 1BZOA 1SN5A 5LUMA 4XNZC 3KGSA 5LNDA 2C3WA 4HSAC 4H8VA 4Y4HB 4X4MA 1DN0B 2Y24A 1IM9A 4KZ0A 5IQ7H 4NUJB 3FB7B 4J8RB 3GK8H 4X2UA 4B9CA 4LLVB 2EDRA 5JXEC 1JYVA 3UH8A 1IEBA 3QORA 4FQXB 3HB3C 3BEVB 3CXFA 4APXB 5EOCH 1HHJB 3OF6A 4A37A 5IBLD 3RPBA 4N2LA 4XP9L 5EDSA 1ZEAL 4BFKA 4F7PB 3BEWA 5LGHH 1I8IB 1HINL 3C5ZB 5ESAA 4S1QH 5F7MC 4ES8A 4IK6A 5F7KC 2RACA 4J3TA 4M1CD 4XNUL 4XPHH 4Y89A 5ANMB 4JHZA 4G8GE 3H0TB 1MVUB 1MWAB 5CGBA 3WXVL 3FCBA 2QGCA 2FJUB 1TNNA 2UX6A 1AGBB 4WUUE 4F9PC 5ACMA 4DTGH 3VI3A 4LCYB 1QFWH 2V4LA 1JWMA 4HVBA 1WS7A 1MAJA 2TSBA 3LX9A 4I0PD 3T65A 4JZNB 3ARGA 3SHSA 1JSYA 1I8LA 3S96A 3VXTA 4X5XB 5AB1A 3US1A 1W6LA 1XWVA 3EXLA 5C8JA 3Q8EA 2EE9A 5BS0B 1S3RA 4NWUL 1NWPA 5DS8B 3VQLA 1UKTA 1NLBL 3MLWH 3T6WA 2NX5A 3X13B 2AQ2A 4KKCD 1R75A 1EFXD 4OTXL 1ZKAA 6CGTA 4HJ0C 1BBDH 3RTLA 4A7UA 2JWYA 2YMTA 1KCRH 5F9JB 3ESMA 3VWKB 5C6WH 4WTZG 4XPGH 2LHAA 2H2PD 2CLVA 2UY6A 1B90A 3D2UA 1JF1B 1NGYB 3ZO9A 5DD5H 1MIEH 3VFWA 2WSPA 3LYRA 1INDL 4DVRL 5HYEA 2GJ6B 3E8UH 2F6AA 2XTJB 4G80B 4G2AA 4HWBH 2NZ9C 5IQNA 1CGUA 1IL1A 1TETH 2EKSB 2KQNA 3P2TA 4OZHE 1Y6KR 3WJLA 4EBQH 5B38A 5JA8B 2Y1AA 4MJIE 4PRAA 1P1VA 3V7AG 3EYOA 4QY8B 4KKZA 5EO1B 1XGPA 3G5ZA 3V9CA 1JPST 3MLYL 4APQD 4XMZA 3C2AH 4JFED 32C2A 4A7VA 5EIIA 3IJ7A 3CFKB 2VZTA 4L3AA 2ZOOA 1M7XA 4RGOH 2ZJSH 4WCYL 1JHKL 2MPAH 1AP2A 3LIUA 3N41F 4PRBB 5GRUL 5MHSD 3O9WC 5GGRY 1GTNA 3NSCA 1T1XA 1SBSH 2YKKA 1R4XA 3M07A 1QI3A 2YRBA 4I2XA 4HUXA 4Q0XL 1E3FA 5A2AA 1P5VB 3L6FB 3VFMB 5C09D 2WZPA 2XNAA 4XAWH 4H0HB 3TN0B 3L3DA 2A73A 4OCLC 1CQYA 4R7XA 2E3VA 3B37A 5DUBB 1SEQH 4UB0H 2VQ1A 1LO4L 4HPYH 4YPJA 4QWWC 1YYMH 4KDTC 4A39A 1ESOA 3QWRA 1JZ5A 1ZS8A 1CFSB 5EZOL 3U4EA 1E65A 4ZNEA 1ITBB 3INUH 2D7MA 1IM3B 1B4LA 1JXDA 2P8LB 4XXDB 4DFIA 2CKNA 3KPOA 3EO0A 1CDIA 4R8WL 4W9CC 2IH3A 1IFHL 2YAOA 1BZ9B 3IJEA 3LH8A 3VMNA 5IBTL 2VH5H 4ZMYA 1FV1A 4KX9A 3MV7B 3QIUA 3SCMB 1OP3H 4V2CB 2AVFA 2GUYA 4XP6H 3TV8A 2JV6A 3UROR 1EZVX 3LRLA 1N64H 3ARDC 3P9LB 3BAWA 4F91B 2VDKL 2AJVL 2H6UA 3PP3H 4EI5B 1SXCA 1UYWL 5CEZL 2EDQA 2QVIA 5CO1A 1CICB 2DDQL 5FO2A 4CVXB 1X5AA 3L4VA 3R4DA 3U4AA 4JY5H 2FIKB 1SYVB 4X4KA 1MCLA 3QQNA 5HHQB 3FCSB 4Z3GA 2WJ7A 3NIDE 2C9XA 3KBPA 4PJ5E 4P46B 2FJHB 3BKJL 4B3VA 4L48A 2NNFA 3GSOA 3KYKL 3JTSA 2D31A 4Y5YA 5IJVB 1T66C 1OCZB 1ZGLB 3CLWA 3G6DL 3QUGA 4Z7OB 3G5XA 2G5UA 4KQ4L 1E4XH 2F61A 7FABH 1UXSB 1Q9LB 3L2LA 4N2GA 4N8UA 2Z8SA 2V6HA 2WZAA 2EO1A 3PHQA 4OJYA 3EDFA 5GS0D 3N1MC 3HVDA 3H7BA 4EUPB 2WNGA 5T3ZE 1IC7H 1HH6B 1RSYA 2XN9E 3FT4A 4O2CA 5JQ6H 2BJMH 3ALWA 1L9RA 1WWAX 2WLIA 1NKOA 2COQA 4QXTB 2MCMA 3VACA 3SPCA 2JLPA 4NN6C 1OB1A 1D5IH 2HKFL 4AGLA 3AY4A 1RL1A 3FFCE 3CN4A 2F54A 2YBRB 4YDJB 4I3RL 1XVSA 4M8QA 2DAVA 4LU5H 4OIIH 4OD3L 3I9AA 5DQJA 3F00A 2VUYA 3TU6A 4ONFH 3B5HA 3TPUA 2CBPA 3C09B 2C9SA 4WHCA 5C0JA 4WNSA 4CDHA 4H0IA 1IGJA 5K9KA 2H0JA 2J8UB 3US0A 1FZKB 1YUHB 5B7EA 2QT6A 3KYOB 3QI9D 5HHPB 5DJXB 4X5QA 1LE9B 2C7UB 3D1MC 4WHDA 3NMEA 1KEMH 3O6FD 1OHZA 4AQ1C 2NY5L 2ZCLH 4ZUTA 4G3YL 1F56A 3WIHH 4FG4A 1U9KA 4MA1C 3P3RA 5SWZA 1NIBA 1SHXA 4L3CA 5DJCB 4U6HA 2XYCA 3JV6B 2EIJB 1RJYB 2W0FB 3GMOB 2YAPA 4NCDA 3X11B 4BKLB 4GT7A 4Q9CA 2HJKB 3BVUA 1IMHC 5FFOA 2WVTA 4QRPE 1OGSA 1H6FA 1EJFA 4PLKD 4EIZC 5CZVL 3JV0A 3MFFA 4FFVD 1WZAA 2J6EL 1DN0A 3V10A 1E4WH 5D5ME 5E8NA 2FYVA 3QNXA 3FB7A 1KIQB 4J8RA 3C6SB 4B7LA 2WXOA 3FB6B 2VABA 4LLVA 4KJPC 4B9YA 1WFJA 1EXHA 2VITB 1MFBH 4FQXA 5IB1B 4APXA 5IB5B 3BWUF 3MX0B 1HHJA 1R0AH 4M1GL 2NXZD 4P2CG 3S8GB 4Q4EA 5AYQA 4F7PA 2RAMA 1FVCB 1I8IA 2WTOA 4HP5A 4UZUA 4U6XB 3ABGA 3C5ZA 2DEYX 2GHZA 4UNIA 2DQCL 1F3DH 2OJ1A 5IQOA 5ANMA 5KSUA 2JK5B 3H0TA 1MVUA 1MWAA 2ZUTA 2ED6A 1AJ7H 4RFEB 3Q7JA 1AGBA 3WFHB 3KJ4C 5CBAB 1J8HE 4LCYA 1JPSL 3FFDB 5L8KB 2WPGA 1EAQA 4WU5A 1LEKA 1HH9B 2OJEB 4JZNA 1YHPA 1V3MA 2BWDA 4HKBB 1HHIB 1F90L 5JIHA 1AZUA 2XZAH 2ZSWA 3BKML 5CGYC 4KROD 4X5XA 3CK0L 3VFNA 3PXHA 2E6PA 5BS0A 4H26A 5DS8A 3BAJA 2I7SA 2DIBA 3P4MA 2HB0A 4R0LC 4QOKE 4X7FC 5D1XE 2O4EA 3QQ4B 5DJ8B 1XH1A 1QHPA 3D39A 4PJ9B 5ENWB 3X13A 2CLZB 3QJVB 4LGRB 4IHOB 2CMRH 2WZ5A 3KBEA 3VXNB 4UOQA 3RILA 5F9JA 2NYZA 1S7SA 2W0KA 2WB7A 1E3ZA 2PETA 3LN5B 3D30A 2JXMB 1J9QA 3H55A 3VXRE 4BKTC 2BS71 3GI8L 4AQZA 2MMXA 5BQ7B 3U6RB 1VESA 3PCYA 4KMQA 5DHVH 5A1AA 1NGYA 2ZOTA 4PN6A 5E56A 3N41B 1ID2A 4LESA 5IUSA 4GP4B 2D7TH 2GJ6A 4ORZC 4YC2C 1U8IB 2Z3FA 2IV9A 4G80A 1HCZA 1MFEL 3KLSA 4Y16C 2VGLM 1KLGB 2EKSA 3O6KL 3DI2B 1XIWC 4BGLA 5LWYH 1KTJA 3GYRA 2UV3A 4EO5A 4L3EB 4N8CL 5GZND 1QSZA 4BELD 4QO1B 2R83A 5EU6E 3TS8A 3QJZA 5JIPA 5LO7A 4QJ4B 4L29A 1FYHB 3KR3L 3QXDB 4CL7A 3A4EA 4FLOA 1UADC 3HKFA 4ZS6C 1ZLSH 4P59H 1NIAA 2HYMA 3CFKA 3MODH 5F21B 4I0CC 5TK2A 4C56D 1JV5B 1T7WA 1Q9WB 3OMNB 3SOBL 5AB2A 2WLYA 3MV11 2CPUA 4LCCC 6PCYA 4PRBA 4FULA 5I0DA 2EILB 2DQMA 2APWA 2ENSA 3D3VE 3OL2A 5AW2B 4KO5A 5AW8B 4YHMH 1DJXA 1P5VA 1Z0NA 3KPSB 3L6FA 3PWLA 3VFMA 3AS1A 3C60B 3U2IA 5I0XA 4Q9RL 4UV4L 3TN0A 3U6XS 1V55B 5DUBA 4K5NA 3DPDA 2Q8AH 3T3PE 1K72A 1BFSA 4WI6A 4BCXA 4N8PA 1JP5A 2AJUH 1YPZF 5I1JL 2A5UA 2ZAIA 1H5BB 1IM3A 3ATAA 3P0VL 3L9RB 1S9XB 3UZEC 2P8LA 3TIEB 1KJ3L 4XXDA 2WQUA 1J88A 3S35X 5IFAL 1NGXB 3HRZB 1BZ9A 4FYTA 4ODSL 3OAUL 1Q0YL 4AC2A 1JHTB 4DESA 1WG3A 4W81A 4DP0X 3MV7A 3SCMA 4L9LC 5KG9B 1ZANH 3D9AH 4IRZH 3TEZA 1BA9A 1FORL 2ZKMX 2AITA 5SV4A 4J8QA 3P9LA 4F15B 5DYFA 1U93B 2D3JA 3VMOA 4CBZA 3VNYA 4EI5A 3CC5B 3UTSD 4YHLL 3DLQR 4JZOB 1W0VB 4UOW0 1AE6H 3D07A 1RV6X 5ABDE 1SYVA 1GSKA 5I1DA 2Z91B 1DBJH 4Z7VE 2XQ0A 5HHQA 3FCSA 2BXZA 2XZCL 3LKOB 2ZUXA 5HD8C 2FJHA 3RVTC 1WWBX 1S6NA 4ZAKD 3S88L 5HYJB 5CP3H 3S98A 1DJYA 5J06A 1IC5H 3BGAA 1IKFL 1VPOL 1JTOA 2COVD 2JJTA 3HAEG 3NABL 4FFZL 4Y1AD 1TOXA 2BSBA 4NWTL 5AALA 3TZVB 5IJVA 3QJRB 4PH8A 3ZKQD 1TQUA 1ZGLA 2UWEE 4QHKI 1YMMA 3AU1B 1N2RB 5IEKA 1UXSA 1Q9LA 4N3TA 2I26N 3VI4E 4YDNA 4ZO9A 5A7EA 1P9MA 3QEQB 1IGYB 1RLWA 4D9LL 5EA0H 4EUPA 3FS9A 1KB3A 1HH6A 3WL9B 1V3JA 1JGIA 5A2KH 1FYTB 1WFIA 2ADFH 4F9LC 2VLKD 4XCFH 4X80H 3HKZA 3RWDB 1GS6X 5GS2D 4QXTA 3QRFM 3PGCB 4RX4A 4WJKB 4TTDC 1X9RA 3L48A 4I18B 5I30H 3MLVL 5DYOB 5GGVY 1UATA 3GKWH 4WEBH 2F68X 2YBRA 1FHNA 1HILB 5DU7A 5ICYB 3G6AA 5JHDD 1KWGA 5JR1L 5ICZB 2FHCA 5IUCA 5DHDA 2PW1A 3PJLA 5AZEH 4FN0A 1XGRB 5F9DC 3S5LG 4TPRH 1E2ZA 4UIMB 5I6XC 1MY5A 1QSFE 3EOBB 4IDJH 1ZV5A 2J5LB 1KV7A 2DKUA 1IAIM 2OSXA 3BVXA 3UIYA 5HY9B 4NUMA 5TTRA 2XKNB 3HG5A 1FZKA 5FYLD 5FCSH 3NCYP 1TTAA 3KYOA 5B1JA 1UT9A 1H6UA 1FDLH 1NOAA 4FQCL 4I0PB 5HHPA 1LE9A 2G5BB 1J18A 5H8DA 5BOJA 4M3HA 3UL4A 3ZKSD 2J56A 1EAJA 2IMNA 2FT8A 3CZKA 5T8IA 1F11B 3BPCA 1IVTA 1NBVL 3DC0A 1BQSA 2PTVA 3TA3D 1F1GA 3HG1D 1HKLH 4ONGL 1QRNA 5IT2H 1P0SE 5DJCA 5I17B 4C47A 2XYBA 3V6ZA 5LNGA 3ETTA 3AADB 1FFRA 1RJYA 2PTTB 3JV6A 2W0FA 4Z95L 2WWMD 1EFXB 2X89A 3GMOA 4W9DC 2XV3A 3L2MA 3X11A 4BKLA 2VM4A 2HJKA 4D9RE 3OG6B 5T3XH 2GB2A 1U3NA 4NM4H 4CU7A 3TEYA 1MZZA 4FTVD 4EF3A 5C9JA 1K85A 3EDDA 1S3KL 4OBRA 1KIQA 3H42H 4PSPA 3SDAA 1VRSA 3FB6A 3ULUC 1JI1A 3M7OA 1FVDB 1JK9B 1A6VL 2VITA 2MKWA 1EJOL 1S9YB 5IB1A 5E1IA 5IB5A 3MX0A 5CJBA 5D8JH 3RI5K 3GJFB 3ZHFA 1YEGL 2P80A 1WFNA 1FVCA 4JO2L 2A3TA 3HHSB 3MUZ1 4BUQA 3EJCA 3SIKA 4EN3D 4HKZB 1QTYT 4FFWD 4N6QA 1IFGA 2PR4H 1N18A 3VTMA 2JK5A 4OF7A 1OM3L 4FYSA 2A99A 2CNZA 4A2GA 4APQB 4RFEA 4JFEB 5TF0A 3WFHA 3U1PA 1QEXA 1MAML 5CBAA 4YSAA 1YEEL 3FFDA 4G9FD 2OV0A 3LY6A 4UQ2B 2OJEA 2X9ZA 1NJ9B 1HHIA 2P5WD 5GS2H 1HHHB 3BN9C 5K9OB 2YRZA 3RTQD 5C0IB 5CUSL 2EIMB 1F0LA 3JWDC 4K23L 5C09B 2A9AA 4G71B 1LNUB 1P5UB 2R2HB 3QQ4A 5DJ8A 5FAAA 1TQVA 5ENWA 3SO5A 4X5LA 2XQYA 2DQDH 1CZ8H 5C0RH 4IHOA 1L6XA 2OTUA 4ZFZB 2YKLH 2H26A 3VXNA 5JUEH 4UTAH 5FGBA 2LLNA 3LN5A 2DM2A 1SHWA 2JXMA 5LBSL 4NQCE 4FA6A 2ENQA 5DR5L 5AUMA 5JOEA 3IFPB 4KK8D 4M93C 4HPHA 3VFGH 2VMCA 2CR0A 4NZ8A 1HDMB 3WEBA 4WIQA 5FYLH 5IBUG 2PXYD 4UOJA 2QHRL 4XO5A 5E2WL 1U8IA 2Z1PA 1AIFB 5F3HB 3WV0A 1AHWB 3LPGA 3BSZA 1C16A 1NIEA 2YQ2A 3ZZ1A 1LK3H 4L3EA 1E2VA 2DOCA 3QUYC 1QBBA 3ISWA 3TX4A 2XDHA 1P4IL 4FCAA 4F27A 3QXDA 4Y2OB 3OMAB 5AOIA 2X3BA 3ECWA 2TSAA 3Q2LA 1YPZB 2R69L 1FIGH 1JV5A 3LTVA 1HT6A 1Q9WA 3ETBJ 3D12B 4LPCA 4HLZH 3CDGB 2Z9TA 1NC2D 1JHLH 3DKHA 1BBJB 1WA1X 4YXHL 2NR6C 2X4RA 1VFAB 3TYFB 3MXWL 4MMZC 1V7ML 4UMSA 1JZEA 1NUGA 3C60A 4PS4L 4ZMVA 4TVPL 1U8CB 2GFBB 4XZUB 3M8OH 4HUVB 2WANA 3G5YB 5KOMC 3EJPA 1X5IA 5CCKH 3JWDL 3OSVA 4KH9A 3VGHA 1QD0A 1HSAB 4M7ZC 2OMTA 2TRHA 2V5RA 3B7YA 4WI3A 2JELL 2LFEA 1H5BA 2DEXX 3RZCB 1NCWL 1S9XA 3L9RA 3TIEA 1U8JA 4PJIF 3U9WA 1OWWA 2UY7B 1NGXA 3HRZA 4WGWB 3FK3A 2PP7A 2HLFC 4LEXL 2BVUA 1JHTA 1TT6A 2WP3T 1U3HC 4YPGB 5I1EL 1R46A 4YHYC 5KG9A 4NQEE 1UWYA 3GUTB 2XIDA 5LQBL 1EGJH 1PF3A 3RWHA 1UXWB 1E27B 1U93A 2AJYH 4YHKH 3CC5A 3IN2A 5KYXB 1XCTB 2H41A 1TFPA 4B5EA 1FE8L 4KH2A 4D9QD 4PB9L 4EQ3A 4MRCA 4M43L 2DYPD 1W0VA 5JNYB 4UAOC 3IXTB 3RWIA 4ZBJA 3WGVB 1TJHL 5LKNA 2EE6A 4UT7H 2A4EA 4WK0B 4YSOA 2F58L 3LKOA 1N5YH 2CGRH 5DLLA 3JTBA 1CO1A 1U6AH 3QI9B 4HWBA 4UU9B 4A1RA 4JFSA 3O6FB 1NBZA 4RQQB 3AU1A 1N2RA 1SLUA 1I1AC 1MHCB 3VSVA 5BJTB 1XH2A 1T04B 4JN1H 1JRHH 4HALA 4NBYB 1KDJA 5DHEA 4KKRA 5H37H 3QEQA 5KJRH 5B1KA 1C5BH 2ESVD 3SJVB 3NPSB 3VXUE 3P4OB 2IDTA 3WL9A 4BK4A 1I1FB 5I76B 4MZIA 3ARBD 3EBIA 3NJIA 3S3DB 2RA1A 4Y0GA 5ANHA 4BQ9A 1FVEB 2WVVB 3FQTB 3RWDA 4B7IA 1LO3L 3O3AB 2BIOA 3H9SD 3PGCA 4M7JH 4NJAH 4NKQB 3WDJA 5D2NB 3MUY1 2WXPA 5DYOA 3FTWA 4P0DA 4PVLA 1HILA 1N8ZB 3QQXA 2DJUA 1RPUA 4KQ3H 4LRIA 2R0LL 5ICZA 4X9IA 3PQYE 1RZKL 1XGRA 4DQOL 1Y7VA 4MCMA 2NXZB 2OSWA 4UIMA 4JRXD 5EEXA 3LRSA 2NW2B 5C0NC 2OI9B 1OCWL 1MCJA 1YNLH 2ZONA 5TDPB 2NY2B 3CUPA 2YWYA 4GFXA 4KUZL 3JWNH 3BMVA 5HY9A 1OE2A 4HUKB 5J8OA 1MQKH 2XKNA 3BVVA 2P8PB 2AANA 1CG9A 1J1PL 4Y2DD 2Z4QB 4UV7L 1JL8A 2EACA 3QEHB 3Q44A 2IALA 2XA3A 2V2WB 2G0KA 3MXVL 1OGPA 3MRJB 1JGVH 2GUOB 4I0PA 3MU3A 3RVVC 3RYMA 5BW7A 2G5BA 4IRSA 2ICWA 2P5ED 7PAZA 3GSNH 5FM5O 1RURL 1WQVT 1E5ZA 1P4BH 3K2IA 4KROB 1KXHA 4JGUA 5ERWB 4LSVL 3QWOA 4OLEA 3KPLB 3V55A 4E9WA 3WAKA 1JMZA 4QTIL 5I17A 1OARL 1IGCL 2PTTA 5DTFA 1EFXA 5EC2B 3PP4H 5EBMB 2ISDA 4YXKL 4HCRH 2VKWA 1FFOB 3TJEL 2IAAC 1UD4A 2QFPA 3QO1B 4EOWH 1BXVA 2GCYB 5D7KD 1A4JB 5TE7L 5BZDB 5IVXF 4MQXD 4BQ8A 3DRTB 3LMJL 2ODIA 1FJ1B 3QHTC 5F96L 1MVFA 3QDGE 4YN3A 1YEHH 3NIFF 5I1IH 1NCJA 3HUJE 4I1RA 1W0YT 1JK9A 1JGDB 3P77B 4R90H 3MNDA 4YBHA 5EU7E 5IIEB 2G75B 4F33A 2KKQA 4ZMWA 4XPAH 3ARSA 3GJFA 1WUZA 2LABA 4PJXF 5D7JC 1QR4A 3DDFA 4W4NA 1A6ZB 3HHSA 3NJLA 4P23B 3MBXL 4HKZA 4K15A 2BNRD 2CJUL 3I9GL 4HIXL 4APQA 4JFEA 4AQ8A 3V0AC 4NQDE 3KWVA 5C0DB 3AQZA 1WE5A 3VFRB 4C56B 4XMLL 3GMLB 2EDHA 1FNGB 4QNPE 1OAZL 3BFQG 4RCAA 4UQ2A 4XP9H 5DI8B 2EC9U 2YAFA 1WRFA 1ZEAH 5F6IC 5F7LB 1NJ9A 1DR9A 4I9XA 3EBHA 5KZCD 2NNXA 5K9OA 3B5TA 5J6HB 3WXVH 5C0IA 4DP6X 1IE5A 4H2CA 2ZUUA 5C09A 3KVDD 2JQZA 1LNUA 4E2OA 5J7CC 5EV7A 5KAQG 4ERSL 4ZFGL 1JNNL 4IMKC 1A6PA 3WY1A 3QAQA 3MJ9H 1TVBA 4K7PY 5CKGA 5J13C 3KBHE 4ZFZA 3BRGC 3RVWC 4XX5A 2YN3A 4JQIL 2MOVA 4XMKL 1Z0MA 2DBLH 3EO1A 3PL6C 5CJ8A 1M3JA 4AW7A 5GZOC 3IFPA 2KLRA 5DJYB 4F7EA 1KB5H 5FB8A 2BINA 1HDMA 4YL4A 3VM5A 4PJEF 1NCDL 4ZX5A 4EIGB 2KZBA 2CU9A 3WIHA 3CFBB 3MRMA 4OTXH 1TITA 1AIFA 4GP8B 1AHWA 3SKOB 3J27A 3BUPA 4H0LC 3K1DA 4W6XB 3I3DA 1BXAA 3R06B 4MFHA 3OR6B 5E4AA 3D50A 4MAUL 3LVEA 4AVKA 2FRGP 1RU9L 1XX9C 3FO2B 3QUHA 2OMXB 4G1EA 3UTSB 1E7VA 2V9RA 4Y2OA 1MCWW 4OQ1A 2ZAHA 3V8OA 2HUEA 3ZOAA 5CLTA 2VDML 4HFWB 3V52L 1DLFH 2QPUA 3CDGA 2ADIB 1JYNA 4PJIB 3VB8A 2VMDA 4HWNA 1BBJA 3VM7A 5HGBB 4ZAKB 1V3KA 3ZTNL 3P9WB 1T0OA 4G8GD 4CSZA 1PLAA 4Y1AB 3DUSB 4WUUD 2QKIC 3RDJA 3N2JA 1YUKB 3U36A 1UEMA 3BVDB 1U8CA 4JDEB 3FBQA 2GFBA 4MNQE 3BQUC 3UEZA 4HUVA 4WCYH 1JHKH 1GZQA 1X5YA 3G5YA 1EHXA 1BD2E 5GRUH 3BPNC 2HWZH 3OJVC 5JW3H 1HSAA 3WNPA 1QACA 3WEMA 1GC1L 2YIHA 3OV6A 4ACTA 2KDGA 3LHPL 2VLKB 3NCFB 2WGXA 3Q3GA 1Q9OB 3CLFL 3QIWC 4JW3A 4X7DC 4XC3L 3PDGA 1B4TA 4RH4A 1F6LL 2VL5B 4KUCF 3ARRA 3GINA 3W82A 3D34A 1SOXA 5BV7L 1LO4H 1NAMB 1GGCL 3LIZL 1KY6A 1A7RL 5JHDB 1RIHH 4EQ2A 1MDTA 4HFUL 5CINH 3GUTA 3KG5A 1CXHA 5EZOH 1UXWA 3SQBB 1E27A 2FIRT 5L2JA 1W2KT 3TEUA 1E42A 4RETB 1OTUC 5KYXA 4KZEH 1AGEB 4O2EB 4LHUD 4R2GD 5JNYA 5CZRA 1IFHH 5JO5B 5EPMB 3BH4A 3DBXB 4FNLL 3QJTB 4UBDC 4U1JB 1DBKL 4HK3N 3S37L 3X1GA 3KPQB 3OLGA 3IMBA 3OLDA 5EF0A 4F8QA 4MJID 4NPYA 3LN9A 1B4RA 1VA9A 1ZK5A 2DQTL 2VDKH 2AJVH 4ZW7A 4Z6AT 4YDLC 4PSRA 1E8YA 1MJJB 2GBTA 2DMKA 3QI9A 4Y19E 3OWEA 4GG6A 4UU9A 4M56A 2NTFA 2VW7A 1W72L 2KQMA 3O6FA 4YZWA 1MHCA 2R7EB 3SY0B 3ESUF 4OGXL 4JFTA 3A24A 1AD9B 4GRWE 5D7SL 4EMZA 3UC0L 4EDXA 2AEQL 4F93B 4UQCA 3TA3B 3HG1B 1JYWA 4OCRH 1T83A 2HFTA 1ONQB 2V9UA 3KYKH 1FLRL 2AV7B 4NOBA 5LBGA 2EH7L 1F4WL 3P4OA 2DYSB 4QAMB 1I1FA 3T77B 5I76A 3AWFA 3GI9L 3G6DH 1FVEA 2B7DT 3CXDL 2WVVA 3FQTA 3PRZA 4X4XB 5J89A 3UADA 1VIWA 3E2HC 5D2NA 5HHXH 5DC0A 1OVZA 4FTVB 2GC7C 3JZ7A 1N8ZA 3H4HA 4FX5A 3OHXB 4P2OC 1UD5A 5DMGC 4JQVC 4NZDA 5C08A 1ROCA 5F1KC 1DLHB 2QKSA 4BK5C 4FXKC 1F42A 3BP7B 1UWXK 1NAKL 2EIDA 3QRLA 2NW2A 3B2UD 3X1BA 5D93B 4ZPTB 2HKFH 5TDPA 4EN3B 1UWGL 4XODA 5DZAA 1RMFL 4GKZB 4I3RH 4GS7B 2J7LA 5JHAA 2EDLA 3FUMA 5DVOA 3FYIB 3ZIMA 5BOPA 3E3QE 3QEHA 5IVXB 4UQIM 2MJWA 4AEFA 1JZ7A 2V2WA 3S8FB 4G9FB 3KXFE 4TLUA 2XLLA 4IRZA 3NIFB 4W4OA 4OR1A 4P2QB 1JN6B 5I18L 5ERWA 3RTQB 2X9XA 3KPLA 3QUXA 2LFGA 4N86A 2WSKA 4PJXB 4BINA 5CP7B 4MS6A 5ESQB 3AWGA 2Q5BA 3SZKC 2F7OA 3P3TA 3O6ML 5EC2A 3UMNA 1NC4D 4WO4C 1EVUA 3QBTB 3GZKA 5EBMA 1BQ5A 4DWHA 3WAJA 3U82B 1FFOA 2XQYG 3K72B 2GCYA 5CP3A 1A4JA 2DMGA 5BZDA 3L81A 1GTFA 5KUMA 3DRTA 2JI1A 1MCNA 2DB8A 2EUZA 1ET8A 2H6PB 5I1CH 5T3ZD 2K6YA 1NM9A 4Y2LA 4JO1L 4WF7A 3BFWA 2PXYB 2LOEA 3P77A 1JGDA 1JV2B 3EIFA 5ABAA 5EF2A 5IIEA 5DD1L 1X44A 2G75A 4X6EB 4DP5X 2Q10A 1SHSA 1UQSA 3CMGA 4XXCC 5GZNA 5CZVH 1A6ZA 1HWWA 2J6EH 3FRPB 4J3OF 4M00A 5GGTL 4JFXB 1VERA 3RUGF 3P73A 4Q4IA 1UACL 4GAJH 1RUKH 3QNZA 3S36L 1RFDL 1KJ2H 3NGBB 4RZCB 3SQOL 3UP1A 3UGXA 5C0DA 2K8QA 3VFRA 3ZHDA 5A6LA 4C56A 1Z9PA 2V5YA 4PJCF 1FNGA 4M1GH 3BC9A 1NC2B 1NMCC 1E4HA 4KAQH 4NQQA 4ELMF 3TBVB 4XXWC 1TZOA 4NKDB 1JS4A 3VGAC 4AKPA 1QTPA 1SFDA 2YQ3A 2A6KA 2X2JA 3LPWA 5G2NA 3QJUB 2WQSA 5J6HA 3RDTD 2LLLA 3H3KA 3EYSL 4PJFE 3J07A 4LL4A 2Y25A 1VGKB 3HC4L 4JY6B 4Z7UE 4QGTA 3IK2A 2B16A 2ICWI 3BKMH 2ICEB 1BQHA 2NSXA 3DTXA 5A3IC 1MG2C 1I85C 3VUAA 2CHZA 1KWKA 4ABWA 3ZRSA 4B53A 4NZUH 1MFAL 2XIIA 4WW2F 3EJSA 4LVHC 2YJQA 5AAMC 2CCVA 1YEFL 3LS5L 1BAGA 4JM2C 2ZWNA 1OT1A 4FFYH 4L0ZA 3WE6B 1MHEB 2VMFA 4UWQB 3SKOA 1X4XA 5CJXA 1AO7E 3ML9A 3R06A 1IBGL 3AC0A 1RKRA 5DHXB 3GI8H 1PKQB 2HFGL 3H8NA 1QG3A 4KKLC 4U1GC 5EORL 3FO2A 4HHGA 1XGYL 4BZ2L 5KYNA 2OMXA 3UTSA 3MKGA 3JYBA 3ARED 1KTBA 2EDJA 2EP6A 2DYPB 3L3OB 4YSTA 4PJAF 5D1QE 5DFAA 3WNJA 4ENED 1MW0A 3CFIC 1KN4L 1EPFA 1SBBA 1E4XI 4N8VB 2HRHA 1MFEH 4HFWA 4HU8A 1Q72H 3O6KH 4M6AA 3ZIYA 1PD6A 1QFPA 2ADIA 4PJIA 3BIKA 4N8CH 2VDNH 5HGBA 4ZAKA 4GUPB 1NZRA 3N40F 1LWRA 3QP3A 5MP6H 2ZKHH 4K94C 4FG6D 4M9OA 3DUSA 4Y1AA 3KR3H 5FO7B 3I02B 5DVMA 3FTGA 2E9WA 5T3ZH 1J8HD 1U95B 3VD4A 4I9WE 3MJ7B 1XR9A 2PLTA 4FQHA 4FNSA 5B3JF 5IB4B 5BZXA 3VFOB 5I16A 3SOBH 2VDLL 4LIQE 2A38A 3NZSA 2QLVB 2BP8B 5GGUA 3OKMB 2I32A 1OW0A 4AY0A 3RY5A 1N6UA 1HZLA 2ESVB 2XHNA 4J3UA 2HVKB 3S97C 1AHKA 4MLSA 5D1XD 3TLRA 4QOKD 3ARBB 4DCQB 2VO8A 1KGJA 2VLKA 3TNMB 1Q9OA 1YMHB 3TM6A 1JXGA 2LLGA 1TU2A 3H9SB 1EEZB 5BMFL 3B9AA 3Q6FB 3VWJD 3HMXL 3GLZA 1NAMA 2C1OB 4LOUC 2A9ML 2GBUA 5JHDA 3OPZH 1KPVB 3VFSB 1R3LB 3SQBA 3BCDA 3KL3A 3WN5C 5GSVB 2YD7A 4L0PB 4YHNB 1LO5B 1GJUA 1T5XA 3HI1B 1DUYB 2C5DC 1KJ3H 4UTAA 1AGEA 5BQDA 4JRXB 3RB7A 5EPMA 2XWXA 1GYAA 2OL3L 3DBXA 2UX7A 2QJDA 4ODSH 4U1JA 4HJTA 1HZKA 2NQ3A 2ZUQC 3KPQA 4ZTPH 2PWEA 5TDOA 4KTGA 2D3NA 3U7WH 4AYID 1KB5B 4LPUA 5EU6D 4Y2DB 5GGQH 4TUJB 3N1FC 4HCFA 3QGVA 1HK6A 1PFOA 4YHLH 1MJJA 5FA3B 3BPLB 5IQMA 4Y4FC 1DO6A 3L5XL 3BGFC 2P5EB 2X1PA 1O6SB 1U8HA 4K8RC 3V0IA 2R7EA 4JO3L 1BG9A 2E56A 3SY0A 5MENE 4MB4A 3RWEA 2EVHA 3HNTH 2XZCH 3HG1A 2B9AA 2R0ZL 1R5IB 1JVLA 1MNUH 3A4DA 3D3VD 2ADJB 2NY0D 1N59B 4FG0A 2AV7A 3H1ZA 4HU2A 1KYAA 3VXPA 2XV6B 3QWQB 5KJ7E 2R9HD 4NWTH 4F24A 3MQIA 3RY6A 4JPKH 4YX2L 3T0DA 1AY1H 4BRJA 1BJ8A 2YEQA 4X4XA 1BGXL 4PGCA 4PY8J 2DBJA 1J0YA 4Y88A 4FTVA 5BVPH 1UJ3C 4D9LH 3OHXA 3SY6A 2VCOA 4FJYA 3HIZA 4LCVA 1OTSD 1DLHA 4GG8B 2WKLA 4MS8C 4Z0BL 3BP7A 1JPGB 2E7DA 3LPOA 5DC2A 1T1YB 4IJ3B 2BOCB 4ZPTA 4EN3A 4FLQA 4KK6D 3WUWB 5L6YL 2MOQA 3RPKA 1TVHB 5JR1H 1TZHB 5H94B 3UXFA 4GXUN 4OUOA 2EZ0D 3LPPA 5IVXA 2GIMA 4N0UE 1CI5A 4JFQB 4G9FA 4LSRL 3V9EA 3QIBD 5KVGE 1LP9E 1BAFH 3EJTA 2P5WA 1BQKA 1LO0L 4HUUB 1EGJA 2WTPA 1SDYA 4GXFA 4H2AA 1PDKB 3C2SA 5KZCB 3RTQA 1E6JL 4MD4A 3HG3A 2Q76A 5IG7B 5KBNC 3EDJA 5CP7A 1IZKA 3WIAA 5ESQA 3NTCL 1NOFA 3RUGB 5BVJB 3UGUA 5JW5B 1ZGLP 4M7LT 4C58B 4LKCB 3ZTJH 3QB7C 3BXNA 3IRZA 1NBVH 4KVNL 4PJCB 3BD5A 5EU5A 3ZZSA 4G7VH 2H6PA 3BUTA 3EGSB 2WLJA 4ELMB 3U9UB 2X09A 3SYOA 2DW5A 2PXYA 4Z95H 1JV2A 3QDJE 3SGJA 4LLWB 4X6EA 1YECL 1RAMA 4P5SA 2O5YL 3KLKA 2ZF8A 3FRPA 4TVUA 4JFXA 5L88L 2J21A 4JVPA 3SPGA 3KD4A 3HCVA 3QUMH 1WA2X 2WV3A 1G1KA 4M6MH 3U2JA 2N56A 2B20A 1EJOH 2NDFA 4LBEB 1LD9B 1I9RL 1QSFD 2I5YL 1N4XH 4WLCA 2MQCA 1NC2A 2FT7A 4WW2B 1KGUA 2N01B 2HKHL 3TBVA 4JO2H 3S0PA 4HKXB 4JG9A 4NKDA 3ZDYF 3F84A 4MJ5B 5TFSH 4G8GB 3HE7C 1SUHA 4WO0A 1QW9A 3FOMB 4WUUB 1XH3A 4B41A 3GDCA 2HJFB 1YEEH 4XP5L 3TYGL 4HWUA 2AABL 5D5MF 1VGKA 3MAWA 4GY4A 4JY6A 3FUIA 4A2HA 4J4PC 4MDJB 1D6VH 5E6IC 1NFAA 2QTEA 1J1XL 3MRGB 4PJAB 2ICEA 3QJQB 2IV8A 1SXAA 4WI0B 4N25A 4PJHF 1QSVA 2X88A 1V5JA 2IBGA 3ECBB 4K23H 4TQ8A 1XXDC 4PWGA 3FTXA 4QMEA 3LD8C 4I3GA 1OK8A 4KI5C 4X4ME 5ELIA 3REVB 2OCCB 3BO8B 4YNYB 4ZW5A 2ATKB 3FCTB 4JREC 4LEEA 5AB9A 1QA9B 5LBSH 1FRGL 2F1BA 4R96B 2AEIT 2WMPB 4NEHB 5DR5H 3NEEA 4NX0A 1J8SA 2IQAB 5B39B 2WY3B 3FSAA 4OZFB 1CUOA 4LASL 3U9PL 2CR6A 4HCRA 4P05A 1TJMA 2WOYA 3V6OA 3B83A 4GP5B 1FG9C 1U8NB 2DYPA 4LHUB 4R2GB 2PYFB 2QHRH 5E2WH 3I6LE 1TENA 4DKEL 3G08B 4N8VA 5K33A 5A2FA 1T0MB 3HFMH 4PYHA 5ALBL 4MJIB 2A83B 1MCKA 2K6ZA 2J44A 2WXGA 4HETA 3KLAB 2XV2A 1GZHA 3FU0A 5FYKE 4NBZB 2DQEH 3L2NA 2NLJB 5I1GL 3WFEH 5BRZB 3I02A 2VZUA 1H3VA 1NIDA 1SJHB 1NKGA 4BXSV 3K81A 1T7VA 3MJ7A 3QXAA 4G6KL 1TYJA 5HGHA 5IB4A 3VFOA 5D71L 4E42B 5F3BB 4NQVB 4PG9A 2BP8A 2ZZUT 1PZBA 3CD4A 3OKMA 4DETA 2ESVA 4JKPL 2CRZA 2K3TA 1OP4A 4RBPH 5C9KA 1I3UA 3MXWH 3QH3B 4L8SB 4AGQA 1IBHA 3ARBA 4ODUA 4PS4H 5C0BE 3TNMA 4UZSA 3MBED 1M6UA 2ZXDA 1PEZA 1CC3A 1YMHA 4N5EC 3NPZB 4BSWB